BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24766_g2_i1 len=1315 path=[1244:0-206 5226:207-227 1472:228-262
9035:263-277 1522:278-305 1550:306-343 8540:344-378 1623:379-399
1644:400-429 9119:430-450 1695:451-525 9203:526-553 1798:554-624
6153:625-739 4996:740-846 2091:847-870 9354:871-930 4471:931-965
4506:966-1023 6543:1024-1043 2279:1044-1053 9424:1054-1067
6586:1068-1072 2308:1073-1096 6614:1097-1314]

Length=1315
                                                                      Score     E

ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    427   9e-144   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    422   8e-142   
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    404   6e-135   Vitis vinifera
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    404   6e-135   
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    402   4e-134   
emb|CDP15888.1|  unnamed protein product                                399   5e-133   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    399   5e-133   Vitis vinifera
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    399   8e-133   
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                398   2e-132   
emb|CAN61955.1|  hypothetical protein VITISV_020020                     397   4e-132   Vitis vinifera
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    397   4e-132   
emb|CDP21787.1|  unnamed protein product                                397   6e-132   
emb|CDP21836.1|  unnamed protein product                                395   2e-131   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    394   5e-131   Vitis vinifera
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    393   1e-130   
emb|CAH05083.1|  putative orcinol O-methyltransferase                   392   2e-130   Rosa hybrid cultivar
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    393   2e-130   
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    392   3e-130   Vitis vinifera
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   391   5e-130   Rosa hugonis
emb|CDP19840.1|  unnamed protein product                                391   8e-130   
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   390   1e-129   Rosa chinensis var. spontanea
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   391   1e-129   Rosa hybrid cultivar
emb|CDP15886.1|  unnamed protein product                                390   2e-129   
gb|AAB71213.1|  methyltransferase                                       390   2e-129   Prunus armeniaca
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   390   2e-129   Rosa odorata var. gigantea
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   389   2e-129   Rosa woodsii var. ultramontana
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    390   2e-129   
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   389   2e-129   Rosa beggeriana
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   389   3e-129   Rosa bracteata [Macartny rose]
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   389   4e-129   Rosa odorata var. gigantea
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   389   5e-129   Rosa odorata var. gigantea
emb|CAH05089.1|  putative orcinol O-methyltransferase                   389   6e-129   Rosa odorata var. gigantea
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   388   7e-129   Rosa majalis [cinnamon rose]
emb|CAH05081.1|  putative orcinol O-methyltransferase                   388   7e-129   Rosa hybrid cultivar
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   388   8e-129   Rosa beggeriana
emb|CDP19709.1|  unnamed protein product                                388   8e-129   
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   388   8e-129   Rosa gallica [apothecary rose]
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   388   9e-129   Rosa odorata [tea rose]
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   388   9e-129   Rosa gallica [apothecary rose]
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   388   9e-129   Rosa chinensis [China rose]
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   388   1e-128   Rosa gallica [apothecary rose]
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   388   1e-128   Rosa canina [dog briar]
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   387   1e-128   Rosa odorata [tea rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa chinensis [China rose]
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa banksiae
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa beggeriana
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa chinensis var. spontanea
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa gallica [apothecary rose]
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    387   2e-128   Vitis vinifera
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa hugonis
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa marretii
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    387   3e-128   Vitis vinifera
emb|CAQ76879.1|  resveratrol O-methyltransferase                        387   3e-128   Vitis vinifera
gb|AEF97347.1|  O-methyltransferase                                     387   3e-128   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   387   3e-128   Rosa hybrid cultivar
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    387   3e-128   
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   387   4e-128   Rosa rugosa [Japanese rose]
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    387   4e-128   
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   387   4e-128   Rosa chinensis [China rose]
emb|CAH05084.1|  orcinol O-methyltransferase 3                          386   4e-128   Rosa hybrid cultivar
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   386   4e-128   Rosa gallica [apothecary rose]
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   386   4e-128   Rosa gallica [apothecary rose]
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    387   5e-128   
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   386   5e-128   Rosa bracteata [Macartny rose]
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   386   6e-128   Rosa canina [dog briar]
emb|CAH05082.1|  putative orcinol O-methyltransferase                   386   6e-128   Rosa hybrid cultivar
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             385   1e-127   Populus trichocarpa [western balsam poplar]
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   385   1e-127   Rosa lucieae [memorial rose]
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   385   1e-127   Rosa chinensis var. spontanea
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    385   1e-127   
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   385   1e-127   Rosa chinensis var. spontanea
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   385   1e-127   Rosa beggeriana
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   385   1e-127   Rosa rugosa [Japanese rose]
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   385   1e-127   Rosa roxburghii [chestnut rose]
gb|AFX68805.1|  O-metyltransferase                                      385   2e-127   
emb|CAH05079.1|  putative orcinol O-methyltransferase                   385   2e-127   Rosa gallica [apothecary rose]
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   385   2e-127   Rosa odorata var. gigantea
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   385   2e-127   Rosa chinensis var. spontanea
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    385   2e-127   Vitis vinifera
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   384   2e-127   Rosa canina [dog briar]
emb|CAH05087.1|  orcinol O-methyltransferase 4                          384   3e-127   Rosa hybrid cultivar
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   384   3e-127   Rosa marretii
emb|CAN78992.1|  hypothetical protein VITISV_005827                     385   3e-127   Vitis vinifera
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    384   3e-127   
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   384   3e-127   Rosa woodsii var. ultramontana
emb|CAH05085.1|  orcinol O-methyltransferase 3                          384   4e-127   Rosa hybrid cultivar
emb|CDP21661.1|  unnamed protein product                                384   5e-127   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           384   7e-127   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    384   8e-127   
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   383   9e-127   Rosa odorata [tea rose]
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   383   9e-127   Rosa banksiae
emb|CAD29556.1|  orcinol O-methyltransferase                            383   1e-126   Rosa hybrid cultivar
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   382   1e-126   Rosa odorata [tea rose]
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   382   2e-126   Rosa chinensis [China rose]
emb|CAH05080.1|  putative orcinol O-methyltransferase                   382   2e-126   Rosa gallica [apothecary rose]
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   382   2e-126   Rosa odorata [tea rose]
ref|NP_001267963.1|  O-methyltransferase                                382   2e-126   
emb|CAH05090.1|  putative orcinol O-methyltransferase                   382   3e-126   Rosa odorata var. gigantea
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   381   3e-126   Rosa odorata var. gigantea
emb|CAH05088.1|  putative orcinol O-methyltransferase                   381   3e-126   Rosa odorata var. gigantea
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   381   4e-126   Rosa odorata [tea rose]
emb|CAH05086.1|  orcinol O-methyltransferase 4                          381   4e-126   Rosa hybrid cultivar
gb|ABQ02270.2|  O-methyltransferase                                     382   4e-126   Vitis vinifera
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    382   4e-126   
emb|CAN79968.1|  hypothetical protein VITISV_043678                     382   4e-126   Vitis vinifera
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   381   4e-126   Rosa marretii
emb|CAD29555.1|  orcinol O-methyltransferase                            381   5e-126   Rosa hybrid cultivar
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   381   6e-126   Rosa odorata var. gigantea
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    384   7e-126   
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   380   7e-126   Rosa odorata var. gigantea
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    381   8e-126   
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   380   9e-126   Rosa chinensis var. spontanea
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    381   1e-125   
emb|CAN83014.1|  hypothetical protein VITISV_029725                     380   1e-125   Vitis vinifera
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   380   1e-125   Rosa odorata var. gigantea
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   380   1e-125   Rosa chinensis [China rose]
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   379   2e-125   Rosa odorata [tea rose]
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   2e-125   
emb|CAH05091.1|  putative orcinol O-methyltransferase                   379   3e-125   Rosa odorata var. gigantea
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    379   4e-125   Vitis vinifera
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   379   4e-125   Rosa odorata var. gigantea
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         379   5e-125   
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   378   5e-125   Rosa odorata var. gigantea
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    378   9e-125   Vitis vinifera
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    378   1e-124   Vitis vinifera
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    378   1e-124   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     377   2e-124   Vitis vinifera
emb|CDP17644.1|  unnamed protein product                                377   2e-124   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   376   4e-124   Rosa odorata [tea rose]
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             377   4e-124   
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   375   8e-124   Rosa odorata [tea rose]
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   375   8e-124   Rosa odorata [tea rose]
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   375   1e-123   Rosa chinensis [China rose]
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   375   1e-123   Rosa chinensis var. spontanea
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    375   6e-123   
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    373   1e-122   Vitis vinifera
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    372   4e-122   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         371   5e-122   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             371   6e-122   
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             370   1e-121   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    370   2e-121   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    368   7e-121   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             368   1e-120   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa odorata var. gigantea
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    364   3e-119   Vitis vinifera
ref|XP_002525160.1|  o-methyltransferase, putative                      364   3e-119   Ricinus communis
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    364   3e-119   
emb|CAN73269.1|  hypothetical protein VITISV_021917                     364   4e-119   Vitis vinifera
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              364   5e-119   
ref|XP_003615966.1|  O-methyltransferase                                363   7e-119   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    363   1e-118   
emb|CDP19713.1|  unnamed protein product                                362   2e-118   
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             362   3e-118   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     360   4e-118   Vitis vinifera
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           361   8e-118   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   9e-118   
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   1e-117   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    360   1e-117   
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             360   1e-117   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           360   1e-117   
ref|XP_002517827.1|  o-methyltransferase, putative                      360   1e-117   Ricinus communis
emb|CDP19711.1|  unnamed protein product                                359   1e-117   
emb|CAA11131.1|  O-methyltransferase                                    359   2e-117   Prunus dulcis [sweet almond]
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   2e-117   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   3e-117   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    362   3e-117   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    358   7e-117   
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             357   1e-116   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             357   2e-116   
emb|CDP19839.1|  unnamed protein product                                355   3e-116   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   3e-116   
ref|XP_002525159.1|  o-methyltransferase, putative                      356   4e-116   Ricinus communis
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    357   4e-116   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           357   4e-116   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   4e-116   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   5e-116   
gb|ABZ89567.1|  O-methyltransferase 3                                   356   9e-116   Humulus lupulus [common hop]
gb|ABK96707.1|  unknown                                                 355   1e-115   Populus trichocarpa x Populus deltoides
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   1e-115   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   1e-115   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   2e-115   Vitis vinifera
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    354   4e-115   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   4e-115   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             353   6e-115   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   1e-114   
gb|AES89720.2|  orcinol O-methyltransferase                             352   1e-114   
emb|CAN70493.1|  hypothetical protein VITISV_002330                     352   3e-114   Vitis vinifera
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           352   3e-114   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    350   7e-114   
gb|AFK40900.1|  unknown                                                 350   9e-114   
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    357   1e-113   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    350   2e-113   
ref|XP_003607523.1|  O-methyltransferase                                350   2e-113   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   348   4e-113   
ref|XP_002517832.1|  o-methyltransferase, putative                      348   7e-113   Ricinus communis
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             347   8e-113   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    347   1e-112   Populus trichocarpa [western balsam poplar]
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    347   1e-112   
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    346   4e-112   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             346   4e-112   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   6e-112   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   8e-112   
ref|XP_003615973.1|  O-methyltransferase                                344   2e-111   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   3e-111   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   3e-111   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   4e-111   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   6e-111   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         342   1e-110   
ref|XP_002517834.1|  o-methyltransferase, putative                      342   1e-110   Ricinus communis
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   1e-110   
gb|AAR09603.1|  O-methyltransferase                                     342   2e-110   Mentha x piperita
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             341   2e-110   
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         341   2e-110   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    341   3e-110   
ref|XP_002517833.1|  o-methyltransferase, putative                      342   3e-110   Ricinus communis
ref|XP_003615967.1|  O-methyltransferase                                341   4e-110   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    347   4e-110   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   5e-110   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     340   5e-110   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    342   5e-110   
ref|XP_002522501.1|  o-methyltransferase, putative                      340   6e-110   Ricinus communis
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           340   7e-110   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    340   7e-110   Mentha x piperita
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   9e-110   
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   1e-109   
emb|CAN73270.1|  hypothetical protein VITISV_021918                     338   1e-109   Vitis vinifera
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 339   2e-109   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   2e-109   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   3e-109   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   4e-109   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       338   1e-108   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   1e-108   Vitis vinifera
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   2e-108   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     337   2e-108   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   2e-108   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   337   2e-108   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                335   2e-108   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   2e-108   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   3e-108   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   3e-108   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   4e-108   
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              335   4e-108   
emb|CBI22005.3|  unnamed protein product                                333   5e-108   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                335   5e-108   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    335   5e-108   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   8e-108   
ref|XP_003615962.1|  O-methyltransferase                                334   9e-108   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   9e-108   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    334   1e-107   
gb|AAR02421.1|  putative O-methyltransferase                            334   1e-107   Catharanthus roseus [chatas]
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    334   2e-107   
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                333   3e-107   
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    333   3e-107   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   3e-107   
ref|XP_002522500.1|  o-methyltransferase, putative                      333   4e-107   Ricinus communis
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      331   6e-107   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     332   7e-107   Vitis vinifera
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   9e-107   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       332   9e-107   
dbj|BAI79244.1|  O-methyltransferase                                    332   1e-106   Carapichea ipecacuanha [ipecac]
dbj|BAJ05387.1|  O-methyltransferase                                    331   2e-106   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 331   3e-106   Gossypium hirsutum [American cotton]
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   4e-106   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     330   4e-106   
dbj|BAJ05384.1|  O-methyltransferase                                    330   6e-106   
emb|CDP21583.1|  unnamed protein product                                328   6e-106   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   9e-106   Vitis vinifera
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    329   1e-105   Catharanthus roseus [chatas]
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   1e-105   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   2e-105   
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   2e-105   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   3e-105   
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   9e-105   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   1e-104   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         327   1e-104   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   1e-104   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       327   1e-104   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   2e-104   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   2e-104   
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                325   2e-104   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     326   3e-104   
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   324   3e-104   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   7e-104   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       324   1e-103   
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   1e-103   
ref|XP_002517835.1|  o-methyltransferase, putative                      324   1e-103   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             324   2e-103   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   2e-103   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      324   2e-103   
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   4e-103   
ref|XP_002522586.1|  o-methyltransferase, putative                      323   4e-103   
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   5e-103   
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   5e-103   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   322   6e-103   
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   6e-103   
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    322   6e-103   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   1e-102   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                322   1e-102   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   1e-102   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   2e-102   
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    321   2e-102   
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   2e-102   
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   3e-102   
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    320   3e-102   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             321   4e-102   
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    319   1e-101   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   2e-101   
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    318   2e-101   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         318   3e-101   
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    317   5e-101   
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      317   5e-101   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   7e-101   
ref|XP_003615968.1|  O-methyltransferase                                315   2e-100   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   2e-100   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         315   2e-100   
emb|CDP21212.1|  unnamed protein product                                314   3e-100   
emb|CDP21582.1|  unnamed protein product                                315   3e-100   
emb|CDP20220.1|  unnamed protein product                                312   4e-100   
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   313   5e-100   
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   6e-100   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   6e-100   
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   7e-100   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   1e-99    
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   3e-99    
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      313   3e-99    
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             310   4e-99    
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   4e-99    
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   4e-99    
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         312   5e-99    
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    326   5e-99    
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   5e-99    
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     312   5e-99    
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    312   6e-99    
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   6e-99    
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        311   9e-99    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   9e-99    
dbj|BAJ05388.1|  O-methyltransferase                                    311   1e-98    
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   1e-98    
dbj|BAI79245.1|  O-methyltransferase                                    311   1e-98    
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   2e-98    
ref|NP_001241010.1|  uncharacterized protein LOC100812688               310   2e-98    
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     310   2e-98    
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    310   9e-98    
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    309   9e-98    
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   1e-97    
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    310   1e-97    
emb|CBI21927.3|  unnamed protein product                                306   1e-97    
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   2e-97    
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            310   2e-97    
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    308   2e-97    
gb|ADO16249.1|  chavicol O-methyltransferase                            308   2e-97    
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   3e-97    
gb|AEF14418.1|  isoflavone O-methyltranferase                           308   3e-97    
dbj|BAJ05383.1|  O-methyltransferase                                    307   4e-97    
dbj|BAA86059.1|  O-methyltransferase                                    308   4e-97    
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   4e-97    
emb|CBI21931.3|  unnamed protein product                                304   5e-97    
ref|XP_002525163.1|  o-methyltransferase, putative                      305   7e-97    
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   8e-97    
dbj|BAI77794.1|  chavicol O-methyltransferase                           306   1e-96    
dbj|BAI79243.1|  O-methyltransferase                                    305   2e-96    
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   4e-96    
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    305   4e-96    
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   5e-96    
gb|AAM97498.1|  O-methyltransferase                                     304   5e-96    
emb|CBI21921.3|  unnamed protein product                                302   6e-96    
ref|XP_006364110.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   1e-95    
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   1e-95    
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    303   1e-95    
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             302   2e-95    
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         301   2e-95    
ref|NP_001267964.1|  O-methyltransferase                                303   3e-95    
emb|CBI21932.3|  unnamed protein product                                305   3e-95    
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    302   4e-95    
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   5e-95    
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   5e-95    
emb|CAN75971.1|  hypothetical protein VITISV_009882                     301   6e-95    
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   9e-95    
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   1e-94    
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   2e-94    
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 300   2e-94    
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   3e-94    
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   3e-94    
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   3e-94    
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   4e-94    
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   4e-94    
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   5e-94    
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    299   6e-94    
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   7e-94    
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 298   1e-93    
gb|AAR02417.1|  putative O-methyltransferase                            298   1e-93    
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      298   1e-93    
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 298   2e-93    
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   297   4e-93    
ref|XP_010070176.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   4e-93    
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   4e-93    
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    295   9e-93    
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    296   1e-92    
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   1e-92    
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   1e-92    
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 296   2e-92    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   2e-92    
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             295   2e-92    
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             295   2e-92    
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    295   2e-92    
gb|KHN14033.1|  Isoflavone 7-O-methyltransferase                        295   2e-92    
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 295   2e-92    
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             295   3e-92    
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    295   3e-92    
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    294   4e-92    
emb|CDP15884.1|  unnamed protein product                                291   4e-92    
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             294   6e-92    
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       293   8e-92    
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    293   1e-91    
emb|CBI21929.3|  unnamed protein product                                291   1e-91    
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    293   1e-91    
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg             293   2e-91    
ref|XP_006467716.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    293   2e-91    
sp|C6TAY1.1|SOMT2_SOYBN  RecName: Full=Flavonoid 4'-O-methyltrans...    293   2e-91    
gb|KHN13532.1|  Isoflavone 7-O-methyltransferase                        293   2e-91    
sp|O22309.1|7OMT9_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    292   2e-91    
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     291   2e-91    
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    292   2e-91    
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    292   2e-91    
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   3e-91    
ref|XP_003552589.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    292   3e-91    
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    291   5e-91    
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    291   6e-91    
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        290   6e-91    
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    291   7e-91    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    291   9e-91    
ref|NP_001241162.1|  uncharacterized protein LOC100813225               290   1e-90    
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   2e-90    
gb|AFK42082.1|  unknown                                                 290   2e-90    
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   3e-90    
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    290   3e-90    
dbj|BAF36052.1|  O-methyltransferase                                    290   3e-90    
gb|KHN14021.1|  Isoflavone 7-O-methyltransferase                        288   4e-90    
sp|Q84KK5.1|D7OMT_GLYEC  RecName: Full=Isoflavone 7-O-methyltrans...    289   5e-90    
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    289   5e-90    
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    288   6e-90    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     288   9e-90    
ref|XP_010093976.1|  Myricetin O-methyltransferase                      288   1e-89    
gb|ACU20151.1|  unknown                                                 288   1e-89    
gb|AES78098.2|  isoflavone-7-O-methyltransferase                        287   2e-89    
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   288   2e-89    
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   2e-89    
gb|ACU19152.1|  unknown                                                 285   2e-89    
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    286   6e-89    
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...    287   9e-89    
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    286   9e-89    
ref|XP_003621880.1|  Caffeate O-methyltransferase-1                     286   1e-88    
gb|KEH30982.1|  isoflavone-7-O-methyltransferase                        285   1e-88    
ref|XP_003552574.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    285   3e-88    
gb|KCW59786.1|  hypothetical protein EUGRSUZ_H02535                     284   3e-88    
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...    286   4e-88    
ref|XP_007139476.1|  hypothetical protein PHAVU_008G032700g             284   4e-88    
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                281   4e-88    
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    284   7e-88    
ref|XP_006586449.1|  PREDICTED: flavonoid 4'-O-methyltransferase-...    283   7e-88    
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        289   8e-88    
emb|CBI21925.3|  unnamed protein product                                280   1e-87    
gb|ABD83944.1|  IOMT 4                                                  283   1e-87    
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        282   3e-87    
ref|XP_008778505.1|  PREDICTED: trans-resveratrol di-O-methyltran...    280   3e-87    
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase                278   4e-87    
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...    282   4e-87    
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    281   6e-87    
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    279   1e-86    
gb|EMS57233.1|  putative O-methyltransferase 2                          280   2e-86    
gb|EMT07987.1|  O-methyltransferase ZRP4                                280   3e-86    
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                   276   3e-86    
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    279   4e-86    
gb|EAZ42206.1|  hypothetical protein OsJ_26771                          279   4e-86    
emb|CBI38115.3|  unnamed protein product                                275   5e-86    
gb|EAZ06416.1|  hypothetical protein OsI_28646                          279   6e-86    
ref|NP_001061464.1|  Os08g0290700                                       279   6e-86    
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    278   7e-86    
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...    277   7e-86    
pdb|1FPX|A  Chain A, Crystal Structure Analysis Of Selenomethioni...    278   8e-86    
emb|CAA54616.1|  flavonoid 7-O-methyltransferase                        279   9e-86    
dbj|BAJ96211.1|  predicted protein                                      279   9e-86    
dbj|BAK04190.1|  predicted protein                                      279   9e-86    
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                     277   1e-85    
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g             278   1e-85    
ref|XP_004970090.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    278   2e-85    
gb|ABD83942.1|  IOMT 2                                                  276   7e-85    
gb|KEH30981.1|  isoflavone-7-O-methyltransferase                        275   7e-85    
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    275   1e-84    
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          275   2e-84    
ref|XP_003622356.1|  Isoflavone-7-O-methyltransferase                   275   2e-84    
sp|Q84KK4.1|I4OMT_LOTJA  RecName: Full=Isoflavone 4'-O-methyltran...    275   3e-84    
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    274   6e-84    
gb|EAZ06414.1|  hypothetical protein OsI_28644                          273   1e-83    
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    273   1e-83    
gb|EMT10452.1|  O-methyltransferase ZRP4                                272   2e-83    
ref|XP_003608214.1|  Isoflavone-7-O-methyltransferase                   272   2e-83    
dbj|BAM37634.1|  O-methyltransferase                                    271   4e-83    



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   427 bits (1098),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 207/359 (58%), Positives = 263/359 (73%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL++L + L+INKAK  HL
Sbjct  12    EILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKAKTTHL  71

Query  237   GRLMRVLTRTGIFIKDD------------DGYALGPPSCLLIKDHPFSMAPFALGATGPT  380
              RLMR+L  +G F+K              +GYAL PPS LL+KD P S+ PF L    P 
Sbjct  72    RRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLLKDEPLSVTPFLLAMLDPI  131

Query  381   FTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
                PW HVSEWF ND PTP+ TA+G+TFWD    +P  NH FN AMAS++ LVM++V KY
Sbjct  132   LVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVIKY  191

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
              ++VFEGL+S+VDVGGGTG VA+++A+ FPD++C+V DLPHVV GLEG KNL YV G+  
Sbjct  192   SKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEGNKNLNYVGGDFF  251

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
               IPPA A++LK I+H+W+DE+ VKILK CKEAIP+RE GGKVII+DM++ +        
Sbjct  252   VSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDMMVDNK-------  304

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               DDE I+TQIF D+ MMV   GRER  K W K+F+DAGF+DYK T  LGL SLI+++P
Sbjct  305   IGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDYKVTPILGLRSLIEVYP  363



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   422 bits (1085),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 263/358 (73%), Gaps = 18/358 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
              EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL++L + L+INKAK  H
Sbjct  11    TEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKAKTTH  70

Query  234   LGRLMRVLTRTGIFIKD----------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             L RLMR+L R+G F+K            +GY+L PPS LL+KD P S+ PF L    P  
Sbjct  71    LRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTPFLLAMLDPIL  130

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW HVSEWF ND PTP+ TA+G+TFWD    +P  NH FN AMAS++ LVM++V KY 
Sbjct  131   VKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVIKYS  190

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             ++VFEGL+S+VDVGGGTG VA+++A+ FPD++C+V DLPHVV GLE +KNL YV G+   
Sbjct  191   KDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEESKNLNYVGGDFFV  250

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              IPPA A++LK I+H+W+DE+ VKILK CKEAIP+RE GGKVII+DM++ +         
Sbjct  251   SIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDMMVDNK-------I  303

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              DDE I+TQIF D+ MMV   GRER  K W K+F DAGF+DYK T  LGL SLI+++P
Sbjct  304   GDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDYKVTPILGLRSLIEVYP  361



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 259/355 (73%), Gaps = 15/355 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
              E++ A  H+WNHIFNFINS SLKCA++LGIPD+IH HG+P+TL ELV  L +N  K   
Sbjct  10    TELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEKTKC  69

Query  234   LGRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L ++G F +        ++GY L   S LL+KD P S  PF L    P    P
Sbjct  70    VYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDPVLITP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             WQ+VS WF NDDPTP+ TA+G+TFWD    +P+ N+ FN+AMAS++ LV S++ K C+ +
Sbjct  130   WQYVSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSVLIKDCKGI  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             F GL+SLVDVGGGTG VARA+A+ FP + C+VLDLPHVVAGLEG+KNL Y+AG+M E IP
Sbjct  190   FVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAGDMFEAIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+WN ++CVKILK C++AIP++E GGKVII+DM+M + +        DD
Sbjct  250   PADAILLKWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQK-------ADD  302

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
             E I+TQ+F D+ MM+   G+ER +K+W K+F DAGF+ YK T  LGL SLI+++P
Sbjct  303   ESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  357



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   404 bits (1039),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 196/362 (54%), Positives = 261/362 (72%), Gaps = 22/362 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL EL + L+INK+K  H
Sbjct  11    SEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANALSINKSKITH  70

Query  234   LGRLMRVLTRTGIFIK--------------DDDGYALGPPSCLLIKDHPFSMAPFALGAT  371
             L RLMR+L  +G F+K              + +GY L PP+ LL+KD P ++ PF L   
Sbjct  71    LRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLTVTPFLLAML  130

Query  372   GPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLV  551
              P    PW HV+EWF +D+PTP++ A+G+TFWD    +   NH FN AMAS++ LVMS+V
Sbjct  131   DPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVMSVV  190

Query  552   KKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAG  731
              KY ++VFEGL+S+VDVGGGTG VA+ +A +FP+++C+V DLPHVV GLEG+ NL YV G
Sbjct  191   MKYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLEGSDNLSYVGG  250

Query  732   NMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRd  911
             +    +PPA A++LK I+H+W+DE+ VKILK CKEAIP++E GGKVII+DM++ +     
Sbjct  251   DFFVSVPPADALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDMMVDNK----  306

Query  912   ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQL  1088
                  DDE I+TQIF D+ MMV   GRER  + W KIF +AGF+DYK T  LGL SLI++
Sbjct  307   ---IGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDYKVTPILGLRSLIEV  363

Query  1089  FP  1094
             +P
Sbjct  364   YP  365



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 196/357 (55%), Positives = 252/357 (71%), Gaps = 14/357 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG+P+TL EL   L IN  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPINPTK  77

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  78    SHSIYRLMRILIHSGFFAKKKLSKSDEEGYVLTDASQLLLKDHPLSITPFLNAMLDPVLT  137

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW + S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   CR
Sbjct  138   KPWHYFSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIVDECR  197

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGLDSLVDVGGGTG VA+A+AD FP +KC+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  198   GVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVADLQGSKNLKYTGGDMFEA  257

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA AV+LK I+H+WNDE+CVKIL+  KEAI  ++  GKVII+DM+M + +        
Sbjct  258   VPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKGKVIIIDMMMENQKG-------  310

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             D+E ++TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T  LGL SLI+++P
Sbjct  311   DEESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   399 bits (1026),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/353 (55%), Positives = 254/353 (72%), Gaps = 12/353 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E+  AQ HIWNHIFNFINS SLKCA+QLGIPD+IH+HGQP+ L +L+D L IN AKA  +
Sbjct  12    ELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAPFV  71

Query  237   GRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G FIK         +GYAL   S LL+ + PFS+ PF L    P  T PW
Sbjct  72    YRLMRILIHSGFFIKAKIPDNEGQEGYALTSASKLLLANDPFSVTPFLLAMLDPILTDPW  131

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              H S+WF N + TP+ T +G + W+   + P+ N  FN+ MAS++ LV ++V + C++VF
Sbjct  132   HHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVSTMVIENCKDVF  191

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SL+DVGGGTG VA+A+AD FP ++CSVLDLPHVV G E +KNL YV G+M E IPP
Sbjct  192   MGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESSKNLAYVGGDMFEAIPP  251

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A AV+LK I+H+W+DE+CV+IL+ CKEAIP+ E GGKVII+DM++ S QN     DDD E
Sbjct  252   ADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVIIIDMLLKSQQN----GDDDAE  307

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
              I+TQ+F D+ MMV+  GRER  K+W K+F +AGF  YK T  LGL S+I+++
Sbjct  308   AIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIEVY  360



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   399 bits (1026),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 264/360 (73%), Gaps = 15/360 (4%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
             +++  +E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+TL ELV  L I+ 
Sbjct  5     SVETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHP  64

Query  219   AKADHLGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
              K   + RLMR+L ++G F +        ++GY L   S LL++D P S+ PF L    P
Sbjct  65    KKVWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDP  124

Query  378   TFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
               T PW +VS WF NDDPTP+ TA+G+TFWD    +P+ N+ FN+AMAS++ LV S++ K
Sbjct  125   ILTKPWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLIK  184

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
              C+ VFEGL+SLVDVGGGTG VA+A+A+ FP + C+V DLPHVVAGLEG+KNL Y+ G+M
Sbjct  185   DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDM  244

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRddd  917
              + IPPA A++LK I+H+WNDE+CVKIL+ C++AIP++E GGKVII+DM+M + +     
Sbjct  245   FKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKG----  300

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                DDE ++TQ+F D+ MM+   G+ER  KEW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  301   ---DDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   399 bits (1024),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 257/354 (73%), Gaps = 16/354 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ HIWNHIF+FINS SLKCA+ LGIPD+I++H +P+TL EL+ TL ++ +KA  +
Sbjct  12    ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPSKARCV  71

Query  237   GRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G F    + +DD   GY L   S LL+KD+PFS+APF      P  T PW
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               VS W  NDDPTP+ TA+G+TFWD V  +P FNH FN AMAS++ LV  ++   C+EVF
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVF  191

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL SLVDVGGGTG VA ++A  FP + C+V DLPHVVA L+G++NL YV G+M E IPP
Sbjct  192   EGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPP  251

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A  +VLK I+H+WNDE+CVKILK CKEAI +RE GGKV+I++M+M + +         DE
Sbjct  252   ADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMMENQKGE-------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQIF D+ MM+ F G+ER  KEW K+F+DAGF++YK T  LGL S+I++FP
Sbjct  304   SIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/357 (54%), Positives = 252/357 (71%), Gaps = 14/357 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  77

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  78    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  137

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  138   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  197

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  198   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  257

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  258   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKG-------  310

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T  LGL SLI+++P
Sbjct  311   DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  367



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 261/360 (73%), Gaps = 15/360 (4%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
             +++  +E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+TL ELV  L I+ 
Sbjct  5     SVETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHP  64

Query  219   AKADHLGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
              K   + RLMR+L ++G F +        ++GY L   S LL++D P S+ PF L    P
Sbjct  65    KKVWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDP  124

Query  378   TFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
               T PW +VS WF NDDPTP+ TA+G TFWD    +P+ N+ FN+AMAS++ LV S + K
Sbjct  125   ILTKPWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLIK  184

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
              C+ VFEGL+SLVDVGGGTG VA+A+A+ FP + C+V DLPHVVAGLEG+KNL Y+ G+M
Sbjct  185   DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDM  244

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRddd  917
              + IPPA A++LK I+H+WNDE+CVKIL+ C++AIP++E GGKVII+DM+M + +     
Sbjct  245   FKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGD---  301

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                 DE ++TQ+F D+ MM+   G+ER  KEW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  302   ----DESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 256/354 (72%), Gaps = 16/354 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ HIWNHIF+FINS SLKCA+ LGIPD+I++H +P+TL EL+  L ++ +KA  +
Sbjct  12    ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPSKARCV  71

Query  237   GRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G F    + +DD   GY L   S LL+KD+PFS+APF      P  T PW
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               VS W  NDDPTP+ TA+G+TFWD V  +P FNH FN AMAS++ LV  ++   C+EVF
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVF  191

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL SLVDVGGGTG VA ++A  FP + C+V DLPHVVA L+G++NL YV G+M E IPP
Sbjct  192   EGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPP  251

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A  +VLK I+H+WNDE+CVKILK CKEAI +RE GGKV+I++M+M + +         DE
Sbjct  252   ADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMMENQKGE-------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQIF D+ MM+ F G+ER  KEW K+F+DAGF++YK T  LGL S+I++FP
Sbjct  304   SIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   397 bits (1020),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 254/355 (72%), Gaps = 14/355 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E+  AQ HIWNHIFNFINS S+KCA QLGIPDVIH+HGQP+TL++L+D L I  AKA  +
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  237   GRLMRVLTRTGIFIK---------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              RLM++L  +G FI+         +  GY L   S LL+K +PFSM PF L    PT T 
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAMLDPTLTD  132

Query  390   PWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             PWQ++S+WF N D TP+ T +G++ +   S +P  N  FN+AMAS++ LV S+V K C+ 
Sbjct  133   PWQNLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVVTKDCKH  192

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFE L+SLVDVGGGTG  A+A+AD FP +KC+VLDLPHVV GLE +KNL YV GNM E I
Sbjct  193   VFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAI  252

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PPA AV++K I+ +W+D++CV+ILK CKEA P++E GGKVII+DM   S Q      DDD
Sbjct  253   PPADAVLMKWILIDWSDDECVQILKKCKEAFPSKEKGGKVIIVDMFCKSLQK----GDDD  308

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
              E I+TQ+F D+ +MV   GR+R  K+W K+F +AGF+DYK T  LGL S+I+++
Sbjct  309   HETIETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 254/355 (72%), Gaps = 14/355 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E+  AQ HIWNHIFNFINS S+KCA+QLGIPDVIH+HGQPITL++L+D L I  AKA  +
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLIDALPIKNAKAPFV  72

Query  237   GRLMRVLTRTGIFIK---------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              RLM++L  +G FI+         +  GY L   S LL+K +PFSM PF L    PT T 
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAMLDPTLTD  132

Query  390   PWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             PW H+S+WF N D TP+ T +G++ +   S +P  N  FN+AMAS++ LV S+V K C+ 
Sbjct  133   PWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVVTKDCKH  192

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFE L+SLVDVGGGTG  A+A+AD FP +KC+VLDLPHVV GLE +KNL YV GNM E I
Sbjct  193   VFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLGYVGGNMFEAI  252

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PPA AV++K I+ +W+D++CV+ILK CKEAIP++E GGKVII+DM   S Q      DDD
Sbjct  253   PPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDMFCKSLQK----GDDD  308

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
              E I+TQ+F D+ +MV    R+R  K+W K+F +AGF+DYK T  LGL S+I+++
Sbjct  309   HEAIETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   394 bits (1012),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 256/355 (72%), Gaps = 13/355 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQTH+WNHIFNFINS SLKCA+QLGIPD+IH H QP+TL ELV  L +   K   
Sbjct  10    SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L  +G F         D++GYAL   S LL+KDHP S  PF L    P  T P
Sbjct  70    VHRLMRILVHSGFFTMQRVQESADEEGYALANASRLLLKDHPLSATPFLLAMLDPDLTEP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+G+T WD    +P FN+ FN+AMAS++ LV S++ K C+  
Sbjct  130   WHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGA  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+S VDVGGGTG VA+ + D FP +  +VLDLPHVVA L+G+KNL Y+AG+M E IP
Sbjct  190   FEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQGSKNLTYLAGDMFEAIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+W+DE+C+KIL+ C+ AIP++E GGKV+I+DM + + +  +D++    
Sbjct  250   PADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKVMIIDMAILNKKGDEDESK---  306

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               ++TQ+F D+ MMV + GRER+ KEW K+F D+GF+ YK T  LGL SLI+++P
Sbjct  307   --VETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 251/361 (70%), Gaps = 13/361 (4%)
 Frame = +3

Query  30    IGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             +G  ++  +E++ AQ HIWNHIF+FINS SLKCAVQLGIPDVI +HGQP+TL ELV  L 
Sbjct  1     MGSEVRASHELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSALP  60

Query  210   INKAKADHLGRLMRVLTRTGIFIKD-----DDGYALGPPSCLLIKDHPFSMAPFALGATG  374
             I+  KA  + RLMR+L  +  F ++     + GY L   S LL++D+P S  PF L    
Sbjct  61    ISPTKAHFIPRLMRILVHSSFFARESLSGGEQGYVLTDASTLLLEDNPMSARPFLLAVLN  120

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P  T PWQ+++ WF ND+PTP+   +G TFWD  +QDP   H FN AMAS++ L+ SLV 
Sbjct  121   PILTDPWQYLTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLISSLVI  180

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
               C+ VF+G+DSLVDVGGGTG VA+++AD FP MKC+VLDLPHVVA L+G+KNL YVAG+
Sbjct  181   DECKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGD  240

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M + +P A A+ LK I+H+W+DE+CVKIL+ CKEAI      GKVII+DM +        
Sbjct  241   MFDAVPAADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVEDKNT---  297

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLF  1091
                 D E  +TQ+F D+ MMV   G+ER  KEW K+F+DAGF+ YK T  LGL SLI+++
Sbjct  298   ----DKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSLGLRSLIEVY  353

Query  1092  P  1094
             P
Sbjct  354   P  354



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 244/346 (71%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             ++ NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EDSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  L RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSLDRLMRILVHSGFFAKEKLSETDEEGYTLTDTSQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW H+S WF NDD TP+ TA+G T WD  +  P F+H FN AMAS++ LV S++   C+
Sbjct  127   KPWHHLSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAMASDARLVASVIINECK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKIL+  KEAI +++  GKVII+DMIMG+ +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILQRSKEAITSKDKKGKVIIIDMIMGNQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+ Q+F D+ MMV   G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIEMQLFFDMLMMVLLKGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/354 (55%), Positives = 254/354 (72%), Gaps = 16/354 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ HIWNHIFNFINS SLKCA+ LGIPD+I++H +P+TL EL+  L ++  KA  +
Sbjct  12    ELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPGKARCV  71

Query  237   GRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G F    + +DD   GY L   S LL+KD+PFS+APF      P  T PW
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYILTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               VS W  NDDPTP+ TA+G+TFWD V  +P FNH FN AMAS++ LV  ++   C+EVF
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVF  191

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL SLVDVGGGTG VA+++A  FP + C+V DLPHVVA L+G++NL YV G+M E IPP
Sbjct  192   EGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPP  251

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A  +VLK I+H+WNDE+CVKILK CKEAI +RE GGKV+I++M+M + +         D+
Sbjct  252   ADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMMENQKGE-------DD  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQIF D+ MM+   G+ER  KEW K+F+DA F++YK T  LGL S+I++FP
Sbjct  304   SIETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKITPILGLRSIIEVFP  357



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 257/355 (72%), Gaps = 13/355 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQTH+WNHIFNFINS SLKCA+QLGIPD+IH H QP+TL ELV  L +   K   
Sbjct  10    SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L  +G F         D++GY L   S LL+KDHP S+ PF L    P  T P
Sbjct  70    VHRLMRILVHSGFFTMQRVQESADEEGYVLANASRLLLKDHPLSVTPFLLAMLDPDLTEP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+G+T WD    +P FN+ FN+AMAS++ LV S++ K C+  
Sbjct  130   WHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLVKECKGA  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+S VDVGGGTG VA+ + + FP +  +VLDLPHVVA L+G K+L Y+AG+M E IP
Sbjct  190   FEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGGKSLTYLAGDMFEAIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+W+DE+C+KILK C+EAIP++E GGKV+I+DM   + QN+  D+D+ +
Sbjct  250   PADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDM---AIQNKKGDDDESN  306

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               ++TQ+F D+ MMV   GRER+ KEW K+F D+GF+ YK T  LGL SLI+++P
Sbjct  307   --VETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 243/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMA ++ LV S++   C+
Sbjct  127   KPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK CKEAI +++  GKVII+DMIM + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMENQK-------V  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   DEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   391 bits (1005),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 253/355 (71%), Gaps = 14/355 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E+  AQ HIWNHIFNFINS S+KCA+QLGIPDVIH+HGQP+TL++L+D L I  AKA  +
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  237   GRLMRVLTRTGIFIK---------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              RLM++L  +G FI+         +  GY L   S LL+K +PFS+ PF L    P  T 
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAMLDPALTD  132

Query  390   PWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             PW H+S+WF N D TP+ T +G++ +   S +P  N  FN+AMAS++ +V S+V K C+ 
Sbjct  133   PWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMVSSVVTKDCKH  192

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFEGL+SLVD+GGGTG  A+A+AD FP +KC+VLDLPHVV GLE +KNL YV GNM E I
Sbjct  193   VFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAI  252

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PPA AV++K I+ +W+D++CV+ILK CKEAIP++E GGKVII+D    S Q      DDD
Sbjct  253   PPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFCKSQQK----GDDD  308

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
              E I+TQ+F D+  MV   GR+R   +W K+F++AGF+DYK T  LGL S+I+++
Sbjct  309   HEAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGFSDYKITAVLGLRSIIEVY  363



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 242/347 (70%), Gaps = 13/347 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI  ++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGE------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQLG  1067
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T + 
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 250/357 (70%), Gaps = 14/357 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  77

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  78    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  137

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  138   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  197

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  198   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  257

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+W+DE+C+KIL+  + AI  +E  GKVII+DM+M + +        
Sbjct  258   VPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD------  311

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T + GL SLI+++P
Sbjct  312   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPISGLRSLIEVYP  367



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 252/352 (72%), Gaps = 8/352 (2%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++ + E++ AQ H+ N + NF  S+SLKCA++LGIPD I++HG+PITL ELV  L IN +
Sbjct  4     VENLTELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPS  63

Query  222   KADHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQH  401
             KA+H+ RLMR L+  G F+  D GYAL     LL+K+ PF++  F    + P    PW  
Sbjct  64    KANHIYRLMRFLSNAGFFVLQDQGYALTAAGRLLLKEEPFNLRAFIFYMSDPVLVKPWNS  123

Query  402   VSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEG  581
             ++EWF NDDP+P+ TA+GK FW   +++P F + FN+AMA++S L++ ++   C+ VF+G
Sbjct  124   LTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMMTQCKFVFDG  183

Query  582   LDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQ  761
             L SL DVGGGTG VARA+A  FP++KC V DLPHV+AG EGT+NL +VAG+MLE +P A 
Sbjct  184   LTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEGTENLDFVAGDMLEKVPAAD  243

Query  762   AVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELI  941
             A++LK I+H+W+DEDCVKILKNCKEAIP R+ GGKVII+DMI+ S          DD+ +
Sbjct  244   AILLKWILHDWSDEDCVKILKNCKEAIPGRDKGGKVIIIDMILESQ-------VKDDDSV  296

Query  942   QTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
             +TQ+  D+ M++ +G +ER  KEW K+F DAGF+DYK    LG+  LI ++P
Sbjct  297   ETQVGVDMQMLMCYGAKERTEKEWAKLFQDAGFSDYKILPALGVCCLIAVYP  348



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 253/359 (70%), Gaps = 14/359 (4%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
             +++  +E++ AQ HIWNHIF+FINS SLKCAVQL IPDVI +HGQP+TL ELV  L I+ 
Sbjct  3     SVRASHELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISP  62

Query  219   AKADHLGRLMRVLTRTGIFIKD------DDGYALGPPSCLLIKDHPFSMAPFALGATGPT  380
              KA  + RLMR+L  +G F K+      + GY L   S LL+KD+P S  PF L    P 
Sbjct  63    TKAHFIPRLMRILVHSGFFAKESLSGCGEQGYILTDASALLLKDNPMSARPFLLAMLSPI  122

Query  381   FTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
              T P+Q+++ WF ND+PTP+    G T WD V+QDP   H FN AMAS++ L+ SLV   
Sbjct  123   LTDPYQYLTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQLISSLVIDD  182

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
             C+EVF+G+DSLVDVGGGTG VA+++AD FP MKC+VLDLPHVVA L+G+KNL YVAG+M 
Sbjct  183   CKEVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMF  242

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E +P A A+ LK I+H+W+DE+CVKIL+ CK A+      GKVII++M   + +N+    
Sbjct  243   EAVPAADAIFLKWILHDWSDEECVKILERCKAAVTREGKKGKVIIVEM---TVENK----  295

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
             + D E  +TQ+F D+HMMV   G+ER  KEW K+F+DAGF+ YK T L G  SLI+++P
Sbjct  296   NTDKESGETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLFGFKSLIEVYP  354



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 243/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ+HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 243/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  N+++ AQ HIWNHIF+FINS+SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNDLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    GRER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 257/359 (72%), Gaps = 19/359 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
              EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL+EL + L+IN +K  H
Sbjct  11    TEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANALSINHSKITH  70

Query  234   LGRLMRVLTRTGIFIKDDDG-----------YALGPPSCLLIKDHPFSMAPFALGATGPT  380
             L RLMR+L  +G F+K   G           Y L PP+ LL+KD P ++ PF L    P 
Sbjct  71    LRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLAPPALLLLKDEPLTVTPFLLAMLDPI  130

Query  381   FTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
                PW HVSEWF +D+PT ++ A+G+TFWD    +P  NH FN AMAS++ LVMS+V KY
Sbjct  131   LVKPWHHVSEWFTSDEPTAFEVAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMSVVMKY  190

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
              ++VFEGL+S+VDVGGGTG VA+ +A  FP+++C+V DLPHVV GLEG+ NL YV G+  
Sbjct  191   SKDVFEGLNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLEGSDNLTYVGGDFF  250

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
               IP A+A++LK I+H+W+DE+ VKILK CKEAIP++E GGKVII+DM++ +        
Sbjct  251   VSIPHAEALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDMMVDNKIGD----  306

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                DE I+TQIF D+ MMV   GRER  + W KIF++AGF+DYK T  LGL SLI+++P
Sbjct  307   ---DESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDYKVTPILGLRSLIEVYP  362



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +R+  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSRDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 243/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA AV+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 243/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ+HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G++NL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   389 bits (998),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 243/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  ++AI +++  GKVIILDM+M   Q R      
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMM-ENQKR------  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   388 bits (997),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   388 bits (997),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 251/352 (71%), Gaps = 8/352 (2%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++ + E++ AQ H+ N + NF  S+SLKCA++LGIPD I++HG+PITL ELV  L IN +
Sbjct  4     VENLTELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPS  63

Query  222   KADHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQH  401
             KA+H+ RLMR L+  G F+  D GYAL     LL+K+ PF++  F    + P    PW  
Sbjct  64    KANHIYRLMRFLSNAGFFVLQDQGYALTAAGRLLLKEEPFNLRAFIFYTSDPVLVKPWNS  123

Query  402   VSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEG  581
             ++EWF NDDP+P+ TA+GK FW   +++P F + FN+AMA++S L + ++   C+ VF+G
Sbjct  124   LTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMMTQCKFVFDG  183

Query  582   LDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQ  761
             L SLVDVGGGTG VARA+A  FP+++C V DLPHV+AG EGT+NL +VAG+MLE +P A 
Sbjct  184   LTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEGTENLDFVAGDMLEKVPAAD  243

Query  762   AVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELI  941
             A++LK I+H+W+D+DCVKILKNCKEAIP R+ GGKVII+DMI+ S          DDE +
Sbjct  244   AILLKWILHDWSDDDCVKILKNCKEAIPGRDKGGKVIIIDMILESHMK-------DDESV  296

Query  942   QTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             +TQ   D+ M+  +G +ER  KEW K+F DAGF+DYK    LG+  LI+++P
Sbjct  297   ETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDYKVLPVLGVRCLIEVYP  348



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   388 bits (997),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   388 bits (997),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI + +  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSEDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   388 bits (997),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 241/343 (70%), Gaps = 13/343 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K+  
Sbjct  10    NELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTKSHS  69

Query  234   LGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T PW
Sbjct  70    VYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLTKPW  129

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+ VF
Sbjct  130   NYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCKGVF  189

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E +PP
Sbjct  190   EGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEAVPP  249

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +         +E
Sbjct  250   ADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD-------EE  302

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   388 bits (996),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI ++   GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKAKNGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKSGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI  ++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRTLVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDP P+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA AV+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C 
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCN  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI  ++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G++NL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPAGTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 250/354 (71%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+T  ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          + ++GY L   S LL+ D   S+ PF L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLDPVLTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+ + FWD    +P+ N+ FN+AMAS+S LV+S++ K  + +F
Sbjct  131   HYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLLKEGKGLF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+ +KNL Y AG+M E IPP
Sbjct  191   EGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQESKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              ++TQ++ D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  305   -VETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+F+NS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S  L+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQPLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMA ++ LV S++   C+
Sbjct  127   KPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK CKEAI +++  GKVII+DMIM + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMENQK-------V  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   DEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS+SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+  + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMRENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 247/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          ++++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TAY + FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGKGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKST-----  305

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   --ETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 249/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          K+++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+ ++FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKST-----  305

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   --ETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 248/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          K+++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+ ++FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKST-----  305

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   --ETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 251/357 (70%), Gaps = 15/357 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  76

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  77    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  136

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF N+DPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  137   TPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  196

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  197   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  256

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  257   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKG-------  309

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T  LGL SLI+++P
Sbjct  310   DEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  366



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 249/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHI NFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          ++++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQSVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+ + FWD    +P+ N+ FN+AMAS++ LV S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG++ E IPP
Sbjct  191   EGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  305   -IETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WN+E+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNNEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMTLVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 253/362 (70%), Gaps = 14/362 (4%)
 Frame = +3

Query  30    IGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             +G  ++  +E++ AQ HIWNHIF+F+NS SLKCAVQL I DVI +HGQP+ L ELV  L 
Sbjct  1     MGSEVRASHELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSALP  60

Query  210   INKAKADHLGRLMRVLTRTGIFIKD------DDGYALGPPSCLLIKDHPFSMAPFALGAT  371
             I+  KA  + RLMR+L  +G F ++      + GY L   S LL+KD+P S  PF L   
Sbjct  61    ISPTKAHFIPRLMRILVHSGFFARESLSGGGEQGYVLTDASALLLKDNPMSARPFLLAML  120

Query  372   GPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLV  551
              P  T PWQ+++ WF ND+PTP+   +G TFWD  +QDP   H FN AMAS++ L+ SL+
Sbjct  121   NPMLTDPWQYLTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSLM  180

Query  552   KKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAG  731
                C+ VF+G+DSLVDVGGGTG VA+++AD FP MKC+VLDLPHVVA L+G+KNL YVAG
Sbjct  181   IDDCKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAG  240

Query  732   NMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRd  911
             +M E +P A A+ LK I+H+W+DE+CVKIL+ CKEAI      GKVII+DM   + +N+ 
Sbjct  241   DMFEAVPEADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDM---TVENK-  296

Query  912   ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQL  1088
                + D E  +TQ+F D+ MMV   G+ER  KEW K+F+DAGF+ YK T  LGL SLI++
Sbjct  297   ---NTDKESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCLGLRSLIEV  353

Query  1089  FP  1094
             +P
Sbjct  354   YP  355



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI  ++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKG-------  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   DEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+ NL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSTNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G++NL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWISHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   387 bits (993),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 249/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHI NFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          ++++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+ + FWD    +P+ N+ FN+AMAS++ LV S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG++ E IPP
Sbjct  191   EGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  305   -IETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE + AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNEPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
              PPA AV+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   APPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW  +S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNCLSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFET  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMTMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 250/354 (71%), Gaps = 16/354 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNF+NS SLKCA+QLGIPDVIH HG+P+TL ELV  L I+ +KA  +
Sbjct  12    ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHPSKAPGI  71

Query  237   GRLMRVLTRTGIFIKDD-------DGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G F   +       +GY L   S LLIKD+PFS+ PF L    P  T PW
Sbjct  72    YRLMRILVHSGFFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLDPILTQPW  131

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              +VS WF ND P+ + TA+ +T W+    + E NH FN+AMAS++ LV S++   C+ VF
Sbjct  132   HYVSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLVNECKGVF  191

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG VA+A+A EF  + C+V DLPHVVAGLEG++NL Y++G+M E IP 
Sbjct  192   EGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGSENLKYLSGDMFEAIPQ  251

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+WNDE+CVKILK CKEAI  RE GGK+II+DM++ + +  +        
Sbjct  252   ADAILLKWILHDWNDEECVKILKQCKEAIKGRE-GGKLIIIDMVVENNKEVEGST-----  305

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MM+   G+ER  KEW K+F DAGF++YK    LGL SLI+++P
Sbjct  306   --ETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVLGLRSLIEVYP  357



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKRLSKTDEEGYTLTDASQLLLKDHPLSLTPFLAAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CV+ILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVEILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFGDYKITPI  345



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 242/347 (70%), Gaps = 13/347 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y+ G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KIL+  + AI  +E  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQLG  1067
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T + 
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 249/361 (69%), Gaps = 17/361 (5%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
              +Q   E++ AQ+H+WNH+FNF+NS SLKC +QLGIPD+I +HG+P+TL EL  +L +N 
Sbjct  7     GIQSTQELLDAQSHVWNHLFNFVNSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLND  66

Query  219   AKADHLGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
             AK+  L RLMR++  +  FI       ++ +GY L P S LL++D P S+ PFALG   P
Sbjct  67    AKSPSLERLMRIMIHSKFFINVKISQVEESEGYWLTPASHLLLRDEPLSVRPFALGMLDP  126

Query  378   TFTGPWQHVSEWFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
               T PW H+SEWF  D D TP+ T +G+T W+   QDP  N  FN+ MAS+S LV +++ 
Sbjct  127   ILTDPWHHLSEWFKTDGDLTPFLTTHGRTLWEHAGQDPRLNELFNEGMASDSELVATVIT  186

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             K CR VFEGL S+VDVGGGTG VA+A+AD F  + C VLDLPHVVAG EGT++L +VAG+
Sbjct  187   KDCRNVFEGLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCEGTESLTFVAGD  246

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M + IPPA AV +K I+H+W DE C+KILK CK+AI N++ GGKVII+DM++   +    
Sbjct  247   MFDYIPPADAVFMKWILHDWPDEQCLKILKKCKQAISNKDKGGKVIIVDMVVDFKKEH--  304

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLF  1091
                   + I+TQ+F D+ M+    G ER  K+W K+F+ AGFT YK T   GL SLI+LF
Sbjct  305   ------KAIETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTSYKITPAFGLRSLIELF  358

Query  1092  P  1094
             P
Sbjct  359   P  359



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++  Q HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI  ++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSRGAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPI  345



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKIL+   EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILERSGEAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 247/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          ++++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TAY + FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLIKEGKGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQ+F D+ M +   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  305   -IETQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAG +DYK T +
Sbjct  301   -EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGLSDYKITPI  345



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI D+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y+ G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KIL+  + AI  +E  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 248/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          K+++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TAY ++FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDL HVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W++E+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKST-----  305

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   --ETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPSSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EA  ++   GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREATTSKAKNGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ H+WNHIF+FINS SLK A+QLGI D+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  N+++ AQ H WNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNDLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 249/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+T  ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          + ++GY L   S LL+ D   S+ PF L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLDPVLTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TA+ + FWD    +P+ N+ FN+AMAS+S LV+S++ K  + +F
Sbjct  131   HYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLLKEGKGLF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG VA+A+A+ FP + C+VLD PHVVAGL+ +KNL Y AG+M E IPP
Sbjct  191   EGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQESKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              ++TQ++ D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  305   -VETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 252/358 (70%), Gaps = 12/358 (3%)
 Frame = +3

Query  27    KIGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL  206
             KIG    E NE++ AQ HI NH+ N++NS SLKCA+QLGIPD+IH HG+ +T  +LV+ L
Sbjct  6     KIG---DETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNAL  62

Query  207   AINKAKA-DHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              INK+K  + + RLMR+L  TG FI+ ++GY L P S LL+K+ P ++APF      P  
Sbjct  63    PINKSKGHECIYRLMRILIHTGFFIEGEEGYLLTPTSRLLLKNEPLNLAPFVQAHLDPIL  122

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW  + EWF N D TP+ TA+GK  +D    DP  N  FN+AM S++ L+MS++ K  
Sbjct  123   MDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSVLIKNG  182

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + VFEGL SLVDVGGG G VA+A+++ FP++KCSV DLPHVV GLEG  NL Y+ G+M +
Sbjct  183   KRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITGDMFK  242

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +P A A++LK I+H+W+DEDC KILK CKEAIP++ENGGKVI++D ++ + +  D    
Sbjct  243   SVPSADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGDDKS--  300

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                   +TQ+F DV MMV+  G+ER  +EW K+F+DAGF+DYK +  LGL S+I+++P
Sbjct  301   -----FETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL  TL I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSTLPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+APF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLAPFLTAMLDPALT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +P A  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DMIM + +        
Sbjct  247   VPLADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMIMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+T++F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETELFFDMLMMAILTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   384 bits (987),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 251/356 (71%), Gaps = 14/356 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E+  AQ HIWNHIFNFINS SLKCA+QL IPDVIH+HG+P+TL++L+D L I   KA  
Sbjct  12    DELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLIDALPIKNEKAPF  71

Query  234   LGRLMRVLTRTGIFIK---------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             + RLM++L  +G FI+         +  GY L   S LL+K +PFS+ PF L    P  T
Sbjct  72    VYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAMLDPALT  131

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW H+S+WF N   +P+ T +G++ +D  S + + N  FN+AMAS++ +V S+V K C+
Sbjct  132   DPWHHLSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMVSSVVTKDCK  191

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFE L+SLVDVGGGTG  A+A+AD FP +KC+VLDLPHVV GLE TKNL YV GNM E 
Sbjct  192   HVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESTKNLGYVGGNMFEA  251

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA AV++K I+ +W+D++CV+ILK CKEAIP++E GGKVII+D    S Q      DD
Sbjct  252   IPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFCKSLQK----GDD  307

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
             D E I+TQ+F D+  MV   GR+R  K+W K+F++AGF DYK T  LGL S+I+++
Sbjct  308   DHEAIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  363



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 246/354 (69%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          K+++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ T Y ++FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK  +H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWTLHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQ+F D+ MM+   GRER   EW K+F  AGF+ YK T  LGL SLI+++P
Sbjct  305   -IETQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 256/358 (72%), Gaps = 16/358 (4%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E  EI+ AQ HI NH+FN++NS SLKCA+QL IPD+IH HG+P+TL  LV+ L INKAK 
Sbjct  10    ETREILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKG  69

Query  228   -DHLGRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              D + RLMR+L  +G FI+       +++GY L P S LL+K+ P S+ PF L    P  
Sbjct  70    QDCIYRLMRILIHSGFFIQTKINETEEEEGYLLTPNSRLLLKNEPLSLVPFVLAQLDPIL  129

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               P+Q +S+W  NDD TP+ TA+GK  ++   ++P  N+ FN+AMAS++ L++S+V K  
Sbjct  130   MDPFQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDARLMISVVIKTG  189

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
               +F+GL SLVDVGGG G VA+A+++ FP++KC+V DLPHVV GLEG+KNL YV G+M +
Sbjct  190   SGIFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGSKNLSYVGGDMFK  249

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +P A A++LK I+H+W+DEDCVKILK CKEAIP++EN GKVII+D+++ S +  +    
Sbjct  250   SVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVIIIDIVVDSQKGDNKS--  307

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                   +TQ+F+D+ MMV+  G+ER  +EW K+F DAGF+DYK    LGL S+I+++P
Sbjct  308   -----FETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVYP  360



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ T +G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVV  L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G T WD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD F  ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA AV+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  8     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  67

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  68    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  127

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ T +G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  128   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIIDDCK  187

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVV  L+G+KNL Y  G+M E 
Sbjct  188   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  247

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  248   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  301

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  302   -EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  346



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     QHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 241/347 (69%), Gaps = 13/347 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+W+DE+C+KIL+  + AI  +E  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIVDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQLG  1067
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T + 
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HI NHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMPDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F +      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAEKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S  F NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 247/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          K+++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TAY ++FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDL HVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+ AIP++E GGKVII+DMIM   Q           
Sbjct  251   AVAILLKWILHDWSDEECVKILKRCRGAIPSKEKGGKVIIIDMIMMKNQGDYKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  305   -IETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 239/344 (69%), Gaps = 13/344 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI DVI++HG  +TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT  1058
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKIT  343



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 239/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIFNFINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+K HP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKGHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ T +G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVV  L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+K+LK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKVLKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI D+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 247/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          K+++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TAY ++FWD    +P+ N+ FN+AMAS++ L+ S++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A+ FP + C+VLDL HVVAGL+G+KNL Y AG+M   IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFGAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W++E+CVKILK C+EAIP++ENGGKVII+DMIM   Q           
Sbjct  251   ADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKST-----  305

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   --ETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/363 (52%), Positives = 251/363 (69%), Gaps = 17/363 (5%)
 Frame = +3

Query  33    GMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAI  212
             G  +Q   E++ AQ+H+WNH+FNFINS SLKC +QLGIPD+I +HG+P+TL EL  +L +
Sbjct  5     GNGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHL  64

Query  213   NKAKADHLGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGAT  371
             N AK+  L RLMR++  +  FI       ++ DGY L P S LL++D P SM PFAL   
Sbjct  65    NDAKSPSLERLMRIMIHSKFFINVKISQVEETDGYWLTPASHLLLRDEPSSMRPFALVLL  124

Query  372   GPTFTGPWQHVSEWFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSL  548
              P    PW HVS+WF +D D TP+ T +G+TFW+  +QDP  N  FN+AMA +++LV S+
Sbjct  125   DPILIDPWHHVSKWFKSDHDLTPFLTTHGRTFWEYAAQDPRLNCFFNEAMACDTVLVASV  184

Query  549   VKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVA  728
             +   CR VFEGL S+VDVGGGTG VA+A+AD F  + C VLDLPHVVAG EGT+NLV+VA
Sbjct  185   ITGDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGTENLVFVA  244

Query  729   GNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNR  908
             G+M E IP A AV +K I+H+W DE C+KIL+ CK+A+ +++  GKVII+D+++   +  
Sbjct  245   GDMFEYIPSADAVFMKWILHDWPDEKCLKILEKCKQAVSDKDKKGKVIIVDIVVDFQKEH  304

Query  909   dddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQ  1085
                     + I+TQ+F D+ MM    GRER  K+W ++F  AGFT YK T  LGL SLI+
Sbjct  305   --------KAIETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVLGLRSLIE  356

Query  1086  LFP  1094
             LFP
Sbjct  357   LFP  359



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 244/354 (69%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G          ++++GY L   S LL+ D   S+ P  L    P  T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              ++S WF NDDPTP+ TAY   FWD    +P+ N+ FN+AMAS++ L+  ++ K    VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLLKEGXGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG VA+A+A  FP + C+VLDL HVVAGL+G+KNL Y AG+M E IPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q  D        
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDDKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              I+TQ+F D+ MM+   GRER   EW KIF DAGF+ YK T  LGL SLI+++P
Sbjct  305   -IETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLP VVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  G+VII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGEVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPI  345



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  8     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  67

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  68    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  127

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  128   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  187

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  188   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  247

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  248   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  301

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  302   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  346



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 239/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++  Q HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP ++ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLTLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ T +G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVV  L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 255/351 (73%), Gaps = 9/351 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE++ AQ HI NH+FN+INS SLKCA+QLGIPD+IH HG+ +T  +LV+ L INK+K 
Sbjct  102   ETNEVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSDLVNALPINKSKG  161

Query  228   -DHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHV  404
              D + RLMR+L   G F + ++GY L P S LL+K+ P S+APF      P    PW  +
Sbjct  162   HDCIYRLMRILIHAGFFTQGEEGYLLTPTSRLLLKNEPLSLAPFVQAQLDPVLMDPWHSL  221

Query  405   SEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGL  584
              EWF N+D TP+ TA+GK  ++    +   N+ FN+AM  ++ L+MS++ K  + VFEGL
Sbjct  222   GEWFANEDSTPFATAHGKPLFEYAGDEQRLNNLFNEAMGCDARLIMSVLIKNGKGVFEGL  281

Query  585   DSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQA  764
              SLVDVGGG G VA+A+++ FP++KCSV DLPHVV GLEG KNL Y+AG+M + +P A A
Sbjct  282   KSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGKNLTYIAGDMFKFVPSADA  341

Query  765   VVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             ++LK I+H+W+D+DCVKILK CKEAIP++ENGGKVI++D+++   Q RD+ +       +
Sbjct  342   ILLKWILHDWSDKDCVKILKKCKEAIPSKENGGKVIVIDIVI-DNQKRDNKS------FE  394

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+F+DV MMV+  G+ER  +EW K+F++AGF+DYK +  LGL S+I+++P
Sbjct  395   TQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSDYKISPILGLRSVIEVYP  445



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 239/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLPKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ T +G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVV  L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 252/354 (71%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA-DH  233
             EI+ AQ HI NH+FN+IN  SLKCA+QL IPD+IH HG+P+TL  LV+ L INKAK  D 
Sbjct  13    EILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  234   LGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             + RLMR+L  +G FI+      +++GY L P S LL+K+ P S+APF L    P    P+
Sbjct  73    IYRLMRILIHSGFFIQTKINENEEEGYLLTPNSHLLLKNEPLSLAPFVLAQLDPILMDPF  132

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
             Q +S+W  N D TP+ TA+GK  ++    +P  N+ FN+AMAS++ L++S+V K  R +F
Sbjct  133   QSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDARLMISVVIKNGRGIF  192

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL SL DVGGG G VA+A+++ FP++KC+V DLPHVV GLEG+  L YV G+M + +P 
Sbjct  193   EGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSNKLSYVGGDMFKSVPS  252

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DEDCVKILK CKEAIP++ENGGKVII+D+++ S +  +        
Sbjct  253   ADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVIIIDIVVDSQKGDNKS------  306

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F+D  MMV+  G+ER  +EWVK+F DAGF+DYK    LGL SLI+++P
Sbjct  307   -FETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDYKIIPILGLRSLIEVYP  359



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   380 bits (977),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 241/347 (69%), Gaps = 13/347 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y+ G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+ NDE+C+KIL+  + AI  +E  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDRNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQLG  1067
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T + 
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 250/369 (68%), Gaps = 25/369 (7%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
              +Q   E++ AQ+H+WNH+FNFINS SLKC +QLGIPD+I +HG+P+TL EL  +L +N+
Sbjct  7     GIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLNE  66

Query  219   AKADHLGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
             AK+  L RLMR++  +  FI       ++ +GY L P S LL++D P S+ PFAL    P
Sbjct  67    AKSPSLERLMRIMIHSKFFINVKISHVEETEGYWLTPASHLLLRDEPLSVRPFALSMLDP  126

Query  378   TFTGPWQHVSEWFHND---------DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNS  530
               T PW HVSEWF  D         D TP+ T +G+T W+   QDP  N  FN+ MAS+S
Sbjct  127   ILTDPWHHVSEWFKTDVSEWFKTDGDLTPFLTTHGRTLWEYAGQDPRLNGLFNEGMASDS  186

Query  531   LLVMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK  710
              LV +++ K CR VFEGL S+VDVGGGTG VA+A+AD F  + C VLDLPHVVAG EGT 
Sbjct  187   KLVATVITKDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGTA  246

Query  711   NLVYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIM  890
             NLV+VAG+M E IPPA AV +K I+H+W DE C+KIL+ CK+AI +++  GKVII+DM++
Sbjct  247   NLVFVAGDMFEYIPPADAVFMKWILHDWPDEKCLKILEKCKQAISDKDKEGKVIIVDMVV  306

Query  891   GSTQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LG  1067
                +          + I+TQ+F D+ +M    GR+R  K+W ++F+ AGFT YK T  LG
Sbjct  307   DFQKEH--------KAIETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVLG  358

Query  1068  LMSLIQLFP  1094
             L SLI+LFP
Sbjct  359   LRSLIELFP  367



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 256/355 (72%), Gaps = 15/355 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMRVL ++  F        ++++GY L   S LL+KD   S+ PF L    PT T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASXLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+ +T WD    +P+ N+  N+AMAS++ LV S++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVKEGKGV  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEXIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+W+DE+CVKILK C+EAIP++E GGKVII+DM+M + +          
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKNQKGDXKSR----  305

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                +TQ+F D+ MMV   G+ER+ KEW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   ---ETQLFFDMLMMVXVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SL DVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 240/347 (69%), Gaps = 13/347 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKGKLCKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+W+DE+C+KIL+  + AI  +E  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQLG  1067
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAG +DYK T + 
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGLSDYKITPIS  346



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +  F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+L+ I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLRWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GGRER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGRERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 246/351 (70%), Gaps = 9/351 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE++ AQ HI NH+ N++NS SLKCA+QLGIPD+IH HG+ +T  +LV+ L INK+K 
Sbjct  10    ETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKSKG  69

Query  228   -DHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHV  404
              + + RLMR+L     FI+ +DGY L P S LL+K+ P S+APF      P    PW  +
Sbjct  70    HECIYRLMRILIHASFFIEGEDGYLLTPTSRLLLKNEPLSLAPFVQAQLDPILMDPWHSL  129

Query  405   SEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGL  584
              EWF N D TP+ TA+GK  +D    DP  N  FN+AM S++ L+MS + K  + VFEGL
Sbjct  130   GEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSALIKNGKRVFEGL  189

Query  585   DSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQA  764
              SLVDVGGG G VA+A+++ FP++KCSV DLPHVV GLEG  NL Y+ G+M + +P A A
Sbjct  190   TSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITGDMFKSVPSADA  249

Query  765   VVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             ++LK I+H+W+D+DC KILK CKEAIP++ENGGKVI++D ++ + +  D          +
Sbjct  250   ILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGDDKS-------FE  302

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             +Q+F DV MMV+  G+ER  +EW K+F+DAGF+DYK +  LGL S+I+++P
Sbjct  303   SQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G  FWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +P A  V+LK I+H+WNDE+CVKILK  +EAI +++  GKVII+DM+M + +        
Sbjct  247   VPLADTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 260/359 (72%), Gaps = 23/359 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL +LV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMRVL ++  F        ++++GY L   S LL+KD   S+ PF L    PT T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+ +T WD    +P+ N+ FN+AMAS++ LV S++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGV  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+SLVDVGGGTG VA+A+A+ FP +KC+VLDLPHVVAGL+G+KNL Y AG+M E IP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIM----GSTQNRdddn  920
             PA A++LK I+H+W+DE+CVKILK C+EAIP++E GGKVII+DM++    G  ++R    
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKGDCKSR----  305

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    +TQ+F D+ MMV   G+ER+ KEW K+F +AGF+ YK T  LGL SLI+++P
Sbjct  306   -------ETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 242/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+W+D++C+KIL+  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWSDQECIKILRRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   379 bits (974),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 185/369 (50%), Positives = 252/369 (68%), Gaps = 23/369 (6%)
 Frame = +3

Query  33    GMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAI  212
             G   Q+ N+++ AQ HIWNHIFNFINS SLKCA+QLGIPD I++HG+P+TL +L+  L+I
Sbjct  7     GTRSQDHNQLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSI  66

Query  213   NKAKADHLGRLMRVLTRTGIFIKDD--------DGYALGPPSCLLIKDHPFSMAPFALGA  368
             + AK   + RL+R+L  +G   K+         +GY L   S LL+K+HPFS+  F L  
Sbjct  67    HPAKTHAIPRLVRILVHSGFLDKEKTEENSQETEGYVLTNASKLLVKEHPFSLKTFLLAM  126

Query  369   TGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSL  548
               P  TGPW H++ WF NDDPTP+QT +G+  W     +PE N  FN+AMA ++ +V S+
Sbjct  127   LDPVLTGPWDHLTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASI  186

Query  549   VKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVA  728
             + K C  VF+GL SLVDVGGGTG VA+ALAD FP + C V DLPHVVAGL+   NL +V 
Sbjct  187   LIKECEGVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDGDNLKFVG  246

Query  729   GNMLEVIPPAQAVVLKM------IMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIM  890
             G+M E IPPA A++LK       IMH+W+DE C+KILKNCKEAI  R+ GGK+II+DM+M
Sbjct  247   GDMFEEIPPADAILLKACYYIYWIMHDWHDEKCIKILKNCKEAIKGRK-GGKLIIIDMVM  305

Query  891   GSTQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LG  1067
              + +          +  +T++F D+ M+V + G+ER  KEW K+F DAGF+D+K T  LG
Sbjct  306   ETQKED-------KDATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKITPVLG  358

Query  1068  LMSLIQLFP  1094
             L S+++++P
Sbjct  359   LRSVVEVYP  367



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 241/346 (70%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +P A  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPLADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+DYK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 259/359 (72%), Gaps = 23/359 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMRVL ++  F        ++++GY L   S LL+KD   S+ PF L    PT T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+ +T WD    +P+ N+ FN+AMAS++ LV S++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGV  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIM----GSTQNRdddn  920
             PA A++LK I+H+W+DE+CVKILK C+EAIP++E GGKVII+DM++    G  ++R    
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKGDCKSR----  305

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    +TQ+F D+ MMV   G+ER+ KEW K+F +AGF+ YK T  LGL SLI+++P
Sbjct  306   -------ETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 258/359 (72%), Gaps = 23/359 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMRVL ++  F        ++++GY L   S LL+KD   S+ PF L    PT T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASQLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+ +T WD    +P+ N+  N+AMAS++ LV S++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVKEGKGV  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEPIP  249

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIM----GSTQNRdddn  920
             PA A++LK I+H+W+DE+CVKILK C+EAIP++E GGKVII+DM+M    G  ++R    
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKNQKGDCKSR----  305

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    +TQ+F D+ MMV   G+ER+ KEW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  306   -------ETQLFFDMLMMVLVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/361 (52%), Positives = 250/361 (69%), Gaps = 13/361 (4%)
 Frame = +3

Query  30    IGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             +G  ++  +E++ AQ  IWNH F+FINS SLKCAVQL IPDVI +HGQP+TL ELV  L 
Sbjct  1     MGSDVRASHELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSALP  60

Query  210   INKAKADHLGRLMRVLTRTGIFIKD-----DDGYALGPPSCLLIKDHPFSMAPFALGATG  374
             I+  KA  + RL+R+L  +G F  +     + GY L   S LL+KD+P S  PF L    
Sbjct  61    ISPTKAHFIPRLIRILVHSGFFASESLNGGEQGYVLTDASALLLKDNPMSARPFLLAMLN  120

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P  T PWQ+++ WF ND+PTP+  A+G TFWD  +QD    H FN+AMAS++ L+ SL+ 
Sbjct  121   PILTDPWQYLTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISSLMI  180

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
               C+ VF+G+DSLVDVGGGTG VA+++A  FP MKC+VLDLPHVVA L+G+ NL YVAG+
Sbjct  181   DDCKGVFQGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSNNLEYVAGD  240

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M E IP A A+ LK I+H+W+DE+CVKIL+ CKEAI      GKVII+DM   + +N+  
Sbjct  241   MFEAIPGADAIFLKWILHDWSDEECVKILERCKEAITRDGKKGKVIIVDM---TVENK--  295

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
               + D E  +TQ+F D+ MMV   G+ER  KEW  +F+DAGF+ YK T  LGL SLI+++
Sbjct  296   --NTDKESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGLGLRSLIEVY  353

Query  1092  P  1094
             P
Sbjct  354   P  354



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/359 (53%), Positives = 259/359 (72%), Gaps = 23/359 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL +LV  L ++  K  +
Sbjct  3     SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  62

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMRVL ++  F        ++++GY L   S LL+KD   S+ PF L    PT T P
Sbjct  63    VYRLMRVLVQSDFFAAPRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  122

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+ +T WD    +P+ N+ FN+AMAS++ LV S++ K  + V
Sbjct  123   WHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLVKEGKGV  182

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+SLVDVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG+M E IP
Sbjct  183   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIP  242

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIM----GSTQNRdddn  920
             PA A++LK I+H+W+DE+CVKILK C+EAIP++E GGKVII+DM++    G  ++R    
Sbjct  243   PADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKGDCKSR----  298

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    +TQ+F D+ MMV   G+ER+ KEW K+F +AGF+ YK T  LGL SLI+++P
Sbjct  299   -------ETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  350



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 248/350 (71%), Gaps = 21/350 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E+  AQ HIWNH+FNFINS SLKCA+QLGIPD+IH+HGQP+ L +L+D L IN AKA  +
Sbjct  12    ELFQAQAHIWNHLFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAHFV  71

Query  237   GRLMRVLTRTGIFIK----DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHV  404
              RLMR+L  +G FIK    D++G+                + PF L    P  T PW H 
Sbjct  72    YRLMRILIHSGFFIKAKMPDNEGHE--------------GVTPFLLAMLDPILTDPWHHF  117

Query  405   SEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGL  584
             S+WF +++ TP+ + +G + W+   + P  N  FN+ MAS++ LV ++V K C++VF GL
Sbjct  118   SQWFQDNEETPFHSCHGTSMWELAGRQPRLNQFFNEGMASDARLVCTMVIKNCKDVFMGL  177

Query  585   DSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQA  764
             +SL+DVGGGTG VA+A+AD FP +KCSVLDLPHVV G E +KNL YV G+M E IPP+ A
Sbjct  178   NSLIDVGGGTGTVAKAIADAFPHLKCSVLDLPHVVDGSESSKNLAYVGGDMFEAIPPSDA  237

Query  765   VVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             V+LK I+H+W+DE+CV+IL+ CKEAIP++E GGKVII+DM++ S QN   D+DD+ E I+
Sbjct  238   VLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVIIIDMLLKSRQN--GDDDDNAEAIE  295

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
             TQ+F D+ MMV   GRER  K+W K+F +AGF  YK T  LGL S+I+++
Sbjct  296   TQLFFDMLMMVLVKGRERNEKDWAKLFFEAGFNGYKITPVLGLRSIIEVY  345



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 240/346 (69%), Gaps = 13/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +  F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  67    SHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG +A+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WND++C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  300

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM   GG+ER  KEW K+F DAGF+ YK T +
Sbjct  301   -EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSGYKITPI  345



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   377 bits (967),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 246/359 (69%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+LGIPD+I++HG+P+TL ELV  L IN +K   +
Sbjct  11    ELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPSKTRCV  70

Query  237   GRLMRVLTRTGIFIK-----------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              RLMR+L  +G F +           ++ GY L   S LL+KD+P S+ PF      P  
Sbjct  71    YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  130

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW  +S WF NDDPTP+ TA+GK+FW+    +P+ N+ FN+AMAS++ L  S+V   C
Sbjct  131   LSPWLKLSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATSVVIHKC  190

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGT-KNLVYVAGNML  740
             ++VFEGL+SLVDVGGGTG VA+A+A  FP+++C+  DLPHVV GLE    NL YV G++ 
Sbjct  191   KDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDVF  250

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AV+ K I+H+WNDE+CVKIL+ CKEAI +    GKVII+DM+  + +      
Sbjct  251   EAIPPADAVLFKWILHDWNDEECVKILQKCKEAITSDVKKGKVIIIDMMRENKKGD----  306

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                 E I+TQ+F D+ MMV   G ER  KEW K+F DAGF+DYK T  LGL SLI+++P
Sbjct  307   ---SESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  362



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 240/346 (69%), Gaps = 14/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  66    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  125

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF N+DPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  126   TPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  185

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD  P ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  186   GVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  245

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  246   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   -EESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 240/346 (69%), Gaps = 14/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FIN  SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  66    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  125

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF N+DPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  126   TPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  185

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  186   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  245

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  246   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   -EESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 239/346 (69%), Gaps = 14/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ P+      P  T
Sbjct  66    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  125

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  126   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  185

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SL DVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  186   GVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  245

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+C+KILK  + AI +++  GKVII+DM+M + +        
Sbjct  246   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD------  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ F D+ MM    G+ER  KEW K+F DAGF+DYK T +
Sbjct  300   -EESIETQPFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 239/346 (69%), Gaps = 14/346 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KDHP S+ PF      P  T
Sbjct  66    SPSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLMPFLTAMLDPVLT  125

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDDPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  126   TPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  185

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SL+DVGGG G VA+A+AD FP ++C+VLDLP+VVA L+G+KNL Y  G+M E 
Sbjct  186   GVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVADLQGSKNLKYTGGDMFEA  245

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  +EAI  ++  GKVII+DM+M + +        
Sbjct  246   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD------  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL  1064
              +E I+TQ+F D+ MM    G+ER  KEW K+F DAG +DYK T +
Sbjct  300   -EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGISDYKITPI  344



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 245/359 (68%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+LGIPD+I++HG+P+TL ELV  L IN +K   +
Sbjct  51    ELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTRCV  110

Query  237   GRLMRVLTRTGIFIK-----------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              RLMR+L  +G F +           ++ GY L   S LL+KD+P S+ PF      P  
Sbjct  111   YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  170

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW  +S WF NDDPTP+ TA+GK+ W+    +P+ N+ FN+AMAS++ L   +V   C
Sbjct  171   LSPWLKLSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLATRVVIHKC  230

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGT-KNLVYVAGNML  740
             ++VFEGL+SLVDVGGGTG VA+A+A  FP+++C+  DLPHVV GLE    NL Y+ G+M 
Sbjct  231   KDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYIGGDMF  290

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AV+ K I+H+WNDE+CVKILK CKEAI +    GKVII+DM+  + +      
Sbjct  291   EAIPPADAVLFKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENKKG-----  345

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               D E I+TQ+F D+ MMV   G ER  KEW K+F DAGF+DYK T  LGL SLI+++P
Sbjct  346   --DSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  402



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 255/358 (71%), Gaps = 14/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH H +P+TL ELV  L +   K
Sbjct  7     ERSSELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVRPNK  66

Query  225   ADHLGRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
                + RLMR+L  +G F K       D++GY L   S LL+KDHP S+ PF L       
Sbjct  67    TLCVHRLMRILVHSGFFTKQRVQESADEEGYVLANASRLLLKDHPLSITPFLLLLDP-DL  125

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW + S WF NDDPTP+ TA+G+T WD    +P FN+ FN+ MAS++ LV S++ K C
Sbjct  126   TEPWDYASAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLVKEC  185

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             +  FEGL+S VDVGGGTG VA+ + + FP +  +VLDLPHVVA L G+KNL Y+AG++ E
Sbjct  186   KGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLRGSKNLTYLAGDLFE  245

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              IPPA A++LK I+H+W+DE+C+KILK C+EAIP++E GGKV+I+DM   + QN+  D+D
Sbjct  246   AIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDM---AIQNKKGDDD  302

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             + +  ++TQ+F D+ MMV   GRER+ KEW K+F D+GF+ YK T  LGL SLI+++P
Sbjct  303   ESN--VETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  358



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 245/355 (69%), Gaps = 16/355 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTHIWNHIF+FINS SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  237   GRLMRVLTRTGIF-IKDDD-------GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
              RLMR++  +G F +++ D        Y L   S LL+K+HP S+ PF      P  T P
Sbjct  71    HRLMRIMIHSGFFSLQNHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNP  130

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W   S WF N DPTP++TA+GK FWD    DP+ NH FN AMAS++  V SLV + C+ V
Sbjct  131   WNQFSTWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGV  190

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             F GL+SLVDVGGGTG +A+A+A  FP ++C V DLPHVV+GL+G++NL YVAG+M E IP
Sbjct  191   FMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIP  250

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+WNDE+CV ILK CKEAI  +   GKVII+DM++ + +         D
Sbjct  251   PADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRD-------D  303

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             E ++TQ+F D+ MMV   G+ER  KEW K+ + AG+ +YK T  LGL SLI+++P
Sbjct  304   ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   371 bits (953),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 245/359 (68%), Gaps = 16/359 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ A  HIWNH FNF+ S SLKCA++LGIPD+IH HGQP+TL +LV  L I ++K
Sbjct  7     ESTNELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIPQSK  66

Query  225   ADHLGRLMRVLTRTGIF----IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + H+ RLM+VL ++G F    + D++GY L   S LL+K+HP +  P+ L    P  T P
Sbjct  67    SHHIHRLMQVLVQSGFFSLQKVSDENGYLLTQSSLLLVKEHPVTARPYVLAVLDPILTKP  126

Query  393   WQHVSEWFHNDD---PTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             W  +S WF N D    TP+  A+ + FWD  S +  FN  FN+AMAS+S +V  +V   C
Sbjct  127   WHFLSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQVVISNC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             +EVF+GL SLVDVGG TG + +A+A+ FP++KC+VLDLPHVVAGL+GTKNL Y+ GNM E
Sbjct  187   KEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKGTKNLNYIGGNMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG-GKVIILDMIMGSTQNRdddn  920
              IPPA A++LKMI H  +DEDC+K+LK CKEA+ N E G GKVII+D++M S        
Sbjct  247   FIPPADAILLKMICHILDDEDCLKLLKKCKEAVMNNEEGSGKVIIIDIVMESPN----WV  302

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             D   E IQ     D+ M+V   G+ER  K+W K+F DAGF++YK    LGL S+I++FP
Sbjct  303   DKATETIQ---LYDLEMLVLVSGQERNEKDWAKLFFDAGFSNYKINPVLGLRSIIEVFP  358



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 241/359 (67%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQTH+WNHIFNFINS +LKCA+QLGIPD+I +HG+P+TL ELV  L IN +K+  +
Sbjct  11    ELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRCV  70

Query  237   GRLMRVLTRTGIFIK-----------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              RLMR+L  TG F +           ++ GY L   S LL+KD+P S+ PF      P  
Sbjct  71    YRLMRILIHTGFFAQQKLISSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  130

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PWQ +  WF NDDPTP+ TA+GKT W+    +P+ N+ FN+AMAS++ L  S++   C
Sbjct  131   LSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMIHKC  190

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGT-KNLVYVAGNML  740
             ++VFEGL+SLVDVGGG G  A+A+A  FP ++C+  DLPHVV GL+    NL YV G+M 
Sbjct  191   KDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLKYVGGDMF  250

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E I PA AV+LK I+H+WNDE+CVKILK CKEAI +    GKVII+DMI  + +  D   
Sbjct  251   EAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENKKGDDKS-  309

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                   I+TQ+F D+ MMV   G ER  KEW K+F  AGF+DYK    LGL SLI+++P
Sbjct  310   ------IETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 241/354 (68%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTH+WNHI +FINS SLKC V LGIPD+IH HGQP++L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  237   GRLMRVLTRTGIFIKDDD-------GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR++ ++G F + +         YAL   S LL+K H  SM P+      P FT PW
Sbjct  71    HRLMRIMVQSGFFSQHNPTENELEVKYALTDSSLLLLKSHAMSMTPYLQAKLDPAFTNPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
                S WF ND PT ++ A+GK FW+    DP FN  FN AMAS++ LV S+V + C+ VF
Sbjct  131   NQFSNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVTSVVIEKCKGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG + +A++  FP ++C+V DLPHVV+GL+G++NL YV G+M E IPP
Sbjct  191   MGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CVKILK CKEAI  +   GKVII+DM++             DE
Sbjct  251   ADAILLKWILHDWSDEECVKILKKCKEAISRKGKEGKVIIIDMVVDKEMKD-------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MMV F G+ER  KEWVK+ + AGF +YK T  +G+ SLI+++P
Sbjct  304   SFETQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVMGIRSLIEIYP  357



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 241/359 (67%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQTH+WNHIFNFINS +LKCA+QLGIPD+I +HG+P+TL ELV  L IN +K+  +
Sbjct  11    ELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRCV  70

Query  237   GRLMRVLTRTGIFIK-----------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              RLMR+L  TG F +           ++ GY L   S LL+KD+P S+ PF      P  
Sbjct  71    YRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  130

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PWQ +  WF NDDPTP+ TA+GKT W+    +P+ N+ FN+AMAS++ L  S++   C
Sbjct  131   LSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMIHKC  190

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGT-KNLVYVAGNML  740
             ++VFEGL+SLVDVGGG G  A+A+A  FP ++C+  DLPHVV GL+    NL YV G+M 
Sbjct  191   KDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLKYVGGDMF  250

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E I PA AV+LK I+H+WNDE+CVKILK CKEAI +    GKVII+DMI  + +  D   
Sbjct  251   EAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENKKGDDKS-  309

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                   I+TQ+F D+ MMV   G ER  KEW K+F  AGF+DYK    LGL SLI+++P
Sbjct  310   ------IETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   368 bits (945),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 253/358 (71%), Gaps = 20/358 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + +++++GAQTH+WNHIF+FINS SLKCA++L IPD+IH++GQP+ L +L  +L+I+ +K
Sbjct  7     ERVSKLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A+ + RLMR+LT +G F    + +++   GY L   S LL+KD+P SM PF      PT 
Sbjct  67    ANCIYRLMRILTHSGFFSQHKVNENELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +  WF NDDP+P+QTA+G   WD   ++P  N  FN AMAS++ LV ++V + C
Sbjct  127   TQPWLQLPTWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIERC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + VF GL+SLVDVGGGTG +A A+A  FP ++C+V DLPHVVA L+G++NL YV G+M E
Sbjct  187   KGVFNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              IP A A++LK I+H+WNDE CVKILK CKEAI +     KVII+DM++ + +       
Sbjct  247   SIPSADAILLKWILHDWNDEQCVKILKKCKEAIKS-----KVIIIDMVVENEKG------  295

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              DDE I+TQ+F D+ +MV + G+ER  KEW K+    GF+DYK T  LGL SLI+++P
Sbjct  296   -DDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 242/359 (67%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+L IPD+I++HG+P+TL +LV  L IN +K   +
Sbjct  11    ELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPSKTRCV  70

Query  237   GRLMRVLTRTGIFIK-----------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              RLMR+L  +G F +           ++ GY L   S LL+KD P S+ PF      P  
Sbjct  71    YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFLQAMLDPIL  130

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW  +S WF +DDP P+ TA+GK+FW+    +P+ N+ FN+AMAS++ L   +V   C
Sbjct  131   LSPWLKLSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKC  190

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGT-KNLVYVAGNML  740
             ++VF+GL+SLVDVGGGTG VA+A+A  FP+++C+  DLPHVV GLE    NL YV G+M 
Sbjct  191   KDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMF  250

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AVVLK I+H+WNDE+CVKILK CKEAI +    GKVII+DM+  + +      
Sbjct  251   EAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENKKGN----  306

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                DE  +TQ+F D+ MMV   G ER  KEW K+F DAGF+DYK T  LGL SLI++ P
Sbjct  307   ---DESTETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITSILGLRSLIEVCP  362



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 237/344 (69%), Gaps = 18/344 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI DVI++HG  +TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHPTK  66

Query  225   ADHLGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             +  + RLMR+L  +G F K      D++GY L   S LL+KD P S+ PF          
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTNASQLLLKDDPLSLTPFLTA-----MN  121

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF N+DPTP+ TA+G TFWD  +  P   H FN AMAS++ LV S++   C+
Sbjct  122   KPWNYLSTWFQNNDPTPFDTAHGMTFWDYGNHQPSIAHFFNNAMASDARLVTSVIIDDCK  181

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL+SLVDVGGGTG VA+A+AD FP ++C+VLDLPHVVA L+G+KNL Y  G+M E 
Sbjct  182   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRGDMFEA  241

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             +PPA  V+LK I+H+WNDE+CVKILK  ++AI +++  GKVIILDM+M   Q R      
Sbjct  242   VPPADTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMM-ENQKR------  294

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT  1058
             D+E I+TQ+F D+ MM    G+ER  KEW K+F DAGF+DYK T
Sbjct  295   DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKIT  338



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 240/354 (68%), Gaps = 17/354 (5%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ H+WNH  NF+NS +LKCAV+LGIPD I+ HGQPITL ELV  L+IN  KA  L 
Sbjct  12    LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPIKAPCLH  71

Query  240   RLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQ  398
             RLMRVL  +G F +        +  Y+L   S  L+KD P S AP  L    P  T P  
Sbjct  72    RLMRVLVHSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVDPHLTNPCH  131

Query  399   HVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
              +S+WF N DPTP+ TAYGK FWD  + +P+FN+ FN+AMAS+S L+ S+V   C+EVF 
Sbjct  132   FLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVVGECKEVFR  191

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
             GL SL+DVGGGTG +A+ +A  FP +KC+V D PHVVA L+G +NL +V G++ E IPPA
Sbjct  192   GLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGDIFEAIPPA  251

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddE  935
              A++LK I+HNW+D +CVKILK CKEAI P ++ GGKVII+D++M + +         DE
Sbjct  252   DAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDIVMENNKG--------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYK-TTQLGLMSLIQLFP  1094
              ++ Q+F D+ MMV   G+ER  +EW  +F  AGF  YK T+ LG  SLI+++P
Sbjct  304   AVEAQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 245/357 (69%), Gaps = 15/357 (4%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             + NE++ AQ HIWNHIF+FINS SLK AVQLGIPD IH HG+PI+L +L+  L I+ AKA
Sbjct  7     DANELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALPIHPAKA  66

Query  228   DHLGRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
               + RLMR+L  +G F K       +++GY L   S LL+KD+P S+APF L    P   
Sbjct  67    RGIPRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASKLLLKDNPLSIAPFLLAMLDPILI  126

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW ++S WF NDD T + TA+G  FW+  + DP  N+ FN+AMAS++ LVM ++    +
Sbjct  127   KPWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMKVLIDEHK  186

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              +FEGL SLVDVGGGTG +A A+A  FP ++C+V DLPHVV GL+GT+NL YVAG+M E 
Sbjct  187   GLFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQGTENLKYVAGDMFEA  246

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IPPA AV+LK IMH W  E CVK+LK CKEAI  ++ GGK+II+D+++ S          
Sbjct  247   IPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIKGKK-GGKLIIVDLVLESQH------VT  299

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             D + ++TQ F D+ +M    G+E+  K+W K+F DAGF+DYK    LGL S+I+++P
Sbjct  300   DHQDVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDYKINPILGLRSVIEVYP  356



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 252/356 (71%), Gaps = 16/356 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKAD  230
             +E++ A+  IWN +F++INS SLKC  +LGIP +I++HG+P+TL EL++ L  +++AKAD
Sbjct  10    SELLEAEARIWNQVFSYINSMSLKCVTELGIPGIINKHGRPMTLTELMEALPGVDRAKAD  69

Query  231   HLGRLMRVLTRTGIFI------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             H+ RLMR +  +G F+       D+ GY L P S LL++DHP SM  F L         P
Sbjct  70    HVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFLLSQLDSVLCEP  129

Query  393   WQHVSEWFHN-DDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             WQH+S WF N +D T + T +G + W++  Q+P F H F+Q M +++ +V  ++ + CR+
Sbjct  130   WQHLSGWFRNIEDRTAFHTTHGMSLWEQKEQNPRFGHLFDQGMGNDTPMVADVIARDCRQ  189

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFEGL SLVDVGGGTG +A+A+A+ FP++ C+VLDL  +VAGLEGT+NL YV G+M E I
Sbjct  190   VFEGLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPIVAGLEGTRNLKYVEGDMFEYI  249

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PPA AV+LK I+H+W+DE+CV+ILK CKEAI + E GGKV+I++M++   QN D  +   
Sbjct  250   PPADAVLLKWILHDWSDEECVEILKRCKEAIKSNEKGGKVVIIEMVV-DDQNSDHKS---  305

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                ++TQ+  D+ MM   GG+ER  KEW K+F+DAGFT+YK +  LG+ S+I+++P
Sbjct  306   ---VETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNYKISPLLGIRSIIEVYP  358



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 240/354 (68%), Gaps = 17/354 (5%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ H+WNH  NF+NS +LKCAV+LGIPD I+ HGQPITL ELV  L+IN  KA  L 
Sbjct  12    LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPIKAPCLH  71

Query  240   RLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQ  398
             RLMRVL  +G F +        +  Y+L   S  L+KD P S AP  L    P  T P  
Sbjct  72    RLMRVLVXSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVDPHLTNPCH  131

Query  399   HVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
              +S+WF N DPTP+ TAYGK FWD  + +P+FN+ FN+AMAS+S L+ S+V   C+EVF 
Sbjct  132   FLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVVGECKEVFR  191

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
             GL SL+DVGGGTG +A+ +A  FP +KC+V D PHVVA L+G +NL +V G++ E IPPA
Sbjct  192   GLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGDIFEAIPPA  251

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddE  935
              A++LK I+HNW+D +CVKILK CKEAI P ++ GGKVII+D++M + +         DE
Sbjct  252   DAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDVVMENNKG--------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYK-TTQLGLMSLIQLFP  1094
              ++ Q+F D+ MMV   G+ER  +EW  +F  AGF  YK T+ LG  SLI+++P
Sbjct  304   AVEAQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 238/355 (67%), Gaps = 13/355 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ H+WN++FNFINS SLKCA+ LGIPDVI  HG+P+T+ ELV  L IN  KA  
Sbjct  15    HELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELVAALPINATKASS  74

Query  234   LGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L  +G F +        ++GY L   S LL+   P S+ PF      P  T P
Sbjct  75    IYRLMRILVHSGFFAQQKLGNNDQEEGYVLTHASRLLLNGDPLSVTPFLKAMLDPILTKP  134

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W  +  WF NDDPTP+ TA+G+TFWD    DP  +H FN+ MAS++ LV S++   C  V
Sbjct  135   WHFLGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDARLVSSILIHKCEGV  194

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             F+GL+S+VDVGGG G VA+A++D FP ++C+V DLP VVAGL+   NL YV G+M E +P
Sbjct  195   FQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQDRGNLKYVGGDMFEAVP  254

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
              A AV+LK I+H+WNDE+CVKILK CKEAI     GGK II+DM++    ++ +D     
Sbjct  255   AADAVLLKWILHDWNDEECVKILKRCKEAISRGGKGGKAIIIDMVLTEKNHKVNDAS---  311

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               I+TQ+F D+ MMV   G+ER  +EW  +F  AGF+DYK T  +GL SLI+++P
Sbjct  312   --IETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPIMGLRSLIEVYP  364



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   363 bits (932),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 245/353 (69%), Gaps = 14/353 (4%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ+HIWNHIFNFINS SLKC V LGIPD+IH +G+PI+L +L+  L I+ +K   + 
Sbjct  14    LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPIHPSKTCFIH  73

Query  240   RLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQ  398
             RLMR++T +  F    + +++    Y L   S LL+KD+P S+ PF      P  T PW 
Sbjct  74    RLMRIMTHSSFFSQYNVTENELEIEYMLTDASILLLKDNPMSVTPFVHAMLDPVLTNPWH  133

Query  399   HVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
               S W  NDDPT ++T +    W+ V+ D +F++ FN++MAS++ LV +L+ + CR VF 
Sbjct  134   QFSTWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLLIEKCRGVFN  193

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
             GL+SLVDVGGGTG +A+ALA  FP M+ SV DLPHVV GL+G++NL YV G+M + IPP 
Sbjct  194   GLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGSENLNYVGGDMFKEIPPT  253

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddEL  938
              A++LK I+H+WNDE+CVKILKNCK+AI  +   GKVI++DM++ S +         +E 
Sbjct  254   DAILLKWILHDWNDEECVKILKNCKDAISKKGKQGKVIVIDMVLESEKES------INES  307

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             ++TQ+F D+ MMV   G+ER  KEW+K+ + AGF+DYK T  LGL SLI+++P
Sbjct  308   VETQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSDYKITPILGLRSLIEIYP  360



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 242/355 (68%), Gaps = 16/355 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTHIWNHIF+FINS SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  237   GRLMRVLTRTGIFIKD--------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
              RLMR++  +G F +         +  Y L   S LL+K+HP S+ PF      P  T P
Sbjct  71    HRLMRIMIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNP  130

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W   S WF N DPTP++TA+G   WD    DP+ N+ FN AMAS++  V SLV + C+ V
Sbjct  131   WNQFSTWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVIEKCKGV  190

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             F GL+SLVDVGGGTG +A+A+A  FP ++C V DLPHVV+GL+G++NL YV+G+M E IP
Sbjct  191   FMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVSGDMFEAIP  250

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+WNDE+CV ILK CKEAI  +   GKVII+DM++ + +        DD
Sbjct  251   PADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKR-------DD  303

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
             E ++TQ+F D+ MMV   G+ER  KEW K+ + AG+ +YK T + GL SLI+++P
Sbjct  304   ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIYP  358



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 242/352 (69%), Gaps = 10/352 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + + E++ AQ H+ N + NF  S+SLKCA++LGIP+ I++HG+PITL ELV  L +N +K
Sbjct  5     ENLTELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPSK  64

Query  225   ADHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHV  404
             A H+ RLMR L++ G F+  D  YAL     LL+KD PF++       + P    PW  +
Sbjct  65    ASHIYRLMRFLSKAGFFVLQDQCYALTAAGRLLLKDDPFNLRALIFFMSDPVLVKPWNSL  124

Query  405   SEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGL  584
             +EWF NDDP P+ TA+GK FW   +++P F + FN+AMA++S  ++ ++   C+ VF+GL
Sbjct  125   TEWFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMMTRCKFVFDGL  184

Query  585   DSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQA  764
              SLVDVGGGTG VARA+A  FP+++C V DLPHV+A  EGT+NL +VAG+MLE +P A A
Sbjct  185   TSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEGTENLDFVAGDMLEKVPTADA  244

Query  765   VVLKM--IMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddEL  938
             ++LK    +H+W+DEDCVKILKNCKEAIP R  GG+VII+DMI+ S          DDE 
Sbjct  245   ILLKKPDSIHDWSDEDCVKILKNCKEAIPGRNKGGRVIIIDMILESQ-------IKDDES  297

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLF  1091
             ++TQ+  D+ M++    +ER  KEW K+F DAGF+ YK   + G+  LI+++
Sbjct  298   VETQVGMDMQMLMCHAAKERTEKEWAKLFRDAGFSYYKILPVFGVRCLIEVY  349



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 242/360 (67%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       I + D Y+L   + LL+KD+P+SM P  L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNDIHNQDAYSLTQSTRLLLKDNPWSMRPLLLVFLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD   +  A+  TFW+   QDP  N+ FN AMA +S+LV  +V   C
Sbjct  127   TKPWDCLSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSILVSKVVVCKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +F+G++SLVDVGGG G +A+ +A+ FP M C+V DLPHVV+ L+G+KNL YV G+M E
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAI--PNRENGGKVIILDMIMGSTQNRddd  917
              +PPA A++LK I+H+W+DEDCVKIL+ CK+AI    ++  GKVII+DM+  +    +  
Sbjct  247   AVPPADAILLKWILHDWSDEDCVKILRRCKQAIMSTGQQKAGKVIIIDMVRENLNGDEGS  306

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    I+TQ+  D+ +MV F G ER  KEW K+F DAGF +YK    LG  +LI+L+P
Sbjct  307   -------IETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   360 bits (923),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 233/347 (67%), Gaps = 35/347 (10%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHI NFI S SLKCA+QLGIPD+IH HG+P+TL E  +            
Sbjct  11    ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPEAGE------------  58

Query  237   GRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSEWF  416
                            +++GY L   S LL+ D   S+ P  L    P  T PW ++S WF
Sbjct  59    ---------------EEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPWHYLSAWF  103

Query  417   HNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDSLV  596
              NDDPTP+ TA+ + FWD    +P+ N+ FN+AMAS++ LV S++ K  + VFEGL+SLV
Sbjct  104   QNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEGLNSLV  163

Query  597   DVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAVVLK  776
             DVGGGTG VA+A+A+ FP + C+VLDLPHVVAGL+G+KNL Y AG++ E IPPA A++LK
Sbjct  164   DVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPPADAILLK  223

Query  777   MIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQTQIF  956
              I+H+W+DE+CVKILK C+EAIP++ENGGKVII+DMIM   Q            I+TQ+F
Sbjct  224   WILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKS-------IETQLF  276

Query  957   ADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              D+ MM+   GRER   EW K+F DAGF+ YK T  LGL SLI+++P
Sbjct  277   FDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  323



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   361 bits (926),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 247/361 (68%), Gaps = 18/361 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             ++  E++GAQ HIWN+IFNFINS SLKCAVQLGIPD IH+HG+P+TL +L+  L +++ K
Sbjct  20    EKATELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALPVHQNK  79

Query  225   ADHLGRLMRVLTRTGIFI---------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
             A ++ RLMR+L  +G F          ++++GY L   S LL+ D+P S+APF L    P
Sbjct  80    APYVYRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDASKLLVGDNPLSVAPFLLAMLDP  139

Query  378   TFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
               T PW  +S WF NDDPT + T  G  FW    Q+P+  + FN AMAS++ LV+S+V +
Sbjct  140   VLTKPWDFLSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVIE  199

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
              C+ VF+ L+S VDVGGGTG VA+A+A  FP M+C+V DLPHVV  L+G  NL +V G+M
Sbjct  200   NCKWVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQGKDNLKFVGGDM  259

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR-ENGGKVIILDMIMGSTQNRdd  914
              + +PPA A++LK I+H+W+D++CVKILK CKEAI ++    GKVII+D+++ +    D 
Sbjct  260   FQQVPPADAILLKWILHDWSDDECVKILKKCKEAITSKGSKKGKVIIIDIMIENKDEDDK  319

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
                      +TQ+F D+ MMV   G+ER  KEW K+F D+GF+DYK    LGL SLI+++
Sbjct  320   SY-------ETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILGLRSLIEVY  372

Query  1092  P  1094
             P
Sbjct  373   P  373



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   360 bits (925),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 250/356 (70%), Gaps = 17/356 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKADH  233
             E++ A+ HIWNH+FN+INS+SLKCA +LGIPDVIH+HG P+TL ELVD L  ++KAKAD 
Sbjct  11    ELLEAEAHIWNHVFNYINSTSLKCATELGIPDVIHKHGGPMTLLELVDALPGVDKAKADC  70

Query  234   LGRLMRVLTRTGIFI------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             + RLMR+L  +G F+       +++ Y+L P S LL+ D P SM P+ +    P    P 
Sbjct  71    MYRLMRILVHSGFFVLEKINSSNEEAYSLTPASRLLVGDLPMSMKPYVISQIDPILVEPM  130

Query  396   QHVSEWFHN-DDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
              H+S WF N ++ TP+QT   G +FW++  ++  F+H F+Q +AS++ +V  ++ + CR+
Sbjct  131   HHLSRWFQNANNHTPFQTINNGMSFWEQKERNLRFSHLFDQGVASDTPMVAHVITRDCRQ  190

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFEGLDSLVDVGGGTG +A+A+A+ FP + C+VLDL  VVAG++GTKNL Y+ GNM E I
Sbjct  191   VFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKNLKYIEGNMFEYI  250

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PP+ AV+LK I+H+W+DE  V+ILK CKEAI +    GKVI+++M++   ++        
Sbjct  251   PPSDAVLLKWILHDWSDEKSVEILKKCKEAITSNGKRGKVILIEMVVDDERSN-------  303

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              E ++TQ+  D+ MM   GG+ERK KEW K+F DAGF DY+    LGL S+I+++P
Sbjct  304   TESVETQLLFDMLMMTLVGGKERKEKEWAKLFYDAGFQDYRIYPVLGLRSIIEVYP  359



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/361 (48%), Positives = 249/361 (69%), Gaps = 18/361 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKA  221
             ++ +E + AQ HIWNH+ ++ NS SLKCA +LGIPD IH+HG P++L ELVD L  ++K 
Sbjct  7     EQSSEKLEAQAHIWNHVLSYTNSMSLKCATELGIPDAIHQHGGPMSLTELVDALPGVDKT  66

Query  222   KADHLGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPT  380
             KAD + RLMR+L  +G F+ +       ++GY+L   S LL+ DHPFSM P  +    P 
Sbjct  67    KADCVYRLMRILVHSGFFVLEKIDSSNYEEGYSLTSTSRLLVGDHPFSMKPLVICGLNPI  126

Query  381   FTGPWQHVSEWFHN-DDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
              T PW+ +  W  N +D TP+  A  G +FW+   ++P F+H  +Q MAS++ LV  ++ 
Sbjct  127   LTEPWRQLGRWLQNTEDHTPFHIANNGMSFWEYKERNPRFSHLLDQVMASDTPLVAGVIT  186

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             + CR+VFEGLDSLVDVGGGTG +A+ +A+ FP + C+VLDL  VVAGLEGT+NL YV G+
Sbjct  187   RDCRQVFEGLDSLVDVGGGTGTLAKVIAEGFPQIHCTVLDLAPVVAGLEGTRNLKYVEGD  246

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M E IPP+ AV+ K I+H+W+DE CV+ILK CKEA+   E  GKVII+DM++   +    
Sbjct  247   MFEFIPPSDAVLCKWILHDWSDEKCVQILKKCKEAVTRDEKKGKVIIIDMVIDDQK----  302

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYK-TTQLGLMSLIQLF  1091
                 D + ++T++F D+ MM   GGRER  KEW K+F+DAGF+DY+ ++ LGL S+I+++
Sbjct  303   ---CDHKSVETKLFFDMLMMTIVGGRERNEKEWAKLFSDAGFSDYRISSLLGLRSIIEVY  359

Query  1092  P  1094
             P
Sbjct  360   P  360



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/360 (50%), Positives = 245/360 (68%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQ+H+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGEMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       I + + Y+L   + LL+KD+P+S+ P  L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLLLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD   +  A+ KTFW+   QD   N+ FN+AMAS+S+L   LV   C
Sbjct  127   TKPWDCLSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDSILASKLVVSKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +F+G++SLVDVGGG G + + +A+ FP M C+V DLPHVV+ L+G KNL YV G+M E
Sbjct  187   KGIFDGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PPA A++LK I+H+W+DEDCVKILK CK+AI ++  +  GKVII+DM+    QNRD+ 
Sbjct  247   AVPPADALLLKWILHDWSDEDCVKILKRCKQAIASKGQQKVGKVIIIDMVR-ENQNRDEG  305

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             +      I+TQ+  D+ MMV   G ER  KEW K+F DAGF +YK    LG  +LI+L+P
Sbjct  306   S------IETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 238/354 (67%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTH+WNHIF+FINS SLKC V LGIPD+IH HGQP++L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  237   GRLMRVLTRTGIFIKDDD-------GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR++  +G F + +         YAL   S LL+K +  S+ PF      P  T PW
Sbjct  71    HRLMRIMVHSGFFSQHNPTENELELKYALTDSSLLLLKSNAMSVTPFLQAMLDPVMTNPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
                S WF N +PT ++   GK FW+  S DP FN  FN AMAS++ LV SLV + C+ VF
Sbjct  131   NQFSNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLVTSLVTEKCKGVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG++ +A+A  FP ++C+V DLPHVV+GL+G++NL YV G+M E IPP
Sbjct  191   MGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+CV ILK CKEA+  +   GKVII+DM++             DE
Sbjct  251   ADAILLKWILHDWSDEECVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKD-------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MMV   G+ER  KEWVK+F+ AGF +YK T  +G  SLI+++P
Sbjct  304   SFETQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFVGSRSLIEIYP  357



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 247/362 (68%), Gaps = 15/362 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAI--NKAKA  227
              E + AQ HIWN IFNFINS SLKCA+QLGIPD IH HG+P+TL +L+  L I  NK   
Sbjct  16    TEQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALPIHQNKKLD  75

Query  228   DHL-GRLMRVLTRTGIFI---------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
              HL  RLMR+L  +  F          + +DGY L   S LL++D+PFS+ P  L    P
Sbjct  76    SHLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVLTNSSKLLVRDNPFSLTPILLTVLDP  135

Query  378   TFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
               T PW  +S W  +DDPTP+ T +G  FWD   +DP F + FN+AMAS++ LV+S++  
Sbjct  136   IMTKPWHSISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDARLVVSVLFD  195

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
                 VFEGL+SLVD+ GGTG V +A+AD FP ++C+V DLPHV+A L+G+ NL +V G+M
Sbjct  196   KRISVFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGSTNLKFVGGDM  255

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNREN-GGKVIILDMIMGSTQ-NRd  911
              + IPPA A+ +K I+H+W+DEDCVK+LK CK AI  + N  GKVI++DM++   Q N+D
Sbjct  256   FDEIPPADAIFMKWILHDWSDEDCVKLLKRCKVAITCKGNKNGKVILVDMVIVEKQNNKD  315

Query  912   ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQL  1088
               +D D +L +TQI  D+ MMV+F GRERK  EW K+F+DAGF+ YK T  LG+ SLI++
Sbjct  316   IGHDHDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAGFSTYKITPILGVRSLIEV  375

Query  1089  FP  1094
             FP
Sbjct  376   FP  377



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 245/353 (69%), Gaps = 15/353 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ HIWNHIFNFINS SLK A+QLGIPD IH HG+PI+L +L+  L +  AKA  +
Sbjct  10    ELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVLPAKARCI  69

Query  237   GRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR+L  +G F    IK +D   G+ L   S LL+KD+P S+ PF L    P  T PW
Sbjct  70    PRLMRILVHSGFFANAKIKGNDEEEGFVLTSASKLLLKDNPLSVTPFLLAMLDPILTEPW  129

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              +VS WF NDD TP+ T +G  FW+    +P+FN+ FN+AMAS++ LVM ++    + VF
Sbjct  130   HYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLIDEYKGVF  189

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+SLVDVGGGTG +A A+A  FP + C V DLPHVVAGL+ + NL YV GNM E +PP
Sbjct  190   EGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSANLKYVGGNMFEGVPP  249

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+C+KIL+  KEAI  ++ GGK+II+DM+  + Q        DD+
Sbjct  250   ADAILLKWIIHDWSDEECLKILQRSKEAIKGKK-GGKLIIIDMVSENQQ------VIDDQ  302

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
              ++TQ+F D+ MM    G+ER  KEW K+F DAGF++YK T  LGL S+I+++
Sbjct  303   YVETQLFYDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  355



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 244/354 (69%), Gaps = 11/354 (3%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++ + E++ AQTH+WN +F+F  S+ LKCAV+LGIPDVI  HG+PITL +L+  L I+ +
Sbjct  4     VENLGELIEAQTHVWNAMFHFKKSACLKCAVELGIPDVIRNHGKPITLSDLISVLPIHPS  63

Query  222   KADHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQH  401
             K+ H+ RLMR L  +G F+++  GYAL     LL+KD PF++      +  P    PW  
Sbjct  64    KSAHIFRLMRFLANSGFFVENPQGYALTSAGRLLLKDEPFNVRAHIFLSCDPAMLKPWNF  123

Query  402   VSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEG  581
             +++WF NDDP+P+ TAYG  FW   +Q+  F   FN+AMAS++ L + ++   C+ VFEG
Sbjct  124   LTKWFQNDDPSPFDTAYGNNFWHYNAQEVRFGKMFNEAMASDNQLSVEVLMTKCKFVFEG  183

Query  582   LDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQ  761
             L +L DVGGGTG V RA+A  FP++KC+V DLPHVVA  EG +NL ++AG+M + +P A 
Sbjct  184   LTTLADVGGGTGKVDRAIAQNFPNIKCTVYDLPHVVANQEGAENLEFLAGDMFQSVPRAN  243

Query  762   AVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGST-QNRdddnddddEL  938
             A++LK I+H+W+DEDC+KILKNCK+AIP ++NGGKVII+D +MGS  Q++          
Sbjct  244   AILLKRILHDWSDEDCLKILKNCKKAIPEKDNGGKVIIIDGVMGSQIQDKTS--------  295

Query  939   IQTQIFADVHMMVNFG-GRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              +T+   D+ M+V  G  +ER  KEW K+F+DAGF+ YK    LG+  LI+++P
Sbjct  296   FETEFSMDMQMLVMLGPAKERTEKEWSKLFSDAGFSSYKVYPVLGMRCLIEVYP  349



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 241/353 (68%), Gaps = 16/353 (5%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ HIWN IF+FIN  SLKCAVQLGIPD+I +HG P++L +L+  L I+  K++ + 
Sbjct  12    LLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISALPIHPKKSNCVY  71

Query  240   RLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQ  398
             RLMR+L  +G F +       +++GY L   S LL+KD P S  PF LGA  P  T PW 
Sbjct  72    RLMRILVHSGFFCRQKLSELDEEEGYVLTDASRLLLKDDPLSARPFLLGALDPFMTKPWH  131

Query  399   HVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
             + S WF NDDPT   TA+G TFWD    +P  +H FN AMAS++ L+  +V    + VFE
Sbjct  132   YFSTWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISKVVSNEYKGVFE  191

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
             GL+SLVDVGGG G + +A+AD FP ++C V DLPHVVA L+G++NL +  G+M E IPP 
Sbjct  192   GLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLKGSENLKFFGGDMFEAIPPT  251

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddEL  938
              A+++K I+H+W+DE+C+KIL+  KEAI  +E  GKVII+DM+M    +        D+ 
Sbjct  252   DAILMKWILHDWSDEECIKILQRSKEAITRKEKKGKVIIVDMVMKQKGD--------DQS  303

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
             I+TQ+F D+ MMV F G+ER  KEW K+F+DAGF+DYK T + GL  LI+++P
Sbjct  304   IETQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDYKITPICGLRYLIEVYP  356



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 238/359 (66%), Gaps = 18/359 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQ H W H  NF+NS  LKCA+QLGIPDVIH HGQP+ L +L+  L++   K
Sbjct  8     ERATELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPTK  67

Query  225   ADHLGRLMRVLTRTGIFIK--------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPT  380
             A  L RLMRVL  +G F +        +++GY+L   S  L+KD P S  PF L    P 
Sbjct  68    APCLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDPI  127

Query  381   FTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
              T PW  + +WF N+DPTP+ TA+ K+FWD    +P+ N  FN+ M S+S L+ +++ + 
Sbjct  128   LTAPWHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIVRQ  187

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
              +EVFEGL SLVDVGGGTG + +A+A  FP +KC V D PHVVA LE  +NL  V GN+ 
Sbjct  188   YKEVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVGENLEIVGGNIF  247

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA A++LK I+H+W+DE+CVKILK CK AIPN+  GGKVII+DM++ S +      
Sbjct  248   EAIPPADAILLKWILHDWSDEECVKILKKCKGAIPNK--GGKVIIIDMVVESNKGD----  301

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
                ++ ++TQ+F D+ MMV   G+ER  KEW K+F  AGFT YK T  LGL SLI+++P
Sbjct  302   ---NKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 241/355 (68%), Gaps = 16/355 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTHIWNHIF+FINS SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  237   GRLMRVLTRTGIFIKD--------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
              RLMR++  +G F +         D  Y L   S LL+K+HP S+ PF      P  T P
Sbjct  71    HRLMRIMIHSGFFSQQNHDMENQLDAKYVLTDASVLLLKNHPMSVTPFLHAMLDPILTNP  130

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W   S WF N D TP++TA+G   WD    DP+ N+ FN AMAS++  V SLV + C+ +
Sbjct  131   WNQFSTWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVTSLVIEKCKGM  190

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             F GL+SLVDVGGGTG +A+A+A  FP ++C V DLPHVV+GL+G++NL YVAG+M E IP
Sbjct  191   FMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIP  250

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA A++LK I+H+WND++CV ILK CKEAI  +   GKVII+DM++ + +        DD
Sbjct  251   PADAILLKWILHDWNDKECVDILKKCKEAITRKGKEGKVIIIDMVVENEKR-------DD  303

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             E ++TQ+F D+ MMV   G+ER  KEW K+ + AG+ +YK T  LGL SLI+++P
Sbjct  304   ESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 249/356 (70%), Gaps = 16/356 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKAD  230
             +E++ A  HIWN +F++INS SLKC  +LGIP++IH+HG+P+TL +L++ L  +++AKAD
Sbjct  110   SELLEAGAHIWNQVFSYINSMSLKCVTELGIPEIIHKHGRPMTLTQLMEALPGVDRAKAD  169

Query  231   HLGRLMRVLTRTGIFI------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             H+ RLMR +  +G F+       D+ GY L P S LL++DHP SM  F L   G     P
Sbjct  170   HVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFVLSQLGSVLCEP  229

Query  393   WQHVSEWFHN-DDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             WQH+S WF N +D T + T +G + W+   Q+P F H F++ M +++ +V  ++ + CR+
Sbjct  230   WQHLSGWFRNTEDRTSFHTTHGMSLWELKEQNPSFGHLFDRGMENDATIVADVITRDCRQ  289

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFEGL SLVDVGGGTG VA+A+A+ FP + C+VLDL  V+AGLEGT+NL YV G+M E I
Sbjct  290   VFEGLGSLVDVGGGTGTVAKAIAEVFPQIHCTVLDLAPVIAGLEGTRNLKYVEGDMFEYI  349

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PPA AV+LK ++H+WNDE+CV+ILK CKEAI + E  GKV+I++M++   QN D  +   
Sbjct  350   PPADAVLLKWLLHDWNDEECVEILKRCKEAIKSNEKRGKVVIIEMVV-DDQNSDHKS---  405

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                ++TQ+F D  +M    GRER  KEW K+F DAGF++YK +  LGL S+I+++P
Sbjct  406   ---VETQLFFDTLVMTIADGRERSQKEWAKLFFDAGFSNYKISPLLGLRSIIEVYP  458



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   358 bits (920),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 242/359 (67%), Gaps = 17/359 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + + E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  13    ESVGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  72

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       + + + Y+L   + LL+KD+P++M P  L       
Sbjct  73    AQYVHRLMRILVHSGFFSQQNLNGVHNQEAYSLTQSTRLLLKDNPWNMRPLLLFELDSVL  132

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF ND+ T +  A+  TFW+   QDP   + FN+AMAS+S+L   LV   C
Sbjct  133   TKPWDCLSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDSILASKLVVSKC  192

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +FEGL SLVDVGGG G +A+ +A+ FP M C+V DLPHVV+ L+G KNL YV G+M +
Sbjct  193   KGIFEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGCKNLKYVGGDMFQ  252

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PPA+A++LK I+H+W+DEDCVKIL+ C++AI ++  +  GKVII+DM+  +    +  
Sbjct  253   AVPPAEAILLKWILHDWSDEDCVKILRRCRQAIMSKGQQKAGKVIIIDMVRENLNGDEGS  312

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
                    I+TQ+F D+ MMV   G ER  KEW K+F DAGF +YK    LG  +LI+L+
Sbjct  313   -------IETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELY  364



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 236/354 (67%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTH+WNHI +FINS SLKC V LGIPD+IH HGQP++L  L+ +L I+ +K   +
Sbjct  11    KLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  237   GRLMRVLTRTGIFIKDDD-------GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMR++  +G F + +         YAL   S LL+K +  S+ PF      P  T PW
Sbjct  71    HRLMRIMVHSGFFSQHNHTENELEVKYALTDSSLLLLKSNAMSVTPFLQAMLDPVLTTPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
                + WF N +PT ++ A GK FW+    DP  N  FN AMAS++ LV S+V + C+ VF
Sbjct  131   NQFANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTSVVIEKCKRVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG + +A+A  FP ++C+V DLPHVV+GL+G++NL YV G+M E IPP
Sbjct  191   MGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDMFEAIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DED V ILK CKEA+  +   GKVII+DM++             DE
Sbjct  251   ADAILLKWILHDWSDEDSVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKD-------DE  303

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +TQ+F D+ MMV F G+ER  KEWVK+F+ AGF +YK T  +GL SLI+++P
Sbjct  304   SFETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVVGLRSLIEIYP  357



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 242/360 (67%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       + + + Y+L   + LL+KD+P+S+    L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD T +  A+ K  W+ V QDP  N+  N+ MA +S+L   LV   C
Sbjct  127   TKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +FEG+ SLVDVGGG G +A+ + + FP M C+VLDLPHVV+ L+G KNL YVAG+M +
Sbjct  187   KGIFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKYVAGDMFQ  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PPA+A++LK ++HNW+DEDCVKILK CK+AI ++  +  GKVII+DM+  +    +  
Sbjct  247   AVPPAEAILLKWMLHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVRENLNGDEGS  306

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKT-TQLGLMSLIQLFP  1094
                    I+TQ+F D+ MMV  GG ER  KEW K+F DAGF +YK    LG  +LI+L+P
Sbjct  307   -------IETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 236/335 (70%), Gaps = 14/335 (4%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLMRVLTRTGIFIK-----  281
             S+KCA+QLGIPDVIH+HGQP+TL++L+D L I  AKA  + RLM++L  +G FI+     
Sbjct  2     SVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPG  61

Query  282   ----DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSEWFHNDDPTPYQTA  449
                 +  GY L   S LL+K +PFSM PF L    PT T PW H+S+WF N D TP+ T 
Sbjct  62    NENDNQKGYLLTSASELLLKSNPFSMTPFLLAILDPTLTDPWHHLSQWFQNSDETPFYTC  121

Query  450   YGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDSLVDVGGGTGMVAR  629
             +G++ +   S +P  N  FN+AMAS++ LV  +V K C+ VFEGL+SLVDVGGGTG  A+
Sbjct  122   HGRSIYAFASHEPWLNQFFNEAMASDTRLVSRVVTKDCKHVFEGLNSLVDVGGGTGTFAK  181

Query  630   ALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAVVLKMIMHNWNDEDC  809
             A+AD FP +KC+VLDLPHVV GLE +KNL YV GNM E IPPA AV++K I+ +W+D++C
Sbjct  182   AIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDDEC  241

Query  810   VKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQTQIFADVHMMVNFGG  989
             V+ILK CKEAIP++E GGKVII++M   S Q      DDD E I+TQ+  D+ +M    G
Sbjct  242   VQILKKCKEAIPSKEKGGKVIIVEMFCKSQQK----GDDDHEAIETQLCYDMEVMALGKG  297

Query  990   RERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
             R+   K+W K+F++AGF DYK T  LGL S+I+++
Sbjct  298   RQINEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  332



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/359 (50%), Positives = 234/359 (65%), Gaps = 20/359 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+L IPD+I++HG+P TL +LV  L IN +K   +
Sbjct  11    ELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPSKTRCV  70

Query  237   GRLMRVLTRTGIFIK-----------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              RLMR+L  +G F +           ++ GY L   S LL+KD P S+ P       P  
Sbjct  71    YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAVLDPIL  130

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW  +S WF +DDP P+   +GK+FW+    +P+ N+ FN+AMAS++ L   +V   C
Sbjct  131   LSPWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKC  190

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGT-KNLVYVAGNML  740
             + VFEGL+SLVDVGG TG VA+A+A  FP+++C+  DLPHVV GLE    NL YV G+M 
Sbjct  191   KNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMF  250

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AVVLK I+H+WNDE+CVKILK CKEAI +    GKVII+DM+  + +      
Sbjct  251   EAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKVIIIDMMRENKKGD----  306

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                DE  +TQ+F  + MMV   G ER  KEW K+  D GF+DYK T  LGL SLI+++P
Sbjct  307   ---DESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITSILGLRSLIEVYP  362



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/359 (51%), Positives = 246/359 (69%), Gaps = 17/359 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
              +  E++ AQ +IWNHIFNFINS SLK A+QLGIPD IH HG+PI+L  L+  L I+ AK
Sbjct  6     HDAQELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALPIHPAK  65

Query  225   ADHLGRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A  + RLMR+L  +G F K       + +GY L   S LL+KD+PFS+ PF L       
Sbjct  66    ARCIPRLMRILIHSGFFAKAKLKENDEAEGYVLTKASKLLLKDNPFSVTPFLLAMLDRIL  125

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW ++S WF NDD T + TA+G  FW+    +P+ N+ FN+AMAS++ LVM ++    
Sbjct  126   TEPWHYLSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMRVLIDEY  185

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + VFEGL SLVDVGGGTG +A+A+A  FP + C V DLPHVVAGL G++NL YVAG+M E
Sbjct  186   KGVFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGLAGSENLKYVAGDMFE  245

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIP-NRENGGKVIILDMIMGSTQNRdddn  920
              +PPA A++LK IMH W+DE+C+K+LK  KEAI  N+E  GK+II+DM++ + Q      
Sbjct  246   GVPPADAILLKWIMHVWSDEECLKLLKLSKEAIKGNKE--GKLIIIDMVLENRQ------  297

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               D + I++Q+F D+ MM    G++R  KEW K+F DAGF+DYK T  LGL S+I+++P
Sbjct  298   VTDHQSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPILGLRSVIEVYP  356



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 241/356 (68%), Gaps = 13/356 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   +++ AQT ++N IF+FINS SLKCA++L IPD+IH +GQPI L +L+ +L I+ +K
Sbjct  41    EHATKLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNYGQPIPLSQLISSLPIHPSK  100

Query  225   ADHLGRLMRVLTRTGIFIKDDDG----YALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             +  + RLMRVLT +  FI   +     Y L   S LL+KDHPFSM        GP  + P
Sbjct  101   SGDIDRLMRVLTHSNFFIVTKNELEVMYELTDASRLLLKDHPFSMTSMLHVILGPIMSKP  160

Query  393   WQHVSEWFHNDDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             W  +S W+ N+DP+P+ T   G  FWD    DPEFNH FN+AMA  + +  ++V   C+ 
Sbjct  161   WHQLSNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLFNEAMACETRMASTVVMGKCKG  220

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VF+GL+SLVDVGGG G +++A+A  FP+++C V DLPHVV GL+G++N  YVAG+M E I
Sbjct  221   VFQGLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQGSENFKYVAGDMFESI  280

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PP Q+++LK ++H+WNDE+C+KILK CKEAI ++   GKVII+D +MG+ +        D
Sbjct  281   PPTQSILLKGVLHDWNDEECLKILKKCKEAIKSKGKEGKVIIIDAVMGNEK-------AD  333

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             +E  + Q+F D+ MMV   G+ER  KEW K+F  AGF +YK T  LG  SLI++FP
Sbjct  334   NESFEAQLFYDLEMMVLVNGKERNEKEWSKLFFSAGFNNYKITHGLGFKSLIEVFP  389



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 246/368 (67%), Gaps = 21/368 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK---  224
              E+V +Q HIWN IFNFINS SLKCA+QLGIPD I+ HG+P+ L +L+ +L I++ K   
Sbjct  17    TELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLPIHQNKRPD  76

Query  225   ADHLGRLMRVLTRTGIFIKDD----------DGYALGPPSCLLIKDHPFSMAPFALGATG  374
             +  + RLMR+L  +G F  ++          +GY L   S LL++D+P S+ PF L    
Sbjct  77    SRLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDNPLSVTPFLLSMLD  136

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P  T PW  +S W  +DDPTP+ T +GK FWD    DP   + FN+AMAS++ LV S+V 
Sbjct  137   PIMTKPWHSISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDARLVTSVVI  196

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             + C+ +FEGL+SLVD+ GGTG VA+A+A  FP + C+V DLPHV+A L+G+KNL +V G+
Sbjct  197   EKCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVGGD  256

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNREN-GGKVIILDMIMGSTQNRd  911
             M + IPPA A+ +K I+H+W+DEDCVK+L+ CK AI  + N  GKVI++DM++   QN  
Sbjct  257   MFDEIPPADAIFVKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQNNK  316

Query  912   ------ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGL  1070
                     +D D +  +TQ+F D+ MMV   GRERK  EW K+F DAGF+ YK T  LG+
Sbjct  317   DIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGRERKETEWAKLFFDAGFSTYKITPILGV  376

Query  1071  MSLIQLFP  1094
              SLI++FP
Sbjct  377   RSLIEVFP  384



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/361 (49%), Positives = 247/361 (68%), Gaps = 19/361 (5%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN----  215
             E  +++ AQ HIWNHIFN+INS SLKCA+QL IPD+IH HG+P+ L +L + L IN    
Sbjct  11    ETRQVLAAQAHIWNHIFNYINSMSLKCAIQLEIPDIIHSHGRPMNLSDLAEALPINNNHD  70

Query  216   KAKA-DHLGRLMRVLTRTGIFIKD-DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
             KAK  D + RLMR+L   G FI++ ++GY L P S LL+KD P SM PF      P    
Sbjct  71    KAKTHDCVYRLMRILVHAGFFIQEAEEGYLLTPTSRLLLKDEPMSMIPFLNFQLDPNLMD  130

Query  390   PWQHVSEWFHN--DDP--TPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMS-LVK  554
             PW  +S+WF+N  DD   TPY TA+G  F+     +P  NH FN+AMAS++ LVM+ L++
Sbjct  131   PWHSLSKWFNNVSDDSNTTPYATAHGMPFFKYAENEPRLNHLFNEAMASDTRLVMTVLIQ  190

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
                  +FEGL SLVDVGGGTG +A+A+AD FP + C+V +LPHV+ GL+G+KNL +V G+
Sbjct  191   NGKGLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLKGSKNLSFVGGD  250

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M   IP A A++LK I+H+W+D DC+KILK CKEAIP++ENGGKVI+++++M   ++ D 
Sbjct  251   MFNSIPSANAILLKWILHDWSDGDCIKILKKCKEAIPSKENGGKVILIEIVMDQNKDDDK  310

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
                      +TQ+  D+ MM+   G+ER  +EW K+F DAG++DYK    LGL  +I+++
Sbjct  311   SY-------ETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDYKIIPILGLRCVIEVY  363

Query  1092  P  1094
             P
Sbjct  364   P  364



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 244/358 (68%), Gaps = 14/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
              + + ++ AQ+HIWNHIFNFINS SLKC V LGIPD+IH +G+P++L +L+  L I+ +K
Sbjct  8     HDASNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPIHPSK  67

Query  225   ADHLGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
                + RLMR++T +G F +        +  Y L   S LL+KD+P +M  F      P  
Sbjct  68    TFFIYRLMRIMTHSGFFSQHNISENELETEYVLTDTSLLLLKDNPMNMRSFVHLVFDPVL  127

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S W  NDDPT ++T +G  FWD   ++ + N+ FN AMAS++ LV S+V + C
Sbjct  128   TKPWHQLSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVVIEKC  187

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             +EVF GL+SLVDVGGGTG +A+ALA  FP ++C+V DLPHVV GL+GT NL YV G+M +
Sbjct  188   KEVFNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQGTDNLKYVGGDMFK  247

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              IPPA A++LK I+H+WND++CVKILK CKE++  + N GKVII+DM++ + +       
Sbjct  248   EIPPADAILLKWILHDWNDDECVKILKKCKESLLKKGNEGKVIIIDMVLDTKKGD-----  302

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               +E  +TQ+F D+ M V   G+ER  KEW+K+ + AGF+DYK    LGL SLI+++P
Sbjct  303   -INESGKTQLFFDMLMTVLVKGKERNDKEWIKLISLAGFSDYKIIPILGLRSLIEVYP  359



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 248/370 (67%), Gaps = 21/370 (6%)
 Frame = +3

Query  30    IGMALQEMN--EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDT  203
             I + L E N  EI+GAQ HIWN IFNFINS SLKCA+QLGIPD+I+ HG+P+T+ +L   
Sbjct  14    IDLILNEENSTEILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLA  73

Query  204   LAINKAKADHLGRLMRVLTRTGIF-----------IKDDDGYALGPPSCLLIKDHPFSMA  350
             L IN+ K+  + RLMR+L  +G F             +++GY +   S LL+KD+P S+ 
Sbjct  74    LPINRKKSPCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDNPMSVT  133

Query  351   PFALGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNS  530
             PF L    P  T PW  +S WF N DPTP+ TA G  FWD  S +P+    FN AMAS++
Sbjct  134   PFLLAMLDPVMTKPWDFLSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDA  193

Query  531   LLVMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK  710
              LV S+V + C+ VFEG++SLVDVGGGTG VA ++A  FP ++C+V DLPHVVA L+G  
Sbjct  194   RLVTSVVIEKCKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGN  253

Query  711   NLVYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIP-NRENGGKVIILDMI  887
             NL +V G+M   +P  + V+LK I+H+WNDE+ VKILK CKEAI  + + GGKVII+DM 
Sbjct  254   NLNFVGGDMFVDVPATEVVLLKWILHDWNDEESVKILKKCKEAISKSNKKGGKVIIIDMK  313

Query  888   MGSTQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-L  1064
             + + ++       DDE  +TQ+F D+ MM    GRER  KEW K+F DAGF++YK T  L
Sbjct  314   VENEKDE------DDESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNYKITPIL  367

Query  1065  GLMSLIQLFP  1094
             GL SLI+++P
Sbjct  368   GLRSLIEVYP  377



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 242/360 (67%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       + + + Y+L   + LL+KD+P+S+    L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD T +  A+ K  W+ V QDP  N+  N+ MA +S+L   LV   C
Sbjct  127   TKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +FEG+ SLVDVGGG G +A+ + + FP M C+VLDLPHVV+ L+G KNL +VAG+M +
Sbjct  187   KGIFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKFVAGDMFQ  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PPA+A++LK I+HNW+DEDCVKILK CK+AI ++  +  GKVII+DM+  +    +  
Sbjct  247   AVPPAEAILLKWILHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVRENLNGDEGS  306

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    I+TQ+F D+ MMV  GG ER  KEW K+F DAGF +YK    LG  +LI+L+P
Sbjct  307   -------IETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVLGPRALIELYP  359



>ref|XP_011092041.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=355

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 249/366 (68%), Gaps = 22/366 (6%)
 Frame = +3

Query  30    IGMALQEMN-EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL  206
             + M  Q+ N E++ A+ HIWN +FN+INS+SLKCA +LGIPDVIH+HG P+TL EL+D L
Sbjct  1     MAMVNQKQNLEVLEAEAHIWNQVFNYINSTSLKCATELGIPDVIHKHGGPMTLTELLDAL  60

Query  207   -AINKAKADHLGRLMRVLTRTGIFI------KDDDGYALGPPSCLLIKDHPFSMAPFALG  365
              A++KAKA+ + RLMR L  +G F+       +++GY+L P   LL+ D P SM PF + 
Sbjct  61    PAVDKAKANCMYRLMRTLVHSGFFVLEKLNSSNEEGYSLTPAPRLLVGDRPMSMKPFVIS  120

Query  366   ATGPTFTGPWQHVSEWFHND-DPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLV  539
                P  T    H+  WF    D T + TA  G +FW++  ++P F+H F+Q M S++ +V
Sbjct  121   QIDPILTESMHHLGRWFQTTHDRTTFHTANNGTSFWEQKERNPRFSHLFDQGMESDTPMV  180

Query  540   MSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLV  719
              S++ + CR+VFEGLDS+VDVGGGTG +A+A+A+ FP + C+VLDLPH+VAGLEG +NL 
Sbjct  181   ASVITRDCRQVFEGLDSVVDVGGGTGTLAKAIAEAFPQIHCTVLDLPHIVAGLEGRRNLK  240

Query  720   YVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGST  899
             Y+ GNM + IPP+ AVVLK ++H+W+DE+ VKILK CKEA+ +    GKVII++M++   
Sbjct  241   YIEGNMFDYIPPSDAVVLKWLLHDWSDEESVKILKKCKEAVTSNGKRGKVIIIEMVVKEN  300

Query  900   QNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMS  1076
             ++           ++TQ+  D+ MM  F G+ER  KEW  + +DAGF+ Y+    L L S
Sbjct  301   ES-----------VETQLLLDMLMMATFKGKERTEKEWADLISDAGFSGYRIYPVLPLRS  349

Query  1077  LIQLFP  1094
             +I+++P
Sbjct  350   IIEIYP  355



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 247/353 (70%), Gaps = 15/353 (4%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ+HIWNHIFNFINS SLKC V LGIPD+IH +G+PI+L +L+  L I+ +K   + 
Sbjct  13    LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLPIHPSKTIFIY  72

Query  240   RLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQ  398
             RLMR++T +G F +        +  Y L   S LL+ D+P S+APF      P  T PW 
Sbjct  73    RLMRIMTHSGFFSQQNITENELETEYMLTDTSLLLLSDNPMSVAPFVHAMLDPVLTNPWH  132

Query  399   HVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
              +S W  N DPT ++T +G  FWD   ++P+FN+ FN AMAS++ LV S+V + C+EVF 
Sbjct  133   QLSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSSVVIEKCKEVFN  192

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
             GL+S+VDVGGG G +A+ALA  FP ++C+VLDLPHVVAGL+ T+NL YV G+M + IP A
Sbjct  193   GLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQETENLKYVGGDMFKEIPSA  252

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddEL  938
              A++LK I+H+WND++CVKILKNCK+AI  +   GKVII+DM+M + + +       +E 
Sbjct  253   DAILLKWILHDWNDDECVKILKNCKDAIAKKGKEGKVIIIDMVMENEKGK-------NES  305

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             +QTQ+F D+ MMV   G+ER  KEWV + + +GF++YK T  LGL S+I+++P
Sbjct  306   LQTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPILGLRSVIEIYP  358



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 239/359 (67%), Gaps = 16/359 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQ  + NH+FNF+NS +LKCA+ L IPDVIH HGQP+ L +LV  L++  +K
Sbjct  7     ERADELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALSVQPSK  66

Query  225   ADHLGRLMRVLTRTGIFIKD--------DDGYALGPPSCLLIKDHPFSMAPFALGATGPT  380
             A  L RLMR+L  +G F +         ++GY+L   S  L+KD P +  P +L    P 
Sbjct  67    APCLHRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLSLLHLNPV  126

Query  381   FTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
              T PW  +S WF N DPTP+ TA+GK +WD  +Q+P+FN  FN+AMAS+S ++ S++   
Sbjct  127   LTAPWHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLITK  186

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
             C+E F+GL SLVDVG GTG + +A+A  FP +KC V D PHVVA L+G  NL  V G+M 
Sbjct  187   CKEQFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGGNLEVVGGDMF  246

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IP A AV+LK I+HNW+DE+CVKILK CKEAIP ++ GGK++I+DM+M + +      
Sbjct  247   ETIPSANAVILKWILHNWSDEECVKILKKCKEAIPTKDKGGKLMIIDMVMENNKGD----  302

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                D+ ++TQ+F D+ MM    G++R   EW K+F  AGFT YK +  LG  SLI+++P
Sbjct  303   ---DQAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHYKISAVLGFRSLIEVYP  358



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/360 (48%), Positives = 243/360 (68%), Gaps = 19/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  AQTH++  +FN++NS SL CA QLGIPD+IH HG+PITL ELV  L I   K
Sbjct  22    QKATELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGRPITLPELVSALHIPPNK  81

Query  225   ADHLGRLMRVLTRTGIFIKD---------DDGYALGPPSCLLIKDHPFSMAPFALGATGP  377
             +  + RLMR+L  +G F            ++ Y L PPS LL+KD+   ++PF +    P
Sbjct  82    SSCIYRLMRMLVHSGFFATTKAVIGQGGGEEAYVLTPPSQLLVKDNTNCLSPF-MSLINP  140

Query  378   TFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
              F  PW  + +WF   +PT +Q AYG  FW+  +Q+PE N  FN AMA +S + M+LV +
Sbjct  141   AFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNGLFNAAMACDSQM-MNLVIR  199

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
              C+ +FEGLDS+VDVGGGTG +AR +++ FP M C+VL++P V+A LEGT+NL YV G+M
Sbjct  200   DCKPIFEGLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLEGTENLKYVGGDM  259

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRddd  917
              + IP A AV+LK+I H W+DEDCVKILK CKEAI ++E GGKVII+D+++   ++    
Sbjct  260   FQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVINEKKDE---  316

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
                  EL +T++  D+ MMV   G+ER ++EW ++F +AGF+ YK T L GL SLI+++P
Sbjct  317   ----HELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIEVYP  372



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 242/361 (67%), Gaps = 20/361 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  AQTH++  +FN++NS SL CA QLGIPD+IH HG PITL ELV  L I   K
Sbjct  22    QKETELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGSPITLPELVSALHIPPNK  81

Query  225   ADHLGRLMRVLTRTGIFIK----------DDDGYALGPPSCLLIKDHPFSMAPFALGATG  374
                + RLMR+L  +G F            +++ Y L PPS LL+KD+   ++PF +    
Sbjct  82    TSCIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  140

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P F  PW  + +WF   +PT +Q AYG  FW+  +Q+PE N  FN AMA +S + M+LV 
Sbjct  141   PAFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNCLFNAAMACDSQM-MNLVI  199

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             + C+ +FEGLDS+VDVGGGTG +AR +++ FP MKC+VL+ P V+A LEGT+NL YV G+
Sbjct  200   RDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLEGTENLKYVGGD  259

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M + IP A AV+LK+I H W+DEDCVKILK CKEAI ++E GGKVII+D+++   ++   
Sbjct  260   MFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVINKKKDE--  317

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLF  1091
                   EL +T++  D+ MMV   G+ER ++EW ++F +AGF+ YK T L GL SLI+++
Sbjct  318   -----HELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIEVY  372

Query  1092  P  1094
             P
Sbjct  373   P  373



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 243/358 (68%), Gaps = 20/358 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + +++++ AQTH+WNHIF+F+NS SLKCA+ L IPD+IH++G+ +   +L  +L++N +K
Sbjct  7     ERVSKLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSK  66

Query  225   ADHLGRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A+ + RLMR+LT +G F    + ++D   GY L   S LL+KD+P SM PF      P  
Sbjct  67    ANCIYRLMRILTHSGFFSQLQVNENDLEMGYVLTDASTLLLKDNPLSMLPFFHAMLDPIL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +  WF NDDPTP+ TA+    WD   +DP+ N  FN AMAS++ LV ++V + C
Sbjct  127   TKPWHQLPTWFRNDDPTPFHTAHEMKIWDYAGRDPKLNQLFNDAMASDAQLVSNVVIERC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
               VF+GL+SLVDVGGGTG++A+A+A  FP + C+V DLPHVVA L+G +NL YV G+M E
Sbjct  187   SGVFKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKGCENLKYVGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +PPA AV+LK I+H+WNDE CVKILK CKE I       KVI++DM++ S +       
Sbjct  247   SVPPADAVLLKWILHDWNDEQCVKILKKCKEGIKR-----KVIVIDMVVESEEE------  295

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              D E  +T++  D+ +MV + G+ER  KEW KI   AGF+DYK T  +GL S I+++P
Sbjct  296   -DFESTETKLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVVGLRSFIEIYP  352



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 241/356 (68%), Gaps = 13/356 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNH+FNFINS +LKCAV+LGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIFIKDD---DGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             A ++ RLMR+L  +G F + +   + Y+L   + LL+KD+P+SM    L    P  T P 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLKQEAYSLTQSTRLLLKDNPWSMRTLLLFVLDPVLTKPH  126

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               +S WF ND+ + +  A+  TFW+   QDP  N+ FN AMAS+S+L   +V   C+ +F
Sbjct  127   DCLSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSILASKVVVSKCKGIF  186

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EG++SLVDVGGG G +A+ + + FP M C+V DLPHVV+ L+G+KNL YV G+M + +PP
Sbjct  187   EGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMFQAVPP  246

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRdddnddd  929
             A A++LK+I+H W DEDCVKIL+ CK+AI ++  +  GKVII+DM+  +    +      
Sbjct  247   ADAILLKLILHCWRDEDCVKILRRCKQAIMSKGQQKAGKVIIIDMVRENLNGDEGS----  302

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKT-TQLGLMSLIQLFP  1094
                I+TQ+F D+ +MV   G ER  KEW K+F DAGF +YK  + LG  +LI+L+P
Sbjct  303   ---IETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  355



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 236/352 (67%), Gaps = 13/352 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQT ++NHIF+FINS SLKCA++L IPDVIH +GQPI L +L+  L I+ +K   +
Sbjct  11    KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  70

Query  237   GRLMRVLTRTGIF-IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHV  404
              RLMRVLT +G F +  +D    Y L   S LL+KDHPFSM        GP  + PW  +
Sbjct  71    HRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKPWYQL  130

Query  405   SEWFHNDDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEG  581
             S W+ NDDP+P+ T   G  FWD    DP  N+ FN+AMA  + L  S+V   C+ VFEG
Sbjct  131   SNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKCKGVFEG  190

Query  582   LDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQ  761
             L+SLVDVGGG G + + +A  FP+++C V DLPHVV GL+G++NL YV G+M E IPP  
Sbjct  191   LESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFEAIPPTH  250

Query  762   AVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELI  941
             +++LK ++H+WNDE+C+KILK CKEAI N+   GKVII+D +MG+ +         +E I
Sbjct  251   SILLKGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEKED-------NESI  303

Query  942   QTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             + Q+F D+ MMV   G+ER  KEW  +F  AGF++YK T  LG  SLI++FP
Sbjct  304   EAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  355



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 182/360 (51%), Positives = 242/360 (67%), Gaps = 19/360 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQTH+WNHIFNFINS SLKCA+QLGIPD+IH H QP+TL ELV  L +   K   
Sbjct  10    SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L  +G F         D++GY L   S LL+KDHP S  PF L    P  T P
Sbjct  70    VHRLMRILVHSGFFTMQRVQESADEEGYXLANASRLLLKDHPLSATPFLLAMLDPDLTEP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W +VS WF NDDPTP+ TA+G+T WD    +P FN+ FN+AMAS++ LV S++ K C+  
Sbjct  130   WHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGA  189

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNL-----VYVAGNM  737
             FEGL+S VDVGGGTG VA+ +   FP +  +VLDLPHVVA L+G K L      YV GN 
Sbjct  190   FEGLNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQGXKXLDLPRRGYVRGNS  249

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRddd  917
                    + +  + I+H+W+DE+C+KILK C+ AIP++E GGKV+I+DM + + +     
Sbjct  250   SCGCHFTEGIT-QWILHDWSDEECLKILKQCRXAIPSKEKGGKVMIIDMAIXNKKG----  304

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              DDD+  ++TQ+F D+ MMV   GRER+ KEW K+F D+GF+ YK T  LGL SLI+++P
Sbjct  305   -DDDESXVETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  363



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/368 (48%), Positives = 242/368 (66%), Gaps = 21/368 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN---KAK  224
              E+V AQ HIWN+IFNFINS SLKCAVQLGIPD IH HG+P+TL +L+  L I+   K+ 
Sbjct  17    TELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSD  76

Query  225   ADHLGRLMRVLTRTGIFIKDD----------DGYALGPPSCLLIKDHPFSMAPFALGATG  374
             +  + RLMR+L  +G F+  +          +GY L   S LL++D+P S+ P  L    
Sbjct  77    SRLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDNPLSVTPLLLSMLD  136

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P  T PW  +S W  +DDPTP+   +G   WD    DP   + FN+AMAS++ LV S++ 
Sbjct  137   PIMTKPWHSLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDARLVTSVLI  196

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
               C+ V EGL+SLVD+ GGTG VA+A+A  FP + C+V DLPHV+A L+G+KNL +V G+
Sbjct  197   DKCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVGGD  256

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNREN-GGKVIILDMIMGSTQNRd  911
             M + IPPA A+ +K I+H+W+DEDCVK+L+ CK AI  + N  GKVI++DM++   QN  
Sbjct  257   MFDEIPPADAIFMKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQNNK  316

Query  912   ------ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGL  1070
                     +D D +  +TQ+F D+ MMV + GRERK  EW K+F+DAGF  YK T  LG+
Sbjct  317   DIGHDHHAHDHDHQSYETQLFFDMLMMVLYPGRERKETEWAKLFSDAGFNTYKITPILGV  376

Query  1071  MSLIQLFP  1094
              SLI++FP
Sbjct  377   RSLIEVFP  384



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   350 bits (899),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 238/357 (67%), Gaps = 19/357 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQTHI++  F FINS SLKCA+ L IPDVIH++GQP+ L +L+ +L I+ +KA  +
Sbjct  11    KLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASLPIHPSKACFI  70

Query  237   GRLMRVLTRTGIFIKDDDG----------YALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
              RLM++LT +G F + ++           Y L   S LL+KDH FSM         P   
Sbjct  71    FRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLLKDHHFSMISLPQVILDPILV  130

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
              PW   S WF N+DPTP+ T  G  FWD  S +P+ NH FN AM ++S L+ S++ + C+
Sbjct  131   NPWFQFSTWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRLISSVLIEKCK  190

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VF GL+SLVDVGGGTG +A+A+A  FP +KC V DLPHVV GL+GT+N+ YV G+M E 
Sbjct  191   GVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQGTENVEYVHGDMFEA  250

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IP A +++LK IMHNWNDE+C+KILK CKEAI N++  GKVII+D+++G+ +        
Sbjct  251   IPSADSIMLKTIMHNWNDEECLKILKRCKEAIANKDK-GKVIIIDVVIGNEKGD------  303

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               EL QT++F D+ MMV   G+ER  K+W K+F  AGF  YK T  LG  SLI+++P
Sbjct  304   -SELDQTKLFYDIEMMVLVTGKERNEKDWAKLFLSAGFNSYKITPVLGFKSLIEVYP  359



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   350 bits (898),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/354 (47%), Positives = 248/354 (70%), Gaps = 15/354 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQ+HIWNHI ++INS SLKC V LGIPD+IH +G+P+ L +L+ +L I+ +KA ++
Sbjct  11    KLLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLPIHSSKAGNI  70

Query  237   GRLMRVLTRTGIF----IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
              RLMRV+  +G F    I +++    Y L   S LL+K HPFS+ PF L +  P    PW
Sbjct  71    PRLMRVMIHSGFFSQHNITENELEVEYTLTDDSILLLKGHPFSILPFLLCSNDPILKKPW  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
              H+S WF NDD TP++TA+G   WD  ++DP+ N+  N++MA ++ L+  +  + C+++ 
Sbjct  131   HHLSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGVFIEKCKDML  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
              GL+SLVDVGGGTG +ARA+A  FP +KC+V DLPHVVA L+G++NL Y+ G+M + IPP
Sbjct  191   NGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQGSENLEYIGGDMFKEIPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddE  935
             A A++LK I+H+W+DE+C+KILKNCKEAI ++   GKVII+DM++   +  D        
Sbjct  251   ADAILLKWILHDWSDEECLKILKNCKEAIKSKGKEGKVIIIDMVIEEDKGDDKS------  304

Query  936   LIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              ++TQ+  D+ MMV   G+ER +KEW  + + AGF+DYK +  LGL S+++++P
Sbjct  305   -VETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVLGLRSVVEIYP  357



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/363 (49%), Positives = 248/363 (68%), Gaps = 23/363 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKA  221
             +  +E++ AQ HIWN +F++INS SLKCA +LGIPD+IH+HG+P+TL ELVD L   +K 
Sbjct  208   ERSSELLEAQAHIWNQVFSYINSMSLKCATELGIPDIIHKHGRPMTLTELVDALPGADKP  267

Query  222   KADHLGRLMRVLTRTGIFIKDD------DGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             KAD + RLMR+L  +G F+ +       + Y+L P S LLI DH  SM  + L    P  
Sbjct  268   KADCVYRLMRILVHSGFFVLEKIDSCNKEAYSLTPASRLLIGDHTMSMKAYVLSQLDPIL  327

Query  384   TGPWQHVSEWFHNDDPTPYQTAY-----GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSL  548
             T PWQH+S WF N   T Y TA+     G + W++  ++P F+H F+Q MA ++ +V   
Sbjct  328   TEPWQHLSRWFQN---TEYHTAFHTANNGTSIWEQKERNPRFSHLFDQGMACDTPMVADA  384

Query  549   VKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVA  728
             + + CR+VFEGLDS+VDVGGGTG +A+A+A+ FP + C VL+L  V+AGL+GT+NL YV 
Sbjct  385   ITRDCRQVFEGLDSIVDVGGGTGTLAKAIAEAFPQIHCLVLELAPVIAGLQGTRNLEYVE  444

Query  729   GNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNR  908
             G+M E IPPA AVVLK I+H+W+DE+CV ILK CK AI +    GKV+I++M++   QN 
Sbjct  445   GDMFEYIPPADAVVLKWILHDWSDEECVGILKKCKAAITSNGKRGKVVIIEMVLDD-QN-  502

Query  909   dddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQ  1085
                   D + ++TQ+F D+ MM    GRERK  EW K+F+DAGFT+YK +  LGL S+I+
Sbjct  503   -----ADHKSVETQLFIDMLMMTILRGRERKEIEWAKLFSDAGFTNYKISPILGLRSIIE  557

Query  1086  LFP  1094
             ++P
Sbjct  558   VYP  560



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/359 (48%), Positives = 236/359 (66%), Gaps = 19/359 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ +Q H+WN+IF+F+NS SLKCA+QLGIPD+IH H +P+TL +L+  L I+  K   
Sbjct  14    DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQIHPTKTQC  73

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L  +G F        + ++GY L   S LL+KDHP S+APF L    P  T P
Sbjct  74    VYRLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKP  133

Query  393   WQHVSEWFHNDDPTP----YQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
             W  VS W  NDD       +   +G  FWD   ++   NH FN+ MAS++ L  S +   
Sbjct  134   WHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIHK  193

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
             C++VFEGL++LVDVGGGTG +A A+A +FP ++C+V D PHVVA L+   NL YV GNM 
Sbjct  194   CKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNMF  253

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AV++K ++HNWNDE+CVKILKNCK+AI      GKVII+D+ M S +      
Sbjct  254   EAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEK------  307

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               D +  +TQ+F D+ MMV   G ER  KEW K+F +AGF+DYK T  LG+ SLI+++P
Sbjct  308   -ADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 237/353 (67%), Gaps = 14/353 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             +++ AQT ++NHIF+FINS SLKCA++L IPDVIH +GQPI L +L+  L I+ +K   +
Sbjct  25    KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  84

Query  237   GRLMRVLTRTGIF-IKDDD---GYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHV  404
              RLMRVLT +G F +  +D    Y L   S LL+KDHPFSM        GP  + PW  +
Sbjct  85    HRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKPWYQL  144

Query  405   SEWFHNDDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEG  581
             S W+ NDDP+P+ T   G  FWD    DP  N+ FN+AMA  + L  S+V   C+ VFEG
Sbjct  145   SNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKCKGVFEG  204

Query  582   LDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQ  761
             L+SLVDVGGG G + + +A  FP+++C V DLPHVV GL+G++NL YV G+M E IPP  
Sbjct  205   LESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFEAIPPTH  264

Query  762   AVVLKM-IMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddEL  938
             +++LK+ ++H+WNDE+C+KILK CKEAI N+   GKVII+D +MG+ +         +E 
Sbjct  265   SILLKVGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEKED-------NES  317

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             I+ Q+F D+ MMV   G+ER  KEW  +F  AGF++YK T  LG  SLI++FP
Sbjct  318   IEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  370



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/359 (48%), Positives = 236/359 (66%), Gaps = 19/359 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ +Q H+WN+IF+F+NS SLKCA+QLGIPD+IH H +P+TL +L+ TL I+  K   
Sbjct  14    DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQC  73

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             +  LMR+L  +G F        + ++GY L   S LL+KDHP S+APF L    P  T P
Sbjct  74    VYHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKP  133

Query  393   WQHVSEWFHNDDPTP----YQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
             W  VS W  NDD       +   +G  FWD   ++   NH FN+ MAS++ L  S +   
Sbjct  134   WHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIHK  193

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
             C++VFEGL++LVDVGGGTG +A A+A +FP ++C+V D PHVVA L+   NL YV GNM 
Sbjct  194   CKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNMF  253

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AV++K ++HNWNDE+CVKILKNCK+AI      GKVII+D+ M S +      
Sbjct  254   EAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEK------  307

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               D +  +TQ+F D+ MMV   G ER  KEW K+F +AGF+DYK T  LG+ SLI+++P
Sbjct  308   -ADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 241/358 (67%), Gaps = 15/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             ++++E++ AQTHIWNH F+FI S SLKCAVQLGIPD+I+ HGQP+TL ELV TL ++  K
Sbjct  7     EKIDELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTK  66

Query  225   ADHLGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
              DHL RLMRVL  +G F           +GY L P S LL+KD  F   PF   A  P  
Sbjct  67    TDHLYRLMRVLVHSGFFNLQNASDNHSQEGYILTPASRLLLKDCSFDTRPFISLALDPVA  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T P+ ++  +  NDDPT + TA+G+T +     +   NH FN+ MAS+S ++   V   C
Sbjct  127   TEPYNYLIPFLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVIIKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             ++VFEG++SLVDVGGGTG +A+A+   FP++KC+VLDLPHVV  L+G+ NL ++ G+M +
Sbjct  187   KKVFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSNNLSFLGGDMFQ  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +PPA A++LK I+H+W DE+C+KILKNCKEA+  +  GGKV+I+DM+MG+         
Sbjct  247   AVPPADAILLKWILHDWPDEECIKILKNCKEAVSEKGTGGKVMIIDMVMGNQS-------  299

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              DD L++ Q+  D+ MM    G+ER  +EW K+F DAGF++YK    LG  +LI+  P
Sbjct  300   WDDSLMEAQLCFDMQMMALLMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEFLP  357



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   347 bits (891),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 234/356 (66%), Gaps = 13/356 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIFIKDD---DGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             A ++ RLMR+L  +G F + +   + Y+L   + LL+KD+P SM    L    P  T P 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNQEAYSLTQSTRLLLKDNPLSMRTLLLFVLDPVLTKPH  126

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               +S WF ND+ T +  A+   FW+   QD   N+ FN AMAS+S+LV  +V   C+ +F
Sbjct  127   DCLSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSILVSKVVVSKCKGIF  186

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EG++SLVDVGGG G +A+ +A+ FP M C+V DLP VV+ L+G+KNL YV G+M E +PP
Sbjct  187   EGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGSKNLKYVGGDMFEAVPP  246

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAI--PNRENGGKVIILDMIMGSTQNRdddnddd  929
             A  ++LK I+H W+DEDCVKILK CK+AI    ++  GKVII+DM+  +           
Sbjct  247   ADVILLKWILHAWSDEDCVKILKRCKQAIMSEGQQKAGKVIIIDMVRENLNGDGGS----  302

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKT-TQLGLMSLIQLFP  1094
                I+TQ+F D+ MMV   G ER  KEW K+F DAGF +YK    LG  +LI+L+P
Sbjct  303   ---IETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  355



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 242/361 (67%), Gaps = 20/361 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  A TH+ + +FN+INS SL CA QLGIPD+IH HG+PITL  LV  L I   K
Sbjct  8     QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALHIAPNK  67

Query  225   ADHLGRLMRVLTRTGIFIK----------DDDGYALGPPSCLLIKDHPFSMAPFALGATG  374
                + RLMR+L  +G F            +++ Y L PPS LL+KD+   ++PF +    
Sbjct  68    TSIIYRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  126

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P F  PW  + +WF  ++PT ++ AYG  FW+  +Q+PE N  FN+AMA +S + M+LV 
Sbjct  127   PAFVTPWLSLGDWFRGNEPTAFEHAYGMAFWEYHNQNPELNRLFNEAMACDSQM-MNLVI  185

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             + C+ +FEGL+S+VDVGGGTG ++R +++ FP M C+VL+LP V+  LEGTKNL YV G+
Sbjct  186   RDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGD  245

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M + IP A AV+LK+I H W+DEDC+KILK CKEAI ++E GGKVII+D+++   ++   
Sbjct  246   MFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKEKGGKVIIVDVVIDEKKDE--  303

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLF  1091
                   EL +T++  D+ MMV   G+ER +KEW K+F +AGF+ YK T L GL SLI+++
Sbjct  304   -----KELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYKITPLFGLRSLIEVY  358

Query  1092  P  1094
             P
Sbjct  359   P  359



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/360 (48%), Positives = 242/360 (67%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       I + + Y+L   + LL+KD+P+S+ P  L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD   +  A+ KT W+   QD  FN+ FN+AMAS+S+L   LV   C
Sbjct  127   TKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +F+G++SLVDVGGG G +A+ +A+ FP M C+V DLPHVV+ L+G KNL YV G+M E
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PPA A++LK ++H+W+DE CVKILK CK+A+ ++  +  GKVII+DM+  +    +  
Sbjct  247   AVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSGDEGS  306

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKT-TQLGLMSLIQLFP  1094
                    I+TQ+  D+ +MV   G ER  KEW K+F DAGF +YK  + LG  +LI+L+P
Sbjct  307   -------IETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 235/351 (67%), Gaps = 12/351 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ  +WN  FN++NS SLKCAV+LGI D+IH HGQP TL ++   L I   K + 
Sbjct  11    SELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASALNIKPNKVEC  70

Query  234   LGRLMRVLTRTGIFIKD-DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             +  +MR+L  +G F +  DD Y L P S LL+KD P   APF      P +T  +  +  
Sbjct  71    IQSVMRILVHSGFFAQQKDDEYFLTPASRLLLKDTPLKAAPFVDLVADPLYTTAFHCLGT  130

Query  411   WFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDS  590
             W  NDDPT ++TA+GK  WDRV+ +P+F   F   M ++S L+  +V K C+EVFEGL S
Sbjct  131   WLQNDDPTLFETAHGKKVWDRVADEPKFKSLFYDLMITDSELIAGIVIKDCKEVFEGLKS  190

Query  591   LVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK-NLVYVAGNMLEVIPPAQAV  767
             LVDV GGTG++ARA+A  FPD+KC+V DLPHVV  L+GT  NL ++ GNM E IP A AV
Sbjct  191   LVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTNDNLDFLGGNMFEAIPQANAV  250

Query  768   VLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDM-IMGSTQNRdddnddddELIQ  944
             +LK I+HNWNDE+ VK+LK CKEAIP+++ GGKVII+DM I   +Q++        E ++
Sbjct  251   LLKWILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDK--------ESME  302

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
             TQ+  D+ M+  F G+ER + +W K+F  AGF+ YK T  LG+ SLI+ +P
Sbjct  303   TQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPMLGVRSLIEAYP  353



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 235/359 (65%), Gaps = 19/359 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ +Q H+WN+IF+F+NS SLKCA+QLGIPD+IH H +P+TL +L+ TL I+  K   
Sbjct  14    DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQC  73

Query  234   LGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             +  LMR+L  +G F        + ++GY L   S LL+KDHP S+APF L    P  T P
Sbjct  74    VYHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKP  133

Query  393   WQHVSEWFHNDDPTP----YQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKY  560
             W  VS W  NDD       +   +G  FWD   ++   NH FN+ MAS++ L  S +   
Sbjct  134   WHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALINK  193

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
             C++VFEGL++LVDVGGGTG +A A+A +FP ++C+V D PHVVA L+    L YV GNM 
Sbjct  194   CKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGYLKYVGGNMF  253

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             E IPPA AV++K ++HNWNDE+CVKILKNCK+AI      GKVII+D+ M S +      
Sbjct  254   EAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEK------  307

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               D +  +TQ+F D+ MMV   G ER  KEW K+F +AGF+DYK T  LG+ SLI+++P
Sbjct  308   -ADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 242/360 (67%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       I + + Y+L   + LL+KD+P+S+ P  L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD   +  A+ KT W+   QD  FN+ FN+AMAS+S+L   LV   C
Sbjct  127   TKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +F+G++SLVDVGGG G +A+ +A+ FP M C+V DLPHVV+ L+G KNL YV G+M E
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PPA A++LK ++H+W+DE CVKILK CK+A+ ++  +  GKVII+DM+  +    +  
Sbjct  247   AVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSGDEGS  306

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKT-TQLGLMSLIQLFP  1094
                    I+TQ+  D+ +MV   G ER  +EW K+F DAGF +YK  + LG  +LI+L+P
Sbjct  307   -------IETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   345 bits (885),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 235/351 (67%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++A  + RLM
Sbjct  13    AQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  72

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    P    PW  +S 
Sbjct  73    RILVHSGFFEQKKLAPDGQGAYVLNHVSKLLLTDNPSNVAPFALSMLDPILINPWHGLSA  132

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G +FW    Q+P FN  FN  MAS++ LV S+V    + VFEG+ 
Sbjct  133   WFHNHVDPTPFEMVQGMSFWRYAGQEPGFNRLFNDGMASDARLVASMVVNEHKGVFEGIT  192

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG  A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  193   SLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  252

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VK+LK C+EA+        KVII+DM+M +T++       D E+++
Sbjct  253   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIDMVMDNTKS-------DKEMVE  305

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  306   TQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  356



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/352 (46%), Positives = 236/352 (67%), Gaps = 14/352 (4%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ+H+WNHIFNFINS SLKC V LGIPD+IH HG+P+ + +L+ +L I+ +K   + 
Sbjct  14    LLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPCIH  73

Query  240   RLMRVLTRTGIFIKDDDG-------YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQ  398
             RLMR++T +G F + +         Y L   S LL+KD+P S+ PF      P    PW 
Sbjct  74    RLMRIMTHSGFFSQQNIAANEPEIEYMLTDASRLLLKDNPMSVTPFVYAMLDPVMMNPWH  133

Query  399   HVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
               S W  NDD T ++T +G   W+  + D +FN+ FN++MA+++ LV +L+ + C+ VF 
Sbjct  134   QFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVEKCKGVFN  193

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
               +SLVDVGGGTG +A+  A  FP M+C V DLPHVV GL+G++NL YV G+M + IPP 
Sbjct  194   EFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGSENLSYVGGDMFKEIPPT  253

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddEL  938
              A++LK I+H+WNDE+CVKILKNCK+AI  +   GKV+I+DM++   +        ++E 
Sbjct  254   DAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVVIIDMVLDCEKGD------NNES  307

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
             ++T++F D+ MMV   G+ER  KEWVK+ + AGF DYK T  LGL ++I+++
Sbjct  308   VETKLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIY  359



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 241/357 (68%), Gaps = 11/357 (3%)
 Frame = +3

Query  36    MALQE--MNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             MA+ E    E++ A T IWNHI+NF++SS+ KCAVQLGIPDV+++HG+ + L +L   L 
Sbjct  1     MAMNENGSTELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAALP  60

Query  210   INKAKADHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
             +N +K   L  L+R L  +G   + +D Y+L P S L +KD P SM  + L    P    
Sbjct  61    LNPSKISFLPILIRSLVHSGFLNEHEDYYSLTPASRLFLKDDPLSMRSYFLIMHDPCVQK  120

Query  390   PWQHVSEWFHNDDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCR  566
             PW  +S WF ND PT +  A+ GK+FWD  + +P  N+ FN +MA++S L+ +++   C+
Sbjct  121   PWFELSSWFQNDFPTAFHAAHNGKSFWDYFADEPRVNNIFNDSMANDSSLIANVLITECK  180

Query  567   EVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEV  746
              VFEGL SLVDVGGGTG +A A+A  FP + C+VLDLPHV+  L+G+ NL +V G+M E 
Sbjct  181   HVFEGLTSLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSGNLEFVGGSMFEK  240

Query  747   IPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndd  926
             IP A A++LK I+HNW DEDCVKILK CKE+IP+RE GGKVII+D+++ + + +      
Sbjct  241   IPNANAILLKWILHNWGDEDCVKILKKCKESIPSREKGGKVIIIDIVLENPKQK------  294

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
              D+ ++ Q   D+ MMV FG +ER  KEW K+F +AGF++Y+ T  LG  SLI+++P
Sbjct  295   -DDSVRAQHNMDLVMMVLFGAKERTKKEWEKLFTEAGFSEYEITPTLGTRSLIEIYP  350



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 243/351 (69%), Gaps = 11/351 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHG-QPITLEELVDTLAINKAKAD  230
             +E++ AQ+H+WNHIFNFINS SLKCA+QLGIPD IH HG  P+ L  LV +L ++  K  
Sbjct  14    DELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQ  73

Query  231   HLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
              + RLMR+LT +G F++ ++GY L   S LL+KD+P +++PF L    P  T PWQ +S 
Sbjct  74    FIYRLMRLLTHSGFFVQQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQFLSI  133

Query  411   WFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDS  590
             WF  DD TP++TA+G  FW  +   P+    FN  MAS++ LV++++ +  R VFEG++S
Sbjct  134   WFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLEKHRSVFEGVES  193

Query  591   LVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK-NLVYVAGNMLEVIPPAQAV  767
             LVDVGGGTG VA+A++  FP M+C+VLDLP VVA L+G + N  YV G+M  +IPPA  +
Sbjct  194   LVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYVEGDMFTLIPPADTI  253

Query  768   VLKMIMHNWNDEDCVKILKNCKEAIPNR-ENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DE+CV+ILK CKEAI       GKV+++D+++ +T+N       D + I+
Sbjct  254   LLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTKN-------DADSIE  306

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+  D+ MM+  GG+ER+ KEW K+  +AGF  YK    L L SLI+++P
Sbjct  307   TQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 243/351 (69%), Gaps = 11/351 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHG-QPITLEELVDTLAINKAKAD  230
             +E++ AQ+H+WNHIFNFINS SLKCA+QLGIPD IH HG  P+ L  LV +L ++  K  
Sbjct  14    DELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQ  73

Query  231   HLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
              + RLMR+LT +G F++ ++GY L   S LL+KD+P +++PF L    P  T PWQ +S 
Sbjct  74    FIYRLMRLLTHSGFFVQQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQFLSI  133

Query  411   WFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDS  590
             WF  DD TP++TA+G  FW  +   P+    FN  MAS++ LV++++ +  R VFEG++S
Sbjct  134   WFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLEKHRSVFEGVES  193

Query  591   LVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK-NLVYVAGNMLEVIPPAQAV  767
             LVDVGGGTG VA+A++  FP M+C+VLDLP VVA L+G + N  YV G+M  +IPPA  +
Sbjct  194   LVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYVEGDMFTLIPPADTI  253

Query  768   VLKMIMHNWNDEDCVKILKNCKEAIPNR-ENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DE+CV+ILK CKEAI       GKV+++D+++ +T+N       D + I+
Sbjct  254   LLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTKN-------DADSIE  306

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+  D+ MM+  GG+ER+ KEW K+  +AGF  YK    L L SLI+++P
Sbjct  307   TQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 234/351 (67%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QLGIPD IH HGQP+ L+ LV  L I+ ++A  + RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMNLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    PT   PW  +S 
Sbjct  75    RILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPCNVAPFALSMLDPTLINPWHGLSA  134

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G +FW    Q+P  N  FN  MAS++ LV S+V    + VFEG+ 
Sbjct  135   WFHNRVDPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG  A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  195   SLVDVGGGTGTTAKAIANAFPHMECTIFDLPHVVANLEVSENVRCVPGDMFESIPPADAI  254

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VKILK CKEA+   +    KVII+DM+M +T++       D E ++
Sbjct  255   ILKWILHDWSDEDAVKILKRCKEALGKGKGKKQKVIIIDMVMDNTKS-------DKETVE  307

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  308   TQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>gb|KDP24060.1| hypothetical protein JCGZ_25717 [Jatropha curcas]
Length=358

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 239/359 (67%), Gaps = 16/359 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIH-RHGQPITLEELVDTLAINKA  221
             + ++E++ AQ+HIW H   FI S SLKCAV+LG+P      HGQP+ L +LV  L +N A
Sbjct  7     ENIDELLKAQSHIWTHSLQFIKSMSLKCAVELGVPVAFSTHHGQPMPLSDLVSALQVNPA  66

Query  222   KADHLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQH  401
             K  HL RLMR+L  +G F   +DGY L   S LL+KD P +  PF      P  T P+  
Sbjct  67    KTHHLHRLMRILVHSGFFSLKEDGYLLTASSRLLLKDTPLNSRPFISLVLDPILTEPYNC  126

Query  402   VSEWFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFE  578
             +S+W  +D D TP+ TA+G++ W+    +   N+ FN+AMAS+S L+   V   C+EVFE
Sbjct  127   MSKWLKDDHDQTPFVTAFGESLWEHAGHEIRVNNLFNEAMASDSFLISEAVIVKCKEVFE  186

Query  579   GLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPA  758
             GLDSLVDV GGTG +A+A+A+ FP++KC+VLDLPHVVAGL+G KNL ++AG+M E +PPA
Sbjct  187   GLDSLVDVAGGTGNMAKAIANTFPNLKCTVLDLPHVVAGLQGIKNLNFLAGDMFEAVPPA  246

Query  759   QAVVLKMIMHNWNDEDCVKILKNCKEAI------PNRENGGKVIILDMIMGSTQNRdddn  920
              AV+LK I+H+W DEDCVKILKNCKEAI       N++   KVII+DM+MG+        
Sbjct  247   DAVLLKWILHDWTDEDCVKILKNCKEAITRNGEQENKKKKKKVIIIDMVMGNQ-------  299

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
               D++  + Q+  D+ MMV   G+ER  KEW K+F DAGFT YK    LG  ++I+++P
Sbjct  300   TWDNDWTEAQVLFDMEMMVCLVGKERTEKEWAKLFFDAGFTKYKIDYVLGPRAVIEVYP  358



>ref|XP_002517834.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44352.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 237/360 (66%), Gaps = 20/360 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA-INKAKAD  230
             NE++ A  H+W+H F+FI S SLKCAV+LGIPD+IH HGQP+TL ELV  L  +  +K+ 
Sbjct  10    NELLQAHAHVWSHAFSFIKSMSLKCAVELGIPDIIHNHGQPMTLSELVAGLPHVLPSKSH  69

Query  231   HLGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
             H+ RLMRVLT +G F        +D+DGY L  P  LL+KD P S  P+      P  T 
Sbjct  70    HVCRLMRVLTHSGFFTLQKASDNRDEDGYLLTKPCLLLLKDSPISARPYLFAVLDPILTK  129

Query  390   PWQHVSEWFHNDDP--TPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             PW  +S WF NDD   +P+  A+GKTFWD  S +  FN  FN+AMAS+S +V  +V   C
Sbjct  130   PWDCLSSWFQNDDSKCSPFSIAHGKTFWDLASHEARFNSIFNEAMASDSSVVREVVISKC  189

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             ++VF GL+SLVDVGG TG++A+A+ + FP++KC+VLDLPHVVAG++   NL ++ G+M E
Sbjct  190   KDVFMGLNSLVDVGGSTGIMAKAIVETFPELKCTVLDLPHVVAGMQDDHNLSFLGGDMFE  249

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIP--NRENGGKVIILDMIMGSTQNRddd  917
              IPPA A++LKMI H   DEDC+K+LK CKEAI   N E  GKVII+D +MG+       
Sbjct  250   SIPPADAIMLKMIFHVLGDEDCLKLLKKCKEAITSNNGERPGKVIIIDTVMGNKD----W  305

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                  E IQ     D+ MMV   G+ER  KEW K+F DAGF+ Y     LGL S+I++FP
Sbjct  306   IKQSTETIQ---LYDLEMMVLVSGQERTEKEWAKLFFDAGFSSYNINPILGLRSIIEVFP  362



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 240/361 (66%), Gaps = 20/361 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  A TH+ + +FN+INS SL CA QLGIPD+IH HG+PITL  LV  L I   K
Sbjct  8     QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHDHGRPITLPHLVSALHIAPNK  67

Query  225   ADHLGRLMRVLTRTGIFIK----------DDDGYALGPPSCLLIKDHPFSMAPFALGATG  374
                + RLMR+L  +G F            +++ Y L PPS LL+KD+   ++PF +    
Sbjct  68    TSIIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  126

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P F  PW  + +WF  ++PT ++ AYG  FW+  +Q+PE N  FN+AMA +S + M+LV 
Sbjct  127   PAFVTPWLSLGDWFRGNEPTAFEQAYGMAFWEYHNQNPELNRLFNEAMACDSQM-MNLVI  185

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             + C+ +FEGL+S+VDVGGGTG ++R +++ FP M C+VL+LP V+  LEGTKNL YV G+
Sbjct  186   RDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGD  245

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M + IP A AV+LK+I H W+DEDC+KILK CKEAI ++  GGKVII+D+++   ++   
Sbjct  246   MFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKGKGGKVIIVDVVIDEKKDE--  303

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLF  1091
                   EL +T++  D+ MMV   G+ER +KEW K+F +AGF+ Y  T L GL SLI+++
Sbjct  304   -----KELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYMITPLFGLRSLIEVY  358

Query  1092  P  1094
             P
Sbjct  359   P  359



>gb|AAR09603.1| O-methyltransferase [Mentha x piperita]
Length=361

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 239/358 (67%), Gaps = 17/358 (5%)
 Frame = +3

Query  51    MNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAD  230
             + E++ A+ H+WNHIF++INS SLK A+QLGIPD+IH+HG PITL +L D L INKAK D
Sbjct  11    VEELLDAEAHVWNHIFSYINSMSLKSALQLGIPDIIHKHGNPITLSQLADALNINKAKTD  70

Query  231   HLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              L RLMR+L  +  F         +++ Y+L   S LL++D P S+AP+      P F  
Sbjct  71    GLFRLMRLLEHSKFFDKVKVEGEGEEEAYSLTRASRLLLRDEPSSLAPYIRAMLDPNFMD  130

Query  390   PWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             P+ H+SEW  ++ P+P++  +G++ W+    +  +N  FNQAMA+++ LV S++ K CR 
Sbjct  131   PFHHLSEWLGSECPSPFEFKHGRSLWEYAGIEERWNQLFNQAMANDAKLVTSILVKECRH  190

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             +F+GL+SLVDVGGG G VA+ +AD FP +K  VLDLPHVVA L  ++NL YV+G+M E I
Sbjct  191   IFQGLESLVDVGGGAGTVAKVVADAFPGLKAVVLDLPHVVADLATSENLRYVSGDMFEDI  250

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAI-PNR-ENGGKVIILDMIMGSTQNRdddnd  923
             P A AV+LK I+HNW+DE+C+KIL+ CKEAI P++  NGGKVI++DMI+   +       
Sbjct  251   PRADAVLLKWILHNWSDEECIKILEKCKEAITPSKNNNGGKVIVIDMILKDEKQHHKGT-  309

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                   +TQ+  DV MM    G+ER  KEW  +F  AGF  YK    L L S+I++FP
Sbjct  310   ------ETQLLFDVLMMTALTGKERTEKEWANLFFAAGFKTYKIHPVLRLRSVIEIFP  361



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 237/360 (66%), Gaps = 17/360 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIF-------IKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
             A ++ RLMR+L  +G F       I +   Y+L   + LL+KD+P+S+ P  L    P  
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQVAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T PW  +S WF NDD   +  A+ KT W+   QD   N+ FN AMAS+S+L   LV   C
Sbjct  127   TKPWDCLSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDSILASKLVVSKC  186

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + +F+G++SLVDVGGG G +A+ +A+ FP M C+V DLPHVV+ L+G KNL Y  G+M E
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYAGGDMFE  246

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRddd  917
              +PP  A++LK I+H+W+DEDCVKILK CK+AI ++  +  GKVII+DM+     NR+ D
Sbjct  247   AVPPVDALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKVIIIDMV---RDNRNGD  303

Query  918   nddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
                    I TQ+  D+ MMV   G ER  KEW K+F DAGF +YK    LG  +L +L+P
Sbjct  304   EGS----IGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALFELYP  359



>gb|KDP21022.1| hypothetical protein JCGZ_21493 [Jatropha curcas]
Length=356

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 243/357 (68%), Gaps = 16/357 (4%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE+  AQ HI+ H+++++ S SLKC V LGIPD+IH++ +P+TL ELV  L I   K 
Sbjct  8     EANELFQAQCHIYKHMYHYMESMSLKCVVHLGIPDIIHKYKRPVTLPELVSALQIPPTKE  67

Query  228   DHLGRLMRVLTRTGIFI------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
             + L R+MR+L  +G F         ++GY L P S LL+K+ P S++ F +    P    
Sbjct  68    NCLQRVMRILVHSGFFAAKKIHDNQEEGYVLTPSSSLLLKESPTSLSTFVVAMVDPALIT  127

Query  390   PWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             PW  ++E F  ++ TP++T +G  FWD   ++PEF    N+AMA +S LV  +VK++ +E
Sbjct  128   PWFSLAENFKGNELTPFETCHGNNFWDYGKKNPEFISSLNEAMACDSRLVSLIVKEH-KE  186

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             +F+G+ SLVDVGGGTG +AR++AD +PDMKC+VLDLP VVA L  +KNL +VAG+M   +
Sbjct  187   MFKGVASLVDVGGGTGTLARSIADAYPDMKCTVLDLPQVVANLPESKNLKFVAGDMFRSV  246

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             P AQAV++K ++HNW+D+ C+KILK C+E+IPN++ GGKVII++M++   ++        
Sbjct  247   PSAQAVMIKSVLHNWSDQACIKILKLCRESIPNKDEGGKVIIIEMVINEKKDE-------  299

Query  930   dELIQTQIFADVHMMVNF-GGRERKLKEWVKIFNDAGFTDYK-TTQLGLMSLIQLFP  1094
              +L +T++FAD+ MM+   GGRER  +EW ++F +AGF  YK T   GL S+I+ +P
Sbjct  300   YQLAETKLFADMQMMLLCPGGRERNEQEWARLFLEAGFNHYKITNTCGLNSIIEAYP  356



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 235/351 (67%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFINS  LKC +QLGIPD IH HGQP+TL+ LV  L I+ ++A  + RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCTIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    P    PW  +S 
Sbjct  75    RILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPILINPWHGLSA  134

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G +FW    Q+P F+  FN  MAS++ LV S+V    + VFEG+ 
Sbjct  135   WFHNHADPTPFEMVQGMSFWRYAGQEPGFDRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG +A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  195   SLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  254

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VK+LK C+EA+        KVII++M+M +T++       D E+++
Sbjct  255   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS-------DKEMVE  307

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  308   TQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_002517833.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44351.1| o-methyltransferase, putative [Ricinus communis]
Length=372

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 233/358 (65%), Gaps = 15/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + ++E++ AQTHIWN  F+FI S SLKCAVQLGIPD+I+ HGQP+TL ELV  L +   K
Sbjct  22    ENIDELIKAQTHIWNETFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLALQVRPTK  81

Query  225   ADHLGRLMRVLTRTGIFIKDD-------DGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
               HL RLMRVL R+G F   +       +GY L P S LL+++  F   PF      P  
Sbjct  82    THHLYRLMRVLVRSGFFNLQNASDNYSQEGYILTPASRLLLQNSSFDTRPFISLVLDPII  141

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             T P+  ++ +  NDD TP+ TA+  T W     +   NH  N  MAS+S ++   V   C
Sbjct  142   TEPYNSLTSFLRNDDLTPFVTAFKDTLWGCAGNEARINHLVNDCMASDSSVIGRAVIIKC  201

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             +EVFEGL+SLVDVGGGTG +A+A+A  FP++KC+VLDLPHVV  L+G  NL ++ G+M +
Sbjct  202   KEVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQGINNLSFLGGDMFQ  261

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +PPA A++LK I+H+W DE+C+KILKNCKEAI  +   GKV+I+D++MG          
Sbjct  262   AVPPADAILLKWILHDWPDEECIKILKNCKEAISRKGKEGKVMIIDIVMG-------YQT  314

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              DD L + Q+  D+ MMV   G+ER  KEW K+F DAGFT+YK    LG  +LI+++P
Sbjct  315   WDDSLTEAQLLFDMKMMVAVMGKERNEKEWTKLFFDAGFTNYKIYPVLGPRALIEVYP  372



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 239/358 (67%), Gaps = 14/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  + ++ AQ+H+WNH+FNFINS SLKC V LGIPD+IH +G+PI L +L+ +L+I+ +K
Sbjct  8     QVASNLLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISSLSIHPSK  67

Query  225   ADHLGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
                + RLMR++T +G F +        +  Y L   S LL+KD+P S+AP+      P  
Sbjct  68    NHGIHRLMRIMTHSGFFSQKNVIGNELEIEYMLTDASKLLLKDNPMSVAPYVHAMVNPVM  127

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PW   S W  NDD   ++T +G + W+  ++D E N+ FN++MA+++ LV  L+ + C
Sbjct  128   MNPWYQFSTWLKNDDTNTFETTHGMSTWEYAARDSEINNLFNESMANDTRLVSDLLVEKC  187

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + VF  ++SLVDVGGGTG +A+ L   FP M+C V DLPHVV GL+G++ L YV G+M +
Sbjct  188   KGVFNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGSEKLRYVGGDMFK  247

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              IPPA A++LK I+H+WNDE C+KILKNCK+AI  +   GKV+I+DM++   +       
Sbjct  248   EIPPADAILLKWILHDWNDEQCLKILKNCKDAISKKGKEGKVVIIDMVLDCEKGD-----  302

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              ++E ++TQ+F D+ MM    G+ER  KEW+K+ + AGF DYK T  LGL S+I+++P
Sbjct  303   -NNESVETQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILGLRSMIEIYP  359



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score =   347 bits (891),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 235/352 (67%), Gaps = 13/352 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             +E++ AQ  +WN  FN++NS SLKCAV+L I D+IH HGQP TL ++   L I   K   
Sbjct  208   SELLKAQAQVWNCTFNYVNSMSLKCAVELDIADIIHSHGQPTTLSQIASALNIKPNKVQC  267

Query  234   LGRLMRVLTRTGIFI--KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVS  407
             +  +MR+L  +G F   KDDD Y L P S LL+KD P   APF      P +T  + ++ 
Sbjct  268   IQSVMRILVHSGFFAQQKDDDEYFLTPASRLLLKDTPLKAAPFVDLVADPLYTTAFHYLG  327

Query  408   EWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
              W  NDDPT ++TA+GK FWDRV+ +P+F   F   M ++S L+  +V K C+EVFEGL 
Sbjct  328   TWLQNDDPTLFETAHGKNFWDRVADEPKFKSLFYDLMITDSELIARIVIKDCKEVFEGLK  387

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK-NLVYVAGNMLEVIPPAQA  764
             SLVDV GGTG +ARA+A  FPD+KC+V DLPHVV  L+GT  NL ++ GNM E IP A A
Sbjct  388   SLVDVAGGTGTMARAIAAAFPDIKCTVFDLPHVVDNLQGTNDNLDFLGGNMFEAIPQANA  447

Query  765   VVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDM-IMGSTQNRdddnddddELI  941
             V+LK I+HNWNDE+ VK+LK CKEAIP+++ GGKVII+DM I   +Q++        E +
Sbjct  448   VLLKGILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDK--------ESM  499

Query  942   QTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             +TQ+  D+ M+  F G+ER + +W K+F  AGF+ YK T  LG+ SLI+ +P
Sbjct  500   ETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP  551



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 235/351 (67%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFI+S  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++A  + RLM
Sbjct  15    AQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    P    PW  +S 
Sbjct  75    RILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPILINPWHGLSA  134

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G +FW    Q+P  N  FN  MAS++ LV S+V    + VFEG+ 
Sbjct  135   WFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG +A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  195   SLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  254

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VK+LK C+EA+        KVII++M+M +T++       D E+++
Sbjct  255   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS-------DKEMVE  307

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  308   TQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 235/351 (67%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFI+S  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++A  + RLM
Sbjct  15    AQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    P    PW  +S 
Sbjct  75    RILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPILINPWHGLSA  134

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G +FW    Q+P  N  FN  MAS++ LV S+V    + VFEG+ 
Sbjct  135   WFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG +A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  195   SLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  254

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VK+LK C+EA+        KVII++M+M +T++       D E+++
Sbjct  255   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS-------DKEMVE  307

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  308   TQLFYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_004139733.1| PREDICTED: LOW QUALITY PROTEIN: trans-resveratrol di-O-methyltransferase-like 
[Cucumis sativus]
Length=398

 Score =   342 bits (877),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 245/366 (67%), Gaps = 19/366 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             NE++ AQ HIWNHIF+FINS +LKCAV+L IPD I+RHG PITL +L+  L I+  K+ H
Sbjct  33    NEVLKAQAHIWNHIFSFINSMALKCAVELRIPDAINRHGSPITLSQLISALQIHPQKSQH  92

Query  234   LGRLMRVLTRTGIFIKDDD----------------GYALGPPSCLLIKDHPFSMAPFALG  365
             + R+MR+L  +G F+  +                  Y+L  PS LL++ +P +++PF+L 
Sbjct  93    VHRIMRILAHSGFFLIHNKLSQQKDDDEDEDEDQVAYSLTNPSLLLLQHNPLTLSPFSLF  152

Query  366   ATGPTFTGPWQHVSEWFHNDDP--TPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLV  539
                     PW  +S W  +D    TP++TA+GK FW+ +  + +    FN AM S++ LV
Sbjct  153   MLDRVLIEPWLFISAWLRSDSDCRTPFETAHGKEFWEHMGSEAKDGEGFNAAMESDAKLV  212

Query  540   MSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLV  719
             +S++ +  + VFEG++S VDVGGGTG VA+A+A+ FP MKC V DLP VVAGLEG  NL+
Sbjct  213   VSVLLEKYKSVFEGVESFVDVGGGTGSVAKAIAEAFPQMKCVVYDLPQVVAGLEGNHNLM  272

Query  720   YVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGST  899
             ++ G+M +VIP A A++LK I+H+W D++CVKILK CKEAI +    GKVII+DM++G+ 
Sbjct  273   FLQGDMFQVIPSADALLLKWILHDWTDDECVKILKKCKEAITSNGKNGKVIIIDMVVGNK  332

Query  900   QNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMS  1076
              N+ +  ++D  + + ++F D+ MMVN GG+ER  KEW ++F  AGF  Y  +  LGL S
Sbjct  333   SNKKNMKNNDMLMTKGKLFWDLLMMVNVGGKERDEKEWAELFQAAGFGAYNISPILGLRS  392

Query  1077  LIQLFP  1094
             LI+L+P
Sbjct  393   LIELYP  398



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 242/361 (67%), Gaps = 19/361 (5%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E++ AQ H++NHIFN+INS  LKCAVQLGIPD+IH+HG+PITL ELV  L I+  K
Sbjct  7     QKATELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSALHIHPTK  66

Query  225   ADHLGRLMRVLTRTGIF--IKDDDG-------YALGPPSCLLIKDHPFSMAPFALGATGP  377
              + + RLMR+L  +G F   K  +G       Y L P S LL+KD+P  + PF      P
Sbjct  67    INFMYRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPSSKLLVKDNPNCLKPFVDSLLKP  126

Query  378   TFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
              F  P   + +WF  ++ T +Q A+G  FW+   ++PEFN  FN+AMAS+S + M+LV +
Sbjct  127   DFVTPGHVLGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRM-MNLVIR  185

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
              C+ +FEG++SLVDVGGG G +AR +++ FPDMKC+VL+LP V+  LEGTKNL YV G+M
Sbjct  186   DCKPIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEGTKNLNYVGGDM  245

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGG-KVIILDMIMGSTQNRdd  914
              + IP A A++LK+I+H WNDE+CVKILK CKEAI +   G  KVI++D+++   ++   
Sbjct  246   FQHIPSADAIILKLILHGWNDEECVKILKKCKEAISSTGKGSEKVIVIDLVINDKKDE--  303

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
                   E  +T++  D+ MM    G+ER  KEW ++F  AGF+ +K T  LGL SLI+++
Sbjct  304   -----YEFTETKLLFDMLMMFVATGKERTEKEWGELFLKAGFSHFKITPILGLRSLIEVY  358

Query  1092  P  1094
             P
Sbjct  359   P  359



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 240/356 (67%), Gaps = 16/356 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
              E++ AQ HIWNHIFN INS +LK AVQLGIPD+IH+H +P+TL +L D + IN+AK+D 
Sbjct  11    QELLDAQAHIWNHIFNHINSMTLKWAVQLGIPDIIHKHDKPMTLSQLADAIPINRAKSDA  70

Query  234   LGRLMRVLTRTGIFIK------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             L R+MR+L  +  F +      +++ Y L   S LL++D P S+ PFAL        G +
Sbjct  71    LHRIMRILVHSKFFDRVRTLPNEEEAYCLTRASRLLLRDEPLSLTPFALAVLDEDLMGTF  130

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               V EWF N+ P+P +  + K+  +    +  ++  FN+ MA+++ LV S++ K  R+VF
Sbjct  131   HCVPEWFGNECPSPLEFKHEKSIREFAENNQRWSLLFNEGMANDARLVGSILAKESRKVF  190

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             EGL+++VDVGGGTGMV++A+ D FP MK  VLDLP+VV+GL+G+ NL YV G+M   +PP
Sbjct  191   EGLETMVDVGGGTGMVSKAIVDAFPGMKGIVLDLPYVVSGLKGSGNLRYVGGDMFHSVPP  250

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNREN--GGKVIILDMIMGSTQNRdddnddd  929
             A AV LK I+HNW+D++C+KIL+ CKEAI   +N  GGKVII+DMI+G  + +       
Sbjct  251   ADAVFLKWILHNWSDDECIKILEKCKEAITTSKNMKGGKVIIVDMILGYEKQQ-------  303

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             DE ++TQ+F D+ MM    G+ER  +EW KIF  AGF  YK    LGL SLI++FP
Sbjct  304   DEAVETQLFFDMMMMTTLTGKERTEQEWAKIFFAAGFKTYKIYPLLGLRSLIEVFP  359



>sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-methyltransferase; AltName: 
Full=Flavonol 8-O-methyltransferase [Mentha x piperita]
 gb|AAR09600.1| flavonoid 8-O-methyltransferase [Mentha x piperita]
Length=366

 Score =   340 bits (873),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 241/366 (66%), Gaps = 21/366 (6%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             +    E++ AQ H+WNHI+++INS SLKCA+QLGIPD IH+HG PITL +L D L INKA
Sbjct  7     ISSKQELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKA  66

Query  222   KADHLGRLMRVLTRTGIF--------------IKDDDGYALGPPSCLLIKDHPFSMAPFA  359
             K+  L RLMR+L  +G F               +++D Y+L P S LL++  P S+APFA
Sbjct  67    KSHGLFRLMRILVHSGFFDKVKVKVKVEGEDEEEEEDAYSLTPASRLLLRSEPLSVAPFA  126

Query  360   LGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLV  539
             L  + P +T  W H+SEWF ND    + T YG TF +    D   N  FN+AMA ++  V
Sbjct  127   LAMSDPVYTETWHHLSEWFRNDAVAAFDTKYGMTFPEYAVADDRLNVLFNEAMACDAGFV  186

Query  540   MSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLV  719
              S++   CRE+F+GL+S+VDVGGGTG  A+ +A  FP M+C+VLDLP+VV GL+G++NL 
Sbjct  187   NSILTTECREIFDGLESMVDVGGGTGATAKGIAAAFPGMECTVLDLPNVVGGLKGSENLS  246

Query  720   YVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGST  899
             +V+G+M + IP A A+ +K I+H+WNDE+CVKILK CKEAI    N  + IIL  I+   
Sbjct  247   FVSGDMFDFIPHADAIFMKFILHDWNDEECVKILKKCKEAISRSNNSCRKIILVEIVMED  306

Query  900   QNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMS  1076
             +          E  +T++F D+ M+    G+ER  KEW K+F DAGFT+YK T+ LGL S
Sbjct  307   EKE------THEATETKLFFDMQMLAIITGKERSEKEWGKLFFDAGFTNYKITRVLGLRS  360

Query  1077  LIQLFP  1094
             +I++FP
Sbjct  361   VIEVFP  366



>ref|XP_010920173.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   340 bits (872),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/357 (48%), Positives = 233/357 (65%), Gaps = 19/357 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H WNHIF+FINS SLKCAV+LGI D+IH HG+PI+L EL   L+I   + + L
Sbjct  12    ELLKAQAHAWNHIFSFINSMSLKCAVELGIADIIHAHGKPISLLELATKLSIPPTRNNDL  71

Query  237   GRLMRVLTRTGIFIKDDDG---------YALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              RLMR+L  +G F ++ DG         Y     S LL+     +++ FAL      F  
Sbjct  72    RRLMRLLVFSGFFARERDGNSHDHDEELYIPTTMSALLVNQKDVNVSSFALVMLDQMFLH  131

Query  390   PWQHVSEWFHND--DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             PW H+S W   D    TP++ A+GK  W+  SQ P FN   N+ MAS++  V  +V + C
Sbjct  132   PWYHLSSWLKQDMLPATPFEAAHGKGVWEATSQSPAFNSLLNEGMASDARFVAKVVVEEC  191

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
              E+F GL SLVDVGGGTG +ARA+AD +P +KC+VLDLP VVA  E  + +  VAG+M +
Sbjct  192   GEIFRGLSSLVDVGGGTGTMARAIADAYPHVKCTVLDLPQVVASSEAGETVQLVAGDMFQ  251

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +PPA AV+LK ++H+W+DE+CVKILK CKEA+P++E GGKVII++M++         + 
Sbjct  252   YVPPADAVLLKWVLHDWSDEECVKILKRCKEAVPSKEKGGKVIIIEMVVD-------LDI  304

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLF  1091
                EL +TQ+  D+HMMV   G++R   EW KIF DAGFTDYK T  LGL S+I+++
Sbjct  305   GFPELAETQLLFDMHMMVQTTGKQRNKCEWKKIFIDAGFTDYKITPALGLRSIIEVY  361



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 243/361 (67%), Gaps = 15/361 (4%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M     + ++ AQ+HIWNH+ NFINS SLKC V LGIPD+IH + +P+ L  L+ +L I+
Sbjct  1     MESHNASNLLKAQSHIWNHMCNFINSMSLKCVVDLGIPDIIHNYEKPMPLSVLISSLPIH  60

Query  216   KAKADHLGRLMRVLTRTGIFIKDDDG-------YALGPPSCLLIKDHPFSMAPFALGATG  374
              +K   + RLMR++T  G F KD+         Y L   S LL+KDHP S+ PF      
Sbjct  61    PSKIPCIYRLMRIMTHLGFFSKDNVTENELEIEYMLTDESILLLKDHPMSVTPFLQVVLD  120

Query  375   PTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVK  554
             P    PW ++S W  NDDPT ++T +G   WD  +++P+FN+ FN AMAS++ LV S+V 
Sbjct  121   PIVANPWHNLSTWLKNDDPTTFETTHGMLIWDYAAREPKFNNLFNDAMASDARLVTSVVI  180

Query  555   KYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGN  734
             + C+ VF GL+SLVDVGGGTG +A+ALA  FP M+C+V DLPHVV GL+G+ NL YV G+
Sbjct  181   EKCKGVFNGLESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQGSDNLNYVGGD  240

Query  735   MLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdd  914
             M + IPPA A++LK I+H+WND++CVKILKNCK+AI  +   GKVII+DM+M   +    
Sbjct  241   MFKNIPPADAILLKWILHDWNDDECVKILKNCKDAIAKKGKKGKVIIIDMVMEKEKGN--  298

Query  915   dnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLF  1091
                  +E + TQ+F D+ MMV   G+ER  KEWV + + +GF+DYK T  LGL S+I+++
Sbjct  299   -----NETLGTQLFFDMLMMVLATGKERTKKEWVNLISSSGFSDYKITPVLGLRSVIEIY  353

Query  1092  P  1094
             P
Sbjct  354   P  354



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 237/356 (67%), Gaps = 46/356 (13%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
              E++ A  H+WNHIFNFINS SLKCA++LGIPD+IH HG+P+TL ELV  L +N  K   
Sbjct  10    TELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEKTKC  69

Query  234   LGRLMRVLTRTGIFIK-------DDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + RLMR+L ++G F +        ++GY L   S LL+KD P S  PF L    P    P
Sbjct  70    VYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDPVLITP  129

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             WQ++                              N+ FN+AMAS++ LV S++ K C+ +
Sbjct  130   WQYL------------------------------NNFFNEAMASDARLVTSVLIKDCKGI  159

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             F GL+SLVDVGGGTG VARA+A+ FP + C+VLDLPHVVAGLEG+KNL Y+AG+M E IP
Sbjct  160   FVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAGDMFEAIP  219

Query  753   PAQAVVLKM-IMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PA A++LK  I+H+WN ++CVKILK C++AIP++E GGKVII+DM+M + +        D
Sbjct  220   PADAILLKQWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQK-------AD  272

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
             DE I+TQ+F D+ MM+   G+ER +K+W K+F DAGF+ YK T  LGL SLI+++P
Sbjct  273   DESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  328



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/362 (47%), Positives = 239/362 (66%), Gaps = 22/362 (6%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
             NE++ A   IWN   NFI   SLKCAV+LGIPD+I+ HGQPITL +L+ +L I+ +KA  
Sbjct  10    NELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLPIHSSKAHC  69

Query  234   LGRLMRVLTRTGIFI--KDDD------------GYALGPPSCLLIKDHPFSMAPFALGAT  371
             + RLMR+L  +G F   K D+             Y+L   S LL+KD P+   PF L   
Sbjct  70    IYRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRATPFFLVQL  129

Query  372   GPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLV  551
              P    PW  VS W  N DPTP++  +GKTFWD V  +P   + F +AMA++S L++ ++
Sbjct  130   EPHLMTPWHFVSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFTEAMATDSQLMVKVI  189

Query  552   KKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAG  731
              + C++VFEGL SLVDVGGGTG+VA+A+A  FP++ C+VLDLP+VVA  +G KNL ++AG
Sbjct  190   VEECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVVANSQGAKNLNFIAG  249

Query  732   NMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRd  911
             +M + IPPA A++LK I+H+W+DE+ V ILK C+EAI ++E G KVII+DM++ + +   
Sbjct  250   DMFKEIPPANAILLKWILHDWSDEEAVMILKRCREAIWSKEKGEKVIIIDMVIENPKMDK  309

Query  912   ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQL  1088
                       +TQ++ D+ MMVN  GRER  KEW  +F  AGF+ YK T + GL SL+++
Sbjct  310   KSA-------ETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHYKITPIVGLRSLMEV  362

Query  1089  FP  1094
             +P
Sbjct  363   YP  364



>ref|XP_004170024.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN44537.1| hypothetical protein Csa_7G328250 [Cucumis sativus]
Length=378

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 244/366 (67%), Gaps = 19/366 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADH  233
              E++ AQ HIWNHIF+FINS +LKCAV+L IPD I+RHG PITL +L+  L I+  K+ H
Sbjct  13    EEVLKAQAHIWNHIFSFINSMALKCAVELRIPDAINRHGSPITLSQLISALQIHPQKSQH  72

Query  234   LGRLMRVLTRTGIFIKDDD----------------GYALGPPSCLLIKDHPFSMAPFALG  365
             + R+MR+L  +G F+  +                  Y+L  PS LL++ +P +++PF+L 
Sbjct  73    VHRIMRILAHSGFFLIHNKLSQQKDDDEDEDEDQVAYSLTNPSLLLLQHNPLTLSPFSLF  132

Query  366   ATGPTFTGPWQHVSEWFHNDDP--TPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLV  539
                     PW  +S W  +D    TP++TA+GK FW+ +  + +    FN AM S++ LV
Sbjct  133   MLDRVLIEPWLFISAWLRSDSDCRTPFETAHGKEFWEHMGSEAKDGEGFNAAMESDAKLV  192

Query  540   MSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLV  719
             +S++ +  + VFEG++S VDVGGGTG VA+A+A+ FP MKC V DLP VVAGLEG  NL+
Sbjct  193   VSVLLEKYKSVFEGVESFVDVGGGTGSVAKAIAEAFPQMKCVVYDLPQVVAGLEGNHNLM  252

Query  720   YVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGST  899
             ++ G+M +VIP A A++LK I+H+W D++CVKILK CKEAI +    GKVII+DM++G+ 
Sbjct  253   FLQGDMFQVIPSADALLLKWILHDWTDDECVKILKKCKEAITSNGKNGKVIIIDMVVGNK  312

Query  900   QNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMS  1076
              N+ +  ++D  + + ++F D+ MMVN GG+ER  KEW ++F  AGF  Y  +  LGL S
Sbjct  313   SNKKNMKNNDMLMTKGKLFWDLLMMVNVGGKERDEKEWAELFQAAGFGAYNISPILGLRS  372

Query  1077  LIQLFP  1094
             LI+L+P
Sbjct  373   LIELYP  378



>ref|XP_004232927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=360

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/362 (48%), Positives = 240/362 (66%), Gaps = 19/362 (5%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++  NE+  AQ HI+ H F + NS +L CA+QLGIPD+IH H +PITL +L+  L +  +
Sbjct  7     VERANELFKAQAHIYKHAFAYANSMALNCAIQLGIPDIIHNHKKPITLPDLLSGLKLPSS  66

Query  222   KADHLGRLMRVLTRTGIF--IK-----DDDGYALGPPSCLLIKDHPFSMAPFALGATGPT  380
             K++ + RLMR+L     F  IK     + +GY L   S LL+K    ++ P       P 
Sbjct  67    KSNAIHRLMRLLVHAQFFDIIKLEENSETEGYVLTTSSRLLLKSEIPNLLPCVRLMVDPV  126

Query  381   FTGPWQHVSEWFH-NDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKK  557
                PWQ + EWFH N++ TP++TA+G   WD  +Q+P F+  FN+AMAS+S + M LV K
Sbjct  127   LVTPWQLLGEWFHKNEEATPFETAHGMPMWDFCAQNPIFDTAFNEAMASDSQM-MKLVVK  185

Query  558   YCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNM  737
              CREVFEGL+SLVDVGGGTG++A+ + +  P +KC+VLDLPHVVA +  T+NL+YV GNM
Sbjct  186   DCREVFEGLNSLVDVGGGTGVIAKTILEAIPHLKCTVLDLPHVVANMPQTENLIYVGGNM  245

Query  738   LEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG--GKVIILDMIMGSTQNRd  911
              + IP A A++LK +MH+W+DEDCVKILK C+EAI +++ G  GKV+I+DM++G  +   
Sbjct  246   FQCIPHADAILLKHVMHDWSDEDCVKILKRCREAIEDKDEGRKGKVLIIDMVLGRDEEE-  304

Query  912   ddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQL  1088
                     + + ++  DV MMV   GR+R  KEW K+F +AGF  YK T  LGL SLIQ+
Sbjct  305   ------ANMTEVKLIFDVLMMVVTTGRQRTEKEWEKLFTEAGFMSYKITPLLGLRSLIQV  358

Query  1089  FP  1094
             FP
Sbjct  359   FP  360



>ref|XP_008364163.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/367 (47%), Positives = 243/367 (66%), Gaps = 25/367 (7%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M   E  ++ GAQ+H++ H+F+FI S SLKC VQLGIPD+I RHGQPITL +LV  L I+
Sbjct  1     MEGDEARDLFGAQSHLYKHVFSFITSMSLKCVVQLGIPDIIDRHGQPITLPDLVTALQIH  60

Query  216   KAKADHLGRLMRVLTRTGIFIK-------------DDDGYALGPPSCLLIKDHPFSMAPF  356
              AK  ++ RLMR++  +G F +             +++ Y L P S LL+KD   S++ F
Sbjct  61    PAKTGNVHRLMRLMVHSGFFARKQVPKNHVEADEGEEEAYDLTPSSTLLLKDKVPSLSSF  120

Query  357   ALGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLL  536
              LG   P    PWQ +  WF   + TP+++A+G  FW+    +PEFN  FN+AMAS+S +
Sbjct  121   VLGMLDPASAAPWQFLGNWFRGTEVTPFESAHGMGFWEYAEGNPEFNSLFNKAMASDSGM  180

Query  537   VMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNL  716
              M+LV + C+ +F+GL SLVDVGGGTG VAR L D FP +KC+VL+LPHVVA L   +NL
Sbjct  181   -MNLVIRDCKPIFDGLSSLVDVGGGTGKVARILCDAFPQLKCTVLELPHVVADLPDCENL  239

Query  717   VYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG-GKVIILDMIMG  893
              +V G+M + IPPA AV LK+I+H+ +DE+C+K+LK C+EAI +  NG GKVII+D++M 
Sbjct  240   KFVRGDMFQGIPPADAVFLKLILHDLSDEECLKVLKKCREAIAS--NGQGKVIIIDIVMN  297

Query  894   STQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GL  1070
               ++         E+ + ++  D+ MMV   GRER  K+W K+F +AGF+ YK T + GL
Sbjct  298   EEKDE-------HEITEAKLLFDLLMMVVITGRERSEKDWKKLFLEAGFSSYKVTPIFGL  350

Query  1071  MSLIQLF  1091
              SLI++F
Sbjct  351   RSLIEVF  357



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/350 (47%), Positives = 237/350 (68%), Gaps = 11/350 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHG-QPITLEELVDTLAINKAKAD  230
             +E++ AQ+HIWNHIFNFINS SLKCA+QLGIPD IH HG  P+ L  LV +L ++  K  
Sbjct  39    DELLEAQSHIWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQ  98

Query  231   HLGRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
              + RLMR+LT +G F++ ++GY L   S LL+KD+P +++PF L    P  T PWQ +S 
Sbjct  99    FIYRLMRLLTHSGFFVQQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQFLSI  158

Query  411   WFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDS  590
             WF  DD TP++TA+G  FW  +   P+    FN  MAS++ LV S++    + VFEG+ S
Sbjct  159   WFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVNSVLLGKHKSVFEGVKS  218

Query  591   LVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTK-NLVYVAGNMLEVIPPAQAV  767
             LVDVGGGTG +A+A++  FP M+C+V DLP VVA L G + NL YV G+M + IPPA  +
Sbjct  219   LVDVGGGTGTMAKAISQAFPQMECTVFDLPQVVAHLRGDQPNLNYVEGDMFKRIPPADVL  278

Query  768   VLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQT  947
             +LK I+H+W+DE+CV+ILKNCK AI +  N GKV+++D+++     +        + ++T
Sbjct  279   LLKWILHDWSDEECVEILKNCKAAIRSNGNKGKVMVIDIVLFGNYKK--------DSMET  330

Query  948   QIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             Q+  D+ MM   GG+ER+ KEW K+  +AGF  YK    +G+ SL++++P
Sbjct  331   QLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  380



>ref|XP_002278127.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=354

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 233/356 (65%), Gaps = 14/356 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  +E+  AQ+ I+ H+F+F++S SLKCAVQLGIPD IH H QPITL EL   + +   K
Sbjct  7     QGRSELFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPEK  66

Query  225   ADHLGRLMRVLTRTGIFI-----KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
                L +LMR+L  +G F      ++ +GY L PPS LL+K +  S+AP  LG   P    
Sbjct  67    TSRLHQLMRLLVHSGFFAMQKVDENQEGYVLTPPSRLLVKGNATSLAPIVLGMLDPVLVT  126

Query  390   PWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
             PW  +  W      T ++ A+G   W+  +Q+PEF     + MA++S + MSL  + C+E
Sbjct  127   PWHFLGSWLQGSSLTAFEAAHGMDLWNYGNQNPEFFSLIGEIMATDSRM-MSLAIRECKE  185

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             +FEGL SLVDVGGGTG +AR + + FP +KC+VLDLP VVA L  ++NL YV G+M + I
Sbjct  186   IFEGLSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDMFQSI  245

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             P A A+ +K ++HNW DEDCVKILK C+EAIP+   GGKVII+D+++ + ++        
Sbjct  246   PSADAIFIKSVLHNWGDEDCVKILKRCREAIPSSAEGGKVIIIDLVLSNKKDE-------  298

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
              EL +T++F D+ MMV   G+ER  +EW K+F +AGF+ YK T + G++SLI+++P
Sbjct  299   HELAKTKLFNDMMMMVLVAGKERCEEEWEKLFLEAGFSHYKITPRFGVLSLIEVYP  354



>ref|XP_009345025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=358

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/367 (47%), Positives = 242/367 (66%), Gaps = 25/367 (7%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M   E  ++ GAQ+H++ H+FNFI S SLKC VQLGIPD+I RHGQPITL +LV  L I+
Sbjct  1     MEGDEARDLFGAQSHLYKHVFNFITSMSLKCVVQLGIPDIIDRHGQPITLLDLVTALQIH  60

Query  216   KAKADHLGRLMRVLTRTGIFIK-------------DDDGYALGPPSCLLIKDHPFSMAPF  356
              AK  ++ RLMR++  +G F +             +++ Y L P S LL+KD   S++PF
Sbjct  61    PAKTGNVHRLMRLMVHSGFFARKQVPKNHGEADKGEEEAYDLTPSSRLLLKDKVPSLSPF  120

Query  357   ALGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLL  536
              LG   P    PWQ +  WF   + TP+++A+G  FW+    +PEFN  FN+AMAS+S +
Sbjct  121   VLGMLDPAIAAPWQFLGNWFRGTEVTPFESAHGMGFWEYGEGNPEFNSLFNKAMASDSGM  180

Query  537   VMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNL  716
              M+LV + C+ +F+GL SLVDVGGGTG VAR L D FP +KC+VL+LPHVVA L   +NL
Sbjct  181   -MNLVIRDCKPIFDGLSSLVDVGGGTGKVARILCDAFPQLKCTVLELPHVVADLPDGENL  239

Query  717   VYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG-GKVIILDMIMG  893
              +V G+M + IPPA AV LK+ +H  +DEDC+K+LK C+EAI +  NG GKVII+D+++ 
Sbjct  240   KFVGGDMFQGIPPADAVFLKLTLHALSDEDCLKVLKKCREAIAS--NGQGKVIIIDIVIN  297

Query  894   STQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GL  1070
               ++         E+ + ++  D+ MMV   GRER  K+W K+F +AGF+ YK T + GL
Sbjct  298   EEKDE-------HEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSSYKVTPIFGL  350

Query  1071  MSLIQLF  1091
              SL+++F
Sbjct  351   RSLLEVF  357



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 232/351 (66%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QL IPD IH H QP+TL+ LV  L I+ ++A  L RLM
Sbjct  13    AQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPSRAHCLDRLM  72

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    P    PW  +S 
Sbjct  73    RILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLDPIVINPWHGLSA  132

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G + W  V Q+P  N  FN  MA+++ LV S+V    + +FEG+ 
Sbjct  133   WFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVVNEHKGMFEGIT  192

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG  A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  193   SLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFESIPPADAI  252

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VKILK C+EA+        KVII+DM+M +T++       D E+++
Sbjct  253   ILKWILHDWSDEDAVKILKRCREALGKGEGKKKKVIIIDMVMDNTKS-------DKEMVE  305

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  306   TQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  356



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 232/351 (66%), Gaps = 16/351 (5%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QL IPD IH H QP+TL+ LV  L I+ ++A  L RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPSRAHCLDRLM  74

Query  249   RVLTRTGIFIKDD---DG---YALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSE  410
             R+L  +G F +     DG   Y L   S LL+ D+P ++APFAL    P    PW  +S 
Sbjct  75    RILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLDPIVINPWHGLSA  134

Query  411   WFHND-DPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
             WFHN  DPTP++   G + W  V Q+P  N  FN  MA+++ LV S+V    + +FEG+ 
Sbjct  135   WFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVVNEHKGMFEGIT  194

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAV  767
             SLVDVGGGTG  A+A+A+ FP M+C++ DLPHVVA LE ++N+  V G+M E IPPA A+
Sbjct  195   SLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFESIPPADAI  254

Query  768   VLKMIMHNWNDEDCVKILKNCKEAI-PNRENGGKVIILDMIMGSTQNRdddnddddELIQ  944
             +LK I+H+W+DED VKILK C+EA+        KVII+DM+M +T++       D E+++
Sbjct  255   ILKWILHDWSDEDAVKILKRCREALGKGEGKKKKVIIIDMVMDNTKS-------DKEMVE  307

Query  945   TQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLFP  1094
             TQ+F D+ MM    GRER   EW K+F  AGF DYK T  LGL SLI+++P
Sbjct  308   TQLFYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  358



>gb|AIY62760.1| N-acetylserotonin O-methyltransferase [Malus zumi]
Length=358

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 243/367 (66%), Gaps = 25/367 (7%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M   E  ++ GAQ+H++ H+F+FI S SLKC VQLGIPD+I RHGQPITL +LV  L I+
Sbjct  1     MEGDEARDLFGAQSHLYKHVFSFITSMSLKCVVQLGIPDIIDRHGQPITLPDLVTALQIH  60

Query  216   KAKADHLGRLMRVLTRTGIFIK-------------DDDGYALGPPSCLLIKDHPFSMAPF  356
              AK  ++ RLMR++  +G F +             +++ Y L P S LL+KD   S++PF
Sbjct  61    PAKTGNVHRLMRLMVHSGFFARKQVPKNHVEADEGEEEAYDLTPSSRLLLKDKVPSLSPF  120

Query  357   ALGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLL  536
              +    P F  PWQ +  WF   + TP+++A+G   W+    +PEFN  FN+AMAS+S +
Sbjct  121   VVAMLDPAFAAPWQFLGNWFRGTEVTPFESAHGMGIWEYGEGNPEFNSLFNKAMASDSGM  180

Query  537   VMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNL  716
              M+LV K C+ +F+GL SLVDVGGGTG VAR L D FP +KC+VL+LPHVVA L  ++NL
Sbjct  181   -MNLVIKDCKPIFDGLSSLVDVGGGTGKVARILCDAFPQLKCTVLELPHVVADLPDSENL  239

Query  717   VYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG-GKVIILDMIMG  893
              +V G+M +VIPPA AV LK+ +H  +DE+C+K+LK C+EAI +  NG GKVII+D+++ 
Sbjct  240   KFVGGDMFQVIPPADAVFLKLTLHALSDEECLKVLKKCREAIAS--NGQGKVIIIDIVIN  297

Query  894   STQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GL  1070
               ++         E+ + ++  D+ MMV   GRER  K+W K+F +AGF+ YK T + GL
Sbjct  298   EEKDE-------HEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSGYKVTPIFGL  350

Query  1071  MSLIQLF  1091
              SLI++F
Sbjct  351   RSLIEVF  357



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 223/335 (67%), Gaps = 16/335 (5%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLMRVLTRTGIFIKD----  284
             SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   + RLMR++  +G F +     
Sbjct  2     SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQNHDL  61

Query  285   ----DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSEWFHNDDPTPYQTAY  452
                 +  Y L   S LL+K+HP S+ PF      P  T PW   S WF N DPTP++TA+
Sbjct  62    ENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNPWNQFSTWFKNGDPTPFETAH  121

Query  453   GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDSLVDVGGGTGMVARA  632
             G   WD    DP+ NH FN AMAS++  V SLV + C+ VF GL+SLVDVGGGTG +A+A
Sbjct  122   GMMLWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGVFMGLESLVDVGGGTGTMAKA  181

Query  633   LADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCV  812
             +A  FP ++C V DLPHVV+GL+G++NL YVAG+M E IPPA A++LK I+H+WNDE+CV
Sbjct  182   IAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECV  241

Query  813   KILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQTQIFADVHMMVNFGGR  992
              ILK CKEAI  +   GKVII+DM++ + +         DE ++TQ+F D+ MMV   G+
Sbjct  242   DILKKCKEAITRKGKEGKVIIIDMVVENEKRD-------DESVETQLFFDMLMMVLVTGK  294

Query  993   ERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             ER  KEW K+ + AG+ +YK T  LGL SLI+++P
Sbjct  295   ERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  329



>ref|XP_011091579.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 241/356 (68%), Gaps = 18/356 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKADH  233
             E++ A+  IW  + N IN  SLKCA +LGIPDVIH+HG P+TL ELVD L  ++KAKAD 
Sbjct  11    ELLEAEAQIWKQMLNCINPMSLKCATELGIPDVIHKHGGPMTLLELVDALPGVDKAKADC  70

Query  234   LGRLMRVLTRTGIFI------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             + RLMR+L  +G F+       +++GY+L P S LL+ DHP SM P+ +    P    P 
Sbjct  71    MYRLMRILVHSGFFVLEKINSSNEEGYSLTPASRLLVGDHPMSMKPY-VSQIHPILLDPM  129

Query  396   QHVSEWFHN-DDPTPYQTAY-GKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCRE  569
              H S WF + ++PTP+ T   G + W+   + P F+H F+Q+MAS++ +V  ++ + CR+
Sbjct  130   HHWSRWFQDANNPTPFHTVNNGMSLWELKERHPGFSHLFDQSMASDTSVVADVITRDCRQ  189

Query  570   VFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVI  749
             VFEGLDSLVDVGGGTG +A+A+A+ FP + C+VLDL  VVAG++GTKNL Y+ GNM E I
Sbjct  190   VFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKNLKYIEGNMFEYI  249

Query  750   PPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddd  929
             PP+ AV+LK I+H+W+DE  V+ILK CKEAI +    GKVI+++M++   ++        
Sbjct  250   PPSDAVLLKWILHDWSDEKSVEILKKCKEAITSNGKRGKVILIEMVVDDERSN-------  302

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              E ++TQ+  D+ MM   GG+ERK KEW  +F+ AGF  Y+    LGL S+I+++P
Sbjct  303   TESVETQLQFDMIMMTLLGGKERKEKEWANLFSGAGFQGYRIYPILGLRSIIEIYP  358



>ref|XP_008364164.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 243/367 (66%), Gaps = 25/367 (7%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M   E  ++ GAQ+H++ H+F+FI S SLKC VQLGIPD+I RHGQPITL +LV  L I+
Sbjct  1     MEGDEARDLFGAQSHLYKHVFSFITSMSLKCVVQLGIPDIIDRHGQPITLPDLVTALQIH  60

Query  216   KAKADHLGRLMRVLTRTGIFIK-------------DDDGYALGPPSCLLIKDHPFSMAPF  356
              AK  ++ RLMR++  +G F +             +++ Y L P S LL+KD   S++PF
Sbjct  61    PAKTGNVHRLMRLMVHSGFFARKQVPKNHVEADEGEEEAYDLTPSSRLLLKDKVPSLSPF  120

Query  357   ALGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLL  536
              +    P F  PWQ +  WF   + TP+++A+G   W+    +PEFN  FN+AMAS+S +
Sbjct  121   VVAMLDPAFAAPWQFLGNWFRGSEVTPFESAHGMGIWEYGEGNPEFNSLFNKAMASDSGM  180

Query  537   VMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNL  716
              M+LV + C+ +F+GL SLVDVGGGTG VAR L D FP +KC+VL+LPHVVA L  ++NL
Sbjct  181   -MNLVIRDCKPIFDGLSSLVDVGGGTGKVARILCDAFPQLKCTVLELPHVVADLPDSENL  239

Query  717   VYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG-GKVIILDMIMG  893
              +V G+M +VIPPA AV LK+ +H  +DE+C+K+LK C+EAI +  NG GKVII+D+++ 
Sbjct  240   KFVGGDMFQVIPPADAVFLKLTLHALSDEECLKVLKKCREAIAS--NGQGKVIIIDIVIN  297

Query  894   STQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GL  1070
               ++         E+ + ++  D+ MMV   GRER  K+W K+F +AGF+ YK T + GL
Sbjct  298   EEKDE-------HEITEAKLLFDLLMMVVXTGRERSEKDWKKLFLEAGFSGYKVTPIFGL  350

Query  1071  MSLIQLF  1091
              SLI++F
Sbjct  351   RSLIEVF  357



>ref|XP_010920172.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/357 (48%), Positives = 232/357 (65%), Gaps = 19/357 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H WNHIF+FI S SLKCAV+LGI D+IH H +PI+L EL   L+I   K + L
Sbjct  12    ELLKAQAHAWNHIFSFIKSMSLKCAVELGIADIIHTHDKPISLTELAAKLSIPPTKNNDL  71

Query  237   GRLMRVLTRTGIFIKDDDG---------YALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              RLMR+L  +G F +  DG         Y     S LL+K++  +++ F L     T   
Sbjct  72    RRLMRLLVFSGFFARKRDGNSHDHDEELYIPTTMSALLVKENDANVSSFVLAILDQTLFN  131

Query  390   PWQHVSEWFHNDD--PTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             PW H+S WF  D    TP++ A+G+  W+ +S+ P FN    +AMAS+S  V  LV + C
Sbjct  132   PWYHLSSWFKQDKVPATPFEVAHGRDVWEAISRSPAFNSLCYEAMASDSRFVAKLVVEEC  191

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
              EVF GL SLVDVGGG G +ARA+A  +P +KC+VLDLPHVVA  E ++ +  VAG+M +
Sbjct  192   GEVFRGLRSLVDVGGGKGTMARAIAVAYPQVKCTVLDLPHVVASPEASEEVQLVAGDMFQ  251

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +PPA AV+LK ++H+W+D+DCVKILK CKEAIP++E GGKVII+DM++         + 
Sbjct  252   YVPPADAVLLKWVLHDWSDDDCVKILKRCKEAIPSKEEGGKVIIIDMVVD-------LDI  304

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTT-QLGLMSLIQLF  1091
                EL +TQ+  D+ MMV   G+ER   EW KIF DAGFTDYK    LGL S+I+++
Sbjct  305   GFPELGETQLLFDLEMMVQTTGKERNECEWKKIFMDAGFTDYKIIPALGLRSIIEVY  361



>ref|XP_009625456.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 238/358 (66%), Gaps = 11/358 (3%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVD--TLAI  212
             A +   E++ AQ  IWNHIFNFI+SS+++CA+QLGI DV++++G+P++L +L    +L I
Sbjct  3     ASESSTELLRAQAQIWNHIFNFISSSAVRCALQLGILDVLYKYGKPMSLSDLSAELSLVI  62

Query  213   NKAKADHLGRLMRVLTRTGIFIKDDDG--YALGPPSCLLIKDHPFSMAPFALGATGPTFT  386
             N +K   L  LMR L  +G   +DD    Y+L P SCLL+K+ PF++    +    P F+
Sbjct  63    NPSKVSFLPILMRFLVHSGFLNQDDQDHHYSLTPASCLLVKNEPFNVRSLLVINHDPVFS  122

Query  387   GPWQHVSEWFHNDDPTPYQTAYGKTFWDRV--SQDPEFNHHFNQAMASNSLLVMSLVKKY  560
               W  +S WF ND PT + TA GK+ WD +   +       FN A+AS+S L  +++   
Sbjct  123   KAWFVLSTWFQNDSPTAFHTANGKSLWDYIVDQESRVLGDIFNDALASDSRLNTNVLITE  182

Query  561   CREVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNML  740
             C+ VFEGL+SLVDVGGGTG V+ A+A  FP++KC+VLDLPHVV   +G+ NL +V G+M 
Sbjct  183   CKHVFEGLNSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPHVVEDCKGSGNLEFVGGDMF  242

Query  741   EVIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddn  920
             + IP A A++LK I+H+W DEDCVKILK CKE+IPNRE GGKVII+D +M     +    
Sbjct  243   DNIPHANAILLKCILHDWRDEDCVKILKKCKESIPNREKGGKVIIIDTVMEDDTKK----  298

Query  921   ddddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYK-TTQLGLMSLIQLF  1091
               +DE I+ Q   D+ MMV    +ER  KEW K+F DAGFT+YK  + LGL SLI+++
Sbjct  299   QSNDEFIRAQHNMDMLMMVLCASKERTKKEWEKLFTDAGFTEYKIISALGLRSLIEIY  356



>ref|XP_007025514.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOY28136.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=352

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 240/358 (67%), Gaps = 16/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             QE +E   AQ H++ HIFN+I S SLKCAVQLGIPD+IH HG PITL ELV  L I+ AK
Sbjct  3     QEASESFRAQAHLYKHIFNYIGSMSLKCAVQLGIPDIIHNHGGPITLSELVAALHIDPAK  62

Query  225   ADHLGRLMRVLTRTGIFI-------KDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTF  383
                + RLMR+L  +G F        ++++ Y L P S +L+KD    ++PF +   GP  
Sbjct  63    DSCIYRLMRLLVHSGFFATTKVDRDQEEEAYVLTPFSKILLKDKINCLSPFVVSMLGPPM  122

Query  384   TGPWQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
               PWQ + +W       P+++A GK FWD + QDPEF + F+ AM S+S + M+LV K C
Sbjct  123   MTPWQFLGDWIQGTKQRPFESANGKAFWDYMDQDPEFKNLFHDAMESDSQM-MNLVVKDC  181

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
             + VFEGL SL+DVGGGTG VAR +++ +P +KC+V DLPHVVA L  + NL ++ G++L+
Sbjct  182   KPVFEGLSSLIDVGGGTGTVARVISEAYPQLKCTVFDLPHVVADLPASGNLNFIGGDVLQ  241

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              IPPA A++LK+++H + DEDC+KILK C+EAIP +   GKVII+D+++   ++      
Sbjct  242   YIPPADAILLKLVLHAFGDEDCIKILKRCREAIPTQGAKGKVIIIDIVINVKKDE-----  296

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
                EL + ++F D+ MMV   GRER  ++W K+F  AGFTDYK + L GL SLI+++P
Sbjct  297   --HELTEAKLFFDMLMMVVVTGRERTEQDWQKLFMAAGFTDYKISPLFGLRSLIEVYP  352



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   333 bits (855),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 221/327 (68%), Gaps = 20/327 (6%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLGRLMRVLTRTGIFIKDDDGY  296
             SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  + RLMR+L  +G         
Sbjct  2     SLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFL-------  54

Query  297   ALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSEWFHNDDPTPYQTAYGKTFWDRV  476
                  +   ++       P  L    P  T PW ++S WF NDDPTP+ TAY ++FWD  
Sbjct  55    -----AAQRVQQGKEEEGPLVLAMLDPILTKPWHYLSAWFQNDDPTPFHTAYERSFWDYA  109

Query  477   SQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDSLVDVGGGTGMVARALADEFPDM  656
               +P+ N+ FN+AMAS++ L+ S++ K  + VF GL+SLVDVGGGTG VA+A+A+ FP +
Sbjct  110   GHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHL  169

Query  657   KCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAVVLKMIMHNWNDEDCVKILKNCKE  836
              C+VLDL HVVAGL+G+KNL Y AG+M E IPPA A++LK I+H+W++E+CVKILK C+E
Sbjct  170   NCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSNEECVKILKRCRE  229

Query  837   AIPNRENGGKVIILDMIMGSTQNRdddnddddELIQTQIFADVHMMVNFGGRERKLKEWV  1016
             AIP++ENGGKVII+DMIM   Q             +TQ+F D+ MM+   GRER   EW 
Sbjct  230   AIPSKENGGKVIIIDMIMMKNQGDYKST-------ETQLFFDMTMMIFAPGRERDENEWE  282

Query  1017  KIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             K+F DAGF+ YK T  LGL SLI+++P
Sbjct  283   KLFLDAGFSHYKITPILGLRSLIEVYP  309



>gb|KHG15351.1| 8-hydroxyquercetin 8-O-methyltransferase [Gossypium arboreum]
Length=366

 Score =   335 bits (860),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 235/357 (66%), Gaps = 14/357 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKADH  233
             E + AQ HIW H FNF++  SLKCA+ LGI D+IH HG+P+T+ ELV  L  +N  KA  
Sbjct  13    EALQAQAHIWRHAFNFVSFMSLKCALDLGILDIIHNHGKPMTITELVVALRMLNPTKACD  72

Query  234   LGRLMRVLTRTGIFIKD-------DDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
             + R+MRVL  +GIF +        ++GY L   S +L+K++PF + P       P  T P
Sbjct  73    IYRIMRVLVHSGIFARQNLFNDAQEEGYVLTNSSRMLLKNNPFCITPTLKATMDPIITKP  132

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W  +  WF ND+ TP+ TAYGKT WD  + DP+     N  +AS+S LV +++   C+E 
Sbjct  133   WSFLGTWFQNDEHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTNVLVDKCKEA  192

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGL+SLVDVGGGTG  A+A+AD FP M+C+V DLPH+VAGL+G+KNL YV GNM E  P
Sbjct  193   FEGLNSLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQGSKNLKYVGGNMFEAFP  252

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENG--GKVIILDMIMGSTQNRdddndd  926
                A++LK ++H+WNDE C+ ILK CKEAI ++++    K+II+D+++   +     ND+
Sbjct  253   TGDAILLKKVLHDWNDEGCLTILKRCKEAISSQDHKVERKLIIVDIVVRENEQ---VNDE  309

Query  927   ddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
                L +TQ+F D+ M+V   G+ER+ +EW K+   AGF+ YK T + G  S+I+++P
Sbjct  310   ASSLTKTQLFFDMLMLVLVAGKERREEEWAKLLLAAGFSSYKITPIVGFTSVIEVYP  366



>ref|XP_006388414.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP47328.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=354

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 234/356 (66%), Gaps = 14/356 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   ADHLGRLMRVLTRTGIFIKDD---DGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPW  395
             A ++ RLMR+L  +G F + +   + Y+L   + LL+KD+P SM P  L    P  T P 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNQEAYSLTQSTRLLLKDNPLSMRPLLLMLLDPVLTKPH  126

Query  396   QHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVF  575
               +S WF ND+ T +  A+ +T W+   QDP  ++ FN+AMAS+S+L   LV   C+ +F
Sbjct  127   DCLSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVLSQCKGIF  186

Query  576   EGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPP  755
             +G+DSLVDVGGG+G +A+ +A+ FP M C+V DLP VV+ L+G KNL YV G+M E +PP
Sbjct  187   DGVDSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGRKNLKYVGGDMFEAVPP  246

Query  756   AQAVVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRdddnddd  929
             A  ++LK  +H+W+DEDCVKILK CK AI ++  +  GKVII+D++ GS           
Sbjct  247   ADVILLKWTLHDWSDEDCVKILKQCKHAIMSKGQQKAGKVIIIDIVRGSQNGE-------  299

Query  930   dELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              E  +TQ+  D+ MMV   G ER   EW K+F DAGF  YK    LG  +LI+L P
Sbjct  300   -ESNETQLLWDLEMMVTVTGLERNEMEWAKLFFDAGFISYKIHNVLGTRALIELHP  354



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   335 bits (858),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 237/353 (67%), Gaps = 15/353 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +KA ++
Sbjct  11    ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  237   GRLMRVLTRTGIFIKDD---DGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVS  407
              RLMR+L   G F + +   + Y+L   + LL+KD+P SM P  L    P  T P   +S
Sbjct  71    HRLMRILVHAGFFSQQNLNQEAYSLTQSTRLLLKDNPLSMRPLLLMLLDPVLTKPHDCLS  130

Query  408   EWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLD  587
              WF ND+ T +  A+ +T W+   QDP  ++ FN+AMAS+S+L   LV   C+ +FEG++
Sbjct  131   TWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVVSKCQGIFEGVN  190

Query  588   SLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLE-GTKNLVYVAGNMLEVIPPAQA  764
             SLVDVGGG+G +A+ +A+ FP M C+V DLP VV+ L+ G+KNL YV G+M E +PPA  
Sbjct  191   SLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQAGSKNLKYVGGDMFEAVPPADV  250

Query  765   VVLKMIMHNWNDEDCVKILKNCKEAIPNR--ENGGKVIILDMIMGSTQNRdddnddddEL  938
             ++LK  +H+WNDEDCVKILK CK AI ++  +  GKVII+D++ GS QN        DE 
Sbjct  251   ILLKWTLHDWNDEDCVKILKQCKHAIMSKGQQKAGKVIIIDIVRGS-QN-------GDES  302

Query  939   IQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
              +TQ+  D+ MMV   G ER   EW K+F DAGF  YK    LG  +LI+L P
Sbjct  303   NETQLLWDLEMMVTVTGLERNEMEWAKLFFDAGFVSYKIHNVLGTRALIELHP  355



>ref|XP_003615962.1| O-methyltransferase [Medicago truncatula]
 gb|AES98920.1| orcinol O-methyltransferase [Medicago truncatula]
Length=341

 Score =   334 bits (857),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 229/346 (66%), Gaps = 18/346 (5%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHLG  239
             ++ AQ+HIW HIFNFINS SLKC V LGIPD+IH +G+P++L +L+ +L IN  K  +  
Sbjct  13    LLKAQSHIWKHIFNFINSMSLKCVVDLGIPDIIHNYGRPMSLSKLISSLPINPTKTCYFH  72

Query  240   RLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSEWFH  419
             RL+R++T +GIF + +           + ++ P S+ P   G   P    PW   S W  
Sbjct  73    RLIRIMTYSGIFSQQN-----------ITENDPMSVVPNVNGILSPVMMEPWHQFSAWLK  121

Query  420   NDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREVFEGLDSLVD  599
             NDD T ++T +G +F D +++D + N+ FN++MA  + LV  L+ + C+ VF  ++SLVD
Sbjct  122   NDDITAFETTHGMSFRDYLARDSKINNSFNESMAKETRLVSDLLVEKCKGVFNEVESLVD  181

Query  600   VGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAVVLKM  779
             VGGGTG +A+ LA  FP M+C V DLPHVV GL G++NL YV G+M + IPP  A++LK 
Sbjct  182   VGGGTGTMAKTLAKSFPQMECIVFDLPHVVDGLLGSENLNYVGGDMFKEIPPTAAILLKW  241

Query  780   IMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQTQIFA  959
             I+H+WNDE+CVKILKNCK+AI  +   GKV+I D +  S +         +E ++TQ+F 
Sbjct  242   ILHDWNDEECVKILKNCKDAISKKGKEGKVVIFDKVFDSEKGN------INESVETQLFF  295

Query  960   DVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQ-LGLMSLIQLFP  1094
             D+ MMV F G+ER  KEW+K+ + AGF+DYK T  LG  S+I+++P
Sbjct  296   DMFMMVVFAGKERNEKEWIKLISSAGFSDYKITPILGSTSMIEIYP  341



>ref|XP_010920171.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   335 bits (858),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 167/357 (47%), Positives = 231/357 (65%), Gaps = 19/357 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E++ AQ H WNH F+FINS SLKCAV+LGI D+IH HG+P +L EL   L+I   + + L
Sbjct  12    ELLKAQAHAWNHKFSFINSMSLKCAVELGIADIIHAHGKPTSLLELATKLSIPPTRNNDL  71

Query  237   GRLMRVLTRTGIFIKDDDG---------YALGPPSCLLIKDHPFSMAPFALGATGPTFTG  389
              RLMR+L  +G F ++ DG         Y     S LL+     +++ FAL      F  
Sbjct  72    RRLMRLLVFSGFFARERDGNSHDHDEELYIPTTMSALLVNQKDVNVSSFALAMLDQMFLH  131

Query  390   PWQHVSEWFHNDD--PTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYC  563
             PW H+S W   D+   TP + A+GK  W+  SQ P FN   N+ MAS++  V  +V + C
Sbjct  132   PWYHLSSWLKQDNLPATPLEAAHGKGVWEATSQSPAFNSLLNEGMASDARFVAKVVVEEC  191

Query  564   REVFEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLE  743
              E+F GL SLVDVGGGTG +ARA+AD++P +KC+VLDLP VVA  E  + +  VAG+M +
Sbjct  192   GEIFRGLSSLVDVGGGTGTMARAIADDYPHVKCTVLDLPQVVASSEAGETVQLVAGDMFQ  251

Query  744   VIPPAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnd  923
              +PPA AV+LK ++H+W+DEDCVKILK CKEA+P+ E GGKVII++M++         + 
Sbjct  252   YVPPADAVLLKWVLHDWSDEDCVKILKRCKEAVPSEEKGGKVIIIEMVVD-------FDI  304

Query  924   dddELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYK-TTQLGLMSLIQLF  1091
                EL +TQ+  D+H+MV   G++R   EW  IF DAGFT+YK T+ LGL S+I+++
Sbjct  305   RSPELAETQLLFDMHIMVQTTGKQRNKYEWRNIFIDAGFTNYKITSALGLRSIIEVY  361



>ref|XP_004229155.1| PREDICTED: myricetin O-methyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=352

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 237/349 (68%), Gaps = 11/349 (3%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAI-NKAKADHL  236
             ++ AQ  IWN+IFNFI+SS+++CA QLGIPDV+++H +P+ L ++   L++ N +K   L
Sbjct  11    LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  237   GRLMRVLTRTGIFIKDDDGYALGPPSCLLIKDHPFSMAPFALGATGPTFTGPWQHVSEWF  416
               LM+ L ++G   + +D Y+L P SCLL KD PF++    L   G  F+  W  +S+WF
Sbjct  71    PILMQFLVQSGFLNQHEDHYSLTPASCLLAKDDPFNVRSLLLLNHGQAFSKAWPELSDWF  130

Query  417   HNDDPTPYQTAYGKTFWDRVSQDPE--FNHHFNQAMASNSLLVMSLVKKYCREVFEGLDS  590
              ND PTP+ TA+GK+ WD + ++        FN A+AS+S L  +++   C+ VFEGL S
Sbjct  131   QNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIAECKHVFEGLTS  190

Query  591   LVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIPPAQAVV  770
             LVDVGGGTG V+ A+A  FP++KC+VLDLP VV  L+G+ NL +V G+M ++IP   A++
Sbjct  191   LVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSGNLDFVGGDMFDMIPHTNAIL  250

Query  771   LKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddnddddELIQTQ  950
             LK ++H+WNDEDCVK+LK CKE+IP+RE GGKVII+D ++   +         +E ++ Q
Sbjct  251   LKCVLHDWNDEDCVKVLKKCKESIPSREKGGKVIIIDTVLEDPKQS-------NEFVRAQ  303

Query  951   IFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKT-TQLGLMSLIQLFP  1094
                 + MMV F  +ER  KEW K+F++AGFT+YK    LGL SLI+++P
Sbjct  304   HNMGMLMMVLFAAKERTEKEWEKLFSEAGFTEYKIFPALGLRSLIEIYP  352



>gb|AAR02421.1| putative O-methyltransferase [Catharanthus roseus]
 gb|AAR02422.1| putative O-methyltransferase [Catharanthus roseus]
Length=354

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 230/355 (65%), Gaps = 16/355 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKADHL  236
             E   AQ HIW+  F+FI  +SLKCA+QLGI D I  HG+P+ L +L +TL IN +K+ +L
Sbjct  7     EFRKAQVHIWSQSFSFITCASLKCALQLGIADAIENHGKPMALSDLTNTLQINPSKSQYL  66

Query  237   GRLMRVLTRTGIFIKDDDG--------YALGPPSCLLIKDHPFSMAPFALGATGPTFTGP  392
              RLMR+L  +G F +   G        Y L P   LL+K+ P ++    L    P     
Sbjct  67    PRLMRLLVNSGFFSEQQLGDAGGGENVYGLTPSMRLLLKNEPLNLRGIVLPMLDPLQIKA  126

Query  393   WQHVSEWFHNDDPTPYQTAYGKTFWDRVSQDPEFNHHFNQAMASNSLLVMSLVKKYCREV  572
             W  +  WF N+D T ++TA+GK++WD V++DP+    F + MAS+SLLV   V    + +
Sbjct  127   WNSLGNWFKNEDGTAFETAHGKSYWDCVTEDPKDVEIFTETMASDSLLVAKFVITEHKSL  186

Query  573   FEGLDSLVDVGGGTGMVARALADEFPDMKCSVLDLPHVVAGLEGTKNLVYVAGNMLEVIP  752
             FEGLDS++DVGG TG  ARA+A+ FP +KC+VLDLP  VA +E T NL +V GNM E IP
Sbjct  187   FEGLDSIIDVGGSTGTFARAIAESFPSLKCTVLDLPETVANIEPTNNLEFVGGNMFEKIP  246

Query  753   PAQAVVLKMIMHNWNDEDCVKILKNCKEAIPNRENGGKVIILDMIMGSTQNRdddndddd  932
             PA  V LKM++H+WNDEDCVKILKNC++AIP +E GGKVI+++ ++    +       D 
Sbjct  247   PAHVVFLKMVLHDWNDEDCVKILKNCRKAIPEKEKGGKVILIETVVQGQMH-------DS  299

Query  933   ELIQTQIFADVHMMVNFGGRERKLKEWVKIFNDAGFTDYKTTQL-GLMSLIQLFP  1094
             E ++TQI  D+ M+V+FG +ER  KEW  +F +AGF+ YK   +  + SLI+++P
Sbjct  300   ESVKTQIAMDMDMLVSFGTKERTEKEWEILFKEAGFSSYKIFPIVDIRSLIEVYP  354



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3497077529660