BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24761_g9_i1 len=1741 path=[9991:0-1740]

Length=1741
                                                                      Score     E

gb|AAZ76711.1|  calcium-dependent protein kinase 2                      833   0.0     Petunia integrifolia subsp. inflata
ref|XP_009791661.1|  PREDICTED: calcium-dependent protein kinase ...    826   0.0     
ref|XP_009588394.1|  PREDICTED: calcium-dependent protein kinase ...    822   0.0     
ref|XP_006347286.1|  PREDICTED: calcium-dependent protein kinase ...    820   0.0     
ref|XP_011073922.1|  PREDICTED: calcium-dependent protein kinase ...    800   0.0     
ref|XP_010322474.1|  PREDICTED: calcium-dependent protein kinase 24     781   0.0     
emb|CDP18751.1|  unnamed protein product                                778   0.0     
ref|XP_009791662.1|  PREDICTED: calcium-dependent protein kinase ...    771   0.0     
ref|XP_009588395.1|  PREDICTED: calcium-dependent protein kinase ...    767   0.0     
gb|EYU36734.1|  hypothetical protein MIMGU_mgv1a004648mg                745   0.0     
ref|XP_002533526.1|  calcium-dependent protein kinase, putative         730   0.0     Ricinus communis
ref|XP_002264388.1|  PREDICTED: calcium-dependent protein kinase 24     731   0.0     Vitis vinifera
emb|CBI36647.3|  unnamed protein product                                731   0.0     
gb|EPS70786.1|  calcium-dependent protein kinase 2                      724   0.0     
ref|XP_010097472.1|  Calcium-dependent protein kinase 24                723   0.0     
ref|XP_006443068.1|  hypothetical protein CICLE_v10024502mg             717   0.0     
ref|XP_010064519.1|  PREDICTED: calcium-dependent protein kinase ...    717   0.0     
gb|KDO43482.1|  hypothetical protein CISIN_1g043828mg                   719   0.0     
ref|XP_008454033.1|  PREDICTED: calcium-dependent protein kinase 24     716   0.0     
ref|XP_002309814.2|  hypothetical protein POPTR_0007s02120g             715   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006494199.1|  PREDICTED: calcium-dependent protein kinase ...    717   0.0     
ref|XP_007034055.1|  Calcium-dependent protein kinase 24                714   0.0     
ref|XP_008379556.1|  PREDICTED: calcium-dependent protein kinase ...    713   0.0     
ref|XP_004152305.1|  PREDICTED: calcium-dependent protein kinase ...    712   0.0     
ref|XP_009357126.1|  PREDICTED: calcium-dependent protein kinase ...    711   0.0     
ref|XP_008222646.1|  PREDICTED: calcium-dependent protein kinase 24     710   0.0     
ref|XP_011026389.1|  PREDICTED: calcium-dependent protein kinase 24     708   0.0     
ref|XP_002879331.1|  calcium-dependent protein kinase 24                709   0.0     
ref|XP_003539045.1|  PREDICTED: calcium-dependent protein kinase ...    707   0.0     
gb|ABK28519.1|  unknown                                                 707   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_180708.1|  calcium-dependent protein kinase 24                   707   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341917.1|  PREDICTED: calcium-dependent protein kinase ...    706   0.0     
dbj|BAC42531.1|  putative calcium-dependent protein kinase              706   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY15391.1|  BnaC04g42320D                                          705   0.0     
emb|CDY19084.1|  BnaA04g18240D                                          705   0.0     
ref|XP_010542759.1|  PREDICTED: calcium-dependent protein kinase ...    705   0.0     
ref|XP_010510191.1|  PREDICTED: calcium-dependent protein kinase ...    704   0.0     
ref|XP_003540704.1|  PREDICTED: calcium-dependent protein kinase ...    702   0.0     
gb|KFK31209.1|  hypothetical protein AALP_AA6G082200                    702   0.0     
gb|KFK31208.1|  hypothetical protein AALP_AA6G082200                    704   0.0     
ref|XP_010063913.1|  PREDICTED: calcium-dependent protein kinase ...    698   0.0     
ref|XP_007224369.1|  hypothetical protein PRUPE_ppa021005mg             700   0.0     
ref|XP_006410285.1|  hypothetical protein EUTSA_v10016430mg             701   0.0     
ref|XP_009132794.1|  PREDICTED: calcium-dependent protein kinase ...    700   0.0     
gb|KEH30304.1|  calmodulin-domain kinase CDPK protein                   698   0.0     
ref|XP_006296276.1|  hypothetical protein CARUB_v10025444mg             699   0.0     
ref|XP_010414119.1|  PREDICTED: calcium-dependent protein kinase ...    697   0.0     
ref|XP_007131964.1|  hypothetical protein PHAVU_011G055400g             696   0.0     
emb|CDY10809.1|  BnaA05g11270D                                          696   0.0     
ref|XP_010414118.1|  PREDICTED: calcium-dependent protein kinase ...    697   0.0     
ref|XP_009144199.1|  PREDICTED: calcium-dependent protein kinase ...    696   0.0     
ref|XP_004507322.1|  PREDICTED: calcium-dependent protein kinase ...    694   0.0     
emb|CDY34489.1|  BnaC04g13100D                                          694   0.0     
ref|XP_004309617.1|  PREDICTED: calcium-dependent protein kinase ...    693   0.0     
ref|XP_009141160.1|  PREDICTED: calcium-dependent protein kinase ...    695   0.0     
ref|XP_010473923.1|  PREDICTED: calcium-dependent protein kinase ...    692   0.0     
ref|XP_010522188.1|  PREDICTED: calcium-dependent protein kinase 24     691   0.0     
ref|XP_004507321.1|  PREDICTED: calcium-dependent protein kinase ...    689   0.0     
ref|XP_009132795.1|  PREDICTED: calcium-dependent protein kinase ...    689   0.0     
emb|CDY23939.1|  BnaC03g17520D                                          689   0.0     
gb|KHN06216.1|  Calcium-dependent protein kinase 24                     686   0.0     
ref|XP_010671825.1|  PREDICTED: calcium-dependent protein kinase 24     686   0.0     
gb|AHG06451.1|  calcium-dependent protein kinase 24                     682   0.0     
ref|XP_009144198.1|  PREDICTED: calcium-dependent protein kinase ...    681   0.0     
ref|XP_010268121.1|  PREDICTED: calcium-dependent protein kinase ...    676   0.0     
ref|XP_010268123.1|  PREDICTED: calcium-dependent protein kinase ...    667   0.0     
ref|XP_010268125.1|  PREDICTED: calcium-dependent protein kinase ...    665   0.0     
ref|XP_010268124.1|  PREDICTED: calcium-dependent protein kinase ...    665   0.0     
ref|XP_010268122.1|  PREDICTED: calcium-dependent protein kinase ...    666   0.0     
ref|XP_008804559.1|  PREDICTED: calcium-dependent protein kinase ...    661   0.0     
ref|XP_010278963.1|  PREDICTED: calcium-dependent protein kinase ...    659   0.0     
ref|XP_010931028.1|  PREDICTED: calcium-dependent protein kinase 32     659   0.0     
gb|EYU46253.1|  hypothetical protein MIMGU_mgv1a004318mg                659   0.0     
ref|XP_007015067.1|  Calcium-dependent protein kinase 19 isoform 1      659   0.0     
ref|XP_010257203.1|  PREDICTED: calcium-dependent protein kinase ...    657   0.0     
ref|XP_010912114.1|  PREDICTED: calcium-dependent protein kinase ...    658   0.0     
ref|XP_008227350.1|  PREDICTED: calcium-dependent protein kinase ...    655   0.0     
ref|XP_008776719.1|  PREDICTED: calcium-dependent protein kinase ...    655   0.0     
ref|XP_010453327.1|  PREDICTED: calcium-dependent protein kinase 7      655   0.0     
ref|XP_008796072.1|  PREDICTED: calcium-dependent protein kinase ...    654   0.0     
ref|XP_010930196.1|  PREDICTED: calcium-dependent protein kinase ...    654   0.0     
ref|XP_006289217.1|  hypothetical protein CARUB_v10002666mg             654   0.0     
ref|XP_002873580.1|  calmodulin-domain protein kinase 7                 653   0.0     
emb|CAG27839.1|  calcium-dependent protein kinase 8                     653   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KFK25522.1|  calcium-dependent protein kinase 19                     653   0.0     
ref|XP_006838340.1|  hypothetical protein AMTR_s00103p00151780          653   0.0     
ref|XP_004139037.1|  PREDICTED: calcium-dependent protein kinase ...    651   0.0     
ref|XP_003562873.1|  PREDICTED: calcium-dependent protein kinase ...    652   0.0     
emb|CDX97205.1|  BnaC09g44200D                                          651   0.0     
ref|XP_004154632.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    651   0.0     
ref|XP_009414742.1|  PREDICTED: calcium-dependent protein kinase 7      651   0.0     
ref|XP_009121835.1|  PREDICTED: calcium-dependent protein kinase 7      651   0.0     
ref|XP_006657859.1|  PREDICTED: calcium-dependent protein kinase ...    652   0.0     
emb|CDX72022.1|  BnaC08g28520D                                          651   0.0     
emb|CDY06098.1|  BnaA09g36820D                                          651   0.0     
emb|CDY33817.1|  BnaCnng07350D                                          651   0.0     
gb|AGG35976.1|  calcium-dependent protein kinase 7                      650   0.0     
ref|NP_001060031.1|  Os07g0568600                                       651   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|AEI70328.1|  calcium-dependent protein kinase                        650   0.0     
ref|XP_006402868.1|  hypothetical protein EUTSA_v10005884mg             650   0.0     
ref|XP_009769547.1|  PREDICTED: calcium-dependent protein kinase ...    649   0.0     
ref|XP_004250931.1|  PREDICTED: calcium-dependent protein kinase ...    649   0.0     
ref|XP_011075228.1|  PREDICTED: calcium-dependent protein kinase ...    649   0.0     
dbj|BAJ96261.1|  predicted protein                                      649   0.0     
ref|XP_008786134.1|  PREDICTED: calcium-dependent protein kinase ...    649   0.0     
ref|NP_568281.1|  calmodulin-domain protein kinase 7                    649   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116455.1|  PREDICTED: calcium-dependent protein kinase 32     649   0.0     
ref|XP_009104064.1|  PREDICTED: calcium-dependent protein kinase 32     649   0.0     
ref|XP_006489930.1|  PREDICTED: calcium-dependent protein kinase ...    648   0.0     
emb|CDX67695.1|  BnaA07g17350D                                          648   0.0     
ref|XP_002529620.1|  calcium-dependent protein kinase, putative         648   0.0     Ricinus communis
gb|ABY59017.1|  calcium-dependent protein kinase                        648   0.0     Triticum aestivum [Canadian hard winter wheat]
gb|EAZ04388.1|  hypothetical protein OsI_26532                          649   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_008810968.1|  PREDICTED: calcium-dependent protein kinase ...    648   0.0     
gb|AHG06453.1|  calcium-dependent protein kinase 32                     648   0.0     
gb|KDO53691.1|  hypothetical protein CISIN_1g009367mg                   647   0.0     
ref|XP_009617561.1|  PREDICTED: calcium-dependent protein kinase ...    647   0.0     
ref|XP_006421421.1|  hypothetical protein CICLE_v10004707mg             647   0.0     
ref|XP_009386117.1|  PREDICTED: calcium-dependent protein kinase ...    647   0.0     
ref|XP_011090028.1|  PREDICTED: calcium-dependent protein kinase ...    647   0.0     
ref|XP_010419839.1|  PREDICTED: calcium-dependent protein kinase ...    647   0.0     
ref|NP_191312.2|  calcium-dependent protein kinase 32                   647   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025545.1|  PREDICTED: calcium-dependent protein kinase ...    647   0.0     
ref|XP_002283549.2|  PREDICTED: calcium-dependent protein kinase 32     646   0.0     Vitis vinifera
gb|AGI21023.1|  calcium-dependent protein kinase 3                      646   0.0     
gb|EMT32905.1|  hypothetical protein F775_52262                         646   0.0     
ref|XP_010923436.1|  PREDICTED: calcium-dependent protein kinase ...    645   0.0     
gb|AAZ30035.1|  putative calcium-dependent protein kinase               646   0.0     Isatis tinctoria [woad]
ref|XP_010092921.1|  Calcium-dependent protein kinase 8                 645   0.0     
ref|XP_010516369.1|  PREDICTED: calcium-dependent protein kinase 32     645   0.0     
ref|XP_009394399.1|  PREDICTED: calcium-dependent protein kinase ...    645   0.0     
emb|CAB66110.1|  calcium-dependent protein kinase                       646   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767518.1|  PREDICTED: calcium-dependent protein kinase ...    645   0.0     
gb|KCW87677.1|  hypothetical protein EUGRSUZ_A00058                     640   0.0     
gb|KGN48128.1|  hypothetical protein Csa_6G439940                       645   0.0     
ref|XP_008344697.1|  PREDICTED: calcium-dependent protein kinase ...    644   0.0     
ref|XP_008449704.1|  PREDICTED: calcium-dependent protein kinase ...    644   0.0     
gb|AFR11232.1|  calcium dependent protein kinase 3                      644   0.0     
ref|XP_002513496.1|  calcium-dependent protein kinase, putative         644   0.0     Ricinus communis
ref|XP_010492013.1|  PREDICTED: calcium-dependent protein kinase ...    644   0.0     
ref|XP_002463047.1|  hypothetical protein SORBIDRAFT_02g036730          644   0.0     Sorghum bicolor [broomcorn]
ref|XP_006366539.1|  PREDICTED: calcium-dependent protein kinase ...    644   0.0     
ref|XP_008450417.1|  PREDICTED: calcium-dependent protein kinase ...    644   0.0     
ref|NP_001147084.1|  LOC100280693                                       644   0.0     Zea mays [maize]
ref|XP_006290868.1|  hypothetical protein CARUB_v10016977mg             644   0.0     
ref|XP_009126361.1|  PREDICTED: calcium-dependent protein kinase 8      644   0.0     
emb|CDY44918.1|  BnaA02g04230D                                          643   0.0     
ref|XP_010427632.1|  PREDICTED: calcium-dependent protein kinase ...    643   0.0     
gb|AGG35977.1|  calcium-dependent protein kinase 8                      643   0.0     
ref|XP_011015928.1|  PREDICTED: calcium-dependent protein kinase ...    643   0.0     
ref|XP_009120885.1|  PREDICTED: calcium-dependent protein kinase ...    643   0.0     
gb|AHN16203.1|  CPK8-2.1                                                643   0.0     
ref|XP_011078890.1|  PREDICTED: calcium-dependent protein kinase ...    643   0.0     
ref|XP_002313342.1|  calcium-dependent protein kinase 1                 643   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002878160.1|  calcium-dependent protein kinase 32                643   0.0     
ref|XP_010555020.1|  PREDICTED: calcium-dependent protein kinase 8      643   0.0     
ref|XP_004291780.1|  PREDICTED: calcium-dependent protein kinase ...    643   0.0     
ref|XP_007028795.1|  Calcium-dependent protein kinase 19                643   0.0     
ref|XP_006489929.1|  PREDICTED: calcium-dependent protein kinase ...    643   0.0     
emb|CDY14001.1|  BnaC09g38250D                                          642   0.0     
ref|XP_010546723.1|  PREDICTED: calcium-dependent protein kinase ...    642   0.0     
emb|CDX92529.1|  BnaA10g15680D                                          642   0.0     
ref|XP_006400505.1|  hypothetical protein EUTSA_v10013210mg             642   0.0     
ref|XP_009603083.1|  PREDICTED: calcium-dependent protein kinase ...    642   0.0     
gb|KDO53692.1|  hypothetical protein CISIN_1g009367mg                   642   0.0     
gb|KDP22101.1|  hypothetical protein JCGZ_25932                         642   0.0     
ref|XP_008648353.1|  PREDICTED: calcium-dependent protein kinase ...    642   0.0     
ref|NP_001151532.1|  calcium-dependent protein kinase, isoform AK1      642   0.0     Zea mays [maize]
ref|XP_002299904.1|  calcium-dependent protein kinase 1                 641   0.0     Populus trichocarpa [western balsam poplar]
gb|KFK35001.1|  hypothetical protein AALP_AA5G221300                    641   0.0     
ref|XP_006446133.1|  hypothetical protein CICLE_v10014873mg             641   0.0     
ref|XP_009369698.1|  PREDICTED: calcium-dependent protein kinase ...    641   0.0     
ref|XP_009369699.1|  PREDICTED: calcium-dependent protein kinase ...    641   0.0     
ref|XP_006351684.1|  PREDICTED: calcium-dependent protein kinase ...    641   0.0     
emb|CDP20654.1|  unnamed protein product                                641   0.0     
ref|XP_011033316.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_004958070.1|  PREDICTED: calcium-dependent protein kinase ...    641   0.0     
ref|XP_008339082.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_009395591.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_002322709.1|  calcium-dependent protein kinase                   640   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010523987.1|  PREDICTED: calcium-dependent protein kinase 32     640   0.0     
ref|XP_006843576.1|  hypothetical protein AMTR_s00007p00105480          640   0.0     
ref|XP_009374942.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_010504682.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_009374937.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
gb|KHG04812.1|  Calcium-dependent protein kinase 7                      641   0.0     
ref|XP_008339084.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_009366097.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
ref|XP_009393522.1|  PREDICTED: calcium-dependent protein kinase ...    640   0.0     
gb|ADO79931.1|  calcium-dependent protein kinase 8                      640   0.0     
ref|XP_009767418.1|  PREDICTED: calcium-dependent protein kinase ...    639   0.0     
ref|NP_197446.1|  calcium-dependent protein kinase 19                   639   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHG11892.1|  Calcium-dependent protein kinase 32                     639   0.0     
ref|XP_002873948.1|  calcium-dependent protein kinase 19                639   0.0     
ref|XP_009396383.1|  PREDICTED: calcium-dependent protein kinase ...    639   0.0     
ref|XP_009597085.1|  PREDICTED: calcium-dependent protein kinase ...    639   0.0     
gb|EYU18750.1|  hypothetical protein MIMGU_mgv1a004372mg                639   0.0     
ref|XP_004228520.1|  PREDICTED: calcium-dependent protein kinase 8      639   0.0     
ref|XP_011045425.1|  PREDICTED: calcium-dependent protein kinase ...    638   0.0     
ref|XP_009758772.1|  PREDICTED: calcium-dependent protein kinase ...    638   0.0     
gb|AAB88537.1|  calcium-dependent protein kinase                        638   0.0     Fragaria x ananassa
dbj|BAE99123.1|  calcium-dependent protein kinase                       635   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ACX37460.1|  calcium dependent protein kinase 32                     638   0.0     Gossypium hirsutum [American cotton]
ref|XP_010667055.1|  PREDICTED: calcium-dependent protein kinase ...    637   0.0     
ref|XP_010057284.1|  PREDICTED: calcium-dependent protein kinase 32     637   0.0     
ref|XP_010102356.1|  Calcium-dependent protein kinase 8                 639   0.0     
ref|XP_006287466.1|  hypothetical protein CARUB_v10000678mg             637   0.0     
dbj|BAJ53260.1|  JMS10C05.3                                             637   0.0     
gb|AIU98506.1|  calcium-dependent protein kinase                        636   0.0     
ref|XP_009615654.1|  PREDICTED: calcium-dependent protein kinase ...    636   0.0     
gb|KHN25281.1|  Calcium-dependent protein kinase 24                     632   0.0     
gb|EMS57373.1|  Calcium-dependent protein kinase 7                      636   0.0     
ref|XP_010454221.1|  PREDICTED: calcium-dependent protein kinase 8      635   0.0     
ref|XP_010493012.1|  PREDICTED: calcium-dependent protein kinase ...    635   0.0     
ref|XP_003554179.1|  PREDICTED: calcium-dependent protein kinase ...    635   0.0     
ref|XP_011071722.1|  PREDICTED: calcium-dependent protein kinase ...    635   0.0     
ref|XP_004304393.1|  PREDICTED: calcium-dependent protein kinase ...    634   0.0     
ref|XP_011020349.1|  PREDICTED: calcium-dependent protein kinase ...    634   0.0     
gb|EYU31372.1|  hypothetical protein MIMGU_mgv1a004319mg                634   0.0     
ref|XP_010922561.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    634   0.0     
ref|XP_006646451.1|  PREDICTED: calcium-dependent protein kinase ...    634   0.0     
ref|XP_004963720.1|  PREDICTED: calcium-dependent protein kinase ...    634   0.0     
ref|XP_011087204.1|  PREDICTED: calcium-dependent protein kinase 10     634   0.0     
ref|XP_008465111.1|  PREDICTED: calcium-dependent protein kinase ...    633   0.0     
gb|AEY55359.1|  calcium-dependent protein kinase                        633   0.0     
ref|XP_004150764.1|  PREDICTED: calcium-dependent protein kinase ...    633   0.0     
gb|KEH23659.1|  calmodulin-domain kinase CDPK protein                   632   0.0     
gb|AFW78312.1|  putative calcium-dependent protein kinase family ...    633   0.0     
ref|XP_007162235.1|  hypothetical protein PHAVU_001G135300g             632   0.0     
ref|NP_001266123.1|  calcium-dependent protein kinase 32-like           632   0.0     
ref|XP_004249195.1|  PREDICTED: calcium-dependent protein kinase ...    632   0.0     
ref|XP_008662648.1|  PREDICTED: calcium-dependent protein kinase ...    633   0.0     
ref|XP_002442035.1|  hypothetical protein SORBIDRAFT_08g007660          633   0.0     Sorghum bicolor [broomcorn]
gb|EPS73534.1|  calcium-dependent protein kinase 8                      632   0.0     
gb|AGI21022.1|  calcium-dependent protein kinase 2                      632   0.0     
ref|XP_009344460.1|  PREDICTED: calcium-dependent protein kinase ...    631   0.0     
ref|XP_004981335.1|  PREDICTED: calcium-dependent protein kinase ...    631   0.0     
gb|KHG01410.1|  Calcium-dependent protein kinase 32                     631   0.0     
ref|XP_008654304.1|  PREDICTED: uncharacterized protein LOC100192...    631   0.0     
ref|XP_002456584.1|  hypothetical protein SORBIDRAFT_03g038870          631   0.0     Sorghum bicolor [broomcorn]
ref|XP_002466239.1|  hypothetical protein SORBIDRAFT_01g004150          630   0.0     Sorghum bicolor [broomcorn]
gb|EEC71743.1|  hypothetical protein OsI_04311                          631   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_006295937.1|  hypothetical protein CARUB_v10025074mg             630   0.0     
gb|ACN39928.1|  unknown                                                 630   0.0     Picea sitchensis
ref|NP_001051652.1|  Os03g0808600                                       630   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008370105.1|  PREDICTED: calcium-dependent protein kinase 13     629   0.0     
ref|NP_181717.3|  calcium-dependent protein kinase 14                   629   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ABK28533.1|  unknown                                                 629   0.0     Arabidopsis thaliana [mouse-ear cress]
tpg|DAA52087.1|  TPA: putative calcium-dependent protein kinase f...    629   0.0     
ref|NP_001149916.1|  calcium-dependent protein kinase, isoform AK1      629   0.0     Zea mays [maize]
ref|XP_008392224.1|  PREDICTED: calcium-dependent protein kinase ...    629   0.0     
gb|AAX07129.1|  calcium-dependent protein kinase 4                      629   0.0     Capsicum annuum
ref|NP_001066443.1|  Os12g0230200                                       630   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008387270.1|  PREDICTED: calcium-dependent protein kinase ...    629   0.0     
ref|XP_004970457.1|  PREDICTED: calcium-dependent protein kinase ...    629   0.0     
ref|XP_003568266.1|  PREDICTED: calcium-dependent protein kinase ...    629   0.0     
gb|ACN31716.1|  unknown                                                 629   0.0     Zea mays [maize]
ref|XP_010031782.1|  PREDICTED: calcium-dependent protein kinase 7      629   0.0     
ref|XP_007204103.1|  hypothetical protein PRUPE_ppa004069mg             629   0.0     
gb|KEH31900.1|  calmodulin-domain kinase CDPK protein                   629   0.0     
ref|XP_002441242.1|  hypothetical protein SORBIDRAFT_09g022960          629   0.0     Sorghum bicolor [broomcorn]
ref|XP_009379635.1|  PREDICTED: calcium-dependent protein kinase ...    628   0.0     
ref|XP_008805325.1|  PREDICTED: calcium-dependent protein kinase ...    629   0.0     
emb|CBI16361.3|  unnamed protein product                                627   0.0     
ref|XP_010517669.1|  PREDICTED: calcium-dependent protein kinase ...    628   0.0     
ref|XP_010505967.1|  PREDICTED: calcium-dependent protein kinase 14     628   0.0     
ref|XP_003521182.1|  PREDICTED: calcium-dependent protein kinase ...    628   0.0     
ref|XP_008805015.1|  PREDICTED: calcium-dependent protein kinase ...    629   0.0     
ref|NP_973661.1|  calcium-dependent protein kinase 14                   627   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009374132.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|XP_010227954.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|XP_002264564.1|  PREDICTED: calcium-dependent protein kinase 13     627   0.0     Vitis vinifera
ref|XP_006351224.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|XP_003518115.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
gb|AAQ14564.1|  protein kinase-like protein                             629   0.0     Oryza sativa [red rice]
ref|XP_009338170.1|  PREDICTED: calcium-dependent protein kinase 13     627   0.0     
dbj|BAB92912.1|  putative calcium dependent protein kinase              628   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564533.1|  PREDICTED: calcium-dependent protein kinase 13     627   0.0     
ref|NP_001148079.1|  LOC100281687                                       627   0.0     Zea mays [maize]
ref|XP_004960751.1|  PREDICTED: calcium-dependent protein kinase ...    628   0.0     
gb|AEL88279.1|  calcium-dependent protein kinase                        627   0.0     
ref|XP_006650768.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|XP_009393785.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|NP_001055790.1|  Os05g0467000                                       627   0.0     
ref|XP_010678598.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|XP_002881805.1|  calcium-dependent protein kinase 14                626   0.0     
ref|XP_003522347.1|  PREDICTED: calcium-dependent protein kinase ...    627   0.0     
ref|XP_002308958.1|  calcium-dependent protein kinase                   625   0.0     
ref|XP_008654607.1|  PREDICTED: uncharacterized protein LOC100273...    625   0.0     
ref|XP_010272208.1|  PREDICTED: calcium-dependent protein kinase ...    626   0.0     
emb|CDM84844.1|  unnamed protein product                                625   0.0     
ref|XP_004508790.1|  PREDICTED: calcium-dependent protein kinase ...    625   0.0     
dbj|BAK05737.1|  predicted protein                                      625   0.0     
gb|AGJ83808.1|  calcium-dependent protein kinase 2a                     624   0.0     
ref|XP_010907403.1|  PREDICTED: calcium-dependent protein kinase ...    625   0.0     
emb|CDP14887.1|  unnamed protein product                                624   0.0     
ref|XP_006838800.1|  hypothetical protein AMTR_s00002p00260590          624   0.0     
ref|XP_010253754.1|  PREDICTED: calcium-dependent protein kinase 13     623   0.0     
gb|KEH41585.1|  calmodulin-domain kinase CDPK protein                   623   0.0     
ref|XP_003537286.1|  PREDICTED: calcium-dependent protein kinase ...    623   0.0     
ref|XP_007037189.1|  Calcium-dependent protein kinase 30 isoform 1      624   0.0     
ref|XP_002282757.3|  PREDICTED: calcium-dependent protein kinase 8      625   0.0     
ref|XP_010256099.1|  PREDICTED: calcium-dependent protein kinase ...    624   0.0     
ref|XP_008805014.1|  PREDICTED: calcium-dependent protein kinase ...    623   0.0     
dbj|BAK03003.1|  predicted protein                                      623   0.0     
ref|XP_001783438.1|  predicted protein                                  622   0.0     
ref|XP_006439667.1|  hypothetical protein CICLE_v10019541mg             623   0.0     
ref|XP_010508676.1|  PREDICTED: calcium-dependent protein kinase ...    622   0.0     
ref|XP_007026683.1|  Calcium-dependent protein kinase 13 isoform 2      622   0.0     
ref|XP_009389540.1|  PREDICTED: calcium-dependent protein kinase ...    622   0.0     
ref|XP_010264623.1|  PREDICTED: calcium-dependent protein kinase ...    621   0.0     
gb|ABY59006.1|  calcium-dependent protein kinase                        622   0.0     
gb|KDP24440.1|  hypothetical protein JCGZ_25004                         621   0.0     
ref|XP_003529159.1|  PREDICTED: calcium-dependent protein kinase ...    621   0.0     
ref|XP_010673649.1|  PREDICTED: calcium-dependent protein kinase ...    621   0.0     
gb|EYU26671.1|  hypothetical protein MIMGU_mgv1a004415mg                620   0.0     
ref|XP_010112584.1|  Calcium-dependent protein kinase 30                621   0.0     
ref|XP_010037633.1|  PREDICTED: calcium-dependent protein kinase ...    621   0.0     
ref|XP_011095019.1|  PREDICTED: calcium-dependent protein kinase 13     620   0.0     
ref|XP_007145611.1|  hypothetical protein PHAVU_007G253300g             620   0.0     
ref|XP_007208475.1|  hypothetical protein PRUPE_ppa004141mg             620   0.0     
ref|XP_009369367.1|  PREDICTED: calcium-dependent protein kinase ...    621   0.0     
ref|XP_009799171.1|  PREDICTED: calcium-dependent protein kinase 13     620   0.0     
ref|XP_001778104.1|  predicted protein                                  622   0.0     
ref|XP_002323583.1|  calcium-dependent protein kinase                   620   0.0     
ref|XP_006411456.1|  hypothetical protein EUTSA_v10016499mg             620   0.0     
gb|ACG27772.1|  calcium-dependent protein kinase 2                      620   0.0     
ref|XP_004302545.1|  PREDICTED: calcium-dependent protein kinase ...    620   0.0     
gb|ABY28389.1|  calcium-dependent protein kinase 1                      620   0.0     
ref|XP_011077546.1|  PREDICTED: calcium-dependent protein kinase 13     620   0.0     
ref|XP_001783436.1|  cpk15 calcium-dependent protein kinase             619   0.0     
ref|XP_004152446.1|  PREDICTED: calcium-dependent protein kinase ...    620   0.0     
ref|XP_006476669.1|  PREDICTED: calcium-dependent protein kinase ...    620   0.0     
ref|XP_008437701.1|  PREDICTED: calcium-dependent protein kinase 10     620   0.0     
ref|XP_011004764.1|  PREDICTED: calcium-dependent protein kinase 13     619   0.0     
ref|NP_001132098.1|  uncharacterized protein LOC100193514               619   0.0     
ref|XP_004157809.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    620   0.0     
gb|ABY59013.1|  calcium-dependent protein kinase                        620   0.0     
ref|XP_007155355.1|  hypothetical protein PHAVU_003G194100g             619   0.0     
ref|NP_001265972.1|  Hop-interacting protein THI080                     619   0.0     
ref|XP_009758773.1|  PREDICTED: calcium-dependent protein kinase ...    618   0.0     
ref|XP_008374510.1|  PREDICTED: calcium-dependent protein kinase ...    619   0.0     
ref|XP_009588980.1|  PREDICTED: calcium-dependent protein kinase 13     619   0.0     
ref|XP_004299607.1|  PREDICTED: calcium-dependent protein kinase ...    619   0.0     
gb|KHG15609.1|  Calcium-dependent protein kinase 13                     618   0.0     
ref|XP_002533636.1|  calcium-dependent protein kinase, putative         618   0.0     
dbj|BAJ91363.1|  predicted protein                                      618   0.0     
ref|XP_009115888.1|  PREDICTED: calcium-dependent protein kinase ...    617   0.0     
ref|XP_004246755.1|  PREDICTED: calcium-dependent protein kinase 13     617   0.0     
gb|EYU20737.1|  hypothetical protein MIMGU_mgv1a004430mg                617   0.0     
ref|XP_008239655.1|  PREDICTED: calcium-dependent protein kinase 10     618   0.0     
gb|EYU41908.1|  hypothetical protein MIMGU_mgv1a004417mg                617   0.0     
ref|XP_003528177.1|  PREDICTED: calcium-dependent protein kinase ...    618   0.0     
ref|XP_002511506.1|  calcium-dependent protein kinase, putative         617   0.0     
gb|EEC79374.1|  hypothetical protein OsI_20273                          618   0.0     
ref|XP_008240991.1|  PREDICTED: calcium-dependent protein kinase ...    617   0.0     
ref|XP_009594933.1|  PREDICTED: calcium-dependent protein kinase ...    617   0.0     
ref|XP_006367515.1|  PREDICTED: calcium-dependent protein kinase ...    617   0.0     
ref|XP_009777763.1|  PREDICTED: calcium-dependent protein kinase ...    617   0.0     
gb|KFK37028.1|  hypothetical protein AALP_AA4G202800                    616   0.0     
ref|XP_006367705.1|  PREDICTED: calcium-dependent protein kinase ...    617   0.0     
ref|XP_007157659.1|  hypothetical protein PHAVU_002G087800g             617   0.0     
ref|XP_010553242.1|  PREDICTED: calcium-dependent protein kinase 13     616   0.0     
gb|ADM64334.1|  calcium-dependent protein kinase 9                      616   0.0     
gb|EEE64023.1|  hypothetical protein OsJ_18852                          618   0.0     
gb|EYU35895.1|  hypothetical protein MIMGU_mgv1a003708mg                617   0.0     
gb|AGQ20410.1|  calcium dependent protein kinase 1                      616   0.0     
gb|KDP31193.1|  hypothetical protein JCGZ_11569                         617   0.0     
emb|CDP06474.1|  unnamed protein product                                615   0.0     
gb|ABF81834.2|  calcium-dependent protein kinase 1                      615   0.0     
ref|XP_007140274.1|  hypothetical protein PHAVU_008G098400g             615   0.0     
gb|KHG14764.1|  Calcium-dependent protein kinase 10                     616   0.0     
ref|XP_007209864.1|  hypothetical protein PRUPE_ppa003795mg             615   0.0     
ref|XP_002266733.1|  PREDICTED: calcium-dependent protein kinase 10     615   0.0     
ref|XP_002976252.1|  calcium dependent protein kinase 7                 614   0.0     
gb|AGS15003.1|  calcium-dependent protein kinase 30                     615   0.0     
ref|XP_004514214.1|  PREDICTED: calcium-dependent protein kinase ...    614   0.0     
ref|XP_002987149.1|  calcium dependent protein kinase                   614   0.0     
ref|XP_006429404.1|  hypothetical protein CICLE_v10011471mg             614   0.0     
gb|AAK62812.1|  calcium-dependent protein kinase                        613   0.0     
ref|XP_006660341.1|  PREDICTED: calcium-dependent protein kinase ...    612   0.0     
gb|ABY59012.1|  calcium-dependent protein kinase                        614   0.0     
gb|AFW67262.1|  putative calcium-dependent protein kinase family ...    614   0.0     
gb|EPS71785.1|  calcium-dependent protein kinase 1                      614   0.0     
ref|XP_009588939.1|  PREDICTED: calcium-dependent protein kinase ...    613   0.0     
ref|XP_009387133.1|  PREDICTED: calcium-dependent protein kinase ...    613   0.0     
ref|XP_009402234.1|  PREDICTED: calcium-dependent protein kinase ...    613   0.0     
ref|XP_001751709.1|  cpk14 calcium-dependent protein kinase             612   0.0     
ref|XP_001751721.1|  cpk13 calcium-dependent protein kinase             612   0.0     
gb|KEH23182.1|  calmodulin-domain kinase CDPK protein                   612   0.0     
ref|XP_009343435.1|  PREDICTED: calcium-dependent protein kinase ...    613   0.0     
emb|CDY23165.1|  BnaA04g05940D                                          612   0.0     
emb|CDX73684.1|  BnaC08g23190D                                          612   0.0     
ref|XP_009139503.1|  PREDICTED: calcium-dependent protein kinase 13     612   0.0     
gb|AAO42812.1|  At1g18890                                               612   0.0     
gb|AHN16205.1|  CPK13-2.1                                               611   0.0     
gb|AGG35966.1|  calcium-dependent protein kinase 13                     611   0.0     
ref|XP_003550764.1|  PREDICTED: calcium-dependent protein kinase ...    611   0.0     
emb|CDX95303.1|  BnaC04g28550D                                          610   0.0     
ref|XP_010528928.1|  PREDICTED: calcium-dependent protein kinase 13     610   0.0     
ref|XP_002876106.1|  calcium-dependent protein kinase 13                610   0.0     
ref|XP_001767801.1|  cpk5 calcium-dependent protein kinase              609   0.0     
ref|XP_006290893.1|  hypothetical protein CARUB_v10017005mg             609   0.0     
ref|XP_004513770.1|  PREDICTED: calcium-dependent protein kinase ...    609   0.0     
ref|NP_001291232.1|  calcium-dependent protein kinase 10-like           610   0.0     
gb|AGG35963.1|  calcium-dependent protein kinase 10                     610   0.0     
gb|KHN18515.1|  Calcium-dependent protein kinase 30                     607   0.0     
ref|XP_011019102.1|  PREDICTED: calcium-dependent protein kinase ...    609   0.0     
gb|EYU24427.1|  hypothetical protein MIMGU_mgv1a004139mg                609   0.0     
ref|XP_011019101.1|  PREDICTED: calcium-dependent protein kinase ...    609   0.0     
gb|AAN11310.1|  calmodulin domain protein kinase 1                      608   0.0     
emb|CDY29049.1|  BnaC07g32550D                                          608   0.0     
ref|XP_009117580.1|  PREDICTED: calcium-dependent protein kinase 10     608   0.0     
emb|CDY21691.1|  BnaA09g44420D                                          608   0.0     
emb|CDY19259.1|  BnaC05g14600D                                          610   0.0     
ref|NP_190753.2|  calcium-dependent protein kinase 13                   607   0.0     
ref|XP_009412526.1|  PREDICTED: calcium-dependent protein kinase ...    607   0.0     
ref|XP_002893022.1|  ATCDPK1                                            607   0.0     
ref|XP_006403875.1|  hypothetical protein EUTSA_v10010284mg             607   0.0     
ref|XP_009781200.1|  PREDICTED: calcium-dependent protein kinase ...    607   0.0     
ref|XP_003525029.1|  PREDICTED: calcium-dependent protein kinase ...    607   0.0     
gb|KFK34428.1|  hypothetical protein AALP_AA5G143600                    606   0.0     
ref|XP_010031280.1|  PREDICTED: calcium-dependent protein kinase 13     607   0.0     
ref|XP_010923302.1|  PREDICTED: calcium-dependent protein kinase ...    607   0.0     
ref|XP_009142021.1|  PREDICTED: calcium-dependent protein kinase ...    606   0.0     
ref|XP_006416554.1|  hypothetical protein EUTSA_v10007293mg             607   0.0     
ref|XP_007026682.1|  Calcium-dependent protein kinase 13 isoform 1      607   0.0     
gb|AHN16204.1|  CPK10-2.1                                               606   0.0     
ref|XP_010416328.1|  PREDICTED: calcium-dependent protein kinase ...    606   0.0     
gb|AAL32617.1|  calcium-dependent protein kinase                        605   0.0     
ref|XP_002888989.1|  calcium-dependent protein kinase 30                605   0.0     
ref|XP_010477091.1|  PREDICTED: calcium-dependent protein kinase ...    605   0.0     
ref|XP_009142786.1|  PREDICTED: calcium-dependent protein kinase 14     605   0.0     
ref|XP_011028700.1|  PREDICTED: calcium-dependent protein kinase ...    606   0.0     
ref|XP_010428465.1|  PREDICTED: calcium-dependent protein kinase ...    605   0.0     
ref|XP_010503891.1|  PREDICTED: calcium-dependent protein kinase ...    605   0.0     
ref|XP_002318616.1|  calcium-dependent protein kinase                   605   0.0     
ref|XP_010539953.1|  PREDICTED: calcium-dependent protein kinase 10     605   0.0     
ref|XP_008796649.1|  PREDICTED: calcium-dependent protein kinase ...    604   0.0     
ref|XP_009777418.1|  PREDICTED: calcium-dependent protein kinase ...    604   0.0     
ref|XP_009136637.1|  PREDICTED: calcium-dependent protein kinase ...    603   0.0     
ref|XP_006302109.1|  hypothetical protein CARUB_v10020106mg             604   0.0     
ref|XP_002322129.1|  calcium-dependent protein kinase                   604   0.0     
ref|XP_003578757.1|  PREDICTED: calcium-dependent protein kinase ...    605   0.0     
ref|XP_008442412.1|  PREDICTED: calcium-dependent protein kinase 13     603   0.0     
ref|NP_177612.2|  calcium-dependent protein kinase 30                   603   0.0     
ref|XP_004169977.1|  PREDICTED: calcium-dependent protein kinase ...    603   0.0     
ref|NP_564066.2|  calcium-dependent protein kinase 1                    603   0.0     
emb|CDX73108.1|  BnaC06g35560D                                          603   0.0     
ref|XP_006307186.1|  hypothetical protein CARUB_v10008777mg             603   0.0     
dbj|BAA04829.1|  calcium-dependent protein kinase                       601   0.0     
ref|XP_004137716.1|  PREDICTED: calcium-dependent protein kinase ...    601   0.0     
ref|XP_010459535.1|  PREDICTED: calcium-dependent protein kinase 10     601   0.0     
emb|CDY26714.1|  BnaA06g13080D                                          603   0.0     
gb|AHG06452.1|  calcium-dependent protein kinase 30                     601   0.0     
ref|XP_009106132.1|  PREDICTED: calcium-dependent protein kinase 30     600   0.0     
gb|EPS69569.1|  calcium-dependent protein kinase 8                      598   0.0     
ref|XP_006390395.1|  hypothetical protein EUTSA_v10018366mg             600   0.0     
gb|KFK44036.1|  hypothetical protein AALP_AA1G207300                    600   0.0     
gb|KFK41910.1|  hypothetical protein AALP_AA2G188200                    600   0.0     
emb|CDX90631.1|  BnaA03g41500D                                          599   0.0     
emb|CDY06900.1|  BnaA04g24150D                                          599   0.0     
ref|XP_010676748.1|  PREDICTED: calcium-dependent protein kinase 13     598   0.0     
ref|XP_009149374.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    599   0.0     
ref|XP_006399766.1|  hypothetical protein EUTSA_v10013170mg             599   0.0     
ref|XP_009388458.1|  PREDICTED: calcium-dependent protein kinase ...    599   0.0     
ref|XP_010104265.1|  Calcium-dependent protein kinase 13                598   0.0     
ref|XP_007211733.1|  hypothetical protein PRUPE_ppa006164mg             592   0.0     
gb|KCW88124.1|  hypothetical protein EUGRSUZ_A00519                     595   0.0     
ref|XP_006603539.1|  PREDICTED: calcium-dependent protein kinase ...    593   0.0     
ref|XP_008810836.1|  PREDICTED: calcium-dependent protein kinase ...    593   0.0     
ref|XP_006655393.1|  PREDICTED: calcium-dependent protein kinase ...    589   0.0     
ref|XP_010532303.1|  PREDICTED: calcium-dependent protein kinase ...    590   0.0     
gb|AHA61365.1|  calcium-dependent protein kinase                        585   0.0     
ref|XP_006664441.1|  PREDICTED: calcium-dependent protein kinase ...    581   0.0     
gb|KHN48651.1|  Calcium-dependent protein kinase 30                     580   0.0     
gb|EEE52973.1|  hypothetical protein OsJ_35636                          576   0.0     
emb|CDP18650.1|  unnamed protein product                                578   0.0     
gb|ABY59015.1|  calcium-dependent protein kinase                        580   0.0     
ref|NP_001050944.1|  Os03g0688300                                       579   0.0     
gb|AGR45434.2|  calcium-dependent protein kinase                        574   0.0     
gb|EMT14442.1|  Calcium-dependent protein kinase 7                      570   0.0     
gb|EMS55572.1|  Calcium-dependent protein kinase 7                      570   0.0     
gb|KHN26325.1|  Calcium-dependent protein kinase 32                     566   0.0     
ref|XP_008644596.1|  PREDICTED: calcium-dependent protein kinase ...    571   0.0     
gb|AAA99794.1|  calcium-dependent protein kinase                        568   0.0     
ref|XP_009397101.1|  PREDICTED: calcium-dependent protein kinase ...    567   0.0     
ref|XP_002466648.1|  hypothetical protein SORBIDRAFT_01g011630          570   0.0     
ref|XP_003559564.1|  PREDICTED: calcium-dependent protein kinase ...    570   0.0     
gb|KDO76025.1|  hypothetical protein CISIN_1g008668mg                   563   0.0     
ref|XP_003578434.1|  PREDICTED: calcium-dependent protein kinase ...    565   0.0     
gb|EMT12313.1|  Calcium-dependent protein kinase 13                     559   0.0     
gb|EMT26492.1|  Calcium-dependent protein kinase 7                      572   0.0     
ref|XP_002977006.1|  calcium dependent protein kinase 7                 561   0.0     
ref|XP_004982142.1|  PREDICTED: calcium-dependent protein kinase ...    562   0.0     
ref|XP_002980746.1|  calcium dependent protein kinase 7                 558   0.0     
emb|CDY48773.1|  BnaC04g02260D                                          554   0.0     
gb|EMS62953.1|  Calcium-dependent protein kinase 13                     552   0.0     
ref|NP_001062383.1|  Os08g0540400                                       555   0.0     
gb|ACD85805.1|  calcium-dependent protein kinase 21                     555   0.0     



>gb|AAZ76711.1| calcium-dependent protein kinase 2 [Petunia integrifolia subsp. 
inflata]
Length=536

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/536 (77%), Positives = 466/536 (87%), Gaps = 4/536 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRR-PIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C+S+ +A  +KR RNR  PID E      SRT  P+SQK SR + V+ +    +GD 
Sbjct  1     MGTCMSVQNASFLKRTRNRPVPIDQETCSKNTSRTSVPKSQKFSRPLNVVKD---PSGDD  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I+K+YEFGKELGRGEFG+TY C +K +GE+VACK I+KSKLRTEIDVEDVRREV IMRHL
Sbjct  58    INKRYEFGKELGRGEFGITYHCVDKVSGENVACKTIAKSKLRTEIDVEDVRREVVIMRHL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVA+GHYTERAAA VTKTILEV++VC
Sbjct  118   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVARGHYTERAAARVTKTILEVVKVC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             H+HGVIHRDLKPENFLYAN  ENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR
Sbjct  178   HEHGVIHRDLKPENFLYANATENAQLKAIDFGLSIFFEPGQRFSEIVGSPYYMAPEVLRR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++SE+AKDLV
Sbjct  238   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSEEAKDLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             KGMLD NPY+R+T+EEVL H WIQNAE V N+ LGEGV  +IKQFTLMNKFKK+VL VVA
Sbjct  298   KGMLDPNPYNRLTVEEVLDHYWIQNAEKVSNICLGEGVRAKIKQFTLMNKFKKKVLRVVA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NL QDQV  IK+MF+MMDTDKNGNLSF+ELKDGL +MGQ VAD +VQLLMDAADVDGNG
Sbjct  358   DNLPQDQVHGIKQMFYMMDTDKNGNLSFQELKDGLHLMGQAVADPEVQLLMDAADVDGNG  417

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
             MLNCEEF+T+AVHL  LSNDD+L KAFL FDK+ SGYIEFE+L+D L +     KNDQV+
Sbjct  418   MLNCEEFVTMAVHLKRLSNDDHLRKAFLHFDKNKSGYIEFEDLKDSLFDDHLGPKNDQVI  477

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +IIFDADLDKDGRIS+ +FK MM+TGTDWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  478   HDIIFDADLDKDGRISYQDFKVMMSTGTDWKMGSRQYSKAMLNALSMRLFKDKSIQ  533



>ref|XP_009791661.1| PREDICTED: calcium-dependent protein kinase 24 isoform X1 [Nicotiana 
sylvestris]
Length=536

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/536 (77%), Positives = 462/536 (86%), Gaps = 4/536 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C+S+ +A  +KR + R  PID E      SRT  P+SQK SR I V+ +    +GD 
Sbjct  1     MGTCMSVQNASFLKRTKMRPTPIDQETCSKNSSRTSVPKSQKFSRPINVVKD---PSGDD  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I K+YEFGKELGRGEFG+TY C +KE+GE+VACK I+KSKLRTEIDVEDVRREV IMRHL
Sbjct  58    IYKRYEFGKELGRGEFGITYQCVDKESGENVACKTIAKSKLRTEIDVEDVRREVVIMRHL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVA+GHYTERAAA VTKTILEV+QVC
Sbjct  118   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVARGHYTERAAARVTKTILEVVQVC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFLYAN +ENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR
Sbjct  178   HKHGVIHRDLKPENFLYANTSENAQLKAIDFGLSIFFEPGQRFGEIVGSPYYMAPEVLRR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++S++AKDLV
Sbjct  238   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSDEAKDLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             KGMLD NPY+R+T+EEVL H WIQNAE V NV LGEGV  RIKQFTLMNKFKK+VL VVA
Sbjct  298   KGMLDPNPYNRLTVEEVLEHHWIQNAEKVSNVCLGEGVRARIKQFTLMNKFKKKVLRVVA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NL QDQV  IK+MF+MMD+DKNGNLSF+ELKDGL MMGQ VAD +VQLLMDAADVDGNG
Sbjct  358   DNLPQDQVHGIKQMFYMMDSDKNGNLSFQELKDGLHMMGQSVADPEVQLLMDAADVDGNG  417

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
             MLNCEEF+T+AVHL  LSNDD+L +AFL FDK+ SGYIEFE+L+  L +     KNDQ +
Sbjct  418   MLNCEEFVTMAVHLQRLSNDDHLRQAFLQFDKNRSGYIEFEDLKVSLFDDHLGPKNDQAI  477

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +II DADLDKDGRIS+ +FK MM+TG DWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  478   HDIISDADLDKDGRISYQDFKVMMSTGMDWKMGSRQYSKAMLNALSMRLFKDKSIQ  533



>ref|XP_009588394.1| PREDICTED: calcium-dependent protein kinase 24 isoform X1 [Nicotiana 
tomentosiformis]
Length=536

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/536 (76%), Positives = 461/536 (86%), Gaps = 4/536 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C+S+ +A  +KR + R  PID E      SRT  P+SQK SR I V+ +    +GD 
Sbjct  1     MGTCMSVQNASFLKRTKMRPTPIDQETCSKNSSRTSVPKSQKFSRPINVVKD---PSGDD  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I K+YEFGKELGRGEFG+TY C +KE+GE+VACK I+KSKLRTEIDVEDVRREV IMRHL
Sbjct  58    IYKRYEFGKELGRGEFGITYQCVDKESGENVACKTIAKSKLRTEIDVEDVRREVVIMRHL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVA+GHYTERAAA VTKTILEV+QVC
Sbjct  118   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVARGHYTERAAARVTKTILEVVQVC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFLYAN +ENA LKAIDFGLSIFF+P QRF EIVGSPYYMAPEVLRR
Sbjct  178   HKHGVIHRDLKPENFLYANTSENAQLKAIDFGLSIFFEPTQRFGEIVGSPYYMAPEVLRR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++S++AKDLV
Sbjct  238   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSDEAKDLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             KGMLD NPY+R+T+EEVL H WIQNAE V NV LGEGV  RIKQFTLMNKFKK+VL VVA
Sbjct  298   KGMLDPNPYNRLTVEEVLEHHWIQNAEKVSNVCLGEGVRARIKQFTLMNKFKKKVLRVVA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NL QDQV  IK+MF+MMD+DKNGNLSF+ELKDGL MMGQ VAD +VQLLMDAADVDGNG
Sbjct  358   DNLPQDQVHGIKQMFYMMDSDKNGNLSFQELKDGLHMMGQSVADPEVQLLMDAADVDGNG  417

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
             MLNCEEF+T+AVHL  LSNDD+L +AFL FDK+ SGYIEFE+L+  L +     KNDQ +
Sbjct  418   MLNCEEFVTMAVHLQRLSNDDHLRQAFLQFDKNRSGYIEFEDLKASLFDDHLGPKNDQAI  477

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +II DADLDKDGRIS+ +FK MM+TG DWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  478   LDIISDADLDKDGRISYQDFKVMMSTGMDWKMGSRQYSKAMLNALSMRLFKDKSMQ  533



>ref|XP_006347286.1| PREDICTED: calcium-dependent protein kinase 24-like [Solanum 
tuberosum]
Length=536

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/536 (76%), Positives = 461/536 (86%), Gaps = 4/536 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C+S+ +A  +KR R R  PID E      SRT  P+SQK SR I V+ +    +GD 
Sbjct  1     MGTCMSVQNASFLKRTRMRPTPIDQETCSKSTSRTSVPKSQKFSRPINVVTD---PSGDD  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I ++YEFGKELGRGEFG+TY C +K +GE+VACK I+KSKLRTEIDVEDVRREV IMRHL
Sbjct  58    IYQRYEFGKELGRGEFGITYQCVDKISGENVACKTIAKSKLRTEIDVEDVRREVVIMRHL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVA+GHYTERAAALVTKTILEV+QVC
Sbjct  118   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVARGHYTERAAALVTKTILEVVQVC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFLYAN NENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR
Sbjct  178   HKHGVIHRDLKPENFLYANVNENAQLKAIDFGLSIFFEPGQRFGEIVGSPYYMAPEVLRR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++S++AKDLV
Sbjct  238   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSDEAKDLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             KGMLDANPY+R T+EEVL H WIQNA+ V NV LGEGV  +IKQFTLMNKFKK+VL VVA
Sbjct  298   KGMLDANPYNRFTVEEVLDHHWIQNADKVSNVCLGEGVRAKIKQFTLMNKFKKKVLRVVA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NL QDQV  IK+MF+ MDTDKNGNLSF+ELKDGL MMGQ VA+ +V LLMDAADVDGNG
Sbjct  358   DNLPQDQVHGIKQMFYKMDTDKNGNLSFQELKDGLHMMGQTVAEPEVHLLMDAADVDGNG  417

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
             MLNCEEF+T+AVHL  LSNDD+L  AFL FDK+ SG+IEFE+L+  L +     +NDQV+
Sbjct  418   MLNCEEFVTMAVHLQRLSNDDHLRHAFLQFDKNKSGFIEFEDLKISLFDDSLAPQNDQVI  477

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +IIF ADLDKDGRIS+ +FK MM+TGTDWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  478   NDIIFGADLDKDGRISYQDFKVMMSTGTDWKMGSRQYSKAMLNALSMRLFKDKSMQ  533



>ref|XP_011073922.1| PREDICTED: calcium-dependent protein kinase 24-like [Sesamum 
indicum]
Length=534

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/533 (74%), Positives = 454/533 (85%), Gaps = 3/533 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C+S+ ++  +K+ +  R     N    G  +      K+SR I+VL +    TG+ I
Sbjct  1     MGTCLSISNSTLLKKTKYDRKSVDHNPHENGKLSGRLAPLKLSRPIQVLKD---PTGNDI  57

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
              K+Y FGKELGRGEFGVTY C +   GES+ACKKI KSKLRT+ID+EDVRREVEIMRHLP
Sbjct  58    FKRYRFGKELGRGEFGVTYQCFDDVNGESLACKKIPKSKLRTDIDIEDVRREVEIMRHLP  117

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIVSY+EVYEDKEA+YLVMELCEGGELFDRIVA+GHYTERAAA VTKTILEV++VCH
Sbjct  118   KHPNIVSYREVYEDKEAIYLVMELCEGGELFDRIVARGHYTERAAAQVTKTILEVVKVCH  177

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             + GVIHRDLKPENFLYAN +ENAPLKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR+
Sbjct  178   EQGVIHRDLKPENFLYANDSENAPLKAIDFGLSIFFEPGQRFNEIVGSPYYMAPEVLRRN  237

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG E+DVWS GVILYILLCGVPPFWAETEEGIA AIV G+IDFKRDPWP+ISE AKDLV+
Sbjct  238   YGPEIDVWSTGVILYILLCGVPPFWAETEEGIAQAIVFGEIDFKRDPWPRISEGAKDLVR  297

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
             GML+ NPYSR+T+EEVLA +W+QNA+ VPN+PLGE V  RIKQF+LMNKFKKRVL VVA 
Sbjct  298   GMLEPNPYSRLTVEEVLASEWMQNADKVPNIPLGERVRARIKQFSLMNKFKKRVLGVVAG  357

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NL  +QV  I++MFHMMDTDKNGNL+F+ELKDGL M+GQP+ DHDVQLL+DAAD DGNGM
Sbjct  358   NLPDEQVHGIRQMFHMMDTDKNGNLNFQELKDGLYMIGQPIPDHDVQLLLDAADCDGNGM  417

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LNCEEF+TLAVHL  +SNDD LH+AFL FDK+ SGYIEFE+LR+ LL+      NDQV+Q
Sbjct  418   LNCEEFVTLAVHLKKISNDDLLHQAFLYFDKNQSGYIEFEDLRESLLDEQFGPTNDQVLQ  477

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
             +IIFDADLDKDGRISFPEFKAMMTTG DWKM SR+YS+ MLNALS RLFKDKS
Sbjct  478   DIIFDADLDKDGRISFPEFKAMMTTGMDWKMGSRQYSRAMLNALSTRLFKDKS  530



>ref|XP_010322474.1| PREDICTED: calcium-dependent protein kinase 24 [Solanum lycopersicum]
Length=510

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/480 (80%), Positives = 430/480 (90%), Gaps = 0/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG     +YEFGKELGRGEFG+TY C +K +GE+VACK I+KSKLRTEIDVEDVRREV I
Sbjct  28    TGLCFCNRYEFGKELGRGEFGITYQCVDKTSGENVACKTIAKSKLRTEIDVEDVRREVVI  87

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPNIVSYKEVYEDK+AVYLVMELCEGGELFDRIVA+GHYTERAAALVTKTILEV
Sbjct  88    MRHLPKHPNIVSYKEVYEDKDAVYLVMELCEGGELFDRIVARGHYTERAAALVTKTILEV  147

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +QVCHKHGVIHRDLKPENFLYAN NENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPE
Sbjct  148   VQVCHKHGVIHRDLKPENFLYANVNENAQLKAIDFGLSIFFEPGQRFGEIVGSPYYMAPE  207

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++S++A
Sbjct  208   VLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSDEA  267

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVKGMLDANPY+R T+EEVL H WIQNA+ V NV LGEGV T+IKQFTLMNKFKK+VL
Sbjct  268   KDLVKGMLDANPYNRFTVEEVLDHHWIQNADKVSNVCLGEGVRTKIKQFTLMNKFKKKVL  327

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA+NL  DQV  IK+MF+MMDTDKNGNLSF+ELKDGL MMGQ VA+ +V LLMDAADV
Sbjct  328   RVVADNLPLDQVHGIKQMFYMMDTDKNGNLSFQELKDGLHMMGQTVAEPEVHLLMDAADV  387

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNGMLNCEEF+T+AVHL  LSNDD+L +AFL FDK+ SG+IE+E+L+  L +     +N
Sbjct  388   DGNGMLNCEEFVTMAVHLQRLSNDDHLKQAFLQFDKNKSGFIEYEDLKISLFDDSLAPQN  447

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             DQV+ +IIFDADLDKDGRIS+ +FK MM+TGTDWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  448   DQVINDIIFDADLDKDGRISYQDFKVMMSTGTDWKMGSRQYSKAMLNALSMRLFKDKSMQ  507



>emb|CDP18751.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/540 (72%), Positives = 462/540 (86%), Gaps = 8/540 (1%)
 Frame = +3

Query  99    MGACVSLHSALT-MKRPRNRRPIDPENVRG----GGSRTRAPRSQKISRQIRVLNESHNA  263
             MG C+S+ +  + +KR +N++ +     +G    GG+    P SQ+ISR + VL +    
Sbjct  1     MGGCMSIPTNTSFLKRTKNQKQVHESCDQGHSVNGGNAAGLPLSQRISRPVTVLKD---P  57

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
              G  I ++Y+FGKELGRGEFGVTY C +KETGE+VACKKISKSKLRTEIDVEDVRREVEI
Sbjct  58    DGHEIYQRYKFGKELGRGEFGVTYQCIDKETGENVACKKISKSKLRTEIDVEDVRREVEI  117

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPK+PNIVSY   YEDKEA+YLVMELCEGGELFDRIVA+GHYTERAAALVTK+ILEV
Sbjct  118   MRHLPKNPNIVSYIAAYEDKEAIYLVMELCEGGELFDRIVARGHYTERAAALVTKSILEV  177

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +++CHKHGVIHRDLKPENFL+AN +EN+PLKAIDFGLSIFF+PGQ F EIVGSPYYMAPE
Sbjct  178   VKLCHKHGVIHRDLKPENFLFANTSENSPLKAIDFGLSIFFQPGQHFCEIVGSPYYMAPE  237

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG EVDVWSAGVILYILLCGVPPFWAE+EEGIAHAIVRG+IDF+RDPWPKIS +A
Sbjct  238   VLRRNYGSEVDVWSAGVILYILLCGVPPFWAESEEGIAHAIVRGEIDFRRDPWPKISRNA  297

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVKGML+ NPY+R+T+EEVL ++WI+NA  V N+PLGEGV TRIKQF+LMNKFKKRVL
Sbjct  298   KDLVKGMLEPNPYTRLTVEEVLENEWIKNANQVANIPLGEGVRTRIKQFSLMNKFKKRVL  357

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA+ L  D+V  IK+MF+ MDTD+NG+LSFEELKDGL+  GQ VAD DV+LL+DAAD+
Sbjct  358   RVVADYLPDDEVHGIKQMFYSMDTDQNGSLSFEELKDGLNKFGQDVADPDVELLIDAADL  417

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNGMLNC+EF+TLAVHL  LS+D++L +AF  FDK+ +GYIEFEELRD L +      N
Sbjct  418   DGNGMLNCDEFVTLAVHLKRLSSDEHLLQAFHQFDKNGNGYIEFEELRDSLSDEHLGPNN  477

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             DQ VQ+IIFDADLDKDG+IS+ EFKAMMTTG DWKMASR+YS+ MLN LS++LFKDKS+Q
Sbjct  478   DQFVQDIIFDADLDKDGKISYAEFKAMMTTGADWKMASRQYSRAMLNVLSMKLFKDKSMQ  537



>ref|XP_009791662.1| PREDICTED: calcium-dependent protein kinase 24 isoform X2 [Nicotiana 
sylvestris]
Length=514

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/536 (73%), Positives = 441/536 (82%), Gaps = 26/536 (5%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C+S+ +A  +KR + R  PID E      SRT  P+SQK SR I V+ +    +GD 
Sbjct  1     MGTCMSVQNASFLKRTKMRPTPIDQETCSKNSSRTSVPKSQKFSRPINVVKD---PSGDD  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I K+YEFGKELGRGEFG+TY C +KE+GE+VACK I+KSKLRTEIDVEDVRREV IMRHL
Sbjct  58    IYKRYEFGKELGRGEFGITYQCVDKESGENVACKTIAKSKLRTEIDVEDVRREVVIMRHL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVA+GHYTERAAA VTKTILEV+QVC
Sbjct  118   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVARGHYTERAAARVTKTILEVVQVC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFLYAN +ENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR
Sbjct  178   HKHGVIHRDLKPENFLYANTSENAQLKAIDFGLSIFFEPGQRFGEIVGSPYYMAPEVLRR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++S++AKDLV
Sbjct  238   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSDEAKDLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             KGMLD NPY+R+T+EEVL H WIQNAE V NV LGEGV  RIKQFTLMNKFKK+VL VVA
Sbjct  298   KGMLDPNPYNRLTVEEVLEHHWIQNAEKVSNVCLGEGVRARIKQFTLMNKFKKKVLRVVA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NL QDQV  IK+MF+MMD+DKNGNLSF+ELKDGL MMGQ VAD +VQLLMDA       
Sbjct  358   DNLPQDQVHGIKQMFYMMDSDKNGNLSFQELKDGLHMMGQSVADPEVQLLMDA-------  410

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
                             LSNDD+L +AFL FDK+ SGYIEFE+L+  L +     KNDQ +
Sbjct  411   ---------------RLSNDDHLRQAFLQFDKNRSGYIEFEDLKVSLFDDHLGPKNDQAI  455

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +II DADLDKDGRIS+ +FK MM+TG DWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  456   HDIISDADLDKDGRISYQDFKVMMSTGMDWKMGSRQYSKAMLNALSMRLFKDKSIQ  511



>ref|XP_009588395.1| PREDICTED: calcium-dependent protein kinase 24 isoform X2 [Nicotiana 
tomentosiformis]
Length=514

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/536 (73%), Positives = 440/536 (82%), Gaps = 26/536 (5%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C+S+ +A  +KR + R  PID E      SRT  P+SQK SR I V+ +    +GD 
Sbjct  1     MGTCMSVQNASFLKRTKMRPTPIDQETCSKNSSRTSVPKSQKFSRPINVVKD---PSGDD  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I K+YEFGKELGRGEFG+TY C +KE+GE+VACK I+KSKLRTEIDVEDVRREV IMRHL
Sbjct  58    IYKRYEFGKELGRGEFGITYQCVDKESGENVACKTIAKSKLRTEIDVEDVRREVVIMRHL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVA+GHYTERAAA VTKTILEV+QVC
Sbjct  118   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVARGHYTERAAARVTKTILEVVQVC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFLYAN +ENA LKAIDFGLSIFF+P QRF EIVGSPYYMAPEVLRR
Sbjct  178   HKHGVIHRDLKPENFLYANTSENAQLKAIDFGLSIFFEPTQRFGEIVGSPYYMAPEVLRR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G IDF RDPWP++S++AKDLV
Sbjct  238   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGTIDFNRDPWPRVSDEAKDLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             KGMLD NPY+R+T+EEVL H WIQNAE V NV LGEGV  RIKQFTLMNKFKK+VL VVA
Sbjct  298   KGMLDPNPYNRLTVEEVLEHHWIQNAEKVSNVCLGEGVRARIKQFTLMNKFKKKVLRVVA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NL QDQV  IK+MF+MMD+DKNGNLSF+ELKDGL MMGQ VAD +VQLLMDA       
Sbjct  358   DNLPQDQVHGIKQMFYMMDSDKNGNLSFQELKDGLHMMGQSVADPEVQLLMDA-------  410

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
                             LSNDD+L +AFL FDK+ SGYIEFE+L+  L +     KNDQ +
Sbjct  411   ---------------RLSNDDHLRQAFLQFDKNRSGYIEFEDLKASLFDDHLGPKNDQAI  455

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +II DADLDKDGRIS+ +FK MM+TG DWKM SR+YSK MLNALS+RLFKDKS+Q
Sbjct  456   LDIISDADLDKDGRISYQDFKVMMSTGMDWKMGSRQYSKAMLNALSMRLFKDKSMQ  511



>gb|EYU36734.1| hypothetical protein MIMGU_mgv1a004648mg [Erythranthe guttata]
Length=516

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/535 (70%), Positives = 438/535 (82%), Gaps = 22/535 (4%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C+SL  + T+ +   +   D +  + G   +      +ISR I+VL +    TG+ I
Sbjct  1     MGTCMSLQRSSTLFKKTKKSNTDSQEFQNGKLFSGKLAPLRISRPIQVLKD---PTGNDI  57

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
               KY FGKELGRGEFGVTY C +   G+ +ACKKISKSKLRT+ID+EDVRREVEIMRHLP
Sbjct  58    FSKYRFGKELGRGEFGVTYQCFDDANGDCLACKKISKSKLRTDIDIEDVRREVEIMRHLP  117

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
              +PNIV YKEVYEDKEA+YLVMELCEGGELFDRIVA+GHYTERAAALVTKTILEV++VCH
Sbjct  118   TNPNIVKYKEVYEDKEAIYLVMELCEGGELFDRIVARGHYTERAAALVTKTILEVVKVCH  177

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             +HGVIHRDLKPENFL+AN  ENAPLKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR+
Sbjct  178   EHGVIHRDLKPENFLFANECENAPLKAIDFGLSIFFEPGQRFSEIVGSPYYMAPEVLRRN  237

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG E+D+WSAGVILYILLCGVPPFWAETEEGIA AIV G+IDF+RDPWP+ISEDAK+LV 
Sbjct  238   YGPEIDIWSAGVILYILLCGVPPFWAETEEGIAQAIVYGEIDFQRDPWPRISEDAKNLVI  297

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
             GML+ NP++R+T+E+VL  K                   RIKQF+LMNKFKK+VL VVA+
Sbjct  298   GMLEPNPHARLTVEQVLELK-------------------RIKQFSLMNKFKKKVLRVVAD  338

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NL  DQV+ IK+MF MMDTDKNGNL+F+ELKDGL M+GQPVADHDVQLL+DAAD DGNGM
Sbjct  339   NLPDDQVDGIKQMFQMMDTDKNGNLNFQELKDGLYMIGQPVADHDVQLLLDAADCDGNGM  398

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LNCEEF+TLAVHL  ++N++ LH+AFL FDK+NSGYIEFEEL+  LL+      NDQVVQ
Sbjct  399   LNCEEFVTLAVHLKKINNEELLHEAFLYFDKNNSGYIEFEELQQSLLDDHFGPTNDQVVQ  458

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +IIFDADLDKDGRISF EFKAMM TG DWKM SR+YS+ MLNALSVRLF+  ++Q
Sbjct  459   DIIFDADLDKDGRISFAEFKAMMKTGMDWKMGSRQYSRAMLNALSVRLFQGHNLQ  513



>ref|XP_002533526.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF28856.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/535 (69%), Positives = 437/535 (82%), Gaps = 5/535 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C+S  + L   R  +RR +  +N R       +  SQ  +   +V N   +  G+ I
Sbjct  1     MGGCIS--APLKAGRIISRR-LHYDN-RSKPLADNSAASQPCT-NFQVGNVLKSPAGNNI  55

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
              +KYEFGKELGRGEFGVTY C  KETGE+ ACK ISK+KL+TEIDVEDVRREVEIMRHLP
Sbjct  56    RQKYEFGKELGRGEFGVTYRCLHKETGETYACKTISKAKLKTEIDVEDVRREVEIMRHLP  115

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIVSYKE YEDKE +YLVMELCEGGELFDRIVAKGHYTERAAA+VTKTILE+++VCH
Sbjct  116   KHPNIVSYKEAYEDKEVIYLVMELCEGGELFDRIVAKGHYTERAAAMVTKTILEIVKVCH  175

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             KHGVIHRDLKPENFL+A+ +EN+ LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRR+
Sbjct  176   KHGVIHRDLKPENFLFADVHENSQLKAIDFGLSIFFQPGQRFSEIVGSPYYMAPEVLRRN  235

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV G IDF RDPWP++SE+AKDLV+
Sbjct  236   YGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVGGKIDFTRDPWPRVSEEAKDLVQ  295

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD NPYSR+T++EVL H WI NA  VPNV LGE V  RIKQF+LMNKFKKRVL VVA+
Sbjct  296   NMLDQNPYSRLTVQEVLEHPWIHNASDVPNVNLGENVRARIKQFSLMNKFKKRVLRVVAD  355

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NL+ +QV+ IK+MFHMMDTD  G+L+FEELK GL  +G PV D DV+ LMDAAD+DGNG 
Sbjct  356   NLTDEQVDGIKQMFHMMDTDNTGDLTFEELKSGLHKIGHPVPDPDVRTLMDAADIDGNGT  415

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             L+ EEF+ +++HL  + ND++L +AF  FDK+ +GYIEFEELRD ++  +     ++V++
Sbjct  416   LSIEEFVAMSIHLIKIGNDEHLSQAFKFFDKNQTGYIEFEELRDAMVHDNLGPNCEEVIK  475

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +I+ D DLDKDGRISF EFKAMM +G DWKMASR+YS+ MLNALS++L KD S+Q
Sbjct  476   DIMSDVDLDKDGRISFDEFKAMMKSGMDWKMASRQYSRAMLNALSMKLLKDGSMQ  530



>ref|XP_002264388.1| PREDICTED: calcium-dependent protein kinase 24 [Vitis vinifera]
Length=554

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/534 (68%), Positives = 437/534 (82%), Gaps = 9/534 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C+S+ +    K+    + I PE      S     R     R I VL E    +G  I
Sbjct  1     MGGCISMPAKAGQKKKAKAKKIIPE------SGDDVFRKSVTIRPISVLKE---PSGKDI  51

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
              K Y  GKELGRGEFGVT+ C + ETGE  ACK ISKSKL TEID++DVRREVEIM+HLP
Sbjct  52    YKTYRLGKELGRGEFGVTHQCFDLETGEIFACKTISKSKLTTEIDIQDVRREVEIMKHLP  111

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIV  KE YEDK+ V+LVMELCEGGELFDRIVA+GHYTERAAA VT++I+E++Q+CH
Sbjct  112   KHPNIVRLKEAYEDKDNVHLVMELCEGGELFDRIVARGHYTERAAADVTRSIVEILQICH  171

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             +HGV+HRDLKPENFL+A+ +E +PLKAIDFGLSIFFKPGQRF EIVGSPYYMAPEVLRR 
Sbjct  172   QHGVMHRDLKPENFLFADASEASPLKAIDFGLSIFFKPGQRFNEIVGSPYYMAPEVLRRH  231

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCGVPPFWAETEEGIA AIV+  +DF+RDPWP +SEDAKDLV+
Sbjct  232   YGPEVDVWSAGVILYILLCGVPPFWAETEEGIAQAIVKSVVDFERDPWPHVSEDAKDLVR  291

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD NPY+R+T+EEVLAH WI+NA ++PNV LGE V TRIKQF+LMNKFKKRVL VVA+
Sbjct  292   SMLDPNPYNRLTVEEVLAHPWIKNATSIPNVSLGENVRTRIKQFSLMNKFKKRVLRVVAD  351

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NL  +Q + I+++FHMMDTDKNGNLSFEELKDGL  +G PVAD DV++L++AAD+DG G 
Sbjct  352   NLPNEQRDGIRQIFHMMDTDKNGNLSFEELKDGLHKIGHPVADPDVKMLIEAADMDGTGT  411

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LNC+EF+T++VHL  +S+D+NL +AF  FDK++SGYIEFEELR+ L E +    N+QV+Q
Sbjct  412   LNCDEFVTISVHLRKISSDENLSEAFRAFDKNDSGYIEFEELREALREDNLGPNNEQVIQ  471

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             +IIFD DLDKDGRIS+ EFKAMM TG DWKM+SR+YS+ MLNALS+R+FKDKS+
Sbjct  472   DIIFDVDLDKDGRISYDEFKAMMKTGMDWKMSSRQYSRAMLNALSMRIFKDKSM  525



>emb|CBI36647.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/534 (68%), Positives = 437/534 (82%), Gaps = 9/534 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C+S+ +    K+    + I PE      S     R     R I VL E    +G  I
Sbjct  23    MGGCISMPAKAGQKKKAKAKKIIPE------SGDDVFRKSVTIRPISVLKE---PSGKDI  73

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
              K Y  GKELGRGEFGVT+ C + ETGE  ACK ISKSKL TEID++DVRREVEIM+HLP
Sbjct  74    YKTYRLGKELGRGEFGVTHQCFDLETGEIFACKTISKSKLTTEIDIQDVRREVEIMKHLP  133

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIV  KE YEDK+ V+LVMELCEGGELFDRIVA+GHYTERAAA VT++I+E++Q+CH
Sbjct  134   KHPNIVRLKEAYEDKDNVHLVMELCEGGELFDRIVARGHYTERAAADVTRSIVEILQICH  193

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             +HGV+HRDLKPENFL+A+ +E +PLKAIDFGLSIFFKPGQRF EIVGSPYYMAPEVLRR 
Sbjct  194   QHGVMHRDLKPENFLFADASEASPLKAIDFGLSIFFKPGQRFNEIVGSPYYMAPEVLRRH  253

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCGVPPFWAETEEGIA AIV+  +DF+RDPWP +SEDAKDLV+
Sbjct  254   YGPEVDVWSAGVILYILLCGVPPFWAETEEGIAQAIVKSVVDFERDPWPHVSEDAKDLVR  313

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD NPY+R+T+EEVLAH WI+NA ++PNV LGE V TRIKQF+LMNKFKKRVL VVA+
Sbjct  314   SMLDPNPYNRLTVEEVLAHPWIKNATSIPNVSLGENVRTRIKQFSLMNKFKKRVLRVVAD  373

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NL  +Q + I+++FHMMDTDKNGNLSFEELKDGL  +G PVAD DV++L++AAD+DG G 
Sbjct  374   NLPNEQRDGIRQIFHMMDTDKNGNLSFEELKDGLHKIGHPVADPDVKMLIEAADMDGTGT  433

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LNC+EF+T++VHL  +S+D+NL +AF  FDK++SGYIEFEELR+ L E +    N+QV+Q
Sbjct  434   LNCDEFVTISVHLRKISSDENLSEAFRAFDKNDSGYIEFEELREALREDNLGPNNEQVIQ  493

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             +IIFD DLDKDGRIS+ EFKAMM TG DWKM+SR+YS+ MLNALS+R+FKDKS+
Sbjct  494   DIIFDVDLDKDGRISYDEFKAMMKTGMDWKMSSRQYSRAMLNALSMRIFKDKSM  547



>gb|EPS70786.1| calcium-dependent protein kinase 2, partial [Genlisea aurea]
Length=492

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/492 (72%), Positives = 426/492 (87%), Gaps = 2/492 (0%)
 Frame = +3

Query  228   RQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTe  407
             R I VL E + +  D +  KY+ GKELGRGEFGVTY   E+ TG++ ACKKISK KLR+E
Sbjct  1     RPISVLREPNGS--DDVFLKYKLGKELGRGEFGVTYEVVEEATGDNFACKKISKRKLRSE  58

Query  408   idvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTER  587
             +D+EDVRREVEIMRHLP+HPNIVSYKEVYED+EA+YL+MELCEGGELFDRIVA+GH++ER
Sbjct  59    VDIEDVRREVEIMRHLPQHPNIVSYKEVYEDREAIYLIMELCEGGELFDRIVARGHFSER  118

Query  588   AAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFK  767
              AA+VTKTILEV++VCH+HGVIHRDLKPENFLYAN +ENAPLKAIDFGLSIFF+ GQRF+
Sbjct  119   GAAMVTKTILEVVKVCHEHGVIHRDLKPENFLYANDSENAPLKAIDFGLSIFFESGQRFQ  178

Query  768   EIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDF  947
             EIVGSPYYMAPEVLRR+YG E+DVWSAG+ILYILLCGVPPFWAETEEGIA AIV G++DF
Sbjct  179   EIVGSPYYMAPEVLRRNYGPEIDVWSAGIILYILLCGVPPFWAETEEGIAQAIVFGELDF  238

Query  948   KRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQ  1127
             +RDPWPK+SE+AK+LV+GML+ NPY+R+TI EVL + WIQNA+ VPNVPLGE V TRIKQ
Sbjct  239   ERDPWPKVSEEAKNLVRGMLEQNPYTRLTINEVLGNPWIQNADRVPNVPLGEQVRTRIKQ  298

Query  1128  FTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVAD  1307
             F+LMNKFKKRVL VVA+NL  ++ + IK+MF  MDT+ NGNL  +ELK GL+M+GQ V D
Sbjct  299   FSLMNKFKKRVLRVVADNLPDEEADGIKQMFRTMDTNNNGNLDLQELKHGLNMIGQNVTD  358

Query  1308  HDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELR  1487
             HDVQLL DAAD DGNG L+C+EF+T+AVHL  +++++ LH+AF+ FDK+ +GYIEFEEL+
Sbjct  359   HDVQLLFDAADCDGNGELSCDEFVTMAVHLKKINSEELLHRAFVHFDKNQNGYIEFEELQ  418

Query  1488  DYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNA  1667
             + LL+      +DQVV +IIFDADLDKDGRISF EFKAMMTTG DWKM SR++S+ MLNA
Sbjct  419   ESLLDDHFGPMSDQVVLDIIFDADLDKDGRISFGEFKAMMTTGLDWKMGSRQFSRAMLNA  478

Query  1668  LSVRLFKDKSVQ  1703
             LS +LFKD+  Q
Sbjct  479   LSTKLFKDQQEQ  490



>ref|XP_010097472.1| Calcium-dependent protein kinase 24 [Morus notabilis]
 gb|EXB68663.1| Calcium-dependent protein kinase 24 [Morus notabilis]
Length=538

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/538 (68%), Positives = 434/538 (81%), Gaps = 12/538 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPID-PENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG+CVS+     + + R    +D PE   G   R     S  I R I ++    + TGD 
Sbjct  1     MGSCVSVADKTGLHKRRG--AVDGPEFDLGKLMR----HSGNILRSISIIE---DPTGDN  51

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             +  KY FGKELGRGEFG+TY C   +TGE+ ACK ISKSKLRTE+DVEDVRREV IMRHL
Sbjct  52    VYAKYLFGKELGRGEFGITYRCVAVDTGEAFACKTISKSKLRTEVDVEDVRREVRIMRHL  111

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             P+HP+IV++KEVYEDKEAVYLVMELCEGGELFDRIV++GHYTER AA +TKT+LEV +VC
Sbjct  112   PEHPHIVAFKEVYEDKEAVYLVMELCEGGELFDRIVSRGHYTERDAARITKTMLEVCKVC  171

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFL+ +G EN+ LKAIDFGLSIFFK G RF EIVGSPYYMAPEVLRR
Sbjct  172   HKHGVIHRDLKPENFLFKDGCENSQLKAIDFGLSIFFKSGDRFSEIVGSPYYMAPEVLRR  231

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG IDF+RDPWPK+SE AKDLV
Sbjct  232   NYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGSIDFERDPWPKVSEKAKDLV  291

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             K MLD NPYSR+T+EEVL H WI N + VP+V L   V TRIKQF+LMN+FKKRVL VVA
Sbjct  292   KSMLDPNPYSRLTVEEVLEHPWIHNTDHVPDVSLCGNVRTRIKQFSLMNRFKKRVLRVVA  351

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NLS++Q++ IK +F  MDTDKNGNL+FEEL+DG  ++G  V D DVQ+L+DAAD DGNG
Sbjct  352   DNLSEEQIDGIKRIFDTMDTDKNGNLTFEELRDGFHLIGHSVTDPDVQMLIDAADADGNG  411

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
              L+CEEF+T +VHL  +  D++L +AF  FDK+ SGYIEFEELR  LL+ + D  NDQV+
Sbjct  412   TLSCEEFVTASVHLKRIGRDEHLSQAFTYFDKNQSGYIEFEELRQALLDDNLDPNNDQVI  471

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLF--KDKSVQ  1703
             ++I+FD DLDKDG+IS+ EFK MM TGTDWKM+SR+YS+ +LNALS ++F  KDKS+Q
Sbjct  472   RDILFDVDLDKDGKISYEEFKVMMKTGTDWKMSSRQYSRALLNALSSKMFKVKDKSLQ  529



>ref|XP_006443068.1| hypothetical protein CICLE_v10024502mg [Citrus clementina]
 gb|ESR56308.1| hypothetical protein CICLE_v10024502mg [Citrus clementina]
Length=538

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/505 (68%), Positives = 429/505 (85%), Gaps = 0/505 (0%)
 Frame = +3

Query  189   GSRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESV  368
             GS     R  K S   ++ +   N     I  KY FGKELGRGEFG+T+ C E ETGE+ 
Sbjct  2     GSCISLARKDKKSISFQLRSVVSNPAEGNILDKYTFGKELGRGEFGITHQCFEIETGETY  61

Query  369   ACKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGEL  548
             ACKKI+K KL+TEID++DVRREVEIMRHLPKHPNIV+YKE YEDK+A+YLVMELCEGGEL
Sbjct  62    ACKKIAKEKLKTEIDIDDVRREVEIMRHLPKHPNIVTYKEAYEDKDAIYLVMELCEGGEL  121

Query  549   FDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDF  728
             FDRIV KGHYTERAAA V KTIL +++VCH++GV+HRDLKPENFL+A+G+EN+ LKAIDF
Sbjct  122   FDRIVNKGHYTERAAAAVGKTILRIVKVCHENGVMHRDLKPENFLFADGSENSQLKAIDF  181

Query  729   GLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEE  908
             GLSIFFKPG++F EIVGSPYYMAPEVLRR+YG E+DVWSAGVI+YILLCGVPPFWAETEE
Sbjct  182   GLSIFFKPGEQFCEIVGSPYYMAPEVLRRNYGPEIDVWSAGVIIYILLCGVPPFWAETEE  241

Query  909   GIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPN  1088
             GIAHAI+RG IDF+RDPWPK+S++AK+LVK MLD NPY+R+T+EEVL + WI+N    PN
Sbjct  242   GIAHAIIRGKIDFERDPWPKVSKEAKELVKNMLDPNPYNRLTLEEVLENPWIKNDNHAPN  301

Query  1089  VPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEEL  1268
             V LG  VT+RIKQF++MNKFKK+VL VVA+NL QDQ+  IK+MF+MMDTDKNG+L+FEEL
Sbjct  302   VSLGGNVTSRIKQFSIMNKFKKKVLRVVADNLPQDQMAQIKQMFYMMDTDKNGDLTFEEL  361

Query  1269  KDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFD  1448
             KDGL+M+GQ V+D DV++LM+AADVDGNG+L+C+EF+T++VHL  + NDD L +AF  FD
Sbjct  362   KDGLNMIGQKVSDPDVKMLMEAADVDGNGLLSCDEFVTMSVHLKRIGNDDILSQAFRFFD  421

Query  1449  KDNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWK  1628
             K+ SG+IE +EL++ LL+ +     DQ +++I+ D DLD+DGRISF EFKAMMT+G DWK
Sbjct  422   KNQSGFIEVDELKEVLLDDNAGPNGDQTIRDILRDVDLDRDGRISFEEFKAMMTSGADWK  481

Query  1629  MASRKYSKVMLNALSVRLFKDKSVQ  1703
             MASR+YS+ M++ALS++LFKDKS++
Sbjct  482   MASRQYSRAMMSALSIKLFKDKSME  506



>ref|XP_010064519.1| PREDICTED: calcium-dependent protein kinase 24-like [Eucalyptus 
grandis]
 gb|KCW87867.1| hypothetical protein EUGRSUZ_A00262 [Eucalyptus grandis]
Length=530

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/540 (65%), Positives = 433/540 (80%), Gaps = 24/540 (4%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRA------PRSQKISRQ--IRVLNES  254
             MG C+S                 P    G  S TR+      P   ++ R   +R ++  
Sbjct  1     MGGCISA----------------PAKRAGSYSSTRSSRFTPQPDVDRVCRSGVLRTISIL  44

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
              N + D I  ++EFGKELGRGEFG+TY CTE  TGE+ ACK ISKSKLRTEIDV+DVRRE
Sbjct  45    KNPSRDNIQDRFEFGKELGRGEFGITYRCTELVTGEAYACKTISKSKLRTEIDVDDVRRE  104

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMRHLP+HPNIVS KE +ED++AVY+VMELCEGGELFDRIVA+GH+TER A  + +TI
Sbjct  105   VEIMRHLPRHPNIVSLKEAFEDRDAVYIVMELCEGGELFDRIVARGHFTERDAVTIARTI  164

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             LE++ VCH+HGVIHRDLKPENFL+AN ++++PLKAIDFGLS FF+PGQ F+EIVGSPYYM
Sbjct  165   LEIVSVCHEHGVIHRDLKPENFLFANSSDSSPLKAIDFGLSTFFEPGQHFREIVGSPYYM  224

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVLRRDYG EVDVWSAGVILYILLCGVPPFWAETEEGIA AIV+G+IDF+RDPWPK+S
Sbjct  225   APEVLRRDYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAQAIVQGEIDFERDPWPKVS  284

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             E+AKDLV+ ML+ NPY+R+T++EVL HKWIQN +   NV LG+ V TRIKQF+LMNKFKK
Sbjct  285   EEAKDLVRNMLEPNPYTRLTVQEVLEHKWIQNVDKASNVSLGQNVRTRIKQFSLMNKFKK  344

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             +VL VVA+NL  +QV+ IKEMFH+MDTDKNG+L+FEELK GL   GQ VAD DVQ+LMDA
Sbjct  345   KVLRVVADNLPDEQVDHIKEMFHVMDTDKNGDLTFEELKHGLHKCGQQVADPDVQMLMDA  404

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             AD DG+G LNC+EF+T++VHL  + +DD+L +AF  FDK+ SGYIEF+EL++ L++ +  
Sbjct  405   ADEDGSGTLNCQEFVTMSVHLRRIGSDDHLTRAFEFFDKNRSGYIEFDELKEALIDDNLG  464

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               N++ +++IIFDADLDKDGRIS+ EFK MM  G DWKMASR+YS+ MLNALS ++FKDK
Sbjct  465   PNNEKFIEDIIFDADLDKDGRISYDEFKVMMKMGMDWKMASRQYSRAMLNALSQKMFKDK  524



>gb|KDO43482.1| hypothetical protein CISIN_1g043828mg [Citrus sinensis]
Length=586

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/496 (70%), Positives = 432/496 (87%), Gaps = 2/496 (0%)
 Frame = +3

Query  216   QKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSK  395
             + IS Q+R +  S+ A G+ I  KY FGKELGRGEFG+T+ C E ETGE+ ACKKI+K K
Sbjct  61    KSISFQLRSV-VSNPAEGN-ILDKYTFGKELGRGEFGITHQCFEIETGETYACKKIAKEK  118

Query  396   LRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGH  575
             L+TEID++DVRREVEIMRHLPKHPNIV+YKE YEDK+A+YLVMELCEGGELFDRIV KGH
Sbjct  119   LKTEIDIDDVRREVEIMRHLPKHPNIVTYKEAYEDKDAIYLVMELCEGGELFDRIVNKGH  178

Query  576   YTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPG  755
             YTERAAA V KTIL +++VCH++GV+HRDLKPENFL+A+G+EN+ LKAIDFGLSIFFKPG
Sbjct  179   YTERAAAAVGKTILRIVKVCHENGVMHRDLKPENFLFADGSENSQLKAIDFGLSIFFKPG  238

Query  756   QRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG  935
             ++F EIVGSPYYMAPEVLRR+YG E+DVWSAGVI+YILLCGVPPFWAETEEGIAHAI+RG
Sbjct  239   EQFCEIVGSPYYMAPEVLRRNYGPEIDVWSAGVIIYILLCGVPPFWAETEEGIAHAIIRG  298

Query  936   DIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTT  1115
              IDF+RDPWPK+S++AK+LVK MLD NPY+R+T+EEVL + WI+N    PNV LG  VT+
Sbjct  299   KIDFERDPWPKVSKEAKELVKNMLDPNPYNRLTLEEVLENPWIKNDNHAPNVSLGGNVTS  358

Query  1116  RIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQ  1295
             RIKQF++MNKFKK+VL VVA+NL QDQ+  IK+MF+MMDTDKNG+L+FEELKDGL+M+GQ
Sbjct  359   RIKQFSIMNKFKKKVLRVVADNLPQDQMAQIKQMFYMMDTDKNGDLTFEELKDGLNMIGQ  418

Query  1296  PVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEF  1475
              V+D DV++LM+AADVDGNG+L+C+EF+T++VHL  + NDD L +AF  FDK+ SG+IE 
Sbjct  419   KVSDPDVKMLMEAADVDGNGLLSCDEFVTMSVHLKRIGNDDILSQAFRFFDKNQSGFIEV  478

Query  1476  EELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKV  1655
             +EL++ LLE +     DQ +++I+ D DLD+DGRISF EFKAMMT+G DWKMASR+YS+ 
Sbjct  479   DELKEVLLEDNAGPNGDQTIRDILRDVDLDRDGRISFEEFKAMMTSGADWKMASRQYSRA  538

Query  1656  MLNALSVRLFKDKSVQ  1703
             M++ALS++LFKDKS++
Sbjct  539   MMSALSIKLFKDKSME  554



>ref|XP_008454033.1| PREDICTED: calcium-dependent protein kinase 24 [Cucumis melo]
Length=527

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/536 (67%), Positives = 442/536 (82%), Gaps = 15/536 (3%)
 Frame = +3

Query  99    MGACVSLHS--ALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGD  272
             MG+CVS+        KRP++  P+ P++V        + R   +     +L  SH++TGD
Sbjct  1     MGSCVSVQPRPGSFSKRPKDINPL-PDHVL-----IESVRKSSVRHAASIL--SHDSTGD  52

Query  273   GISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRH  452
              I +KY FGKELGRGEFG+T+ C + ETG++ ACK ISKSKLR+EI+VEDVRREV IMR 
Sbjct  53    NIFEKYRFGKELGRGEFGITHQCFDIETGDTFACKTISKSKLRSEINVEDVRREVAIMRS  112

Query  453   LPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQV  632
             LPKHPNIV++KE +ED EAVY VMELCEGGELFDRIV+KGHYTERAAA VTKTI+E+ +V
Sbjct  113   LPKHPNIVTFKEAFEDNEAVYFVMELCEGGELFDRIVSKGHYTERAAANVTKTIVEICKV  172

Query  633   CHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLR  812
             CH++GVIHRDLKPENFL+A+ +EN+ LKAIDFGLSIFF+P QRF EIVGSPYYMAPEVLR
Sbjct  173   CHENGVIHRDLKPENFLFADESENSQLKAIDFGLSIFFEPDQRFGEIVGSPYYMAPEVLR  232

Query  813   RDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDL  992
             R YG E+DVWSAGVILYILLCGVPPFWAE+EEGIAHAIVRG+IDF+RDPWPK+S++AK+L
Sbjct  233   RSYGPEIDVWSAGVILYILLCGVPPFWAESEEGIAHAIVRGNIDFERDPWPKVSKEAKEL  292

Query  993   VKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVV  1172
             V GMLD NPY+RMT+EEVLAH WIQN     NV LGE V  RIKQFTLMNKFKK+VL VV
Sbjct  293   VVGMLDPNPYNRMTVEEVLAHPWIQNKNQARNVSLGENVGIRIKQFTLMNKFKKKVLRVV  352

Query  1173  AENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGN  1352
             A++LS +Q+E I+ MFHMMDTD+NG+L+FEELK+GL M+G  + D DV++LMDAAD+DGN
Sbjct  353   ADHLSDEQMEGIRRMFHMMDTDQNGDLTFEELKNGLHMIGHSLPDPDVRMLMDAADLDGN  412

Query  1353  GMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQV  1532
             G L+CEEF T+++HL  +S D+ L +AF  FDK+ +GYIE++ELR+ L+  DD   N++V
Sbjct  413   GTLSCEEFATMSIHLRKMSTDELLTQAFNFFDKNQNGYIEYDELREALM--DD---NEKV  467

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             +Q+II D D DKDGRIS+ EFKAM+TTG DWKM+SR+YS+ ML+ALS++LFKDKSV
Sbjct  468   IQDIISDVDSDKDGRISYEEFKAMLTTGMDWKMSSRQYSRAMLHALSLKLFKDKSV  523



>ref|XP_002309814.2| hypothetical protein POPTR_0007s02120g [Populus trichocarpa]
 gb|EEE90264.2| hypothetical protein POPTR_0007s02120g [Populus trichocarpa]
Length=534

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/540 (65%), Positives = 439/540 (81%), Gaps = 13/540 (2%)
 Frame = +3

Query  99    MGACVS----LHSALTMKRPRN-RRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNA  263
             MG+CVS    L   ++ +   N R+P+   +     S  + PR+ +I+  I+        
Sbjct  1     MGSCVSTPANLGQIISKRSSHNVRKPLPSPD--QNDSVVQTPRALQIASVIK------EP  52

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I +KY FGKELGRGEFG+TY C + +TGE  ACK ISKSKL++EIDVEDVRREVEI
Sbjct  53    TGHNIHEKYTFGKELGRGEFGITYHCFDIKTGEKYACKTISKSKLKSEIDVEDVRREVEI  112

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPNIVS++E YED++AV+LVMELCEGGELFDRI++KGHY+ERAAA+VTKTILE+
Sbjct  113   MRHLPKHPNIVSFREAYEDRDAVHLVMELCEGGELFDRIISKGHYSERAAAMVTKTILEI  172

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             ++VCH HGVIHRDLKPENFL+A+ +E++ LKAIDFGLSIFF+PGQRF+EIVGSPYYMAPE
Sbjct  173   VKVCHDHGVIHRDLKPENFLFADASESSQLKAIDFGLSIFFEPGQRFREIVGSPYYMAPE  232

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             +LRR+YG EVDVWS GVILYILLCGVPPFWAETEEGIAHAIVRG+IDF RDPWPK+SE+ 
Sbjct  233   ILRRNYGPEVDVWSTGVILYILLCGVPPFWAETEEGIAHAIVRGEIDFARDPWPKVSEEG  292

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KD+VK MLD NPY+R+T+EEVL + WIQNA  VPN+ LGE V T+IKQF+LMN+FKK+ L
Sbjct  293   KDIVKKMLDQNPYNRLTVEEVLENPWIQNASDVPNISLGENVRTKIKQFSLMNRFKKKAL  352

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA++L  +QV+ IK+MFHMMDTD NG+LSF+ELKDGL+  G  V D DV+LLMDAAD 
Sbjct  353   RVVADSLPDEQVDKIKQMFHMMDTDHNGDLSFQELKDGLNKFGHSVPDPDVKLLMDAADA  412

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+CEEF+ ++VHL  +S+D +L +AF  FDKD +G+IEF+ELR+ +   D    N
Sbjct  413   DGNGSLSCEEFVAVSVHLKRISSDKHLTQAFRFFDKDQNGFIEFDELREAMSNDDLGPNN  472

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +QV+++IIFD DLDKDGRIS+ EFKAMM +G DWKM SR+YS+ M+ ALS+ L K++S Q
Sbjct  473   EQVIKDIIFDVDLDKDGRISYNEFKAMMKSGLDWKMGSRQYSRAMMKALSINLLKNESKQ  532



>ref|XP_006494199.1| PREDICTED: calcium-dependent protein kinase 24-like [Citrus sinensis]
Length=586

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/496 (70%), Positives = 432/496 (87%), Gaps = 2/496 (0%)
 Frame = +3

Query  216   QKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSK  395
             + IS Q+R +  S+ A G+ I  KY FGKELGRGEFG+T+ C E ETGE+ ACKKI+K K
Sbjct  61    KSISFQLRSV-VSNPAEGN-ILDKYTFGKELGRGEFGITHQCFEIETGETYACKKIAKEK  118

Query  396   LRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGH  575
             L+TEID++DVRREVEIMRHLPKHPNIV+YKE YEDK+A+YLVMELCEGGELFDRIV KGH
Sbjct  119   LKTEIDIDDVRREVEIMRHLPKHPNIVTYKEAYEDKDAIYLVMELCEGGELFDRIVNKGH  178

Query  576   YTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPG  755
             YTERAAA V KTIL +++VCH++GV+HRDLKPENFL+A+G+EN+ LKAIDFGLSIFFKPG
Sbjct  179   YTERAAAAVGKTILRIVKVCHENGVMHRDLKPENFLFADGSENSQLKAIDFGLSIFFKPG  238

Query  756   QRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG  935
             ++F EIVGSPYYMAPEVLRR+YG E+DVWSAGVI+YILLCGVPPFWAETEEGIAHAI+RG
Sbjct  239   EQFCEIVGSPYYMAPEVLRRNYGPEIDVWSAGVIIYILLCGVPPFWAETEEGIAHAIIRG  298

Query  936   DIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTT  1115
              IDF+RDPWPK+S++AK+LVK MLD NPY+R+T+EEVL + WI+N    PNV LG  VT+
Sbjct  299   KIDFERDPWPKVSKEAKELVKNMLDPNPYNRLTLEEVLENPWIKNDNHAPNVSLGGNVTS  358

Query  1116  RIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQ  1295
             RIKQF++MNKFKK+VL VVA+NL QDQ+  IK+MF+MMDTDKNG+L+FEELKDGL+M+GQ
Sbjct  359   RIKQFSIMNKFKKKVLRVVADNLPQDQMAQIKQMFYMMDTDKNGDLTFEELKDGLNMIGQ  418

Query  1296  PVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEF  1475
              V+D DV++LM+AADVDGNG+L+C+EF+T++VHL  + NDD L +AF  FDK+ SG+IE 
Sbjct  419   KVSDPDVKMLMEAADVDGNGLLSCDEFVTMSVHLKRIGNDDILSQAFRFFDKNQSGFIEV  478

Query  1476  EELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKV  1655
             +EL++ LL+ +     DQ +++I+ D DLD+DGRISF EFKAMMT+G DWKMASR+YS+ 
Sbjct  479   DELKEVLLDDNAGPNGDQTIRDILRDVDLDRDGRISFEEFKAMMTSGADWKMASRQYSRA  538

Query  1656  MLNALSVRLFKDKSVQ  1703
             M++ALS++LFKDKS++
Sbjct  539   MMSALSIKLFKDKSME  554



>ref|XP_007034055.1| Calcium-dependent protein kinase 24 [Theobroma cacao]
 gb|EOY04981.1| Calcium-dependent protein kinase 24 [Theobroma cacao]
Length=537

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/490 (71%), Positives = 418/490 (85%), Gaps = 2/490 (0%)
 Frame = +3

Query  225   SRQIRVLNES--HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKL  398
             S  +RV N     +++GD I ++YE GKELGRGEFGVT+ C +  TGE+ ACKKISK+KL
Sbjct  42    SMNLRVTNGKVLKDSSGDNILERYELGKELGRGEFGVTHQCFDLVTGEAYACKKISKAKL  101

Query  399   RTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHY  578
             R+EIDVEDVRREVEIMRHLPKHPNIV+++E +EDKEAVYLVMELC GGELFDRIVAKGHY
Sbjct  102   RSEIDVEDVRREVEIMRHLPKHPNIVTFREAFEDKEAVYLVMELCHGGELFDRIVAKGHY  161

Query  579   TERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQ  758
             TERAAA   KTILE+++VCH+HGVIHRDLKPENFL A+ +E AP+KAIDFGLSIF++PGQ
Sbjct  162   TERAAATAIKTILEIVKVCHEHGVIHRDLKPENFLLADESETAPIKAIDFGLSIFYEPGQ  221

Query  759   RFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGD  938
             RF +IVGSPYYMAPEVLRR+YG EVD+WS GVILYILLCGVPPFWA+TEEGIAHAI++GD
Sbjct  222   RFSDIVGSPYYMAPEVLRRNYGKEVDIWSIGVILYILLCGVPPFWADTEEGIAHAIIKGD  281

Query  939   IDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTR  1118
             IDF+RDPWPK+SE+AKDLV+ MLD NPYSRMT++EV  H WIQN E  PNV LGE V TR
Sbjct  282   IDFERDPWPKVSEEAKDLVRSMLDPNPYSRMTVQEVFEHPWIQNLEHAPNVNLGENVRTR  341

Query  1119  IKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQP  1298
             IKQF+ M+KFKK+VL VVA NL  +Q ++I ++F MMDTD+NG+LSFEEL+DGL  +G  
Sbjct  342   IKQFSFMSKFKKKVLRVVAGNLPNEQTDAIVQIFRMMDTDENGHLSFEELRDGLQKIGHC  401

Query  1299  VADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFE  1478
             VAD DVQLLMDAAD+DGNG L+CEEF+T+AVHL  +SND++L +AF  FDK+ SGYIEFE
Sbjct  402   VADPDVQLLMDAADIDGNGTLSCEEFVTMAVHLKRMSNDEHLSQAFHHFDKNQSGYIEFE  461

Query  1479  ELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVM  1658
             EL++ LL  D    N+QV+++II D DLDKDGRIS+ EFKAMM TG DWKMASR+YS+ +
Sbjct  462   ELQEALLHDDLGPNNEQVIRDIIHDVDLDKDGRISYEEFKAMMLTGMDWKMASRQYSRAL  521

Query  1659  LNALSVRLFK  1688
             LNA+S+++ K
Sbjct  522   LNAVSIKILK  531



>ref|XP_008379556.1| PREDICTED: calcium-dependent protein kinase 24-like [Malus domestica]
Length=537

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/539 (67%), Positives = 430/539 (80%), Gaps = 8/539 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR--RPIDPENVRGGGSRTR--APRSQKISRQIRVLNESHNAT  266
             MG+CV   +       R    +P+   +V     R    AP     S  I VL+++    
Sbjct  1     MGSCVCTPAKAGFHHRRRDIIKPLPQSSVHDSSPRRSFVAPVPHH-STIIWVLDKT---A  56

Query  267   GDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiM  446
             G+ I  KY+FG ELGRGEFG+TY C  +ETGE+ ACK ISKSKL+TEIDVEDVRRE EIM
Sbjct  57    GNDIFGKYQFGNELGRGEFGITYRCVHRETGEAFACKTISKSKLKTEIDVEDVRREAEIM  116

Query  447   RHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVI  626
             R LPKHPNIV +KE YED+EAVYLVMELCEGGELFDRIVAKGHYTERAAA VT+TILE+ 
Sbjct  117   RRLPKHPNIVCFKEAYEDREAVYLVMELCEGGELFDRIVAKGHYTERAAATVTRTILEIC  176

Query  627   QVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEV  806
             QVCHKHGVIHRDLKPENFL+A+G+ENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEV
Sbjct  177   QVCHKHGVIHRDLKPENFLFADGSENAELKAIDFGLSIFFEPGQRFNEIVGSPYYMAPEV  236

Query  807   LRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAK  986
             LRR+YG EVDVWS+GVILYILLCGVPPFWAETEEGIA AIVRG IDF+R+ W  +SE+AK
Sbjct  237   LRRNYGPEVDVWSSGVILYILLCGVPPFWAETEEGIAQAIVRGTIDFERETWKNVSEEAK  296

Query  987   DLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLM  1166
             +LV+ MLD NP +R+ +EEVL H WI N   VPNVPLGE VT RIKQF+LMNKFKK+VL 
Sbjct  297   ELVRSMLDPNPCNRLKVEEVLDHPWIXNGNQVPNVPLGENVTLRIKQFSLMNKFKKKVLR  356

Query  1167  VVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVD  1346
             VVA+NL +DQ++ I+++F MMD D NGNL+FEEL+DGL  +G  VAD DVQ+L+DAAD D
Sbjct  357   VVADNLPEDQIDGIRQIFEMMDIDNNGNLTFEELRDGLVKIGHNVADPDVQMLLDAADAD  416

Query  1347  GNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND  1526
             GNG L+C+EF+ ++VHL  + +D+ LH+AF  FDK+NSGYIEF+ELR+ LL+      N+
Sbjct  417   GNGTLSCDEFVMVSVHLKKIDSDEFLHQAFGYFDKNNSGYIEFDELREALLDDKLGPDNE  476

Query  1527  QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             QV+Q+IIFD DLDKDGRI F EFKAMM TG DWKMASR+YS+ +LN LS +L KD+S+Q
Sbjct  477   QVIQDIIFDVDLDKDGRIGFEEFKAMMKTGMDWKMASRQYSRALLNVLSRKLLKDESLQ  535



>ref|XP_004152305.1| PREDICTED: calcium-dependent protein kinase 24-like [Cucumis 
sativus]
 ref|XP_004156997.1| PREDICTED: calcium-dependent protein kinase 24-like [Cucumis 
sativus]
 gb|KGN53027.1| hypothetical protein Csa_4G011740 [Cucumis sativus]
Length=527

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/536 (67%), Positives = 439/536 (82%), Gaps = 15/536 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRN--RRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGD  272
             MG+CVS+ +     RP +  +R  D  N     +   + R   +     +L  SH++TGD
Sbjct  1     MGSCVSIQA-----RPGSFSKRTKDI-NTLPDHAFIESVRKSSVRHAASIL--SHDSTGD  52

Query  273   GISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRH  452
              I +KY FGKELGRGEFG+T+ C + ETG++ ACK ISKSKLR+EI+VEDVRREV IMR 
Sbjct  53    NIFEKYRFGKELGRGEFGITHQCFDIETGDTFACKTISKSKLRSEINVEDVRREVAIMRS  112

Query  453   LPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQV  632
             LPKHPNIV++KE +ED EAVY VMELCEGGELFDRIV+KGHYTERAAA VTKTI+E+ ++
Sbjct  113   LPKHPNIVTFKEAFEDNEAVYFVMELCEGGELFDRIVSKGHYTERAAANVTKTIIEICKL  172

Query  633   CHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLR  812
             CH++GVIHRDLKPENFL+A+ +EN+ LKAIDFGLSIFF+P QRF EIVGSPYYMAPEVLR
Sbjct  173   CHENGVIHRDLKPENFLFADESENSQLKAIDFGLSIFFEPDQRFGEIVGSPYYMAPEVLR  232

Query  813   RDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDL  992
             R YG E+DVWSAGVILYILLCGVPPFWAE+EEGIAHAIVRG+IDF+RDPWPK+S++AK+L
Sbjct  233   RSYGPEIDVWSAGVILYILLCGVPPFWAESEEGIAHAIVRGNIDFERDPWPKVSKEAKEL  292

Query  993   VKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVV  1172
             V GMLD NPY+RMT+EEVL H WIQN     NV LGE V  RIKQFTLMNKFKK+VL VV
Sbjct  293   VVGMLDPNPYNRMTVEEVLGHPWIQNKNQARNVSLGENVGIRIKQFTLMNKFKKKVLRVV  352

Query  1173  AENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGN  1352
             A++LS +Q+E I+ MFHMMDTDKNG+L+FEELK+GL M+G  + D DV++LMDAAD+DGN
Sbjct  353   ADHLSDEQMEGIRRMFHMMDTDKNGDLTFEELKNGLHMIGHSLPDPDVRMLMDAADLDGN  412

Query  1353  GMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQV  1532
             G L+CEEF T+++HL  +S D+ L +AF  FDKD +GYIE++ELR+ L+  DD   N++V
Sbjct  413   GTLSCEEFATMSIHLRKMSTDELLTQAFSFFDKDQNGYIEYDELREALM--DD---NEKV  467

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             +Q+II D D DKDGRIS+ EFKAM+TTG DWKM+SR+YS+ ML+ALS++LFKDKSV
Sbjct  468   IQDIISDVDSDKDGRISYNEFKAMLTTGMDWKMSSRQYSRAMLHALSLKLFKDKSV  523



>ref|XP_009357126.1| PREDICTED: calcium-dependent protein kinase 24-like [Pyrus x 
bretschneideri]
Length=537

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/539 (67%), Positives = 429/539 (80%), Gaps = 8/539 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR--RPIDPENVRGGGSRTR--APRSQKISRQIRVLNESHNAT  266
             MG+CV   +       R    +P+   +V     R    AP +   S  I VL+++    
Sbjct  1     MGSCVCTPAKAGFHHRRRDIIKPLPQSSVHDSSPRRSFVAPVAHH-STIIWVLDKT---A  56

Query  267   GDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiM  446
             G+ I  KY+FG ELGRGEFG+TY C  +ETGE+ ACK ISKSKL+TEIDVEDVRRE EIM
Sbjct  57    GNDIFGKYQFGNELGRGEFGITYRCVHRETGEAFACKTISKSKLKTEIDVEDVRREAEIM  116

Query  447   RHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVI  626
             R LPKHPNIV +KE YED+EAVYLVMELCEGGELFDRIVAKGHYTERA   VT+TILE+ 
Sbjct  117   RRLPKHPNIVCFKEAYEDREAVYLVMELCEGGELFDRIVAKGHYTERAXXTVTRTILEIC  176

Query  627   QVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEV  806
             QVCHKHGVIHRDLKPENFL+A+ +ENA LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEV
Sbjct  177   QVCHKHGVIHRDLKPENFLFADSSENAELKAIDFGLSIFFEPGQRFNEIVGSPYYMAPEV  236

Query  807   LRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAK  986
             LRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIA AIVRG IDF+R+ W  +SE+AK
Sbjct  237   LRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAQAIVRGTIDFERETWKNVSEEAK  296

Query  987   DLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLM  1166
             +LV+ MLD NP +R+ +EEVL H WI+NA  VPNVPLGE VT RIKQF+LMNKFKK+VL 
Sbjct  297   ELVRSMLDPNPCNRLKVEEVLDHPWIRNANQVPNVPLGENVTLRIKQFSLMNKFKKKVLR  356

Query  1167  VVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVD  1346
             VVA+NL +DQ++ I+++F MMD D NG L+FEEL+DGL  +G  VAD DVQ+L+DAAD D
Sbjct  357   VVADNLPEDQIDGIRQIFEMMDIDNNGTLTFEELRDGLVKIGHNVADPDVQMLLDAADAD  416

Query  1347  GNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND  1526
             GNG L+C+EF+ ++VHL  + +D+ LH+AF  FDK+NSGYIEF+ELR+ LL+      N+
Sbjct  417   GNGTLSCDEFVMVSVHLKKIDSDEFLHQAFGYFDKNNSGYIEFDELREALLDDKLGPDNE  476

Query  1527  QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             QV+Q+IIFD DLDKDGRI F EFKAMM TG DWKMASR+YS+ +LN LS +L KD+S+Q
Sbjct  477   QVIQDIIFDVDLDKDGRIGFEEFKAMMKTGMDWKMASRQYSRALLNVLSRKLLKDESLQ  535



>ref|XP_008222646.1| PREDICTED: calcium-dependent protein kinase 24 [Prunus mume]
Length=544

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/538 (65%), Positives = 433/538 (80%), Gaps = 4/538 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR---RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATG  269
             MG+CV   +   +   R++   +P+ P+ +     ++       +     ++       G
Sbjct  1     MGSCVCTPAKAGVYHKRSKDIIKPL-PQCIHDSPRKSSVAAPAAVHHHRSIIWVLDKTAG  59

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             + I  KYEFGKELGRGEFG+TY CT +ETGE +ACKKI+KSKL+TEIDVEDVRRE EIMR
Sbjct  60    NNIFDKYEFGKELGRGEFGITYRCTHRETGELLACKKIAKSKLKTEIDVEDVRREAEIMR  119

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LPKHPNIVS+KE YEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA VT+TILE+ +
Sbjct  120   RLPKHPNIVSFKEAYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAATVTRTILEICK  179

Query  630   VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVL  809
             VCH++GVIHRDLKPENFL+ + +ENA LKAIDFGLSIFF+ GQRF EIVGSPYYMAPEVL
Sbjct  180   VCHQNGVIHRDLKPENFLFTDSSENAQLKAIDFGLSIFFEKGQRFSEIVGSPYYMAPEVL  239

Query  810   RRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKD  989
             RR+YG EVDVWSAGVILYILLCGVPPFWAE+EEGIA AIVRG IDF+R+ W K+S++AK+
Sbjct  240   RRNYGPEVDVWSAGVILYILLCGVPPFWAESEEGIAQAIVRGSIDFEREAWKKVSDEAKE  299

Query  990   LVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMV  1169
             LVK MLD NP++R+ +EEVL H WI++A  VPNVPLG  VT RIKQF+LM+KFKK+VL V
Sbjct  300   LVKRMLDPNPFNRLGVEEVLDHPWIRHANQVPNVPLGGNVTLRIKQFSLMSKFKKKVLRV  359

Query  1170  VAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDG  1349
             VA+NL  DQ++ I+++F+MMD D NGNL+FEEL+DGL  +G  V D DVQ+L+DAAD DG
Sbjct  360   VADNLPDDQIDGIRQLFNMMDIDNNGNLNFEELRDGLVKIGHHVTDPDVQMLIDAADGDG  419

Query  1350  NGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQ  1529
              G LNC+EF+ ++VHL  + ND+ LH+AF  FDK++SGY+EF+ELR+ LL+      N+Q
Sbjct  420   TGTLNCDEFVVVSVHLRKIDNDELLHQAFTYFDKNDSGYVEFDELREALLDDKLGPANEQ  479

Query  1530  VVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             V+Q+IIFD DLDKDGRISF EFKAMM +G DWKMASR+YS+ MLNALS +L KD+S+Q
Sbjct  480   VIQDIIFDVDLDKDGRISFEEFKAMMKSGMDWKMASRQYSRAMLNALSRKLLKDESLQ  537



>ref|XP_011026389.1| PREDICTED: calcium-dependent protein kinase 24 [Populus euphratica]
Length=534

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/540 (65%), Positives = 435/540 (81%), Gaps = 13/540 (2%)
 Frame = +3

Query  99    MGACVSLHSAL---TMKRPRN--RRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNA  263
             MG+CVS  + L     KR  +  R+P+   +     S  + PR+  I+  I+        
Sbjct  1     MGSCVSTPANLGHIISKRSSHNVRKPLPSPD--QNDSVVQTPRALHITSVIK------EP  52

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I +KY FGKELGRGEFGVTY C + +TGE  ACK ISKSKL++EIDVEDVRREVEI
Sbjct  53    TGHNIHEKYTFGKELGRGEFGVTYQCFDIKTGEKYACKTISKSKLKSEIDVEDVRREVEI  112

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPNIVS++E YED++AV+LVMELCEGGELFDRIV+KGHY+ERAAA+VTKTILE+
Sbjct  113   MRHLPKHPNIVSFREAYEDRDAVHLVMELCEGGELFDRIVSKGHYSERAAAMVTKTILEI  172

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             ++VCH HGVIHRDLKPENFL+A+ +E + LKAIDFGLSIFF+PGQRF+EIVGSPYYMAPE
Sbjct  173   VKVCHDHGVIHRDLKPENFLFADASECSQLKAIDFGLSIFFEPGQRFREIVGSPYYMAPE  232

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             +LRR+YG EVDVWS GVILYILLCGVPPFWAETEEGIAHAIVRG+IDF RDPWPK+SE+ 
Sbjct  233   ILRRNYGPEVDVWSTGVILYILLCGVPPFWAETEEGIAHAIVRGEIDFARDPWPKVSEEG  292

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KD+VK MLD NPY+R+T+EEVL + WIQNA  VPN+ LGE V T+IKQF+LMN+FKK+ L
Sbjct  293   KDIVKKMLDQNPYNRLTVEEVLENPWIQNASDVPNISLGENVRTKIKQFSLMNRFKKKAL  352

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA++L  +QV+ IK+MFHMMDTD NG+LSF+ELKDGL+  G  V D DV+LLMDAAD 
Sbjct  353   RVVADSLPDEQVDKIKQMFHMMDTDHNGDLSFQELKDGLNKFGHSVPDPDVKLLMDAADA  412

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG+L+C+EF+ ++VHL  + +D +L +AF  FDKD +G+IEF+ELR+ +   D    N
Sbjct  413   DGNGLLSCDEFVAVSVHLKRIGSDKHLTQAFRFFDKDQNGFIEFDELREAMSNDDLGPNN  472

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +Q +++II D DLDKDGRIS+ EFKAMM +G DWKM SR+YS+ M+ ALSV L K++S Q
Sbjct  473   EQAIKDIIVDVDLDKDGRISYNEFKAMMKSGLDWKMGSRQYSRAMMKALSVNLLKNESKQ  532



>ref|XP_002879331.1| calcium-dependent protein kinase 24 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55590.1| calcium-dependent protein kinase 24 [Arabidopsis lyrata subsp. 
lyrata]
Length=582

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/545 (66%), Positives = 439/545 (81%), Gaps = 24/545 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRA-PR---SQKISRQI------RV  242
             MG+CVS  L  +   KRP  RR           SRT + PR   S  +SR++      RV
Sbjct  1     MGSCVSSPLKGSPFGKRPVRRR-------HSSNSRTSSVPRFDSSTNLSRRLIFQPPSRV  53

Query  243   LNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidved  422
             L E     GDGI  KY+ GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVED
Sbjct  54    LPE---PIGDGIHLKYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVED  110

Query  423   vrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALV  602
             VRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V
Sbjct  111   VRREVEIMRCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASV  170

Query  603   TKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGS  782
              KTILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSIFFKP QRF EIVGS
Sbjct  171   AKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGS  230

Query  783   PYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPW  962
             PYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPW
Sbjct  231   PYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPW  290

Query  963   PKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMN  1142
             PK+S +AK+LVK MLDANPYSR+T++EVL H WI+NA+  PNV LG+ V T+I+QF LMN
Sbjct  291   PKVSREAKELVKNMLDANPYSRLTVQEVLEHPWIRNADRAPNVNLGDNVRTKIQQFLLMN  350

Query  1143  KFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQL  1322
             +FKK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ V D DV++
Sbjct  351   RFKKKVLRIVADNLPNEEIAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKM  410

Query  1323  LMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLE  1502
             LMDAAD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL++ L +
Sbjct  411   LMDAADTDGNGMLSCEEFVTLSIHLKRMGCDEHLQEAFKYFDKNRNGFIELDELKEALCD  470

Query  1503  --IDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
               +   N NDQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  471   DKLGHGNGNDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSI  530

Query  1677  RLFKD  1691
             ++FK+
Sbjct  531   KMFKE  535



>ref|XP_003539045.1| PREDICTED: calcium-dependent protein kinase 24-like [Glycine 
max]
Length=542

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/538 (65%), Positives = 437/538 (81%), Gaps = 8/538 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPR--NRRPIDPENVRGGG---SRTRAPRSQKISRQIRVLNESHNA  263
             MG+C+S  +  T KR R  N +P  P   RG G   +R  +  +++ S   R LN     
Sbjct  1     MGSCISTQAVRTRKRSRSPNHKPSTP---RGRGHEVARRSSVAARRSSVTARPLNVVSGP  57

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             +   I  KY+FGKELGRGEFGVT+   + E+GE+ ACKKISK+KLRTEIDV+DVRREV+I
Sbjct  58    SPGNIFDKYQFGKELGRGEFGVTHRVVDVESGEAFACKKISKTKLRTEIDVQDVRREVQI  117

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP+HPNIV++KE YEDK+AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTILEV
Sbjct  118   MRHLPQHPNIVAFKEAYEDKDAVYLVMELCEGGELFDRIVAKGHYTERAAANVVKTILEV  177

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
              +VCH+HGVIHRDLKPENFL+A+ +E+APLK+IDFGLS F++ G+RF EIVGSPYYMAPE
Sbjct  178   CKVCHEHGVIHRDLKPENFLFADTSESAPLKSIDFGLSTFYESGERFSEIVGSPYYMAPE  237

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG E+DVWS GVILYILLCGVPPFWAE+EEGIA AI+RG +DF RDPWPK+S++A
Sbjct  238   VLRRNYGQEIDVWSTGVILYILLCGVPPFWAESEEGIAQAIIRGKVDFTRDPWPKVSDEA  297

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             K LVK MLD NP++R+T++EVL + WIQN E    + LG+ V  RIKQF+LMN+FK++VL
Sbjct  298   KHLVKRMLDPNPFTRITVQEVLDNSWIQNREHGRTISLGDQVRMRIKQFSLMNRFKRKVL  357

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA+NLS +Q++  K+MF+MMD DKNGNLSFEEL+DGLSM+G  + D DV++LMDAAD+
Sbjct  358   RVVADNLSDEQIDVFKQMFNMMDKDKNGNLSFEELRDGLSMIGHAIPDPDVEMLMDAADI  417

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG LN EEFIT++VHL  + +D++L +AF  FDK+ SGY+EFEEL+D L + D +  +
Sbjct  418   DGNGTLNYEEFITMSVHLRKIESDEHLSEAFRYFDKNQSGYVEFEELKDALSDDDSEASD  477

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
             DQVV++I+ D DLDKDGRISF EFKAMM TG DWKMASR+YS+ +LNALS ++FKD S
Sbjct  478   DQVVKDILNDVDLDKDGRISFEEFKAMMNTGGDWKMASRQYSRALLNALSFKMFKDTS  535



>gb|ABK28519.1| unknown [Arabidopsis thaliana]
Length=583

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/545 (66%), Positives = 438/545 (80%), Gaps = 24/545 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRA-PR---SQKISRQI------RV  242
             MG+CVS  L  +   KRP  RR           SRT + PR   S  +SR++      RV
Sbjct  1     MGSCVSSPLKGSPFGKRPVRRR-------HSSNSRTSSVPRFDSSTNLSRRLIFQPPSRV  53

Query  243   LNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidved  422
             L E     GDGI  KY+ GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVED
Sbjct  54    LPE---PIGDGIHLKYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVED  110

Query  423   vrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALV  602
             VRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V
Sbjct  111   VRREVEIMRCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASV  170

Query  603   TKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGS  782
              KTILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSIFFKP QRF EIVGS
Sbjct  171   AKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGS  230

Query  783   PYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPW  962
             PYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPW
Sbjct  231   PYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPW  290

Query  963   PKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMN  1142
             PK+S +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF LMN
Sbjct  291   PKVSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLMN  350

Query  1143  KFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQL  1322
             +FKK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ V D DV++
Sbjct  351   RFKKKVLRIVADNLPNEEIAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKM  410

Query  1323  LMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLE  1502
             LMDAAD DGNGML+C+EF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL+  L +
Sbjct  411   LMDAADTDGNGMLSCDEFVTLSIHLKRMGCDEHLQEAFKYFDKNGNGFIELDELKVALCD  470

Query  1503  --IDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
               +   N NDQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  471   DKLGHANGNDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSI  530

Query  1677  RLFKD  1691
             ++FK+
Sbjct  531   KMFKE  535



>ref|NP_180708.1| calcium-dependent protein kinase 24 [Arabidopsis thaliana]
 sp|Q9SIQ7.1|CDPKO_ARATH RecName: Full=Calcium-dependent protein kinase 24 [Arabidopsis 
thaliana]
 gb|AAD24851.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAM15433.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|ABE65877.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AEC08555.1| calcium-dependent protein kinase 24 [Arabidopsis thaliana]
Length=582

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/545 (66%), Positives = 438/545 (80%), Gaps = 24/545 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRA-PR---SQKISRQI------RV  242
             MG+CVS  L  +   KRP  RR           SRT + PR   S  +SR++      RV
Sbjct  1     MGSCVSSPLKGSPFGKRPVRRR-------HSSNSRTSSVPRFDSSTNLSRRLIFQPPSRV  53

Query  243   LNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidved  422
             L E     GDGI  KY+ GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVED
Sbjct  54    LPE---PIGDGIHLKYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVED  110

Query  423   vrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALV  602
             VRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V
Sbjct  111   VRREVEIMRCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASV  170

Query  603   TKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGS  782
              KTILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSIFFKP QRF EIVGS
Sbjct  171   AKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGS  230

Query  783   PYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPW  962
             PYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPW
Sbjct  231   PYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPW  290

Query  963   PKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMN  1142
             PK+S +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF LMN
Sbjct  291   PKVSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLMN  350

Query  1143  KFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQL  1322
             +FKK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ V D DV++
Sbjct  351   RFKKKVLRIVADNLPNEEIAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKM  410

Query  1323  LMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLE  1502
             LMDAAD DGNGML+C+EF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL+  L +
Sbjct  411   LMDAADTDGNGMLSCDEFVTLSIHLKRMGCDEHLQEAFKYFDKNGNGFIELDELKVALCD  470

Query  1503  --IDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
               +   N NDQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  471   DKLGHANGNDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSI  530

Query  1677  RLFKD  1691
             ++FK+
Sbjct  531   KMFKE  535



>ref|XP_008341917.1| PREDICTED: calcium-dependent protein kinase 24-like [Malus domestica]
Length=541

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/538 (66%), Positives = 429/538 (80%), Gaps = 6/538 (1%)
 Frame = +3

Query  99    MGACVSL--HSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQI-RVLNESHNATG  269
             MG+C+    ++ +  +R     P+   +V     R  +  +    R I  VL+++    G
Sbjct  1     MGSCLCTPANAGVHHRRRNIIXPLPQNSVHDSSPRKSSVAAVPQHRSIIWVLDKT---AG  57

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             D I  KY FGKELGRGEFG+TY C  +ETGE   CK ISKSKL+TEIDVEDVRRE EIMR
Sbjct  58    DDIFGKYLFGKELGRGEFGITYRCVHRETGEPFXCKTISKSKLKTEIDVEDVRREAEIMR  117

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LPKH NIV +KE YED+EAVYLVMELCEGGELFDRIVAKGHYTERAAA VT+T+LEV Q
Sbjct  118   RLPKHLNIVCFKEAYEDREAVYLVMELCEGGELFDRIVAKGHYTERAAANVTRTMLEVCQ  177

Query  630   VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVL  809
             VCHKHGVIHRD+KPENFL+A+ +ENA LKAIDFGL IFF+PGQRF EIVGSPYYMAPEVL
Sbjct  178   VCHKHGVIHRDMKPENFLFADSSENAQLKAIDFGLGIFFEPGQRFTEIVGSPYYMAPEVL  237

Query  810   RRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKD  989
             RR+YG EVDVWSAGVILYILLCGVPPFWAE+EEGIA AIVRG IDF+R+ W ++SE+AK+
Sbjct  238   RRNYGSEVDVWSAGVILYILLCGVPPFWAESEEGIAQAIVRGTIDFERETWKQVSEEAKE  297

Query  990   LVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMV  1169
             LV+ MLD NP++R+T+EEVL H WI+NA  VPNVPLGE VT RIKQF+LMNKFKK+VL V
Sbjct  298   LVRRMLDPNPHNRLTVEEVLDHPWIRNANQVPNVPLGENVTLRIKQFSLMNKFKKKVLRV  357

Query  1170  VAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDG  1349
             VA NL +DQ+  I+++F MMD D NGNL+FEEL+DGL  +G  VAD DV +L++AAD DG
Sbjct  358   VAXNLPEDQIGGIRQIFEMMDIDNNGNLTFEELRDGLVKIGHNVADPDVHMLLEAADADG  417

Query  1350  NGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQ  1529
             NG L+CEEF+ ++VHL  + +D+ LH+AF  FDK+NSGYIEFEELR+ LL+      N+Q
Sbjct  418   NGTLSCEEFVMVSVHLKKIDSDEFLHQAFGYFDKNNSGYIEFEELREALLDDTLGPANEQ  477

Query  1530  VVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             V+Q+IIFD DLDKDGRISF EFK MM TG DWKM+SR+YS+ +LN LS +L KD+S+Q
Sbjct  478   VIQDIIFDVDLDKDGRISFEEFKGMMKTGMDWKMSSRQYSRALLNVLSRKLLKDESLQ  535



>dbj|BAC42531.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=582

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/545 (66%), Positives = 437/545 (80%), Gaps = 24/545 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRA-PR---SQKISRQI------RV  242
             MG+CVS  L  +   KRP  RR           SRT + PR   S  +SR++      RV
Sbjct  1     MGSCVSSPLKGSPFGKRPVRRR-------HSSNSRTSSVPRFDSSTNLSRRLIFQPPSRV  53

Query  243   LNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidved  422
             L E     GDGI  KY+ GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVED
Sbjct  54    LPE---PIGDGIHLKYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVED  110

Query  423   vrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALV  602
             VRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V
Sbjct  111   VRREVEIMRCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASV  170

Query  603   TKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGS  782
              KTILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSIFFKP QRF EIVGS
Sbjct  171   AKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGS  230

Query  783   PYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPW  962
             PYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPW
Sbjct  231   PYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPW  290

Query  963   PKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMN  1142
             PK+S +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF LMN
Sbjct  291   PKVSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLMN  350

Query  1143  KFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQL  1322
             +FKK+VL +VA+NL  +++ +I +MF  MD DKNG+L+FEEL+DGL  +GQ V D DV++
Sbjct  351   RFKKKVLRIVADNLPNEEIAAIVQMFQTMDADKNGHLTFEELRDGLKKIGQVVPDGDVKM  410

Query  1323  LMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLE  1502
             LMDAAD DGNGML+C+EF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL+  L +
Sbjct  411   LMDAADTDGNGMLSCDEFVTLSIHLKRMGCDEHLQEAFKYFDKNGNGFIELDELKVALCD  470

Query  1503  --IDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
               +   N NDQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  471   DKLGHANGNDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSI  530

Query  1677  RLFKD  1691
             ++FK+
Sbjct  531   KMFKE  535



>emb|CDY15391.1| BnaC04g42320D [Brassica napus]
Length=580

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/544 (67%), Positives = 432/544 (79%), Gaps = 23/544 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRT----RAPRSQKISRQI------RV  242
             MG+CVS  L  +   KRP  RR       + G S+T    R   S  +S+++      RV
Sbjct  1     MGSCVSSPLKGSPFRKRPVRRR-------KSGKSKTSTNPRVDSSTNLSQRLIFQPPSRV  53

Query  243   LNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidved  422
             L E     GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVED
Sbjct  54    LPE---PIGDGIFVKYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDVED  110

Query  423   vrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALV  602
             VRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V
Sbjct  111   VRREVEIMRSLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASV  170

Query  603   TKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGS  782
              KTILEV++VCH+HGVIHRDLKPENFL+++  E A LKAIDFGLSIFFKPGQRF EIVGS
Sbjct  171   AKTILEVVKVCHEHGVIHRDLKPENFLFSSETETAQLKAIDFGLSIFFKPGQRFNEIVGS  230

Query  783   PYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPW  962
             PYYMAPEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPW
Sbjct  231   PYYMAPEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPW  290

Query  963   PKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMN  1142
             PK+S +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T+I+QF LMN
Sbjct  291   PKVSTEAKELVKDMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTKIQQFLLMN  350

Query  1143  KFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQL  1322
             +FKK+VL +VA+NL   ++E I +MF  MDTDKNG L+FEEL+DGL   G    D DV++
Sbjct  351   RFKKKVLRIVADNLPNKEIEEIVQMFQTMDTDKNGRLTFEELRDGLKKFGTVCPDGDVKM  410

Query  1323  LMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLE  1502
             LMDAAD DGNGML+CEEF+TLA+HL  +  D++L +AF  FDK+ +G IE +EL++ L +
Sbjct  411   LMDAADTDGNGMLSCEEFVTLAIHLKRMGCDEHLQQAFKYFDKNGNGSIELDELKEALFD  470

Query  1503  IDDDNKN-DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVR  1679
              D    N DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS++
Sbjct  471   DDKLGHNGDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIK  530

Query  1680  LFKD  1691
             +FK+
Sbjct  531   MFKE  534



>emb|CDY19084.1| BnaA04g18240D [Brassica napus]
Length=566

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/537 (68%), Positives = 426/537 (79%), Gaps = 23/537 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRA-PRSQKISRQIRVLNESHNATG  269
             MG+CVS  L  +   KRP  RR       +   S+T   PR        RVL E     G
Sbjct  1     MGSCVSSPLKGSPFRKRPARRR-------KSSKSKTSTNPRPPS-----RVLPE---PIG  45

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             DGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVRREVEIMR
Sbjct  46    DGIFVKYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDVEDVRREVEIMR  105

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LPKHPNIVS+KE +EDKEAVYLVME+CEGGELFDRIV++GHYTERAAA V KTILEV++
Sbjct  106   SLPKHPNIVSFKEAFEDKEAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTILEVVK  165

Query  630   VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVL  809
             VCH+HGVIHRDLKPENFL++N  E A LKAIDFGLSIFFKPGQRF EIVGSPYYMAPEVL
Sbjct  166   VCHEHGVIHRDLKPENFLFSNETETAQLKAIDFGLSIFFKPGQRFNEIVGSPYYMAPEVL  225

Query  810   RRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKD  989
             RR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK+S +AK+
Sbjct  226   RRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKVSAEAKE  285

Query  990   LVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMV  1169
             LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T+I+QF LMN+FKK+VL +
Sbjct  286   LVKDMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTKIQQFLLMNRFKKKVLRI  345

Query  1170  VAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDG  1349
             VA+NL   ++E I +MF  MDTDKNG L+FEEL+DGL   G    D DV++LMDAAD DG
Sbjct  346   VADNLPNKEIEEIVQMFRTMDTDKNGRLTFEELRDGLKKFGTVCPDGDVKMLMDAADTDG  405

Query  1350  NGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD---NK  1520
             NGML+CEEF+TLA+HL  +  D++L +AF  FDK+ +G IE +EL++ L   DDD     
Sbjct  406   NGMLSCEEFVTLAIHLKRMGCDEHLQQAFKYFDKNGNGSIELDELKEALF--DDDKLGQG  463

Query  1521  NDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
              DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK+
Sbjct  464   GDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKMFKE  520



>ref|XP_010542759.1| PREDICTED: calcium-dependent protein kinase 24-like [Tarenaya 
hassleriana]
Length=582

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/535 (66%), Positives = 432/535 (81%), Gaps = 7/535 (1%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPI--DPENVRGGGSRTRAPRSQKISRQIRVLNESHNAT  266
             MG+CVS  L ++   KRP  R+    +   V    S T   R        RVL    +  
Sbjct  1     MGSCVSSPLKASPFRKRPIRRKSYGSNTSTVPRYDSPTNLSRKSIFRPPNRVL---PDPV  57

Query  267   GDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiM  446
              D I  KYE G+ELGRGEFGVT+ C E ET E  ACK+ISK KLRTEIDVEDVRREVEIM
Sbjct  58    ADDILLKYEIGRELGRGEFGVTHECIELETRERYACKRISKEKLRTEIDVEDVRREVEIM  117

Query  447   RHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVI  626
              HLPKHPNIVS+KE +ED++AVYLVMELCEGGELFDRIV++GHYTERAAA V +TILE++
Sbjct  118   MHLPKHPNIVSFKEAFEDRDAVYLVMELCEGGELFDRIVSRGHYTERAAASVARTILEIV  177

Query  627   QVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEV  806
             +VCH+HGVIHRDLKPENFL+ANG+E+A LKAIDFGLSIFFKPGQ F EIVGSPYYMAPEV
Sbjct  178   KVCHEHGVIHRDLKPENFLFANGSESAQLKAIDFGLSIFFKPGQVFGEIVGSPYYMAPEV  237

Query  807   LRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAK  986
             LRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIA AIV+G IDF+RDPW K+SE+AK
Sbjct  238   LRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAQAIVKGSIDFERDPWSKVSEEAK  297

Query  987   DLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLM  1166
             +LV+ MLD NPYSR+T+ EVL H WI+NA+  PNV LG+ V T+I+QF LMNKFKK+VL 
Sbjct  298   ELVRNMLDPNPYSRLTVREVLEHPWIRNAQKAPNVNLGDNVRTKIQQFMLMNKFKKKVLR  357

Query  1167  VVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVD  1346
             +VA+NL  +++E I +MF MMDTDKNGNL+FEEL+DGL  +G+ V D DV++LMDAAD D
Sbjct  358   IVADNLPNEEIEGIVKMFQMMDTDKNGNLTFEELRDGLRKVGEGVPDSDVKMLMDAADTD  417

Query  1347  GNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND  1526
             G+GML+CEEF+T+++H+  +  DD+L +AF  FD++N+G+IE +EL++ L ++   + ND
Sbjct  418   GDGMLSCEEFVTVSIHMKRIGGDDHLRQAFRYFDQNNNGFIELDELKEALFDVKLGHTND  477

Query  1527  QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
             Q V++I FD DL+KDGRISF EFKAMM TGTDWKMASR+YS+ +LNALS+++FK+
Sbjct  478   QWVKDIFFDVDLNKDGRISFEEFKAMMKTGTDWKMASRQYSRALLNALSIKMFKE  532



>ref|XP_010510191.1| PREDICTED: calcium-dependent protein kinase 24-like isoform X1 
[Camelina sativa]
 ref|XP_010510192.1| PREDICTED: calcium-dependent protein kinase 24-like isoform X2 
[Camelina sativa]
Length=582

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/477 (72%), Positives = 410/477 (86%), Gaps = 0/477 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             +  GDGI  KYE GKELGRGEFGVT+ C E  TGE  ACK+ISK KLRTEIDVEDVRREV
Sbjct  58    DPIGDGIHLKYELGKELGRGEFGVTHECIEITTGERFACKRISKEKLRTEIDVEDVRREV  117

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM  LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KTIL
Sbjct  118   EIMSCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAANVAKTIL  177

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV++VCH+HGVIHRDLKPENFL++NG E+A LKAIDFGLSIFFKP QRF EIVGSPYYMA
Sbjct  178   EVVKVCHEHGVIHRDLKPENFLFSNGTESAQLKAIDFGLSIFFKPAQRFNEIVGSPYYMA  237

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK+S 
Sbjct  238   PEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKVSH  297

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF LMN+FKK+
Sbjct  298   EAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVSLGDNVRTKIQQFLLMNRFKKK  357

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
             VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEELKDGL  +GQ V D DV++LMDAA
Sbjct  358   VLRIVADNLPNEEIAAIVQMFQAMDTDKNGHLTFEELKDGLKKIGQVVPDGDVKMLMDAA  417

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+N+G IE +EL++ L +    N
Sbjct  418   DTDGNGMLSCEEFVTLSIHLKRMGCDEHLQQAFKYFDKNNNGSIELDELKETLYDDKLGN  477

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFK  1688
              +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK
Sbjct  478   SSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKMFK  534



>ref|XP_003540704.1| PREDICTED: calcium-dependent protein kinase 24-like [Glycine 
max]
Length=533

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/533 (65%), Positives = 429/533 (80%), Gaps = 7/533 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG+C+S     T KR R++      N +    R   P +++ S   R LN     +   I
Sbjct  1     MGSCISTQGVRTRKRSRSK------NYKPSTPRGHEP-ARRSSVTARPLNVVSGPSPGNI  53

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
               KY+FGKELGRGEFGVT+   + E+GE+ ACK I+K+KLRTEIDV+DVRREV+IMRHLP
Sbjct  54    FDKYQFGKELGRGEFGVTHRIVDVESGEAFACKTIAKTKLRTEIDVQDVRREVQIMRHLP  113

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             +HPNIV++KE YEDK+AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTILEV +VCH
Sbjct  114   QHPNIVAFKEAYEDKDAVYLVMELCEGGELFDRIVAKGHYTERAAADVAKTILEVCKVCH  173

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             +HGVIHRDLKPENFL+A+ +E APLK+IDFGLS F+  G+RF EIVGSPYYMAPEVLRR+
Sbjct  174   EHGVIHRDLKPENFLFADSSETAPLKSIDFGLSTFYVSGERFSEIVGSPYYMAPEVLRRN  233

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG E+DVWSAGVILYILLCGVPPFWAE+EEGIA AI+RG +DF RDPWPK+S++AK LVK
Sbjct  234   YGPEIDVWSAGVILYILLCGVPPFWAESEEGIAQAIIRGKVDFTRDPWPKVSDEAKHLVK  293

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD NP++R+T++EVL + WIQN E    + LG+ V  RIKQF+LMN+FK++VL VVA+
Sbjct  294   RMLDPNPFTRITVQEVLDNSWIQNREHGRTISLGDQVRMRIKQFSLMNRFKRKVLRVVAD  353

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NLS +QV+  K+MF MMD DKNGNLSFEEL+DGLSM+G  + D DVQ+LMDAAD+DGNG 
Sbjct  354   NLSDEQVDVFKQMFDMMDKDKNGNLSFEELRDGLSMIGHAIPDPDVQMLMDAADIDGNGT  413

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LN +EFIT++VHL  + +D++L +AF  FDK+ SGY+EFEEL+D L + D +  +DQVV+
Sbjct  414   LNYDEFITMSVHLRKIESDEHLSEAFRYFDKNQSGYVEFEELKDALSDDDLEASDDQVVK  473

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
             +I+ D DLDKDGRISF EFKAMM TG DWK+ASR+YS+ +LNALS ++FKD S
Sbjct  474   DILNDVDLDKDGRISFEEFKAMMKTGGDWKLASRQYSRALLNALSFKMFKDTS  526



>gb|KFK31209.1| hypothetical protein AALP_AA6G082200 [Arabis alpina]
Length=550

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/485 (71%), Positives = 413/485 (85%), Gaps = 3/485 (1%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidv  416
             RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDV
Sbjct  22    RVLPE---PIGDGIFLKYELGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDV  78

Query  417   edvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA  596
             EDVRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA
Sbjct  79    EDVRREVEIMRSLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAA  138

Query  597   LVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIV  776
              V KTILEV++VCH+HGVIHRDLKPENFL++N  E A LKAIDFGLSIFFKP QRF EIV
Sbjct  139   SVAKTILEVVKVCHEHGVIHRDLKPENFLFSNKTETAQLKAIDFGLSIFFKPAQRFNEIV  198

Query  777   GSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRD  956
             GSPYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF RD
Sbjct  199   GSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFTRD  258

Query  957   PWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTL  1136
             PWPK+S +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T+I+QF L
Sbjct  259   PWPKVSNEAKELVKDMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTKIQQFLL  318

Query  1137  MNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDV  1316
             MN+FKK+VL +VA++L  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ V + DV
Sbjct  319   MNRFKKKVLGIVADHLPNEEIAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPEGDV  378

Query  1317  QLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYL  1496
             ++LMDAAD DGNGML+CEEF+T+++HL  + +D++LH+AF  FDK+ +G+IE  EL++ L
Sbjct  379   KMLMDAADTDGNGMLSCEEFVTMSIHLKRMGSDEHLHEAFKFFDKNGNGFIELNELKEAL  438

Query  1497  LEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
              +    + NDQ +++I FDADL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  439   FDDKLGHGNDQWIKDIFFDADLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSI  498

Query  1677  RLFKD  1691
             ++FKD
Sbjct  499   KMFKD  503



>gb|KFK31208.1| hypothetical protein AALP_AA6G082200 [Arabis alpina]
Length=581

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/499 (69%), Positives = 419/499 (84%), Gaps = 9/499 (2%)
 Frame = +3

Query  213   SQKISRQI------RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVAC  374
             S  +SR++      RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T E  AC
Sbjct  39    STNLSRRLIFQPPSRVLPE---PIGDGIFLKYELGKELGRGEFGVTHECIEISTRERFAC  95

Query  375   KKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFD  554
             K+ISK KLRTEIDVEDVRREVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFD
Sbjct  96    KRISKEKLRTEIDVEDVRREVEIMRSLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFD  155

Query  555   RIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGL  734
             RIV++GHYTERAAA V KTILEV++VCH+HGVIHRDLKPENFL++N  E A LKAIDFGL
Sbjct  156   RIVSRGHYTERAAASVAKTILEVVKVCHEHGVIHRDLKPENFLFSNKTETAQLKAIDFGL  215

Query  735   SIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGI  914
             SIFFKP QRF EIVGSPYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGI
Sbjct  216   SIFFKPAQRFNEIVGSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGI  275

Query  915   AHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVP  1094
             AHAIVRG+IDF RDPWPK+S +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV 
Sbjct  276   AHAIVRGNIDFTRDPWPKVSNEAKELVKDMLDANPYSRLTVQEVLEHPWIQNAERAPNVN  335

Query  1095  LGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKD  1274
             LG+ V T+I+QF LMN+FKK+VL +VA++L  +++ +I +MF  MDTDKNG+L+FEEL+D
Sbjct  336   LGDNVRTKIQQFLLMNRFKKKVLGIVADHLPNEEIAAIVQMFQTMDTDKNGHLTFEELRD  395

Query  1275  GLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKD  1454
             GL  +GQ V + DV++LMDAAD DGNGML+CEEF+T+++HL  + +D++LH+AF  FDK+
Sbjct  396   GLKKIGQVVPEGDVKMLMDAADTDGNGMLSCEEFVTMSIHLKRMGSDEHLHEAFKFFDKN  455

Query  1455  NSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMA  1634
              +G+IE  EL++ L +    + NDQ +++I FDADL+KDGRISF EFKAMM +GTDWKMA
Sbjct  456   GNGFIELNELKEALFDDKLGHGNDQWIKDIFFDADLNKDGRISFDEFKAMMKSGTDWKMA  515

Query  1635  SRKYSKVMLNALSVRLFKD  1691
             SR+YS+ +LNALS+++FKD
Sbjct  516   SRQYSRALLNALSIKMFKD  534



>ref|XP_010063913.1| PREDICTED: calcium-dependent protein kinase 24-like, partial 
[Eucalyptus grandis]
Length=473

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/467 (72%), Positives = 405/467 (87%), Gaps = 0/467 (0%)
 Frame = +3

Query  294   FGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHPNI  473
             FGKELGRGEFG+TY CTE  TGE+ ACK ISKSKLRTEIDV+DVRREVEIMRHLP+HPNI
Sbjct  1     FGKELGRGEFGITYRCTELVTGEAYACKTISKSKLRTEIDVDDVRREVEIMRHLPRHPNI  60

Query  474   VSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVI  653
             VS KE +ED++AVY+VMELCEGGELFDRIV +GH+TER A  + +TILE++ VCH+HGVI
Sbjct  61    VSLKEAFEDRDAVYIVMELCEGGELFDRIVERGHFTERDAVTIARTILEIVSVCHEHGVI  120

Query  654   HRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEV  833
             HRDLKPENFL+AN ++++PLKAIDFGLS FF+PGQ F+EIVGSPYYMAPEVLRRDYG EV
Sbjct  121   HRDLKPENFLFANSSDSSPLKAIDFGLSTFFEPGQHFREIVGSPYYMAPEVLRRDYGPEV  180

Query  834   DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDA  1013
             DVWSAGVILYILLCGVPPFWAETEEGIA AIV+G+IDF+RDPWPK+SE+AKDLV+ ML+ 
Sbjct  181   DVWSAGVILYILLCGVPPFWAETEEGIAQAIVQGEIDFERDPWPKVSEEAKDLVRNMLEP  240

Query  1014  NPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQD  1193
             NPY+R+T++EVL HKWIQN +   NV LG+ V TRIKQF+LMNKFKK+VL VVA+NL  +
Sbjct  241   NPYTRLTVQEVLEHKWIQNVDKASNVSLGQNVRTRIKQFSLMNKFKKKVLRVVADNLPDE  300

Query  1194  QVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEE  1373
             QV+ IKEMFH+MDTDKNG+L+FEELK GL   GQ VAD DVQ+LMDAAD DG+G LNC+E
Sbjct  301   QVDHIKEMFHVMDTDKNGDLTFEELKHGLHKCGQQVADPDVQMLMDAADEDGSGTLNCQE  360

Query  1374  FITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFD  1553
             F+T++VHL  + +DD+L +AF  FDK+ SGYIEF+EL++ L++ +    N++ +++IIFD
Sbjct  361   FVTMSVHLRRIGSDDHLTQAFEFFDKNRSGYIEFDELKEALIDDNLGPNNEKFIEDIIFD  420

Query  1554  ADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             ADLDKDGRI + EFK MM  G DWKMASR+YS+ MLNALS ++FKDK
Sbjct  421   ADLDKDGRIGYDEFKVMMKMGMDWKMASRQYSRAMLNALSQKMFKDK  467



>ref|XP_007224369.1| hypothetical protein PRUPE_ppa021005mg, partial [Prunus persica]
 gb|EMJ25568.1| hypothetical protein PRUPE_ppa021005mg, partial [Prunus persica]
Length=526

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/530 (66%), Positives = 431/530 (81%), Gaps = 9/530 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR---RPIDPENVRGGGSRTRAPRSQKISRQ--IRVLNESHNA  263
             MG+CV   +   +   R++   +P+ P+ V     ++    S  +  +  I VL+++   
Sbjct  1     MGSCVCTPAKAGIYHKRSKDIIKPL-PQCVHDSPRKSSVVASAPVHHRSIIWVLDKT---  56

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
              G+ I  KYEFGKELGRGEFG+T+ CT +ETGE +ACKKISKSKL+TEIDVEDVRRE EI
Sbjct  57    AGNNIFDKYEFGKELGRGEFGITHRCTHRETGELLACKKISKSKLKTEIDVEDVRREAEI  116

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MR LPKHPNIVS+KE YEDKEAVYLVMELCEGGELFD+IVAKGHYTERAAA VT+TILE+
Sbjct  117   MRRLPKHPNIVSFKEAYEDKEAVYLVMELCEGGELFDKIVAKGHYTERAAATVTRTILEI  176

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
              +VCH++GVIHRDLKPENFL+ + +ENA LKAIDFGLSIFF+ GQRF EIVGSPYYMAPE
Sbjct  177   CKVCHQNGVIHRDLKPENFLFTDSSENAQLKAIDFGLSIFFEKGQRFSEIVGSPYYMAPE  236

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG EVDVWSAGVILYILLCGVPPFWAE+EEGIA AIVRG IDF+R+ W K+S++A
Sbjct  237   VLRRNYGAEVDVWSAGVILYILLCGVPPFWAESEEGIAQAIVRGSIDFEREAWKKVSDEA  296

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             K+LVK MLD NP++R+ +EEVL H WI++A  VPNVPLG  VT RIKQF+LMNKFKK+VL
Sbjct  297   KELVKRMLDPNPFNRLGVEEVLDHPWIRHANQVPNVPLGGNVTLRIKQFSLMNKFKKKVL  356

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA+NL  DQ++ I+++F+MMD D NGNL+FEEL+DGL  +G  V D DVQ+L+DAAD 
Sbjct  357   RVVADNLPDDQIDGIRQLFNMMDIDNNGNLNFEELRDGLVKIGHHVTDPDVQMLIDAADG  416

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG G LNC+EF+ ++VHL  + ND+ LH+AF  FDK++SGY+EF+ELR+ LL+      N
Sbjct  417   DGTGTLNCDEFVVVSVHLRKIDNDELLHQAFTYFDKNDSGYVEFDELREALLDDKLGPAN  476

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALS  1673
             +QV+Q+IIFD DLDKDGRISF EFKAMM +G DWKMASR+YS+ MLNALS
Sbjct  477   EQVIQDIIFDVDLDKDGRISFEEFKAMMKSGMDWKMASRQYSRAMLNALS  526



>ref|XP_006410285.1| hypothetical protein EUTSA_v10016430mg [Eutrema salsugineum]
 gb|ESQ51738.1| hypothetical protein EUTSA_v10016430mg [Eutrema salsugineum]
Length=581

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/540 (66%), Positives = 434/540 (80%), Gaps = 15/540 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPR---SQKISRQI------RVLNE  251
             MG+CVS  S L    P  +RP+   N     + +  PR   S  +SR++      RVL +
Sbjct  1     MGSCVS--SPLK-GSPFGKRPVRRRNSSSSKTSSSNPRFDSSTNLSRRLIFQPPSRVLPD  57

Query  252   SHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrr  431
                  GDGI  KYE GKELGRGEFGVT+ C +  T E  ACK+ISK KLRTEIDVEDVRR
Sbjct  58    ---PIGDGIFLKYELGKELGRGEFGVTHECIDITTRERFACKRISKEKLRTEIDVEDVRR  114

Query  432   eveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKT  611
             EVEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KT
Sbjct  115   EVEIMRCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKT  174

Query  612   ILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYY  791
             ILEV++VCHKHGVIHRDLKPENFL++N  E A LKAIDFGLSIFFKP QRF EIVGSPYY
Sbjct  175   ILEVVKVCHKHGVIHRDLKPENFLFSNDTETAQLKAIDFGLSIFFKPAQRFNEIVGSPYY  234

Query  792   MAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKI  971
             MAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIV+G+IDF+RDPWPK+
Sbjct  235   MAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVKGNIDFERDPWPKV  294

Query  972   SEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFK  1151
             S +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T+I+QF LMN+FK
Sbjct  295   SNEAKELVKNMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTKIQQFLLMNRFK  354

Query  1152  KRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMD  1331
             K+VL +VA+NL  +++  I +MF  MDTDKNG+L+FEEL+DGL  +GQ V D DV++LMD
Sbjct  355   KKVLRIVADNLPNEEIAGIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKMLMD  414

Query  1332  AADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDD  1511
             AAD DGNG L+CEEF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL++ L +   
Sbjct  415   AADTDGNGTLSCEEFVTLSIHLKRMGCDEHLQEAFKYFDKNGNGFIELDELKEALFDDKL  474

Query  1512  DNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
              + +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK+
Sbjct  475   GHGSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKMFKE  534



>ref|XP_009132794.1| PREDICTED: calcium-dependent protein kinase 24 isoform X1 [Brassica 
rapa]
Length=581

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/539 (66%), Positives = 432/539 (80%), Gaps = 13/539 (2%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQI------RVLNES  254
             MG+CVS  L  +   KRP  RR  +  + +   S  +   S  +SR++      RVL E 
Sbjct  1     MGSCVSSPLKGSPFGKRPVRRR--NNSHSKTSSSNPKFVSSTNLSRRLLFQPPSRVLPE-  57

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
                 GDGI  KYE GKELGRGEFGVT+ C E  T +  ACK+ISK KLRTEIDVEDVRRE
Sbjct  58    --PIGDGILLKYELGKELGRGEFGVTHECIEITTRKRFACKRISKEKLRTEIDVEDVRRE  115

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIM  LPKHPNIV++KE +ED++AVYLVME+CEGGELFDRIVA+GHYTERAAA VTKTI
Sbjct  116   VEIMSCLPKHPNIVTFKEAFEDEDAVYLVMEICEGGELFDRIVARGHYTERAAASVTKTI  175

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             LEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSI FK GQRF EIVGSPYYM
Sbjct  176   LEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSINFKHGQRFNEIVGSPYYM  235

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVLRRDYG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG IDF+RDPWPK+S
Sbjct  236   APEVLRRDYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGHIDFERDPWPKVS  295

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             ++AK LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T I+QF LMN+FKK
Sbjct  296   KEAKQLVKSMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTNIQQFVLMNRFKK  355

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             +VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ   D DV++LMDA
Sbjct  356   KVLRIVADNLPNEEIAAIVQMFETMDTDKNGHLTFEELRDGLKNLGQVCPDGDVKMLMDA  415

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             AD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL++ L +    
Sbjct  416   ADTDGNGMLSCEEFVTLSIHLKRIGCDEHLQEAFKYFDKNGNGFIELDELKEALFDDKLG  475

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
               +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK+
Sbjct  476   QGSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSMKMFKE  534



>gb|KEH30304.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=545

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/545 (64%), Positives = 426/545 (78%), Gaps = 16/545 (3%)
 Frame = +3

Query  99    MGACVSLHSA-----------LTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVL  245
             MG+CVS               +  K   N +  +P       S     RS   SRQ+ V+
Sbjct  1     MGSCVSTQGKHGGRKKSKDHHINTKHKINDQNHEPNTPTTRRSSVTGRRSSVTSRQLNVV  60

Query  246   NESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedv  425
                 N +   I  KYE GKELGRGEFGVT+ C E +TGE+ ACKKI+K+KLRTEID++DV
Sbjct  61    T---NPSPGNIFDKYELGKELGRGEFGVTHRCVELKTGEAFACKKIAKTKLRTEIDIQDV  117

Query  426   rreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVT  605
             RREV+IMRHLP+HPNIV+++E YED++AVYLVMELCEGGELFDRIVAKGHYTERAAA V 
Sbjct  118   RREVQIMRHLPEHPNIVAFREAYEDRDAVYLVMELCEGGELFDRIVAKGHYTERAAANVA  177

Query  606   KTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSP  785
             KTILEV +VCH+HGVIHRDLKPENFL+A+G+E A LKAIDFGLS F+  G RF EIVGSP
Sbjct  178   KTILEVCKVCHEHGVIHRDLKPENFLFADGSEAASLKAIDFGLSTFYVNGDRFNEIVGSP  237

Query  786   YYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWP  965
             YYMAPEVLRR+YG E+D+WS GVILYILLCGVPPFWAETEE IA AI+RG++DF RDPWP
Sbjct  238   YYMAPEVLRRNYGPEIDIWSTGVILYILLCGVPPFWAETEEAIAQAIIRGNVDFTRDPWP  297

Query  966   KISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNK  1145
             K+SE+AK LVK MLD NP+SR+T++EVL H WIQN E   NV LG+ V +RIKQF+LMN+
Sbjct  298   KVSEEAKYLVKRMLDPNPFSRITVQEVLDHSWIQNREHGKNVSLGDQVRSRIKQFSLMNR  357

Query  1146  FKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLL  1325
             FKK+VL VVA+NL  +Q++  ++MF MMD DKNG+L+FEELKDG + +G  + D D+Q+L
Sbjct  358   FKKKVLRVVADNLPDEQIDGFRKMFDMMDKDKNGHLTFEELKDGFAEIGNVIPDPDLQML  417

Query  1326  MDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEI  1505
             MDAAD DGNG LNCEEFIT++VH+  L ND++L +AF  FDK+ SGY+EF+EL+D L   
Sbjct  418   MDAADFDGNGTLNCEEFITMSVHMRRLGNDEHLTEAFNFFDKNKSGYVEFDELKDAL--S  475

Query  1506  DDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLF  1685
             D+ + +DQV+++I+ D DLDKDGR+SF EFKAMM TG DWKMASR+YSK  LNALS R+F
Sbjct  476   DNGSTDDQVIRDILNDVDLDKDGRVSFEEFKAMMKTGGDWKMASRQYSKAFLNALSFRMF  535

Query  1686  KDKSV  1700
             KDKS 
Sbjct  536   KDKST  540



>ref|XP_006296276.1| hypothetical protein CARUB_v10025444mg [Capsella rubella]
 gb|EOA29174.1| hypothetical protein CARUB_v10025444mg [Capsella rubella]
Length=582

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/541 (66%), Positives = 429/541 (79%), Gaps = 16/541 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPEN----------VRGGGSRTRAPRSQKISRQIRVLN  248
             MG+CVS  S L    P  +RP+   +          V    S T   R        RVL 
Sbjct  1     MGSCVS--SPLK-GSPFGKRPVRRRHSSSNSRTSSSVPHFDSSTNLSRRLIFQPPSRVLP  57

Query  249   ESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvr  428
             E     GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVR
Sbjct  58    E---PIGDGIHLKYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDVEDVR  114

Query  429   reveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTK  608
             REVEIM  LPKHPNIVS+KE +ED++AVYLVME+CEGGELFDRIV++GHYTERAAA V K
Sbjct  115   REVEIMSCLPKHPNIVSFKEAFEDEDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAK  174

Query  609   TILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPY  788
             TILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSIFFKP QRF EIVGSPY
Sbjct  175   TILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGSPY  234

Query  789   YMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPK  968
             YMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK
Sbjct  235   YMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPK  294

Query  969   ISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKF  1148
             +S +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF LMN+F
Sbjct  295   VSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLMNRF  354

Query  1149  KKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLM  1328
             KK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ V D DV++LM
Sbjct  355   KKKVLRIVADNLPNEEIAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKMLM  414

Query  1329  DAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEID  1508
             DAAD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+ +GYIE +EL++ L +  
Sbjct  415   DAADTDGNGMLSCEEFVTLSIHLKRMGCDEHLQEAFKYFDKNGNGYIELDELKEALWDDK  474

Query  1509  DDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFK  1688
                 +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK
Sbjct  475   LGQSSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKMFK  534

Query  1689  D  1691
             +
Sbjct  535   E  535



>ref|XP_010414119.1| PREDICTED: calcium-dependent protein kinase 24 isoform X2 [Camelina 
sativa]
Length=550

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/484 (71%), Positives = 411/484 (85%), Gaps = 3/484 (1%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidv  416
             RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDV
Sbjct  22    RVLPE---PIGDGIHLKYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDV  78

Query  417   edvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA  596
             EDVRREVEIM  LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA
Sbjct  79    EDVRREVEIMSCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAA  138

Query  597   LVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIV  776
              V KTILEV++VCH+HGVIHRDLKPENFL++NG E+A LKAIDFGLSIFFKP Q F EIV
Sbjct  139   NVAKTILEVVKVCHEHGVIHRDLKPENFLFSNGTESAQLKAIDFGLSIFFKPAQPFNEIV  198

Query  777   GSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRD  956
             GSPYYMAPEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RD
Sbjct  199   GSPYYMAPEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERD  258

Query  957   PWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTL  1136
             PWPK+S +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF L
Sbjct  259   PWPKVSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLL  318

Query  1137  MNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDV  1316
             +N+FKK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEELKDGL  +GQ V D DV
Sbjct  319   INRFKKKVLRIVADNLPNEEIAAIVQMFQAMDTDKNGHLTFEELKDGLKKIGQVVPDGDV  378

Query  1317  QLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYL  1496
             ++LMDAAD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+N+G IE +EL++ L
Sbjct  379   KMLMDAADTDGNGMLSCEEFVTLSIHLKRMGCDEHLQQAFKYFDKNNNGSIELDELKETL  438

Query  1497  LEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
              +    N +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  439   YDDKLGNSSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSI  498

Query  1677  RLFK  1688
             ++FK
Sbjct  499   KMFK  502



>ref|XP_007131964.1| hypothetical protein PHAVU_011G055400g [Phaseolus vulgaris]
 gb|ESW03958.1| hypothetical protein PHAVU_011G055400g [Phaseolus vulgaris]
Length=539

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/541 (63%), Positives = 432/541 (80%), Gaps = 9/541 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRN-RRPIDPENVRGGGSRTR-----APRSQKISRQIRVLNESHN  260
             MG+C+S     T KR ++  +P  P     G  +TR     APRS   +R + V+    N
Sbjct  1     MGSCISTQGVRTRKRVKHTSKPSSPRGQGHGHEQTRRSSVVAPRSSVTARPLNVVA---N  57

Query  261   ATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreve  440
              +   I  KY+FGKELGRGEFGVT+   +  +GE+ ACKKI+K+KLRTEIDVEDV+REV+
Sbjct  58    PSPGNIFDKYQFGKELGRGEFGVTHRVVDLVSGEAFACKKIAKTKLRTEIDVEDVKREVQ  117

Query  441   iMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILE  620
             IMRHLP+HPNIV++KE YED++AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTILE
Sbjct  118   IMRHLPRHPNIVAFKEAYEDRDAVYLVMELCEGGELFDRIVAKGHYTERAAANVAKTILE  177

Query  621   VIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAP  800
             V +VCH HGVIHRDLKPENFL+A+ +E A LK+IDFGLS F+ PG++F EIVGSPYYMAP
Sbjct  178   VCKVCHAHGVIHRDLKPENFLFADASETAALKSIDFGLSTFYVPGEKFSEIVGSPYYMAP  237

Query  801   EVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISED  980
             EVLRR+YG E+DVWS GVILYILLCGVPPFWAE+EEGIA +I++G +DF RDPWPK+S++
Sbjct  238   EVLRRNYGQEIDVWSTGVILYILLCGVPPFWAESEEGIAQSIIKGKVDFTRDPWPKVSDE  297

Query  981   AKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRV  1160
             AK LVK MLD +P++R+T++EVL + WIQN E    + LG+ V  RIKQF+LMN+FK++V
Sbjct  298   AKHLVKRMLDPSPFTRITVQEVLDNTWIQNREHGRTISLGDQVRMRIKQFSLMNRFKRKV  357

Query  1161  LMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAAD  1340
             L VVA+NLS +Q+   K+MF MMD DKNGNLSFEELKDGLSM+G  + D DVQ+LM+AAD
Sbjct  358   LRVVADNLSDEQLAMFKKMFDMMDKDKNGNLSFEELKDGLSMIGHAIPDPDVQMLMEAAD  417

Query  1341  VDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNK  1520
             +DGNG LN +EFIT++VHL  +  D++L +AF  FDK+ +GY+EFEEL+D L + + +  
Sbjct  418   IDGNGTLNYDEFITMSVHLKKIEGDEHLSQAFRYFDKNQTGYVEFEELKDALSDDESEVM  477

Query  1521  NDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             NDQV+++I+ D DLDKDGRISF EFKAMM TG DWKMASR+YS+ +LNALS++LFKD  +
Sbjct  478   NDQVIKDILNDVDLDKDGRISFGEFKAMMKTGGDWKMASRQYSRALLNALSIKLFKDTPM  537

Query  1701  Q  1703
             +
Sbjct  538   K  538



>emb|CDY10809.1| BnaA05g11270D [Brassica napus]
Length=537

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/488 (71%), Positives = 411/488 (84%), Gaps = 8/488 (2%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidv  416
             RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDV
Sbjct  8     RVLPE---PIGDGIFLKYELGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDV  64

Query  417   edvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA  596
             EDVRREVEIMR LPKH NIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA
Sbjct  65    EDVRREVEIMRSLPKHANIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAA  124

Query  597   LVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIV  776
              V KTILEV++VCH+HGVIHRDLKPENFL++N  E A LKAIDFGLSIFFKP QRF EIV
Sbjct  125   SVAKTILEVVKVCHEHGVIHRDLKPENFLFSNETETAQLKAIDFGLSIFFKPAQRFNEIV  184

Query  777   GSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRD  956
             GSPYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RD
Sbjct  185   GSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERD  244

Query  957   PWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTL  1136
             PWPK+S +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+GV T+I+QF L
Sbjct  245   PWPKVSREAKELVKNMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDGVRTKIQQFLL  304

Query  1137  MNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDV  1316
             MN+FKK+VL VVA+NL  +++ESI +MF  MDTDKNG+L+FEEL+DGL  +GQ   D DV
Sbjct  305   MNRFKKKVLRVVADNLPNEEIESIIQMFQTMDTDKNGHLTFEELRDGLKKIGQVCPDGDV  364

Query  1317  QLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYL  1496
             ++LMDAAD DGNG L+CEEF+TLA+HL  +  D++L +AF  FDK+ +G IE +EL++ L
Sbjct  365   KMLMDAADTDGNGTLSCEEFVTLAIHLKRMGCDEHLQQAFKYFDKNGNGSIELDELKEAL  424

Query  1497  LEIDDD---NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNA  1667
                DDD   +  DQ +++I FD DL+KDGRISF EF+AMM +GTDWKMASR+YS+ +LNA
Sbjct  425   F--DDDKLGHGGDQWIKDIFFDVDLNKDGRISFDEFRAMMKSGTDWKMASRQYSRALLNA  482

Query  1668  LSVRLFKD  1691
             LS+++FK+
Sbjct  483   LSIKMFKE  490



>ref|XP_010414118.1| PREDICTED: calcium-dependent protein kinase 24 isoform X1 [Camelina 
sativa]
Length=582

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/540 (66%), Positives = 433/540 (80%), Gaps = 16/540 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTR-APR---SQKISRQI------RVLN  248
             MG+CVS  S L    P  +RP+         + +   P    S  +SR++      RVL 
Sbjct  1     MGSCVS--SPLK-GSPFGKRPVRRRQSSNSRTSSSSVPHFDCSTNLSRRLIFQPPSRVLP  57

Query  249   ESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvr  428
             E     GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVR
Sbjct  58    E---PIGDGIHLKYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDVEDVR  114

Query  429   reveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTK  608
             REVEIM  LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V K
Sbjct  115   REVEIMSCLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAANVAK  174

Query  609   TILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPY  788
             TILEV++VCH+HGVIHRDLKPENFL++NG E+A LKAIDFGLSIFFKP Q F EIVGSPY
Sbjct  175   TILEVVKVCHEHGVIHRDLKPENFLFSNGTESAQLKAIDFGLSIFFKPAQPFNEIVGSPY  234

Query  789   YMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPK  968
             YMAPEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK
Sbjct  235   YMAPEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPK  294

Query  969   ISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKF  1148
             +S +AK+LVK MLDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF L+N+F
Sbjct  295   VSHEAKELVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLINRF  354

Query  1149  KKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLM  1328
             KK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEELKDGL  +GQ V D DV++LM
Sbjct  355   KKKVLRIVADNLPNEEIAAIVQMFQAMDTDKNGHLTFEELKDGLKKIGQVVPDGDVKMLM  414

Query  1329  DAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEID  1508
             DAAD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+N+G IE +EL++ L +  
Sbjct  415   DAADTDGNGMLSCEEFVTLSIHLKRMGCDEHLQQAFKYFDKNNNGSIELDELKETLYDDK  474

Query  1509  DDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFK  1688
               N +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK
Sbjct  475   LGNSSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKMFK  534



>ref|XP_009144199.1| PREDICTED: calcium-dependent protein kinase 24-like isoform X2 
[Brassica rapa]
Length=584

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/542 (66%), Positives = 432/542 (80%), Gaps = 16/542 (3%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQI------RVLNES  254
             MG+CVS  L  +   KRP  RR            +T    +  +SR++      RVL E 
Sbjct  1     MGSCVSSPLKGSPFGKRPARRRNNSSSTKTSSNPKTDTSSTSTLSRRLIFQPPSRVLPE-  59

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
                 GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVRRE
Sbjct  60    --PIGDGIFLKYELGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRRE  117

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMR LPKH NIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KTI
Sbjct  118   VEIMRSLPKHANIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTI  177

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             LEV++VCH+HGVIHRDLKPENFL++N  E A LKAIDFGLSIFFKP QRF EIVGSPYYM
Sbjct  178   LEVVKVCHEHGVIHRDLKPENFLFSNETETAQLKAIDFGLSIFFKPAQRFNEIVGSPYYM  237

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK+S
Sbjct  238   APEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKVS  297

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
              +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+GV T+I+QF LMN+FKK
Sbjct  298   REAKELVKNMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDGVRTKIQQFLLMNRFKK  357

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             +VL VVA+NL  +++ESI +MF  MDTDKNG+L+FEEL+DGL  +GQ   D DV++LMDA
Sbjct  358   KVLRVVADNLPNEEIESIIQMFQTMDTDKNGHLTFEELRDGLKKIGQVCPDGDVKMLMDA  417

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             AD DGNG L+CEEF+TLA+HL  +  D++L +AF  FDK+ +G IE +EL++ L   DDD
Sbjct  418   ADTDGNGTLSCEEFVTLAIHLKRMGCDEHLQQAFKYFDKNGNGSIELDELKEALF--DDD  475

Query  1515  ---NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLF  1685
                +  DQ +++I FD DL+KDGRISF EF+AMM +GTDWKMASR+YS+ +LNALS+++F
Sbjct  476   KLGHGGDQWIKDIFFDVDLNKDGRISFDEFRAMMKSGTDWKMASRQYSRALLNALSIKMF  535

Query  1686  KD  1691
             K+
Sbjct  536   KE  537



>ref|XP_004507322.1| PREDICTED: calcium-dependent protein kinase 24-like isoform X2 
[Cicer arietinum]
Length=541

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/542 (64%), Positives = 426/542 (79%), Gaps = 15/542 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPR---SQKISRQ-----IRVLNES  254
             MG+CVS     T  +   R+     N+     +T  P    S   +R+      R LN  
Sbjct  1     MGSCVS-----TQGKNGGRKRSRDHNINNKQHKTNDPHHEVSTPTARRSSVSTTRPLNVV  55

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
              N +   I  KYE GKELGRGEFGVT+ C E +TGE+ ACKKI+K+KLRTEID++DVRRE
Sbjct  56    TNPSPGNIFDKYELGKELGRGEFGVTHRCVEIKTGEAFACKKIAKTKLRTEIDIQDVRRE  115

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             V+IMRHLPKHPNIVS++E YED++AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTI
Sbjct  116   VQIMRHLPKHPNIVSFREAYEDRDAVYLVMELCEGGELFDRIVAKGHYTERAAANVAKTI  175

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             LEV +VCH HGVIHRDLKPENFL+A+G E A LK+IDFGLS F+ PG++F EIVGSPYYM
Sbjct  176   LEVCKVCHDHGVIHRDLKPENFLFADGTEGASLKSIDFGLSTFYNPGEKFNEIVGSPYYM  235

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVLRR+Y  E+D+WS GVILYILLCGVPPFWAETEE IA AI+RG++DF RDPWPK+S
Sbjct  236   APEVLRRNYSQEIDIWSTGVILYILLCGVPPFWAETEEAIAQAIIRGNVDFTRDPWPKVS  295

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             E+AK LVK MLD +P +R+ ++E L H WIQ+ E   NV LG+ V  RIKQF+LMN+FKK
Sbjct  296   EEAKYLVKRMLDPDPDTRIKVQEALDHSWIQHREHGRNVSLGDQVRMRIKQFSLMNRFKK  355

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             +VL VVA+NL  +Q++ +++MF MMD DKNG+L+FEELKDG SM+G  + D DV++L+DA
Sbjct  356   KVLRVVADNLPDEQIDGLRQMFDMMDKDKNGHLTFEELKDGFSMIGHVIPDPDVRMLIDA  415

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             AD DGNG LNCEEFIT++VHL  + ND++L +AF  FDK+ SGY+EFEEL+D L   DDD
Sbjct  416   ADFDGNGTLNCEEFITMSVHLRRIGNDEHLSEAFNFFDKNQSGYVEFEELKDAL--SDDD  473

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             + +DQV+++I+ D DLDKDGRISF EFKAMM +G DWKMASR+YS+ +LNALS R+FKDK
Sbjct  474   STDDQVIRDILNDVDLDKDGRISFEEFKAMMKSGGDWKMASRQYSRALLNALSFRMFKDK  533

Query  1695  SV  1700
             S 
Sbjct  534   SA  535



>emb|CDY34489.1| BnaC04g13100D [Brassica napus]
Length=538

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/491 (71%), Positives = 414/491 (84%), Gaps = 9/491 (2%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGES-VACKKISKSKLRTeid  413
             RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T ES  ACK+ISK KLRTEID
Sbjct  8     RVLPE---PIGDGIFLKYELGKELGRGEFGVTHECIEISTRESRFACKRISKEKLRTEID  64

Query  414   vedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAA  593
             VEDVRREVEIMR LPKH NIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAA
Sbjct  65    VEDVRREVEIMRSLPKHANIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAA  124

Query  594   ALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEI  773
             A V KTILEV++VCH+HGVIHRDLKPENFL++N +E A LKAIDFGLSIFFKP QRF EI
Sbjct  125   ASVAKTILEVVKVCHEHGVIHRDLKPENFLFSNESETAQLKAIDFGLSIFFKPAQRFNEI  184

Query  774   VGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKR  953
             VGSPYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+R
Sbjct  185   VGSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFER  244

Query  954   DPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFT  1133
             DPWPK+S +AK+LVK M+DANPYSR+T++EVL H WIQNAE  PNV LG+GV T+I+QF 
Sbjct  245   DPWPKVSREAKELVKNMVDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDGVRTKIQQFL  304

Query  1134  LMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHD  1313
             LMN+FKK+VL VVA+NL  +++ESI +MF  MDTDKNG+L+FEEL+DGL  +GQ   D D
Sbjct  305   LMNRFKKKVLRVVADNLPNEEIESIIQMFQTMDTDKNGHLTFEELRDGLKKIGQVCPDDD  364

Query  1314  VQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDY  1493
             V++LMDAAD DGNG L+CEEF+TLA+HL  +  D++L +AF  FDK+ +G IE +EL++ 
Sbjct  365   VKMLMDAADTDGNGTLSCEEFVTLAIHLKRMGCDEHLQQAFKYFDKNGNGSIELDELKEA  424

Query  1494  LLEIDDD---NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLN  1664
             L   DDD   +  DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LN
Sbjct  425   LF--DDDKLGHGGDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLN  482

Query  1665  ALSVRLFKDKS  1697
             ALS+++FK+ +
Sbjct  483   ALSIKMFKEDA  493



>ref|XP_004309617.1| PREDICTED: calcium-dependent protein kinase 24-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/535 (65%), Positives = 429/535 (80%), Gaps = 9/535 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG+CV   +   +   ++R  +    V+   +   +P   + S   +VL+++    GD I
Sbjct  1     MGSCVCTPAKAGLLHRKHRDQL----VKPIPAYVDSPSHHRGSH--KVLDKT---DGDNI  51

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
               KY  GKELGRGEFG+T+ C + +TGE+ ACK ISKSKL+TEID+EDVRRE EIM+ LP
Sbjct  52    FNKYRLGKELGRGEFGITHQCVDSKTGETFACKMISKSKLKTEIDIEDVRREAEIMKRLP  111

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
              HPNIV++KE YEDK+AVYLVMELCEGGELFDRIV KGHYTERAAA VTKTILEV +VCH
Sbjct  112   NHPNIVTFKEAYEDKDAVYLVMELCEGGELFDRIVTKGHYTERAAAHVTKTILEVCKVCH  171

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             ++GVIHRDLKPENFL+A+ +ENA LKAIDFGLS+ F+PGQRF EIVGSPYYMAPEVLRR+
Sbjct  172   ENGVIHRDLKPENFLFADSSENAQLKAIDFGLSVIFEPGQRFSEIVGSPYYMAPEVLRRN  231

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YGHEVDVWSAGVILYILLCGVPPF  ETEEGIA AI+RG IDF++D W K+SE+AK LVK
Sbjct  232   YGHEVDVWSAGVILYILLCGVPPFXPETEEGIAQAIIRGKIDFQKDTWQKVSEEAKLLVK  291

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD NPY+R+T+EEVL H WI+NA  V +VPLGE V  RIKQFTLMNKFKK+VL VVA+
Sbjct  292   NMLDPNPYNRLTVEEVLDHPWIRNANEVSDVPLGENVGLRIKQFTLMNKFKKKVLRVVAD  351

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             NL  +Q+E I+++F+MMDTD NG+L+FEEL+DGL  +G  V D DV +L+DAADVDG+G 
Sbjct  352   NLPDEQIEGIRQIFNMMDTDNNGDLTFEELRDGLLKIGHQVTDPDVHMLIDAADVDGSGT  411

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LNC+EF+ ++VHL  +S+D+ L +AF  FDK+NS YIEF+EL++ LL+      N+QV+Q
Sbjct  412   LNCDEFVMVSVHLKKISSDELLAQAFSYFDKNNSNYIEFDELKEALLDDQLGPANEQVIQ  471

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +IIFD DLDKDGRIS+ EFKAMM TG DWKMASR+YS+ MLN LS +L KDKS+Q
Sbjct  472   DIIFDVDLDKDGRISYEEFKAMMKTGMDWKMASRQYSRAMLNVLSRKLLKDKSIQ  526



>ref|XP_009141160.1| PREDICTED: calcium-dependent protein kinase 24-like [Brassica 
rapa]
Length=581

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/543 (66%), Positives = 426/543 (78%), Gaps = 20/543 (4%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQI------RVLNES  254
             MG+CVS  L  +   KRP  RR           +  R   S  +SR++      RVL E 
Sbjct  1     MGSCVSSPLKGSPFRKRPARRRKSSKSKT---STNPRVDSSTNLSRRLIFQPPSRVLPE-  56

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
                 GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVRRE
Sbjct  57    --PIGDGIFVKYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDVEDVRRE  114

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMR LPKHPNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KTI
Sbjct  115   VEIMRSLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTI  174

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQR-FKEIVGSPYY  791
             LEV++VCH+HGVIHRDLKPENFL++N  E A LKAIDFGLSIFFKP +  F EIVGSPYY
Sbjct  175   LEVVKVCHEHGVIHRDLKPENFLFSNETETAQLKAIDFGLSIFFKPEKTLFNEIVGSPYY  234

Query  792   MAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKI  971
             MAPEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK+
Sbjct  235   MAPEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKV  294

Query  972   SEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFK  1151
             S +AK+LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T+I+QF LMN+FK
Sbjct  295   SAEAKELVKDMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTKIQQFLLMNRFK  354

Query  1152  KRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMD  1331
             K+VL +VA+NL   ++E I +MF  MDTDKNG L+FEEL+DGL   G    D DV++LMD
Sbjct  355   KKVLRIVADNLPNKEIEEIVQMFRTMDTDKNGRLTFEELRDGLKKFGTVCPDGDVKMLMD  414

Query  1332  AADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDD  1511
             AAD DGNGML+CEEF+TLA+HL  +  D++L +AF  FDK+ +G IE +EL++ L   DD
Sbjct  415   AADTDGNGMLSCEEFVTLAIHLKRMGCDEHLQQAFKYFDKNGNGSIELDELKEALF--DD  472

Query  1512  D---NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRL  1682
             D      DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++
Sbjct  473   DKLGQGGDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKM  532

Query  1683  FKD  1691
             FK+
Sbjct  533   FKE  535



>ref|XP_010473923.1| PREDICTED: calcium-dependent protein kinase 24-like [Camelina 
sativa]
Length=574

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/468 (72%), Positives = 404/468 (86%), Gaps = 0/468 (0%)
 Frame = +3

Query  285   KYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKH  464
             KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVRREVEIM  LPKH
Sbjct  59    KYELGKELGRGEFGVTHECIEITTRERFACKRISKEKLRTEIDVEDVRREVEIMSCLPKH  118

Query  465   PNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKH  644
             PNIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KTILEV++VCH+H
Sbjct  119   PNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAANVAKTILEVVKVCHEH  178

Query  645   GVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYG  824
             GVIHRDLKPENFL++NG E+A LKAIDFGLSIFFKP QRF EIVGSPYYMAPEVLRR+YG
Sbjct  179   GVIHRDLKPENFLFSNGTESAQLKAIDFGLSIFFKPAQRFNEIVGSPYYMAPEVLRRNYG  238

Query  825   HEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGM  1004
              EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG+IDF+RDPWPK+S +AK+LVK M
Sbjct  239   PEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKVSHEAKELVKNM  298

Query  1005  LDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENL  1184
             LDANPYSR+T++EVL H WI+NAE  PNV LG+ V T+I+QF L+N+FKK+VL +VA+NL
Sbjct  299   LDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLINRFKKKVLRIVADNL  358

Query  1185  SQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLN  1364
               +++ +I +MF  MDTDKNG+L+FEELKDGL  +GQ V D DV++LMDAAD DGNGML+
Sbjct  359   PNEEIAAIIQMFQAMDTDKNGHLTFEELKDGLKKIGQVVPDGDVKMLMDAADTDGNGMLS  418

Query  1365  CEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEI  1544
             CEEF+TL++HL  +  D++L +AF  FDK+N+G IE +EL++ L +    N +DQ +++I
Sbjct  419   CEEFVTLSIHLKRMGCDEHLQQAFKYFDKNNNGSIELDELKETLYDDKLGNSSDQWIKDI  478

Query  1545  IFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFK  1688
              FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+++FK
Sbjct  479   FFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSIKMFK  526



>ref|XP_010522188.1| PREDICTED: calcium-dependent protein kinase 24 [Tarenaya hassleriana]
Length=583

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/485 (69%), Positives = 409/485 (84%), Gaps = 3/485 (1%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidv  416
             RVL E     GDGI  KYE GKELGRGEFG+T+ C E  T E  ACK+ISK KLRTEIDV
Sbjct  52    RVLPE---PIGDGILLKYEMGKELGRGEFGITHECIEIRTRERYACKRISKEKLRTEIDV  108

Query  417   edvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA  596
             EDVRREVEIM  LPKHPNIVS+KE +EDK+A+YLVMELCEGGELFDRIV++GHYTERAAA
Sbjct  109   EDVRREVEIMMRLPKHPNIVSFKEAFEDKDAIYLVMELCEGGELFDRIVSRGHYTERAAA  168

Query  597   LVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIV  776
              V +TIL +++VCH++GVIHRDLKPENFL+ + +E+A LKAIDFGLSIFFKPGQRF EIV
Sbjct  169   SVARTILNIVKVCHENGVIHRDLKPENFLFTDASESAQLKAIDFGLSIFFKPGQRFNEIV  228

Query  777   GSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRD  956
             GSPYYMAPEVLRR+YG EVDVWSAGVILYILLCGVPPFWAET+EGIAHAIV+G IDF RD
Sbjct  229   GSPYYMAPEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETDEGIAHAIVKGKIDFARD  288

Query  957   PWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTL  1136
             PWPK+SE+AK+LV+ MLD NPYSR+T++EVL H WIQN E VPNV LG+ V T+I+QF L
Sbjct  289   PWPKVSEEAKELVRNMLDPNPYSRLTVQEVLEHPWIQNPEKVPNVNLGDNVRTKIQQFML  348

Query  1137  MNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDV  1316
             MNKFKK+VL +VA+NL  +++  I ++F MMDTDKNG+LSFEEL+DGL  +GQ V D +V
Sbjct  349   MNKFKKKVLRIVADNLPNEEIAGIIKVFKMMDTDKNGHLSFEELRDGLRKIGQGVPDSEV  408

Query  1317  QLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYL  1496
             ++L+DAAD DGNGML+CEEF+T+ +H+  +  DD L +AF  FDK+N+G+IE  EL++ L
Sbjct  409   KMLIDAADTDGNGMLSCEEFVTVLIHMKRIGGDDQLLQAFRYFDKNNNGFIELNELKEAL  468

Query  1497  LEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
              +I   + NDQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  469   FDIKLGHTNDQWIKDIFFDVDLNKDGRISFEEFKAMMKSGTDWKMASRQYSRALLNALSI  528

Query  1677  RLFKD  1691
             ++F++
Sbjct  529   KMFRE  533



>ref|XP_004507321.1| PREDICTED: calcium-dependent protein kinase 24-like isoform X1 
[Cicer arietinum]
Length=543

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/544 (64%), Positives = 426/544 (78%), Gaps = 17/544 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPR---SQKISRQ-----IRVLNES  254
             MG+CVS     T  +   R+     N+     +T  P    S   +R+      R LN  
Sbjct  1     MGSCVS-----TQGKNGGRKRSRDHNINNKQHKTNDPHHEVSTPTARRSSVSTTRPLNVV  55

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
              N +   I  KYE GKELGRGEFGVT+ C E +TGE+ ACKKI+K+KLRTEID++DVRRE
Sbjct  56    TNPSPGNIFDKYELGKELGRGEFGVTHRCVEIKTGEAFACKKIAKTKLRTEIDIQDVRRE  115

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             V+IMRHLPKHPNIVS++E YED++AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTI
Sbjct  116   VQIMRHLPKHPNIVSFREAYEDRDAVYLVMELCEGGELFDRIVAKGHYTERAAANVAKTI  175

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPG--QRFKEIVGSPY  788
             LEV +VCH HGVIHRDLKPENFL+A+G E A LK+IDFGLS F+ PG  ++F EIVGSPY
Sbjct  176   LEVCKVCHDHGVIHRDLKPENFLFADGTEGASLKSIDFGLSTFYNPGSGEKFNEIVGSPY  235

Query  789   YMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPK  968
             YMAPEVLRR+Y  E+D+WS GVILYILLCGVPPFWAETEE IA AI+RG++DF RDPWPK
Sbjct  236   YMAPEVLRRNYSQEIDIWSTGVILYILLCGVPPFWAETEEAIAQAIIRGNVDFTRDPWPK  295

Query  969   ISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKF  1148
             +SE+AK LVK MLD +P +R+ ++E L H WIQ+ E   NV LG+ V  RIKQF+LMN+F
Sbjct  296   VSEEAKYLVKRMLDPDPDTRIKVQEALDHSWIQHREHGRNVSLGDQVRMRIKQFSLMNRF  355

Query  1149  KKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLM  1328
             KK+VL VVA+NL  +Q++ +++MF MMD DKNG+L+FEELKDG SM+G  + D DV++L+
Sbjct  356   KKKVLRVVADNLPDEQIDGLRQMFDMMDKDKNGHLTFEELKDGFSMIGHVIPDPDVRMLI  415

Query  1329  DAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEID  1508
             DAAD DGNG LNCEEFIT++VHL  + ND++L +AF  FDK+ SGY+EFEEL+D L   D
Sbjct  416   DAADFDGNGTLNCEEFITMSVHLRRIGNDEHLSEAFNFFDKNQSGYVEFEELKDALS--D  473

Query  1509  DDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFK  1688
             DD+ +DQV+++I+ D DLDKDGRISF EFKAMM +G DWKMASR+YS+ +LNALS R+FK
Sbjct  474   DDSTDDQVIRDILNDVDLDKDGRISFEEFKAMMKSGGDWKMASRQYSRALLNALSFRMFK  533

Query  1689  DKSV  1700
             DKS 
Sbjct  534   DKSA  537



>ref|XP_009132795.1| PREDICTED: calcium-dependent protein kinase 24 isoform X2 [Brassica 
rapa]
 emb|CDX84782.1| BnaA03g14480D [Brassica napus]
Length=550

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 408/485 (84%), Gaps = 3/485 (1%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidv  416
             RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T +  ACK+ISK KLRTEIDV
Sbjct  22    RVLPE---PIGDGILLKYELGKELGRGEFGVTHECIEITTRKRFACKRISKEKLRTEIDV  78

Query  417   edvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA  596
             EDVRREVEIM  LPKHPNIV++KE +ED++AVYLVME+CEGGELFDRIVA+GHYTERAAA
Sbjct  79    EDVRREVEIMSCLPKHPNIVTFKEAFEDEDAVYLVMEICEGGELFDRIVARGHYTERAAA  138

Query  597   LVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIV  776
              VTKTILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSI FK GQRF EIV
Sbjct  139   SVTKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSINFKHGQRFNEIV  198

Query  777   GSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRD  956
             GSPYYMAPEVLRRDYG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG IDF+RD
Sbjct  199   GSPYYMAPEVLRRDYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGHIDFERD  258

Query  957   PWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTL  1136
             PWPK+S++AK LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T I+QF L
Sbjct  259   PWPKVSKEAKQLVKSMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTNIQQFVL  318

Query  1137  MNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDV  1316
             MN+FKK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ   D DV
Sbjct  319   MNRFKKKVLRIVADNLPNEEIAAIVQMFETMDTDKNGHLTFEELRDGLKNLGQVCPDGDV  378

Query  1317  QLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYL  1496
             ++LMDAAD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL++ L
Sbjct  379   KMLMDAADTDGNGMLSCEEFVTLSIHLKRIGCDEHLQEAFKYFDKNGNGFIELDELKEAL  438

Query  1497  LEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
              +      +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  439   FDDKLGQGSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSM  498

Query  1677  RLFKD  1691
             ++FK+
Sbjct  499   KMFKE  503



>emb|CDY23939.1| BnaC03g17520D [Brassica napus]
Length=550

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 408/485 (84%), Gaps = 3/485 (1%)
 Frame = +3

Query  237   RVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidv  416
             RVL E     GDGI  KYE GKELGRGEFGVT+ C E  T +  ACK+ISK KLRTEIDV
Sbjct  22    RVLPE---PIGDGILLKYELGKELGRGEFGVTHECIEINTRKRFACKRISKEKLRTEIDV  78

Query  417   edvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAA  596
             EDVRREVEIM  LPKHPNIV++KE +ED++AVYLVME+CEGGELFDRIVA+GHYTERAAA
Sbjct  79    EDVRREVEIMSCLPKHPNIVTFKEAFEDEDAVYLVMEICEGGELFDRIVARGHYTERAAA  138

Query  597   LVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIV  776
              VTKTILEV++VCH+HGVIHRDLKPENFL++NG E A LKAIDFGLSI FK GQRF EIV
Sbjct  139   SVTKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSINFKHGQRFNEIV  198

Query  777   GSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRD  956
             GSPYYMAPEVLRRDYG E+DVWSAGVILYILLCGVPPFWAETEEGIAHAIVRG IDF+RD
Sbjct  199   GSPYYMAPEVLRRDYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGHIDFERD  258

Query  957   PWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTL  1136
             PWPK+S++AK LVK MLDANPYSR+T++EVL H WIQNAE  PNV LG+ V T I+QF L
Sbjct  259   PWPKVSKEAKQLVKSMLDANPYSRLTVQEVLEHPWIQNAERAPNVNLGDNVRTNIQQFVL  318

Query  1137  MNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDV  1316
             MN+FKK+VL +VA+NL  +++ +I +MF  MDTDKNG+L+FEEL+DGL  +GQ   D DV
Sbjct  319   MNRFKKKVLRIVADNLPNEEIAAIVQMFETMDTDKNGHLTFEELRDGLKNLGQVCPDGDV  378

Query  1317  QLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYL  1496
             ++LMDAAD DGNGML+CEEF+TL++HL  +  D++L +AF  FDK+ +G+IE +EL++ L
Sbjct  379   KMLMDAADTDGNGMLSCEEFVTLSIHLKRIGCDEHLQEAFKYFDKNGNGFIELDELKEAL  438

Query  1497  LEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSV  1676
              +      +DQ +++I FD DL+KDGRISF EFKAMM +GTDWKMASR+YS+ +LNALS+
Sbjct  439   FDDKLGQGSDQWIKDIFFDVDLNKDGRISFDEFKAMMKSGTDWKMASRQYSRALLNALSM  498

Query  1677  RLFKD  1691
             ++FK+
Sbjct  499   KMFKE  503



>gb|KHN06216.1| Calcium-dependent protein kinase 24, partial [Glycine soja]
Length=482

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/474 (70%), Positives = 408/474 (86%), Gaps = 0/474 (0%)
 Frame = +3

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I  KY+FGKELGRGEFGVT+   + E+GE+ ACKKISK+KLRTEIDV+DVRREV+IMRHL
Sbjct  2     IFDKYQFGKELGRGEFGVTHRVVDVESGEAFACKKISKTKLRTEIDVQDVRREVQIMRHL  61

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             P+HPNIV++KE YEDK+AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTILEV +VC
Sbjct  62    PQHPNIVAFKEAYEDKDAVYLVMELCEGGELFDRIVAKGHYTERAAANVVKTILEVCKVC  121

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             H+HGVIHRDLKPENFL+A+ +E+APLK+IDFGLS F++ G+RF EIVGSPYYMAPEVLRR
Sbjct  122   HEHGVIHRDLKPENFLFADTSESAPLKSIDFGLSTFYESGERFSEIVGSPYYMAPEVLRR  181

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG E+DVWS GVILYILLCGVPPFWAE+EEGIA AI+RG +DF RDPWPK+S++AK LV
Sbjct  182   NYGQEIDVWSTGVILYILLCGVPPFWAESEEGIAQAIIRGKVDFTRDPWPKVSDEAKHLV  241

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             K MLD NP++R+T++EVL + WIQN E    + LG+ V  RIKQF+LMN+FK++VL VVA
Sbjct  242   KRMLDPNPFTRITVQEVLDNSWIQNREHGRTISLGDQVRMRIKQFSLMNRFKRKVLRVVA  301

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             +NLS +Q++  K+MF+MMD DKNGNLSFEEL+DGLSM+G  + D DV++LMDAAD+DGNG
Sbjct  302   DNLSDEQIDVFKQMFNMMDKDKNGNLSFEELRDGLSMIGHAIPDPDVEMLMDAADIDGNG  361

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
              LN EEFIT++VHL  + +D++L +AF  FDK+ SGY+EFEEL+D L + D +  +DQVV
Sbjct  362   TLNYEEFITMSVHLRKIESDEHLSEAFRYFDKNQSGYVEFEELKDALSDDDSEASDDQVV  421

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
             ++I+ D DLDKDGRISF EFKAMM TG DWKMASR+YS+ +LNALS ++FKD S
Sbjct  422   KDILNDVDLDKDGRISFEEFKAMMNTGGDWKMASRQYSRALLNALSFKMFKDTS  475



>ref|XP_010671825.1| PREDICTED: calcium-dependent protein kinase 24 [Beta vulgaris 
subsp. vulgaris]
Length=545

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/511 (68%), Positives = 420/511 (82%), Gaps = 6/511 (1%)
 Frame = +3

Query  159   PIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYL  338
             P D E+    G ++R+  S   SR I VL +      D I +KY+FGKELGRGEFGVTY 
Sbjct  32    PADEEHSSTVGRKSRS--STYHSRSITVLVDP--TVRDNIKQKYKFGKELGRGEFGVTYQ  87

Query  339   CTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYL  518
             C E ETGE+ ACK ISKSKLRT+ID++DVRREVEIMRHLPKH NIV++KE YEDK+AVYL
Sbjct  88    CMELETGENYACKTISKSKLRTDIDIDDVRREVEIMRHLPKHSNIVTFKEAYEDKDAVYL  147

Query  519   VMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGN  698
             VMELCEGGELFDRIV++GHY+ERAAA V KTIL+V++VCH+HGVIHRDLKPENFL++N N
Sbjct  148   VMELCEGGELFDRIVSRGHYSERAAAQVVKTILQVVKVCHEHGVIHRDLKPENFLFSNKN  207

Query  699   ENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCG  878
             E+A LKAIDFGLSIFF+PGQRF EIVGSPYYMAPEVLRRDYG E+DVWSAGVILYILLCG
Sbjct  208   ESASLKAIDFGLSIFFEPGQRFSEIVGSPYYMAPEVLRRDYGPEIDVWSAGVILYILLCG  267

Query  879   VPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHK  1058
             VPPFWAETEEGIA AIV+G IDF+RDPWP++S  AKDLVK ML  NPY+R+++EEVL H 
Sbjct  268   VPPFWAETEEGIAQAIVKGVIDFERDPWPRVSPQAKDLVKHMLHQNPYNRLSVEEVLEHP  327

Query  1059  WIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTD  1238
             W++NA    ++PLG+ V TRIKQF+LMNKFKK+VL VVA+ L  +Q++ ++  FHMMDTD
Sbjct  328   WMKNANNNADIPLGQNVRTRIKQFSLMNKFKKKVLRVVADTLPDEQIDKLRRTFHMMDTD  387

Query  1239  KNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDD  1418
             KNG+L FEELK GL  +G  + D DVQ+++DAAD+DGNG L+C EF+ L++HL  + +D+
Sbjct  388   KNGSLCFEELKQGLLKLGHALPDSDVQMILDAADLDGNGTLDCGEFLALSIHLQKMGDDE  447

Query  1419  NLHKAFLIFDKDNSGYIEFEELRDYLLEID--DDNKNDQVVQEIIFDADLDKDGRISFPE  1592
             +L +AF  FDKD SGYIEFEEL++ L   D  D  K++QV+++I+FDADLDKDGRI F E
Sbjct  448   HLRRAFKFFDKDQSGYIEFEELKEELFLDDVLDGTKSEQVIRDILFDADLDKDGRIDFNE  507

Query  1593  FKAMMTTGTDWKMASRKYSKVMLNALSVRLF  1685
             FKAMM TG DWKM+SR+YSK MLN LS +LF
Sbjct  508   FKAMMHTGMDWKMSSRQYSKAMLNKLSFKLF  538



>gb|AHG06451.1| calcium-dependent protein kinase 24 [Brassica napus]
Length=610

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/568 (63%), Positives = 432/568 (76%), Gaps = 42/568 (7%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQI------RVLNES  254
             MG+CVS  L  +   KRP  RR            +T    +  +SR++      RVL E 
Sbjct  1     MGSCVSSPLKGSPFGKRPARRRNNSSSTKTSSNPKTDTSSTSTLSRRLIFQPPSRVLPE-  59

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
                 GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVRRE
Sbjct  60    --PIGDGIFLKYELGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRRE  117

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMR LPKH NIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KTI
Sbjct  118   VEIMRSLPKHANIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTI  177

Query  615   LEVIQVC--------------------------HKHGVIHRDLKPENFLYANGNENAPLK  716
             LEV++VC                          H+HGVIHRDLKPENFL++N  E A LK
Sbjct  178   LEVVKVCEKNSNLLCIFCFFPAFIVVFLCLKVCHEHGVIHRDLKPENFLFSNETETAQLK  237

Query  717   AIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWA  896
             AIDFGLSIFFKP QRF EIVGSPYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWA
Sbjct  238   AIDFGLSIFFKPAQRFNEIVGSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWA  297

Query  897   ETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAE  1076
             ETEEGIAHAIVRG+IDF+RDPWPK+S +AK+LVK MLDANPYSR+T++EVL H WIQNAE
Sbjct  298   ETEEGIAHAIVRGNIDFERDPWPKVSREAKELVKNMLDANPYSRLTVQEVLEHPWIQNAE  357

Query  1077  TVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLS  1256
               PNV LG+GV T+I+QF LMN+FKK+VL VVA+NL  +++ESI +MF  MDTDKNG+L+
Sbjct  358   RAPNVNLGDGVRTKIQQFLLMNRFKKKVLRVVADNLPNEEIESIIQMFQTMDTDKNGHLT  417

Query  1257  FEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAF  1436
             FEEL+DGL  +GQ   D DV++LMDAAD DGNG L+CEEF+TLA+HL  +  D++L +AF
Sbjct  418   FEELRDGLKKIGQVCPDGDVKMLMDAADTDGNGTLSCEEFVTLAIHLKRMGCDEHLQQAF  477

Query  1437  LIFDKDNSGYIEFEELRDYLLEIDDD---NKNDQVVQEIIFDADLDKDGRISFPEFKAMM  1607
               FDK+ +G IE +EL++ L   DDD   +  DQ +++I FD DL+KDGRISF EF+AMM
Sbjct  478   KYFDKNGNGSIELDELKEALF--DDDKLGHGGDQWIKDIFFDVDLNKDGRISFDEFRAMM  535

Query  1608  TTGTDWKMASRKYSKVMLNALSVRLFKD  1691
              +GTDWKMASR+YS+ +LNALS+++FK+
Sbjct  536   KSGTDWKMASRQYSRALLNALSIKMFKE  563



>ref|XP_009144198.1| PREDICTED: calcium-dependent protein kinase 24-like isoform X1 
[Brassica rapa]
Length=610

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/568 (63%), Positives = 432/568 (76%), Gaps = 42/568 (7%)
 Frame = +3

Query  99    MGACVS--LHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQI------RVLNES  254
             MG+CVS  L  +   KRP  RR            +T    +  +SR++      RVL E 
Sbjct  1     MGSCVSSPLKGSPFGKRPARRRNNSSSTKTSSNPKTDTSSTSTLSRRLIFQPPSRVLPE-  59

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
                 GDGI  KYE GKELGRGEFGVT+ C E  T E  ACK+ISK KLRTEIDVEDVRRE
Sbjct  60    --PIGDGIFLKYELGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRRE  117

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMR LPKH NIVS+KE +EDK+AVYLVME+CEGGELFDRIV++GHYTERAAA V KTI
Sbjct  118   VEIMRSLPKHANIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTI  177

Query  615   LEVIQVC--------------------------HKHGVIHRDLKPENFLYANGNENAPLK  716
             LEV++VC                          H+HGVIHRDLKPENFL++N  E A LK
Sbjct  178   LEVVKVCEKNSNLLCIFCFFPAFIVVFLCLKVCHEHGVIHRDLKPENFLFSNETETAQLK  237

Query  717   AIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWA  896
             AIDFGLSIFFKP QRF EIVGSPYYMAPEVLRR+YG E+DVWSAGVILYILLCGVPPFWA
Sbjct  238   AIDFGLSIFFKPAQRFNEIVGSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWA  297

Query  897   ETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAE  1076
             ETEEGIAHAIVRG+IDF+RDPWPK+S +AK+LVK MLDANPYSR+T++EVL H WIQNAE
Sbjct  298   ETEEGIAHAIVRGNIDFERDPWPKVSREAKELVKNMLDANPYSRLTVQEVLEHPWIQNAE  357

Query  1077  TVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLS  1256
               PNV LG+GV T+I+QF LMN+FKK+VL VVA+NL  +++ESI +MF  MDTDKNG+L+
Sbjct  358   RAPNVNLGDGVRTKIQQFLLMNRFKKKVLRVVADNLPNEEIESIIQMFQTMDTDKNGHLT  417

Query  1257  FEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAF  1436
             FEEL+DGL  +GQ   D DV++LMDAAD DGNG L+CEEF+TLA+HL  +  D++L +AF
Sbjct  418   FEELRDGLKKIGQVCPDGDVKMLMDAADTDGNGTLSCEEFVTLAIHLKRMGCDEHLQQAF  477

Query  1437  LIFDKDNSGYIEFEELRDYLLEIDDD---NKNDQVVQEIIFDADLDKDGRISFPEFKAMM  1607
               FDK+ +G IE +EL++ L   DDD   +  DQ +++I FD DL+KDGRISF EF+AMM
Sbjct  478   KYFDKNGNGSIELDELKEALF--DDDKLGHGGDQWIKDIFFDVDLNKDGRISFDEFRAMM  535

Query  1608  TTGTDWKMASRKYSKVMLNALSVRLFKD  1691
              +GTDWKMASR+YS+ +LNALS+++FK+
Sbjct  536   KSGTDWKMASRQYSRALLNALSIKMFKE  563



>ref|XP_010268121.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Nelumbo nucifera]
Length=665

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/527 (65%), Positives = 416/527 (79%), Gaps = 13/527 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPI------DPENVRGGGSRTRAPRSQKISRQIRVLNESHN  260
             MG C S  +A   +R  +R+P       D ++V    SR              VL ES  
Sbjct  1     MGGCFSSANATLSQRANHRKPCAKGDKKDVDDV----SRDSVVVPVPKVVLPAVLTES--  54

Query  261   ATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreve  440
              TG+ I K+Y  G ELGRGEFG+T  C + ETGE +ACK ISK+KLR+EIDVEDVRREVE
Sbjct  55    -TGNDILKRYHLGSELGRGEFGITRQCVDIETGEKLACKTISKNKLRSEIDVEDVRREVE  113

Query  441   iMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILE  620
             IMR LP HPN+V  KE YED+EAV+LVMELCEGGELFDRIVA+GHYTE AAA+VTKTI+E
Sbjct  114   IMRRLPVHPNVVRLKESYEDEEAVHLVMELCEGGELFDRIVARGHYTEGAAAVVTKTIIE  173

Query  621   VIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAP  800
             V+Q+CH HGV+HRDLKPENFL+ +  E++ L+AIDFGLSIFF+PGQRF EIVGSP+YMAP
Sbjct  174   VVQMCHNHGVMHRDLKPENFLFTDRTEDSVLRAIDFGLSIFFEPGQRFNEIVGSPFYMAP  233

Query  801   EVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISED  980
             EVLRR+YG EVD+WSAGVILYILLCGVPPFWAETEEG+A AIVR DIDF RDPWPK+SED
Sbjct  234   EVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEEGVAQAIVRSDIDFIRDPWPKVSED  293

Query  981   AKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRV  1160
             AKDLV+GMLD NPY R+T++EVL H W+QNA  V NVPLGE VTT IKQF+LMNKFKKR 
Sbjct  294   AKDLVRGMLDPNPYCRLTVKEVLEHPWLQNANKVLNVPLGECVTTMIKQFSLMNKFKKRA  353

Query  1161  LMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAAD  1340
             L VVA+ L  DQ   IK++FHMMDTD NGNL+FEE+KDGL M+GQPV D DVQ+L+DA D
Sbjct  354   LRVVADILPMDQTAGIKKIFHMMDTDNNGNLTFEEVKDGLHMIGQPVPDPDVQMLIDAED  413

Query  1341  VDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNK  1520
             +DG+G LN E+F+T+++HL  +S+ ++L  AF +FDK++SG+IE+EELR+ LLE D    
Sbjct  414   IDGSGTLNYEDFVTISIHLKRISSKEHLSTAFNLFDKNDSGFIEYEELREALLEDDLGPD  473

Query  1521  NDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVML  1661
             N+QV+++I+ D D DKDGRIS+ EF+AMM  G DWKM+SR+YS+ M 
Sbjct  474   NEQVIRDILSDVDTDKDGRISYEEFEAMMKAGMDWKMSSRQYSRSMF  520


 Score =   134 bits (337),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  1053  HKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMD  1232
             H W QNA  V NVPLGE VTT+IKQF+LMNKFKKR L VVA+ L  DQ   IK++FHMMD
Sbjct  561   HSWPQNANKVLNVPLGECVTTKIKQFSLMNKFKKRALRVVADILPMDQTIGIKKIFHMMD  620

Query  1233  TDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
             T+ NGNL+FEE+KDGL M+GQPV D DVQ+L+D  ++
Sbjct  621   TNNNGNLTFEEVKDGLHMIGQPVPDPDVQMLIDVVNM  657



>ref|XP_010268123.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X3 
[Nelumbo nucifera]
Length=598

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/544 (63%), Positives = 416/544 (76%), Gaps = 27/544 (5%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPI---DPENVRGGGSRTRAPRSQKISRQIRVLNESHNATG  269
             MG C S  +A   +R  +R+P    D ++V    SR              VL ES   TG
Sbjct  1     MGGCFSSANATLSQRANHRKPCAKGDKKDV-DDVSRDSVVVPVPKVVLPAVLTES---TG  56

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             + I K+Y  G ELGRGEFG+T  C + ETGE +ACK ISK+KLR+EIDVEDVRREVEIMR
Sbjct  57    NDILKRYHLGSELGRGEFGITRQCVDIETGEKLACKTISKNKLRSEIDVEDVRREVEIMR  116

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LP HPN+V  KE YED+EAV+LVMELCEGGELFDRIVA+GHYTE AAA+VTKTI+EV+Q
Sbjct  117   RLPVHPNVVRLKESYEDEEAVHLVMELCEGGELFDRIVARGHYTEGAAAVVTKTIIEVVQ  176

Query  630   --------------------VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFK  749
                                 +CH HGV+HRDLKPENFL+ +  E++ L+AIDFGLSIFF+
Sbjct  177   WSDMLLEHNFDICLLLYFTLMCHNHGVMHRDLKPENFLFTDRTEDSVLRAIDFGLSIFFE  236

Query  750   PGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV  929
             PGQRF EIVGSP+YMAPEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETEEG+A AIV
Sbjct  237   PGQRFNEIVGSPFYMAPEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEEGVAQAIV  296

Query  930   RGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGV  1109
             R DIDF RDPWPK+SEDAKDLV+GMLD NPY R+T++EVL H W+QNA  V NVPLGE V
Sbjct  297   RSDIDFIRDPWPKVSEDAKDLVRGMLDPNPYCRLTVKEVLEHPWLQNANKVLNVPLGECV  356

Query  1110  TTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMM  1289
             TT IKQF+LMNKFKKR L VVA+ L  DQ   IK++FHMMDTD NGNL+FEE+KDGL M+
Sbjct  357   TTMIKQFSLMNKFKKRALRVVADILPMDQTAGIKKIFHMMDTDNNGNLTFEEVKDGLHMI  416

Query  1290  GQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYI  1469
             GQPV D DVQ+L+DA D+DG+G LN E+F+T+++HL  +S+ ++L  AF +FDK++SG+I
Sbjct  417   GQPVPDPDVQMLIDAEDIDGSGTLNYEDFVTISIHLKRISSKEHLSTAFNLFDKNDSGFI  476

Query  1470  EFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYS  1649
             E+EELR+ LLE D    N+QV+++I+ D D DKDGRIS+ EF+AMM  G DWKM+SR+YS
Sbjct  477   EYEELREALLEDDLGPDNEQVIRDILSDVDTDKDGRISYEEFEAMMKAGMDWKMSSRQYS  536

Query  1650  KVML  1661
             + M 
Sbjct  537   RSMF  540



>ref|XP_010268125.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X5 
[Nelumbo nucifera]
Length=553

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/544 (63%), Positives = 416/544 (76%), Gaps = 27/544 (5%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPI---DPENVRGGGSRTRAPRSQKISRQIRVLNESHNATG  269
             MG C S  +A   +R  +R+P    D ++V    SR              VL ES   TG
Sbjct  1     MGGCFSSANATLSQRANHRKPCAKGDKKDV-DDVSRDSVVVPVPKVVLPAVLTES---TG  56

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             + I K+Y  G ELGRGEFG+T  C + ETGE +ACK ISK+KLR+EIDVEDVRREVEIMR
Sbjct  57    NDILKRYHLGSELGRGEFGITRQCVDIETGEKLACKTISKNKLRSEIDVEDVRREVEIMR  116

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LP HPN+V  KE YED+EAV+LVMELCEGGELFDRIVA+GHYTE AAA+VTKTI+EV+Q
Sbjct  117   RLPVHPNVVRLKESYEDEEAVHLVMELCEGGELFDRIVARGHYTEGAAAVVTKTIIEVVQ  176

Query  630   --------------------VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFK  749
                                 +CH HGV+HRDLKPENFL+ +  E++ L+AIDFGLSIFF+
Sbjct  177   WSDMLLEHNFDICLLLYFTLMCHNHGVMHRDLKPENFLFTDRTEDSVLRAIDFGLSIFFE  236

Query  750   PGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV  929
             PGQRF EIVGSP+YMAPEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETEEG+A AIV
Sbjct  237   PGQRFNEIVGSPFYMAPEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEEGVAQAIV  296

Query  930   RGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGV  1109
             R DIDF RDPWPK+SEDAKDLV+GMLD NPY R+T++EVL H W+QNA  V NVPLGE V
Sbjct  297   RSDIDFIRDPWPKVSEDAKDLVRGMLDPNPYCRLTVKEVLEHPWLQNANKVLNVPLGECV  356

Query  1110  TTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMM  1289
             TT IKQF+LMNKFKKR L VVA+ L  DQ   IK++FHMMDTD NGNL+FEE+KDGL M+
Sbjct  357   TTMIKQFSLMNKFKKRALRVVADILPMDQTAGIKKIFHMMDTDNNGNLTFEEVKDGLHMI  416

Query  1290  GQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYI  1469
             GQPV D DVQ+L+DA D+DG+G LN E+F+T+++HL  +S+ ++L  AF +FDK++SG+I
Sbjct  417   GQPVPDPDVQMLIDAEDIDGSGTLNYEDFVTISIHLKRISSKEHLSTAFNLFDKNDSGFI  476

Query  1470  EFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYS  1649
             E+EELR+ LLE D    N+QV+++I+ D D DKDGRIS+ EF+AMM  G DWKM+SR+YS
Sbjct  477   EYEELREALLEDDLGPDNEQVIRDILSDVDTDKDGRISYEEFEAMMKAGMDWKMSSRQYS  536

Query  1650  KVML  1661
             + M 
Sbjct  537   RSMF  540



>ref|XP_010268124.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X4 
[Nelumbo nucifera]
Length=570

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/544 (63%), Positives = 416/544 (76%), Gaps = 27/544 (5%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPI---DPENVRGGGSRTRAPRSQKISRQIRVLNESHNATG  269
             MG C S  +A   +R  +R+P    D ++V    SR              VL ES   TG
Sbjct  1     MGGCFSSANATLSQRANHRKPCAKGDKKDV-DDVSRDSVVVPVPKVVLPAVLTES---TG  56

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             + I K+Y  G ELGRGEFG+T  C + ETGE +ACK ISK+KLR+EIDVEDVRREVEIMR
Sbjct  57    NDILKRYHLGSELGRGEFGITRQCVDIETGEKLACKTISKNKLRSEIDVEDVRREVEIMR  116

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LP HPN+V  KE YED+EAV+LVMELCEGGELFDRIVA+GHYTE AAA+VTKTI+EV+Q
Sbjct  117   RLPVHPNVVRLKESYEDEEAVHLVMELCEGGELFDRIVARGHYTEGAAAVVTKTIIEVVQ  176

Query  630   --------------------VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFK  749
                                 +CH HGV+HRDLKPENFL+ +  E++ L+AIDFGLSIFF+
Sbjct  177   WSDMLLEHNFDICLLLYFTLMCHNHGVMHRDLKPENFLFTDRTEDSVLRAIDFGLSIFFE  236

Query  750   PGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV  929
             PGQRF EIVGSP+YMAPEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETEEG+A AIV
Sbjct  237   PGQRFNEIVGSPFYMAPEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEEGVAQAIV  296

Query  930   RGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGV  1109
             R DIDF RDPWPK+SEDAKDLV+GMLD NPY R+T++EVL H W+QNA  V NVPLGE V
Sbjct  297   RSDIDFIRDPWPKVSEDAKDLVRGMLDPNPYCRLTVKEVLEHPWLQNANKVLNVPLGECV  356

Query  1110  TTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMM  1289
             TT IKQF+LMNKFKKR L VVA+ L  DQ   IK++FHMMDTD NGNL+FEE+KDGL M+
Sbjct  357   TTMIKQFSLMNKFKKRALRVVADILPMDQTAGIKKIFHMMDTDNNGNLTFEEVKDGLHMI  416

Query  1290  GQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYI  1469
             GQPV D DVQ+L+DA D+DG+G LN E+F+T+++HL  +S+ ++L  AF +FDK++SG+I
Sbjct  417   GQPVPDPDVQMLIDAEDIDGSGTLNYEDFVTISIHLKRISSKEHLSTAFNLFDKNDSGFI  476

Query  1470  EFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYS  1649
             E+EELR+ LLE D    N+QV+++I+ D D DKDGRIS+ EF+AMM  G DWKM+SR+YS
Sbjct  477   EYEELREALLEDDLGPDNEQVIRDILSDVDTDKDGRISYEEFEAMMKAGMDWKMSSRQYS  536

Query  1650  KVML  1661
             + M 
Sbjct  537   RSMF  540



>ref|XP_010268122.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 
[Nelumbo nucifera]
Length=609

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/544 (63%), Positives = 416/544 (76%), Gaps = 27/544 (5%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPI---DPENVRGGGSRTRAPRSQKISRQIRVLNESHNATG  269
             MG C S  +A   +R  +R+P    D ++V    SR              VL ES   TG
Sbjct  1     MGGCFSSANATLSQRANHRKPCAKGDKKDV-DDVSRDSVVVPVPKVVLPAVLTES---TG  56

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             + I K+Y  G ELGRGEFG+T  C + ETGE +ACK ISK+KLR+EIDVEDVRREVEIMR
Sbjct  57    NDILKRYHLGSELGRGEFGITRQCVDIETGEKLACKTISKNKLRSEIDVEDVRREVEIMR  116

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
              LP HPN+V  KE YED+EAV+LVMELCEGGELFDRIVA+GHYTE AAA+VTKTI+EV+Q
Sbjct  117   RLPVHPNVVRLKESYEDEEAVHLVMELCEGGELFDRIVARGHYTEGAAAVVTKTIIEVVQ  176

Query  630   --------------------VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFK  749
                                 +CH HGV+HRDLKPENFL+ +  E++ L+AIDFGLSIFF+
Sbjct  177   WSDMLLEHNFDICLLLYFTLMCHNHGVMHRDLKPENFLFTDRTEDSVLRAIDFGLSIFFE  236

Query  750   PGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIV  929
             PGQRF EIVGSP+YMAPEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETEEG+A AIV
Sbjct  237   PGQRFNEIVGSPFYMAPEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEEGVAQAIV  296

Query  930   RGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGV  1109
             R DIDF RDPWPK+SEDAKDLV+GMLD NPY R+T++EVL H W+QNA  V NVPLGE V
Sbjct  297   RSDIDFIRDPWPKVSEDAKDLVRGMLDPNPYCRLTVKEVLEHPWLQNANKVLNVPLGECV  356

Query  1110  TTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMM  1289
             TT IKQF+LMNKFKKR L VVA+ L  DQ   IK++FHMMDTD NGNL+FEE+KDGL M+
Sbjct  357   TTMIKQFSLMNKFKKRALRVVADILPMDQTAGIKKIFHMMDTDNNGNLTFEEVKDGLHMI  416

Query  1290  GQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYI  1469
             GQPV D DVQ+L+DA D+DG+G LN E+F+T+++HL  +S+ ++L  AF +FDK++SG+I
Sbjct  417   GQPVPDPDVQMLIDAEDIDGSGTLNYEDFVTISIHLKRISSKEHLSTAFNLFDKNDSGFI  476

Query  1470  EFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYS  1649
             E+EELR+ LLE D    N+QV+++I+ D D DKDGRIS+ EF+AMM  G DWKM+SR+YS
Sbjct  477   EYEELREALLEDDLGPDNEQVIRDILSDVDTDKDGRISYEEFEAMMKAGMDWKMSSRQYS  536

Query  1650  KVML  1661
             + M 
Sbjct  537   RSMF  540


 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  1161  LMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAAD  1340
             L VVA+ L  DQ   IK++FHMMDT+ NGNL+FEE+KDGL M+GQPV D DVQ+L+D  +
Sbjct  541   LEVVADILPMDQTIGIKKIFHMMDTNNNGNLTFEEVKDGLHMIGQPVPDPDVQMLIDVVN  600

Query  1341  V  1343
             +
Sbjct  601   M  601



>ref|XP_008804559.1| PREDICTED: calcium-dependent protein kinase 32-like [Phoenix 
dactylifera]
Length=531

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/482 (66%), Positives = 396/482 (82%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFG+TYLCT+KETGE +ACK ISK KLRT +D+EDVRREV
Sbjct  45    DPTGRDIESRYELGRELGRGEFGITYLCTDKETGEVIACKSISKKKLRTAVDIEDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP+HPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VT+TI+
Sbjct  105   EIMRHLPRHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTRTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVVQMCHKHGVMHRDLKPENFLFANKKEASPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFW+ETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  225   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWSETEQGVAQAIIRSVIDFKRDPWPKVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLDA+P  R+T ++VL H W+QNA+  PNV LGE V  R++QF++MNKFKKR
Sbjct  285   NAKDLVRRMLDADPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVRARLQQFSVMNKFKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IKEMF  MD + NG ++  ELK+GL  +G  +AD DVQ+LM+AA
Sbjct  345   ALRVVAEHLSVEEVADIKEMFGKMDVNNNGKITLGELKNGLHRLGHQIADADVQILMEAA  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G L+  EF+ +++HL  + ND++L KAF  FD++NSGYIE  EL++ L + D   
Sbjct  405   DVDGDGTLDYGEFVAVSIHLKKIGNDEHLRKAFAYFDQNNSGYIEIAELKNALAD-DLGP  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD S
Sbjct  464   NHEEVINAIIHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGS  523

Query  1698  VQ  1703
             +Q
Sbjct  524   LQ  525



>ref|XP_010278963.1| PREDICTED: calcium-dependent protein kinase 32-like [Nelumbo 
nucifera]
Length=534

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/481 (67%), Positives = 385/481 (80%), Gaps = 1/481 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I   YE G+ELGRGEFGVTYLCT+K TGE  ACK ISK KLRT IDVEDVRREVEI
Sbjct  47    TGTDIESTYELGRELGRGEFGVTYLCTDKSTGEQFACKSISKKKLRTAIDVEDVRREVEI  106

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP HPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EV
Sbjct  107   MRHLPNHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEV  166

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG RF EIVGSPYYMAPE
Sbjct  167   VQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSMFFKPGDRFTEIVGSPYYMAPE  226

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWS GVILYILLCGVPPFWAETE+G+A AI+R  +DF RDPWPK+S++A
Sbjct  227   VLKRNYGPEVDVWSCGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFTRDPWPKVSDNA  286

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T ++VL H WIQNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  287   KDLVKKMLDPDPTQRLTAQQVLDHPWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  346

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE LS ++V  IKE F MMDT  NG ++ EEL+DGL  +G  + + DVQ+LMDAAD+
Sbjct  347   KVIAEFLSVEEVAGIKEAFEMMDTGNNGKITIEELRDGLQKLGHHIPEPDVQILMDAADL  406

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLL-EIDDDNK  1520
             DG+G L+  EF+ ++VHL  + ND++L KAF  FD++ SGYIE EELR+ L  E   D  
Sbjct  407   DGDGALDYGEFVAVSVHLRKMGNDEHLRKAFSFFDQNRSGYIEIEELREALADEEGGDAN  466

Query  1521  NDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             N++V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L KD S+
Sbjct  467   NEEVINAIIQDVDTDKDGRISYEEFSAMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSL  526

Query  1701  Q  1703
             Q
Sbjct  527   Q  527



>ref|XP_010931028.1| PREDICTED: calcium-dependent protein kinase 32 [Elaeis guineensis]
Length=532

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/482 (66%), Positives = 396/482 (82%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFG+TYLCT+KETGE +ACK ISK KLRT +D++DVRREV
Sbjct  46    DPTGRDIESRYELGRELGRGEFGITYLCTDKETGEVLACKSISKKKLRTAVDIDDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP+HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VT+TI+
Sbjct  106   EIMRHLPRHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTRTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  166   EVVQMCHKHGVMHRDLKPENFLFANKKEISPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  226   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R++QF++MNKFKKR
Sbjct  286   NAKDLVRRMLDPDPKRRLTAQQVLEHPWLQNAKKAPNVSLGETVRARLQQFSVMNKFKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IK+MF  MD + NG +S EELK+GL  +G  +AD DVQ+LM+AA
Sbjct  346   ALRVVAEHLSVEEVADIKDMFEKMDINSNGKISLEELKNGLHRLGHQIADADVQILMEAA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G L+  EF+ +++HL  + ND++L KAF  FD++NSGYIE EEL++ L + D   
Sbjct  406   DVDGDGSLDYGEFVAVSIHLKKIGNDEHLRKAFAYFDQNNSGYIEIEELKNALAD-DLGP  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD  
Sbjct  465   NHEEVINAIIHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGC  524

Query  1698  VQ  1703
             +Q
Sbjct  525   LQ  526



>gb|EYU46253.1| hypothetical protein MIMGU_mgv1a004318mg [Erythranthe guttata]
Length=533

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/539 (61%), Positives = 414/539 (77%), Gaps = 18/539 (3%)
 Frame = +3

Query  99    MGACVSL---HSALTMKRPRNRRPIDPENVRGGGS-RTRAPRSQKISRQIRVLNESHNAT  266
             MG C +    HS    K+ RN +P +P ++  G S ++  P +  + +         + T
Sbjct  1     MGNCCATPPSHST-DAKKKRNNKP-NPFSIDYGASHKSNGPNNLVVLK---------DPT  49

Query  267   GDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiM  446
             G  I+ +Y+ G+ELGRGEFGVTYLCT+ ETGE +ACK ISK KLRT +D+EDVRREVEIM
Sbjct  50    GHNITARYDLGRELGRGEFGVTYLCTDIETGERLACKSISKKKLRTAVDIEDVRREVEIM  109

Query  447   RHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVI  626
             R +PKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAALV +TI+EV+
Sbjct  110   RRMPKHPNIVTLKDTYEDDSAVHIVMELCEGGELFDRIVARGHYTERAAALVMRTIVEVV  169

Query  627   QVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEV  806
             QVCH+ GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG++F EIVGSPYYMAPEV
Sbjct  170   QVCHQQGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEQFNEIVGSPYYMAPEV  229

Query  807   LRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAK  986
             L+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++AK
Sbjct  230   LKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNAK  289

Query  987   DLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLM  1166
             DLVK MLD +P  R+T  +VL H W+QN +  PNV LGE V  R+KQF++MNK KKR L 
Sbjct  290   DLVKKMLDPDPSRRLTARQVLEHSWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKRALR  349

Query  1167  VVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVD  1346
             VVAE+LS ++   IKE F MMD+ K G ++ EELK GL  +G  ++D D+Q+LM+AADVD
Sbjct  350   VVAEHLSVEEAAGIKEAFDMMDSGKRGKVNLEELKVGLQKLGHQISDPDIQILMEAADVD  409

Query  1347  GNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN-  1523
             G+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SGYIE EELRD L   D+DN N 
Sbjct  410   GDGTLNYGEFVAVLVHLRKMANDEHLHKAFAFFDRNRSGYIEIEELRDAL--SDEDNANS  467

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             ++V+  I+ D D DKDGRISF EF  MM  GTDW+ ASR+YS+   N+LS++L KD SV
Sbjct  468   EEVISAIMHDVDTDKDGRISFEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLIKDGSV  526



>ref|XP_007015067.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao]
 gb|EOY32686.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao]
Length=532

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/491 (65%), Positives = 400/491 (81%), Gaps = 4/491 (1%)
 Frame = +3

Query  231   QIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTei  410
             ++RVL E    TG  IS +Y+ G+ELGRGEFGVTYLCT+  +G+  ACK ISK KLRT +
Sbjct  43    KLRVLKEP---TGHDISAQYDLGRELGRGEFGVTYLCTDVSSGDKFACKSISKKKLRTAV  99

Query  411   dvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERA  590
             D+EDVRREV+IM+HLPKHPNIVS K+ YED +AV++VMELCEGGELFDRIVA+GHYTERA
Sbjct  100   DIEDVRREVQIMKHLPKHPNIVSLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERA  159

Query  591   AALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKE  770
             AA V +TI+EV+Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF E
Sbjct  160   AAGVMRTIVEVVQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNE  219

Query  771   IVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFK  950
             IVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFK
Sbjct  220   IVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFK  279

Query  951   RDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQF  1130
             RDPWPK+S++AKDLV+ ML+ +P  R+T +EVL H W+QNA+  PNVPLGE V  R+KQF
Sbjct  280   RDPWPKVSDNAKDLVRKMLNPDPKQRLTAQEVLEHPWLQNAKKAPNVPLGETVKARLKQF  339

Query  1131  TLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADH  1310
             ++MNK KKR L V+AE+LS ++V  IKE F MMDT K G ++ +EL+ GL  +GQ + D 
Sbjct  340   SVMNKLKKRALRVIAEHLSLEEVAGIKEAFKMMDTRKQGKINLDELRMGLQKLGQQIPDA  399

Query  1311  DVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRD  1490
             D+Q+LM+AADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD + SGY+E E+LRD
Sbjct  400   DLQILMEAADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFAFFDLNKSGYLEIEDLRD  459

Query  1491  YLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNAL  1670
              L + + D  +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+L
Sbjct  460   ALND-EVDTSSEEVIDAIMHDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSL  518

Query  1671  SVRLFKDKSVQ  1703
             S++L +D S+Q
Sbjct  519   SLKLMRDGSLQ  529



>ref|XP_010257203.1| PREDICTED: calcium-dependent protein kinase 8-like [Nelumbo nucifera]
Length=535

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/535 (61%), Positives = 412/535 (77%), Gaps = 10/535 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C +   +++ K+ R ++  +P +    GS +          ++ VL    + TG  I
Sbjct  1     MGNCCTTTGSISGKK-RGKKKQNPFSADYAGSYSSGG-----GNKLSVLK---DPTGRDI  51

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
                YE G+ELGRGEFG+TYLCT+K +G+  ACK ISK KLRT +D+EDVRREVEIM+HLP
Sbjct  52    GSTYELGRELGRGEFGITYLCTDKSSGQQFACKSISKKKLRTAVDIEDVRREVEIMKHLP  111

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VT+TI+EV+Q+CH
Sbjct  112   KHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTRTIVEVVQMCH  171

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             KHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPEVL+R+
Sbjct  172   KHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKRN  231

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++AKDLVK
Sbjct  232   YGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNAKDLVK  291

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD +P  RMT +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L V+AE
Sbjct  292   RMLDPDPKRRMTAQEVLDHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVMAE  351

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
              LS ++V  IKE F MMDT   G ++ ++LK GL  +GQ + D D+Q+LM+AADVD +G 
Sbjct  352   FLSVEEVAGIKEAFQMMDTGNCGKINLDQLKVGLQKLGQQIPDPDLQILMEAADVDRDGY  411

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             L+  EF+ ++VHL  ++ND++L KAF  FD++ SGYIE EELR+ L + +  N N++V+ 
Sbjct  412   LDYGEFVAVSVHLRKMANDEHLRKAFDFFDQNQSGYIEIEELREALADEEGAN-NEEVIN  470

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L KD S+Q
Sbjct  471   AIINDVDTDKDGRISYEEFTAMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQ  525



>ref|XP_010912114.1| PREDICTED: calcium-dependent protein kinase 8-like [Elaeis guineensis]
Length=550

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/497 (65%), Positives = 403/497 (81%), Gaps = 2/497 (0%)
 Frame = +3

Query  213   SQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKS  392
             S   +  + VL   H+++ D +  ++  G ELGRGEFGVT  C++  TGE++ACK ISK 
Sbjct  53    SSGTASPVSVLRGPHSSSADFL-HRFRLGAELGRGEFGVTRRCSDAATGETLACKSISKR  111

Query  393   KLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKG  572
             KLRT IDV DVRRE+EIMR LP+HPNIV  +E YED EAV+LVME+CEGGELFDRIVA+G
Sbjct  112   KLRTIIDVSDVRREIEIMRGLPEHPNIVRLREAYEDAEAVHLVMEICEGGELFDRIVARG  171

Query  573   HYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP  752
             HYTERAAA++ KTI+EV+Q+CHKHGVIHRDLKPENFL+AN +E+APLKAIDFGLS+FFKP
Sbjct  172   HYTERAAAIIFKTIVEVVQICHKHGVIHRDLKPENFLFANESEDAPLKAIDFGLSVFFKP  231

Query  753   GQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVR  932
             GQRF E+VGSPYYMAPEVL+++YG EVDVWSAGVILYILLCGVPPFWAET+EGIA AI+R
Sbjct  232   GQRFSEVVGSPYYMAPEVLKQNYGPEVDVWSAGVILYILLCGVPPFWAETDEGIAQAIIR  291

Query  933   GDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVT  1112
               IDF+R+PWP +S  AKDLV+ MLD NP +R+T ++VL H W+QNA T PNV LGE V 
Sbjct  292   SVIDFEREPWPMVSSKAKDLVRQMLDPNPNTRLTAQQVLEHPWLQNANTAPNVSLGEIVR  351

Query  1113  TRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG  1292
              R+KQF+ MNKFKK+ L VVA+ L  ++V S+K+MFHMMD DKNG+L+FEELK+GL + G
Sbjct  352   ARLKQFSAMNKFKKKALRVVAKQLPVEEVTSLKQMFHMMDKDKNGHLTFEELKEGLHING  411

Query  1293  QPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIE  1472
             + V + D+Q+LM+AAD DGNG L+CEEF+T+++HL  +S++++L +AF  FDKD SG+IE
Sbjct  412   ERVPEPDLQMLMEAADTDGNGTLDCEEFVTVSLHLKKVSSEEHLAQAFNFFDKDGSGFIE  471

Query  1473  FEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSK  1652
              EELR+ L E  D   N+QV+ EII D D DKDGRISF EF+ MM TG+DW+ ASR+YS+
Sbjct  472   VEELREALGE-GDLGPNEQVIWEIISDVDKDKDGRISFQEFELMMKTGSDWRNASRQYSR  530

Query  1653  VMLNALSVRLFKDKSVQ  1703
               L+ALS RL K  S++
Sbjct  531   QALSALSCRLLKYGSMK  547



>ref|XP_008227350.1| PREDICTED: calcium-dependent protein kinase 8-like [Prunus mume]
Length=533

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/480 (65%), Positives = 391/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  IS +Y+ G+ELGRGEFG+TYLCTE  +GE  ACK ISK KLRT +D+EDVRREVEI
Sbjct  49    TGRDISVQYDLGRELGRGEFGITYLCTEASSGEKFACKSISKKKLRTAVDIEDVRREVEI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP HPNIV+ K+ YED+EAV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+EV
Sbjct  109   MRHLPPHPNIVTLKDTYEDEEAVHIVMELCEGGELFDRIVARGHYTERAAASVMRTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKP ++F EIVGSPYYMAPE
Sbjct  169   VQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPDEQFNEIVGSPYYMAPE  228

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  229   VLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDNA  288

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R+KQF++MNK KKR L
Sbjct  289   KDLVKKMLDPDPKKRLTAQEVLDHPWIQNAKKAPNVPLGETVRARLKQFSIMNKLKKRAL  348

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++V  IKE F MMDT   G ++ EEL+ G+  +GQ + D D+Q+LM+AADV
Sbjct  349   GVIAEHLSVEEVAGIKEAFQMMDTGNKGKVTIEELRSGIQQLGQQIPDPDLQILMEAADV  408

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ + VHL  ++NDD+LHKAF  FD++ SG+IE EELR+ L + D D   
Sbjct  409   DGDGALNYGEFVAVTVHLKRMANDDHLHKAFAFFDQNQSGFIEIEELRNALND-DVDAGG  467

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S+Q
Sbjct  468   EEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSLQ  527



>ref|XP_008776719.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Phoenix dactylifera]
Length=547

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/488 (66%), Positives = 398/488 (82%), Gaps = 2/488 (0%)
 Frame = +3

Query  240   VLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidve  419
             VL   H++  + + +++  G ELGRGEFGVT  C +  TGE++ACK ISK KLRT IDV 
Sbjct  60    VLRGPHSSAAEFL-RRFRLGVELGRGEFGVTRRCCDAATGETLACKSISKRKLRTTIDVS  118

Query  420   dvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAAL  599
             DVRRE+EIMR LP+HPNIV  +E YED EAV+LVME+CEGGELFDRIVA+GHYTERAAA+
Sbjct  119   DVRREIEIMRCLPEHPNIVQLREAYEDGEAVHLVMEICEGGELFDRIVARGHYTERAAAI  178

Query  600   VTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVG  779
             + KTI EV+Q+CHKHGVIHRDLKPENFL+AN +E+APLKAIDFGLS+FFKPGQRF E+VG
Sbjct  179   IFKTIGEVVQICHKHGVIHRDLKPENFLFANESEDAPLKAIDFGLSVFFKPGQRFSEVVG  238

Query  780   SPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDP  959
             SPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAET+EGI  AI+R  IDF+R+P
Sbjct  239   SPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETDEGITQAIIRSVIDFEREP  298

Query  960   WPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLM  1139
             WP +S+ AKDLV+ MLD NP +R+T ++VL H W+QNA T PNV LGE V  R+KQF+ M
Sbjct  299   WPMVSDKAKDLVRHMLDPNPNTRLTAQQVLEHPWLQNANTAPNVSLGEIVRARLKQFSAM  358

Query  1140  NKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQ  1319
             NKFKK+ L VVAE L  ++V S+K+MFHMMD DKNG+L+FEELK+GL + G+ V + D+Q
Sbjct  359   NKFKKKALRVVAEQLPVEEVTSLKQMFHMMDKDKNGHLTFEELKEGLHINGERVPEPDLQ  418

Query  1320  LLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLL  1499
             +LM+AAD DGNG L+CEEF+T+++HL  +++++ L +AF  FDKD SG+IE EELR+ L 
Sbjct  419   MLMEAADTDGNGTLDCEEFVTVSLHLKKVNSEERLAEAFNFFDKDGSGFIEVEELREALG  478

Query  1500  EIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVR  1679
             E  D   N+QV+ EII D D DKDGRISF EF+ MM TG+DW+ ASR+YS+  L+ LS R
Sbjct  479   E-GDLGPNEQVIWEIISDVDKDKDGRISFQEFELMMKTGSDWRNASRQYSRQALSTLSRR  537

Query  1680  LFKDKSVQ  1703
             LFKD S++
Sbjct  538   LFKDGSMK  545



>ref|XP_010453327.1| PREDICTED: calcium-dependent protein kinase 7 [Camelina sativa]
 ref|XP_010453328.1| PREDICTED: calcium-dependent protein kinase 7 [Camelina sativa]
 ref|XP_010453329.1| PREDICTED: calcium-dependent protein kinase 7 [Camelina sativa]
Length=535

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/535 (60%), Positives = 408/535 (76%), Gaps = 5/535 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C    S+ T    +  +P +  N       T   RS     ++ VL    N TG  I
Sbjct  1     MGNCCGNPSSAT-SESKQGKPKNKSNPFYSNEYTATDRS-GAGFKLSVLK---NPTGHDI  55

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
             S +Y+ G+E+GRGEFG+TYLCT+KETG+  ACK ISK KLRT +D+EDVRREVEIM+H+P
Sbjct  56    SLQYDLGREVGRGEFGITYLCTDKETGDKYACKSISKKKLRTAVDIEDVRREVEIMKHMP  115

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPN+VS K+ +ED + V++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV+Q+CH
Sbjct  116   KHPNVVSLKDAFEDDDDVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICH  175

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             K GV+HRDLKPENFL+AN  E APLKAIDFGLSIFFKPG++F EIVGSPYYMAPEVLRR+
Sbjct  176   KQGVMHRDLKPENFLFANKKETAPLKAIDFGLSIFFKPGEQFNEIVGSPYYMAPEVLRRN  235

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+ AKDLV+
Sbjct  236   YGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDSAKDLVR  295

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R+T  +VL H WI NA+  PNV LGE V  R+KQF++MNK KKR L V+AE
Sbjct  296   KMLEPDPRKRLTAAQVLEHSWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAE  355

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             +LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DVDG+G 
Sbjct  356   HLSVEEAAGIKEAFEMMDVNKRGKINLEELKVGLQKAGQQIADADLQILMEATDVDGDGT  415

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  DD  +++V+ 
Sbjct  416   LNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELREALNDELDDTSSEEVIA  475

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  476   AIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  530



>ref|XP_008796072.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Phoenix dactylifera]
Length=532

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/482 (65%), Positives = 391/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFG+TYLCT+KETG   ACK ISK KLRT +D+EDVRREV
Sbjct  46    DPTGRDIENRYELGRELGRGEFGITYLCTDKETGGLFACKSISKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP+HPNIVS K+ YED++A++LVMELCEGGELFDRIVA+GHYTERAAA+VT+TI+
Sbjct  106   EIMRHLPRHPNIVSLKDTYEDEDAIHLVMELCEGGELFDRIVARGHYTERAAAVVTRTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  166   EVVQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGECFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+   IDFKRDPWPK+S 
Sbjct  226   PEVLKRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIHSVIDFKRDPWPKVSN  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNVPLGE V  R++QF++MNKFKKR
Sbjct  286   NAKDLVRQMLDPDPKRRLTAQQVLEHPWLQNAKKAPNVPLGETVRARLQQFSVMNKFKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IKEMF  MD   NG ++ EELK G   +G  +AD DVQ+LM+AA
Sbjct  346   ALRVVAEHLSVEEVADIKEMFEKMDVKGNGRITLEELKSGFHRLGHQIADADVQILMEAA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDGNG L+  EF+ +++H+  + ND++L KAF  FD++NSGYIE EELR+ L + D   
Sbjct  406   DVDGNGALDYGEFVAVSIHVKKMGNDEHLCKAFSYFDQNNSGYIEIEELRNALAD-DLGP  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L  D S
Sbjct  465   NHEEVINAIICDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMMDGS  524

Query  1698  VQ  1703
             +Q
Sbjct  525   LQ  526



>ref|XP_010930196.1| PREDICTED: calcium-dependent protein kinase 7 isoform X1 [Elaeis 
guineensis]
Length=526

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/536 (61%), Positives = 417/536 (78%), Gaps = 14/536 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDP-ENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C S  S    K+PRN R + P   V     R   P        I VL +S  AT   
Sbjct  1     MGNCCSAPS--NNKKPRNLRCLSPISTVDDDKGRPITP--------ITVLPDSKAATD--  48

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             +  +YE GKELGRGEFGVT  CT+ +TGE +ACK ISK KLRT +DVEDVRREVEIMR L
Sbjct  49    LPLRYELGKELGRGEFGVTRRCTDTKTGEVLACKSISKRKLRTCVDVEDVRREVEIMRGL  108

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             P HPNIV  ++ +EDKEAV+LVME+CEGGELFDRI+A+GHYTERAAA V +TI+EV+Q C
Sbjct  109   PAHPNIVQLRDAFEDKEAVHLVMEVCEGGELFDRIIARGHYTERAAATVMRTIMEVVQHC  168

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HK+GVIHRDLKPENFL+AN +ENAPLKAIDFGLS+FFKPG+ F EIVGSPYYMAPEVL+R
Sbjct  169   HKNGVIHRDLKPENFLFANQSENAPLKAIDFGLSVFFKPGESFNEIVGSPYYMAPEVLKR  228

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG +VDVWSAGVILYILLCGVPPFWAET+EGIA +I+R  I+ +R+PW K+S++AKDLV
Sbjct  229   NYGPQVDVWSAGVILYILLCGVPPFWAETDEGIAQSIIRSVINLEREPWSKVSQNAKDLV  288

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             + MLD NPY+R+T++EVL H W+QN +  P++PLGE V +R+ QF++MNKFKK+ L+VVA
Sbjct  289   RSMLDPNPYTRLTVQEVLRHPWLQNTKQAPDIPLGEAVRSRLNQFSVMNKFKKKALIVVA  348

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             E+L  ++V  IK+MFHMMD +K G L+ +ELK+G ++ G  + + D+ +LM+AAD+DGNG
Sbjct  349   EHLPVEEVADIKQMFHMMDINKKGKLTLDELKNGFNLTGHHMPEKDIDMLMEAADIDGNG  408

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
              LNCEEF+T+ +HL  + ++++L KAF  FDKD SGYIE +ELR+ L   D+ + NDQV+
Sbjct  409   HLNCEEFVTVCIHLKKIRSEEHLPKAFKHFDKDGSGYIEIDELREALGG-DELDANDQVI  467

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              +II D D DKDGRIS+ EF+ MM  GTDW+ ASR+YS+ + N LS+++FKD S++
Sbjct  468   LDIISDVDKDKDGRISYEEFEMMMKAGTDWRNASRQYSRAVFNTLSLKMFKDGSLK  523



>ref|XP_006289217.1| hypothetical protein CARUB_v10002666mg [Capsella rubella]
 gb|EOA22115.1| hypothetical protein CARUB_v10002666mg [Capsella rubella]
Length=534

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 389/482 (81%), Gaps = 0/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  IS +Y+ G+E+GRGEFG+TYLCT++ETGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    NPTGHDISLQYDLGREVGRGEFGITYLCTDRETGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPN+VS K+ +ED + V++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  108   EIMKHMPKHPNVVSLKDAFEDDDDVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIV  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK GV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  168   EVVQICHKQGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R+T  +VL H WI NA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   SAKDLVRKMLEPDPRKRLTAAQVLEHSWILNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A 
Sbjct  348   ALRVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADADLQILMEAT  407

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  DD 
Sbjct  408   DVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELREALNDELDDT  467

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              + +V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  468   SSQEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  527

Query  1698  VQ  1703
             +Q
Sbjct  528   LQ  529



>ref|XP_002873580.1| calmodulin-domain protein kinase 7 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49839.1| calmodulin-domain protein kinase 7 [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 391/482 (81%), Gaps = 0/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+E+GRGEFG+TYLCT+KETGE  ACK ISK KLRT +D+EDVRREV
Sbjct  49    DPTGHDISLQYDLGREVGRGEFGITYLCTDKETGEKYACKSISKKKLRTAVDIEDVRREV  108

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPN+VS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  109   EIMKHMPKHPNVVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIV  168

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  169   EVVQICHKQGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  228

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  229   PEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  288

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R+T  +VL H WI NA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  289   SAKDLVRKMLEPDPKKRLTAAQVLEHTWILNAKKAPNVSLGETVKARLKQFSVMNKLKKR  348

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A 
Sbjct  349   ALRVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADADLQILMEAT  408

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  D+ 
Sbjct  409   DVDGDGTLNYSEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELREALNDELDNT  468

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  469   SSEEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  528

Query  1698  VQ  1703
             +Q
Sbjct  529   LQ  530



>emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia]
Length=528

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 389/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  KY+ G+ELGRGEFGVTYLCTE +TG+  ACK ISK KLRT +D++DVRREVEI
Sbjct  45    TGQNIHDKYDLGRELGRGEFGVTYLCTEVDTGDKYACKSISKKKLRTAVDIDDVRREVEI  104

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLPKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA + +T++EV
Sbjct  105   MKHLPKHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAGILRTVVEV  164

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CH+HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  165   VQMCHRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  224

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++A
Sbjct  225   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNA  284

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T E VL H W+QN +  PNV LGE V  R+KQF++MNK KK+ L
Sbjct  285   KDLVKKMLDPDPSRRLTAERVLEHPWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKKAL  344

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE LS ++V  +++ F MMDT K G ++  ELKDGL  +G   +D D+Q+LM+AADV
Sbjct  345   TVIAEFLSAEEVAGMRDAFEMMDTGKKGQINLGELKDGLQKLGHQTSDVDLQILMEAADV  404

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR  L + +DDN +
Sbjct  405   DGDGSLNYAEFVAVSVHLRKMANDEHLHKAFSFFDKNQSGYIEIEELRCALSD-EDDNTS  463

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  464   EEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  523



>gb|KFK25522.1| calcium-dependent protein kinase 19 [Arabis alpina]
Length=535

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 391/482 (81%), Gaps = 0/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG+ IS +Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  49    NPTGNDISLQYDLGREVGRGEFGITYLCTDIQTGEKYACKSISKKKLRTAVDIEDVRREV  108

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  109   EIMKHMPKHPNIVTLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIV  168

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  169   EVVQICHKQGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  228

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  229   PEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  288

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R+T  EVL H WI NA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  289   SAKDLVRKMLEPDPKKRLTAAEVLEHSWILNAKKAPNVSLGETVKARLKQFSVMNKLKKR  348

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A 
Sbjct  349   ALRVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADADLQILMEAT  408

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  DD 
Sbjct  409   DVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELREALNDELDDT  468

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L KD S
Sbjct  469   SSEEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMKDGS  528

Query  1698  VQ  1703
             ++
Sbjct  529   LK  530



>ref|XP_006838340.1| hypothetical protein AMTR_s00103p00151780 [Amborella trichopoda]
 gb|ERN00909.1| hypothetical protein AMTR_s00103p00151780 [Amborella trichopoda]
Length=530

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/482 (65%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+ +Y+ G+ELGRGEFG+TYLCT+++TGE +ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDIASRYDLGRELGRGEFGITYLCTDRDTGEVLACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
              IM HLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VT+TI+
Sbjct  107   AIMGHLPKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  167   EVVQLCHKHGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEHFSEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  227   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AK+LVK ML+ +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  287   NAKNLVKRMLEPDPKLRLTAQEVLDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE LS ++   IK+ F MMD + NG ++FEELK GL  +GQ   D DVQ+LM+AA
Sbjct  347   ALRVIAEFLSVEEAAGIKDTFQMMDINNNGKITFEELKVGLQKIGQQAQDADVQMLMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D DG+G LN  EF+ +++HL  + NDD+L KAFL FD++ SGYIE EELRD L +   DN
Sbjct  407   DADGDGTLNYAEFVAVSIHLRKIGNDDHLRKAFLYFDQNQSGYIEIEELRDSLADDLADN  466

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+    +LS++L +D S
Sbjct  467   -CEEVINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFTSLSLKLLQDGS  525

Query  1698  VQ  1703
             +Q
Sbjct  526   LQ  527



>ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus]
 gb|KGN66491.1| hypothetical protein Csa_1G614120 [Cucumis sativus]
Length=531

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/482 (65%), Positives = 393/482 (82%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G ELGRGEFGVTYLCT++ TGE +ACK ISK KLRT +D++DVRREV
Sbjct  45    DPTGRDISALYDLGSELGRGEFGVTYLCTDRNTGEKLACKSISKKKLRTAVDIDDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM++LPKHPNIVS ++ YED++AV++VMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  105   EIMKNLPKHPNIVSLRDTYEDEQAVHIVMELCEGGELFDRIVARGHYTERAAAVVMRTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK+GV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVVQMCHKNGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP +S+
Sbjct  225   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPIVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  285   NAKDLVKKMLDPDPKKRLTAQEVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F MMDT K G ++ +EL+ GL  +GQ + D D+Q+L++AA
Sbjct  345   ALRVIAEHLSVEEVAGIKEAFEMMDTGKRGKINLDELRVGLQKLGQQIPDPDLQILVEAA  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR+ L + DD+ 
Sbjct  405   DLDGDGTLNYSEFVAVSVHLKKMANDEHLHKAFSFFDKNQSGYIEIEELRNALND-DDET  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               + VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  464   NGEDVVNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  523

Query  1698  VQ  1703
             + 
Sbjct  524   LH  525



>ref|XP_003562873.1| PREDICTED: calcium-dependent protein kinase 8-like [Brachypodium 
distachyon]
Length=538

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/480 (65%), Positives = 394/480 (82%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I+ +YE G ELGRGEFGVTYLCT++ TGE++ACK ISK KLRT +D+EDVRREVEI
Sbjct  56    TGRDIAARYELGGELGRGEFGVTYLCTDRATGEALACKSISKKKLRTAVDIEDVRREVEI  115

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPNIV+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+EV
Sbjct  116   MRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIVEV  175

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FF PG+RF EIVGSPYYMAPE
Sbjct  176   VQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFTPGERFTEIVGSPYYMAPE  235

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  236   VLKRNYGQEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAIDFKRDPWPRVSDNA  295

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+GML+ +P  R+T ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK  L
Sbjct  296   KDLVRGMLNPDPKRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHAL  355

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++V  IK+MF  MD +K+  ++F+ELK GL+ +G  + D DVQ+LMDAAD 
Sbjct  356   RVIAEHLSVEEVAGIKDMFEKMDLNKDSMINFDELKLGLNKLGHQMPDADVQILMDAADA  415

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+  EF+TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D  + +
Sbjct  416   DGNGCLDYGEFVTLSVHLKKIGNDEHLHKAFAYFDRNKSGYIEIDELRESLAD-DLGHNH  474

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDG+ISF EF AMM  GTDW+ ASR+YS+    +LS++L KD S+Q
Sbjct  475   EEVINAIIRDVDTDKDGKISFDEFVAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQ  534



>emb|CDX97205.1| BnaC09g44200D [Brassica napus]
Length=535

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 388/480 (81%), Gaps = 0/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  IS +Y+ G+E+GRGEFGVTYLCT+ +TGE  ACK ISK KLRT +D+ DVRREVEI
Sbjct  51    TGHDISSQYDLGREVGRGEFGVTYLCTDIQTGEKYACKSISKKKLRTAVDIGDVRREVEI  110

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRH+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  111   MRHMPKHPNIVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEV  170

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHK GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  171   VQICHKQGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEQFNEIVGSPYYMAPE  230

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI++  IDFKRDPWP++SE A
Sbjct  231   VLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIKSVIDFKRDPWPRVSESA  290

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ ML+ +P  R++  EVL H WI NA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  291   KDLVRKMLEPDPKKRLSAAEVLEHTWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  350

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DV
Sbjct  351   RVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADADLQILMEATDV  410

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  D+  +
Sbjct  411   DGDGTLNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIETEELREALNDELDETSS  470

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  471   EEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  530



>ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
8-like [Cucumis sativus]
Length=530

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/482 (65%), Positives = 393/482 (82%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G ELGRGEFGVTYLCT++ TGE +ACK ISK KLRT +D++DVRREV
Sbjct  44    DPTGRDISALYDLGSELGRGEFGVTYLCTDRNTGEKLACKSISKKKLRTAVDIDDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM++LPKHPNIVS ++ YED++AV++VMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  104   EIMKNLPKHPNIVSLRDTYEDEQAVHIVMELCEGGELFDRIVARGHYTERAAAVVMRTIV  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK+GV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  164   EVVQMCHKNGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP +S+
Sbjct  224   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPIVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  284   NAKDLVKKMLDPDPKKRLTAQEVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F MMDT K G ++ +EL+ GL  +GQ + D D+Q+L++AA
Sbjct  344   ALRVIAEHLSVEEVAGIKEAFEMMDTGKRGKINLDELRVGLQKLGQQIPDPDLQILVEAA  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR+ L + DD+ 
Sbjct  404   DLDGDGTLNYSEFVAVSVHLKKMANDEHLHKAFSFFDKNQSGYIEIEELRNALND-DDET  462

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               + VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  463   NGEDVVNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  522

Query  1698  VQ  1703
             + 
Sbjct  523   LH  524



>ref|XP_009414742.1| PREDICTED: calcium-dependent protein kinase 7 [Musa acuminata 
subsp. malaccensis]
Length=530

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/483 (66%), Positives = 386/483 (80%), Gaps = 3/483 (1%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I  +YE  +ELGRGEFGVTYLCT+K TG   ACK ISK KLRT +D+EDVRREV
Sbjct  44    NPTGRDIGSQYELAQELGRGEFGVTYLCTDKATGHHYACKSISKKKLRTAVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH P HPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  104   EIMRHFPSHPNIVSLKDTYEDDGAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTII  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQVCHKHGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  164   EVIQVCHKHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGEHFSEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFW+ETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  224   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWSETEQGVAQAILRSSIDFKRDPWPKVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ MLD +P  R T ++VL H W+QNA+  PNV LGE V  R++QF++MNKFKK+
Sbjct  284   SAKDLVRHMLDPDPKQRFTAQQVLDHSWLQNAKKAPNVNLGETVRARLQQFSVMNKFKKK  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE LS ++   IK+MF  MD +KNG ++FEELK GL  +G  ++D DVQ+LM+A 
Sbjct  344   ALRVVAEYLSVEEAADIKDMFDKMDINKNGKINFEELKLGLHKLGHQISDADVQILMEAG  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ +++HL  + ND++LHKAF  FD++ SGYIE EEL+D L  +DD  
Sbjct  404   DVDGSGTLNYGEFVAVSIHLRKIGNDEHLHKAFSYFDQNKSGYIEIEELKDSL--VDDLG  461

Query  1518  KN-DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
              N ++V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   ++LS +L KD 
Sbjct  462   PNHEEVIDAIIRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFSSLSSKLMKDG  521

Query  1695  SVQ  1703
             S+Q
Sbjct  522   SLQ  524



>ref|XP_009121835.1| PREDICTED: calcium-dependent protein kinase 7 [Brassica rapa]
 ref|XP_009121836.1| PREDICTED: calcium-dependent protein kinase 7 [Brassica rapa]
 emb|CDY53966.1| BnaA10g29980D [Brassica napus]
Length=532

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/540 (59%), Positives = 409/540 (76%), Gaps = 18/540 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMK----RPRNRR-PIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNA  263
             MG C    S+ T++    +P+N+  P       G G+            ++ VL    + 
Sbjct  1     MGNCCGSPSSATIESGHGKPKNKNNPFHSNEANGSGA----------GFKLSVLK---DP  47

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  IS +Y+ G+E+GRGEFGVTYLCT+ +TG+  ACK ISK KLRT +D+ DVRREVEI
Sbjct  48    TGHDISSQYDLGREVGRGEFGVTYLCTDIQTGDKYACKSISKKKLRTAVDIGDVRREVEI  107

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRH+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  108   MRHMPKHPNIVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEV  167

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHK GV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  168   VQICHKQGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPE  227

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE A
Sbjct  228   VLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSESA  287

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ ML+ +P  R++  EVL H WI NA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  288   KDLVRKMLEPDPKKRLSAAEVLEHTWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  347

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DV
Sbjct  348   RVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADADLQILMEATDV  407

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR+ L +  D+  +
Sbjct  408   DGDGTLNYGEFVAVSVHLKKMANDEHLHKAFNFFDKNQSGYIEPEELREALNDELDETSS  467

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  468   EEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  527



>ref|XP_006657859.1| PREDICTED: calcium-dependent protein kinase 8-like [Oryza brachyantha]
Length=552

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/504 (64%), Positives = 402/504 (80%), Gaps = 8/504 (2%)
 Frame = +3

Query  192   SRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVA  371
             +R+ AP   ++     VL E    TG  I  +YE G ELGRGEFGVTYLCTE+ETG++ A
Sbjct  52    NRSSAPSGPRLV----VLREP---TGRDIGARYELGGELGRGEFGVTYLCTERETGDAYA  104

Query  372   CKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELF  551
             CK ISK KLRT +D+EDVRREV+IMRHLPKHPNIV+ ++ YED  AV+LVMELCEGGELF
Sbjct  105   CKSISKKKLRTAVDIEDVRREVDIMRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELF  164

Query  552   DRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFG  731
             DRIVA+GHYTERAAALVT+TI+EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFG
Sbjct  165   DRIVARGHYTERAAALVTRTIVEVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFG  224

Query  732   LSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEG  911
             LS+FF PG+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G
Sbjct  225   LSVFFTPGERFTEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQG  284

Query  912   IAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNV  1091
             +A AI+R  IDFKRDPWP++S++AKDLVKGML+ +P  R+  ++VL H W+QN +  PNV
Sbjct  285   VAQAIIRSAIDFKRDPWPRVSDNAKDLVKGMLNPDPRRRLNAQQVLDHPWLQNIKKAPNV  344

Query  1092  PLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELK  1271
              LGE V  R++QF++MNKFKK  L V+AE+LS ++V  IK+MF  MD +K+  ++F+ELK
Sbjct  345   NLGETVKARLQQFSVMNKFKKHALRVIAEHLSVEEVAGIKDMFEKMDLNKDNMINFDELK  404

Query  1272  DGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDK  1451
              GL  +G  +AD DVQ+LMDAADVDGNG L+  EF+TL+VHL  + ND++LHKAF  FD+
Sbjct  405   LGLHKLGHQMADADVQILMDAADVDGNGSLDYGEFVTLSVHLRKIGNDEHLHKAFAYFDR  464

Query  1452  DNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKM  1631
             + SGYIE +ELR+ L + D    +++V+  II D D DKDG+IS+ EF AMM  GTDW+ 
Sbjct  465   NKSGYIEIDELRESLAD-DLGANHEEVINAIIRDVDTDKDGKISYDEFAAMMKAGTDWRK  523

Query  1632  ASRKYSKVMLNALSVRLFKDKSVQ  1703
             ASR+YS+    +LS++L KD S+Q
Sbjct  524   ASRQYSRERFTSLSLKLQKDGSLQ  547



>emb|CDX72022.1| BnaC08g28520D [Brassica napus]
Length=540

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 393/482 (82%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS+KY+ G+ELGRGEFGVTYLCT+KET E  ACK I K KLRT +D+EDVRREV
Sbjct  55    DPTGREISQKYKLGRELGRGEFGVTYLCTDKETEEVFACKSILKKKLRTAVDIEDVRREV  114

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTER AA+VTKTI+
Sbjct  115   EIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERDAAVVTKTIM  174

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E+APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  175   EVVQVCHKHGVMHRDLKPENFLFANNKESAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  234

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  ++F+RDPWPK+SE
Sbjct  235   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVALAIIRSQLNFRRDPWPKVSE  294

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  295   NAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTIMNKLKKR  354

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT++ G ++ +ELK GL  +G  V   D+Q+LMDA 
Sbjct  355   ALRVIAEHLSDEEASGIREGFQIMDTNQRGKINIDELKIGLQKLGHAVPQDDLQILMDAG  414

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  415   DIDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  472

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV+ II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S +L +D S
Sbjct  473   TSEEVVEAIIRDVDTDKDGRISYEEFATMMKTGTDWRKASRQYSRERFNSISQKLMQDAS  532

Query  1698  VQ  1703
             + 
Sbjct  533   LH  534



>emb|CDY06098.1| BnaA09g36820D [Brassica napus]
Length=541

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 393/482 (82%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS+KY+ G+ELGRGEFGVTYLCT+KET E  ACK I K KLRT +D+EDVRREV
Sbjct  56    DPTGREISQKYKLGRELGRGEFGVTYLCTDKETEEVFACKSILKKKLRTAVDIEDVRREV  115

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+
Sbjct  116   EIMRHMPEHPNVVTLKETYEDEIAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIM  175

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  176   EVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  235

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  ++F+RDPWPK+SE
Sbjct  236   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVALAIIRSQLNFRRDPWPKVSE  295

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  296   NAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  355

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT++ G ++ +ELK GL  +G  V   D+Q+LMDA 
Sbjct  356   ALRVIAEHLSDEEASGIREGFQIMDTNQRGKINIDELKIGLQKLGHAVPQDDLQILMDAG  415

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  416   DIDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  473

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV+ II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S +L +D S
Sbjct  474   TSEEVVEAIIRDVDTDKDGRISYEEFATMMKTGTDWRKASRQYSRERFNSISQKLMQDAS  533

Query  1698  VQ  1703
             + 
Sbjct  534   LH  535



>emb|CDY33817.1| BnaCnng07350D [Brassica napus]
Length=538

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/481 (64%), Positives = 387/481 (80%), Gaps = 2/481 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I +KY  G+ELGRGEFGVTYLCT+KETGE +ACK I K KLRT +D+EDVRRE 
Sbjct  53    DPTGREIEQKYTLGRELGRGEFGVTYLCTDKETGEVLACKSILKKKLRTAVDIEDVRREA  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  113   EIMRHMPEHPNLVTLKETYEDEYAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTII  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSQLDFRRDPWPKVSE  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDL++ MLD +   R+T ++VL H W+QNA T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   HAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNANTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHNIPQDDIQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  413   DTDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  471   TSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  530

Query  1698  V  1700
             +
Sbjct  531   L  531



>gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus]
Length=532

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/540 (59%), Positives = 409/540 (76%), Gaps = 18/540 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMK----RPRNRR-PIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNA  263
             MG C    S+ T++    +P+N+  P       G G+            ++ VL    + 
Sbjct  1     MGNCCGSPSSATIESGHGKPKNKNNPFHSNEANGSGA----------GFKLSVLK---DP  47

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  IS +Y+ G+E+GRGEFGVTYLCT+ +TG+  ACK ISK KLRT +D+ DVRREVEI
Sbjct  48    TGHDISSQYDLGREVGRGEFGVTYLCTDIQTGDKYACKSISKKKLRTAVDIGDVRREVEI  107

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRH+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  108   MRHMPKHPNIVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEV  167

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHK GV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  168   VQICHKQGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPE  227

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE A
Sbjct  228   VLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSESA  287

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ ML+ +P  R++  EVL H WI NA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  288   KDLVRKMLEPDPKKRLSAAEVLEHTWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  347

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DV
Sbjct  348   RVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADADLQILMEATDV  407

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  D+  +
Sbjct  408   DGDGTLNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIETEELREALNDELDETSS  467

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  468   EEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  527



>ref|NP_001060031.1| Os07g0568600 [Oryza sativa Japonica Group]
 dbj|BAC83205.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21945.1| Os07g0568600 [Oryza sativa Japonica Group]
 gb|EAZ40349.1| hypothetical protein OsJ_24795 [Oryza sativa Japonica Group]
Length=550

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/504 (63%), Positives = 402/504 (80%), Gaps = 8/504 (2%)
 Frame = +3

Query  192   SRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVA  371
             +R+ AP   ++     VL E    TG  I+ +YE G ELGRGEFGVTYLCTE+ETG++ A
Sbjct  50    NRSSAPSGHRLV----VLREP---TGRDIAARYELGGELGRGEFGVTYLCTERETGDAYA  102

Query  372   CKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELF  551
             CK ISK KLRT +D+EDVRREV+IMRHLPKHPNIV+ ++ YED  AV+LVMELCEGGELF
Sbjct  103   CKSISKKKLRTAVDIEDVRREVDIMRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELF  162

Query  552   DRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFG  731
             DRIVA+GHYTERAAALVT+TI+EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFG
Sbjct  163   DRIVARGHYTERAAALVTRTIVEVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFG  222

Query  732   LSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEG  911
             LS+FF PG+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G
Sbjct  223   LSVFFTPGERFTEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQG  282

Query  912   IAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNV  1091
             +A AI+R  IDFKRDPWP++S++AKDLVKGML+ +P  R+  ++VL H W+QN +  PNV
Sbjct  283   VAQAIIRSVIDFKRDPWPRVSDNAKDLVKGMLNPDPRRRLNAQQVLDHPWLQNIKKAPNV  342

Query  1092  PLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELK  1271
              LGE V  R++QF++MNKFKK  L V+AE+LS ++V  IK+MF  MD +K+  ++F+ELK
Sbjct  343   NLGETVKARLQQFSVMNKFKKHALRVIAEHLSVEEVAGIKDMFEKMDLNKDNMINFDELK  402

Query  1272  DGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDK  1451
              GL  +G  +AD DVQ+LMDAADVDGNG L+  EF+ L+VHL  + ND++LHKAF  FD+
Sbjct  403   LGLHKLGHQMADADVQILMDAADVDGNGSLDYGEFVALSVHLRKIGNDEHLHKAFAYFDR  462

Query  1452  DNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKM  1631
             + SGYIE +ELR+ L + D    +++V+  II D D DKDG+IS+ EF AMM  GTDW+ 
Sbjct  463   NQSGYIEIDELRESLAD-DLGANHEEVINAIIRDVDTDKDGKISYDEFAAMMKAGTDWRK  521

Query  1632  ASRKYSKVMLNALSVRLFKDKSVQ  1703
             ASR+YS+    +LS++L KD S+Q
Sbjct  522   ASRQYSRERFTSLSLKLQKDGSLQ  545



>gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=530

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/497 (64%), Positives = 396/497 (80%), Gaps = 4/497 (1%)
 Frame = +3

Query  213   SQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKS  392
             S  +  ++ VL    + TG  I ++YE G+ELGRGEFG+TYLCT+KET ++ ACK ISK 
Sbjct  33    SNGVQHKLTVLK---DPTGREIEQRYELGRELGRGEFGITYLCTDKETRDTFACKSISKK  89

Query  393   KLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKG  572
             KLRT +D+EDVRREV+IMRHLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+G
Sbjct  90    KLRTAVDIEDVRREVQIMRHLPKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARG  149

Query  573   HYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP  752
             HYTERAAA VTKTI+EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKP
Sbjct  150   HYTERAAAAVTKTIVEVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKP  209

Query  753   GQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVR  932
             G++F EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R
Sbjct  210   GEKFNEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIR  269

Query  933   GDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVT  1112
               IDFKRDPWPK+S++AKDLVK MLD +P  R+T ++VL H W+QNA+  PNV LGE V 
Sbjct  270   SVIDFKRDPWPKVSDNAKDLVKKMLDPDPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVK  329

Query  1113  TRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG  1292
              R+KQF++MNK KKR L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +G
Sbjct  330   ARLKQFSVMNKLKKRALRVIAEHLSVEEVAGIKEGFQLMDTSNKGKINIDELRIGLQKLG  389

Query  1293  QPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIE  1472
               + D D+Q+LM+A DVD +G L+  EF+T++VHL  + ND++L KAF  FDK+ SGYIE
Sbjct  390   HQITDTDLQILMEAGDVDRDGHLDYGEFVTISVHLRKMGNDEHLLKAFEFFDKNQSGYIE  449

Query  1473  FEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSK  1652
              EELRD L +  D+N +++++  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+
Sbjct  450   IEELRDALADEVDEN-SEEIINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSR  508

Query  1653  VMLNALSVRLFKDKSVQ  1703
                N LS++L KD S+Q
Sbjct  509   ERFNNLSLKLMKDGSLQ  525



>ref|XP_006402868.1| hypothetical protein EUTSA_v10005884mg [Eutrema salsugineum]
 gb|ESQ44321.1| hypothetical protein EUTSA_v10005884mg [Eutrema salsugineum]
Length=534

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
             ++ TG  I +KY  G+ELGRGEFGVTYLCT+KE G+ +ACK I K KLRT +D+EDVRRE
Sbjct  48    NDPTGREIEQKYTLGRELGRGEFGVTYLCTDKENGDVLACKSILKKKLRTAVDIEDVRRE  107

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI
Sbjct  108   VEIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTI  167

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             +EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYM
Sbjct  168   MEVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYM  227

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S
Sbjct  228   APEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFRRDPWPKVS  287

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             E+AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KK
Sbjct  288   ENAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKK  347

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             R L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA
Sbjct  348   RALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
              D D +G L+C+EFI ++VHL  + ND++L KAF  FD++N+GYIE EELR+ L   D+ 
Sbjct  408   GDNDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIEELREAL--SDEV  465

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D 
Sbjct  466   GTSEEVVDAIIRDVDTDKDGRISYEEFATMMKTGTDWRKASRQYSRERFNSISLKLMQDA  525

Query  1695  SVQ  1703
             S+Q
Sbjct  526   SLQ  528



>ref|XP_009769547.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana 
sylvestris]
Length=528

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/480 (65%), Positives = 388/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  KY+ G+ELGRGEFGVTYLCTE +TG+  ACK ISK KLRT +D++DVRREVEI
Sbjct  45    TGQNIHDKYDLGRELGRGEFGVTYLCTEVDTGDKYACKSISKKKLRTAVDIDDVRREVEI  104

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLPKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA + +T++EV
Sbjct  105   MKHLPKHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAGILRTVVEV  164

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CH+HGVIHRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+ F EIVGSPYYMAPE
Sbjct  165   VQMCHRHGVIHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGEHFNEIVGSPYYMAPE  224

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++A
Sbjct  225   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNA  284

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T E VL H W+QN +  PNV LGE V  R+KQF++MNK KK+ L
Sbjct  285   KDLVKKMLDPDPTRRLTAERVLEHPWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKKAL  344

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE LS ++V  +++ F MMDT K G ++  ELKDGL  +G   +D D+Q+LM+AADV
Sbjct  345   TVIAEFLSAEEVAGMRDAFEMMDTGKKGQVNLGELKDGLQKLGHQTSDVDLQILMEAADV  404

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR  L + +DDN +
Sbjct  405   DGDGSLNYAEFVAVSVHLRKMANDEHLHKAFSFFDKNQSGYIEIEELRCALSD-EDDNTS  463

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ S+Q
Sbjct  464   EEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGSLQ  523



>ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum lycopersicum]
Length=533

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 390/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I +KY+ G ELGRGEFGVTYLCT+ +TG+  ACK ISK KLRT +D++DVRREV
Sbjct  46    DPTGHNIQEKYDLGCELGRGEFGVTYLCTDVDTGDKYACKSISKKKLRTAVDIDDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA++ KTI+
Sbjct  106   EIMKHLPKHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAVIMKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  166   EVVQMCHMHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  226   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QN +  PNV LGE V  R+KQF++MNK KKR
Sbjct  286   NAKDLVKKMLDPDPTRRLTAQQVLEHTWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L ++AE LS ++V  +K+ F MMDT K G ++  ELK+GL  +G  + D D+Q+LM+AA
Sbjct  346   ALTIMAEFLSAEEVAGMKDAFDMMDTGKKGKINLGELKNGLQKLGHQIPDVDLQILMEAA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF +FD+D SGYIE EELR  L + D  N
Sbjct  406   DVDGDGSLNYGEFVAVSVHLRKMANDEHLHKAFSVFDRDQSGYIEIEELRSALSDEDGGN  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  466   -SEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  524

Query  1698  VQ  1703
             +Q
Sbjct  525   IQ  526



>ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase 32 isoform X1 [Sesamum 
indicum]
Length=530

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/482 (66%), Positives = 384/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I + YE G+ELGRGEFGVTYLCT+K TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  45    NPTGHNIEEFYELGRELGRGEFGVTYLCTDKTTGEVFACKSISKKKLRTRVDIEDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  105   EIMRHLPKHPNIVSLKDTYEDDHAVHLVMELCEGGELFDRIVARGHYTERAAAAVIRTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVI+ CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVIENCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  225   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLVK ML+ +P  R+T +EVL H WIQNA++ PNV LGE V  R+KQF++MNK KKR
Sbjct  285   RAKDLVKKMLNPDPKKRLTAQEVLDHPWIQNAKSAPNVSLGESVRARLKQFSMMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT   G +   EL+ GL  +G  + + D+Q+LM+A 
Sbjct  345   ALRVIAEHLSVEEVAGIKEGFQLMDTSNKGKIDINELRTGLHKLGHQIPEADLQVLMEAG  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+C EF+ ++VHL  + +DD+L KAF  FDK+ SGYIE EELR+ L   D+  
Sbjct  405   DVDKDGYLDCGEFVAISVHLRKMGSDDHLRKAFEFFDKNESGYIEIEELREAL--ADEAE  462

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              ++ V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L KD S
Sbjct  463   TSEDVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGS  522

Query  1698  VQ  1703
             +Q
Sbjct  523   LQ  524



>dbj|BAJ96261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/522 (61%), Positives = 409/522 (78%), Gaps = 6/522 (1%)
 Frame = +3

Query  138   KRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRG  317
             K P+ R+   P       +R+  P + ++     V+      TG  I+++YE G ELGRG
Sbjct  25    KEPKQRKGKKPNPFSIEYNRSAPPGASRL-----VVLRDPTGTGRDIAERYELGGELGRG  79

Query  318   EFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYE  497
             EFGVTYLCT+++T E++ACK ISK KLRT +D+EDVRREVEIMRHLPKHPNIV+ ++ YE
Sbjct  80    EFGVTYLCTDRDTREALACKSISKKKLRTAVDIEDVRREVEIMRHLPKHPNIVTLRDTYE  139

Query  498   DKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPEN  677
             D  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+EV+Q+CHKHGV+HRDLKPEN
Sbjct  140   DDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIVEVVQMCHKHGVMHRDLKPEN  199

Query  678   FLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVI  857
             FL+AN  E A LKAIDFGLS+FF PG+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVI
Sbjct  200   FLFANKKETAALKAIDFGLSVFFTPGERFTEIVGSPYYMAPEVLKRNYGQEVDVWSAGVI  259

Query  858   LYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTI  1037
             LYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++AKDLV+GML+ +P  R+T 
Sbjct  260   LYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDNAKDLVRGMLNPDPRRRLTA  319

Query  1038  EEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEM  1217
             ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK  L V+AE+LS ++V  IK+M
Sbjct  320   QQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHALRVIAEHLSVEEVAGIKDM  379

Query  1218  FHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHL  1397
             F  MD +K+  ++F+ELK GL+ +G  + D DVQ+LMDAAD DGNG L+  EF+TL+VHL
Sbjct  380   FEKMDLNKDSMINFDELKLGLNKLGHQMPDADVQILMDAADADGNGCLDYGEFVTLSVHL  439

Query  1398  TNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGR  1577
               + ND++LHKAF  FD++ SGYIE +ELR+ L + D    +++V+  II D D DKDG+
Sbjct  440   KKIGNDEHLHKAFGYFDRNKSGYIEIDELRESLAD-DLGPNHEEVINAIIRDVDTDKDGK  498

Query  1578  ISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ISF EF AMM  GTDW+ ASR+YS+    +LS++L KD S+Q
Sbjct  499   ISFEEFVAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQ  540



>ref|XP_008786134.1| PREDICTED: calcium-dependent protein kinase 8-like [Phoenix dactylifera]
Length=532

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/482 (65%), Positives = 390/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I  +YE G+ELGRGEFGVTYLCT+K T E+ ACK ISK KLRT +D+EDVRREV
Sbjct  46    NPTGRDIGSRYELGEELGRGEFGVTYLCTDKSTSETFACKSISKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IMR+LP HPNIVS K+ YED  AV+LVMELCEGGELFDRIVAKGHYTERAAA VT+TI+
Sbjct  106   DIMRYLPSHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVAKGHYTERAAAAVTRTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLS+FF+PG+RF EIVGSPYYMA
Sbjct  166   EVVQMCHKHGVMHRDLKPENFLFANKKETSTLKAIDFGLSVFFRPGERFSEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKR+PWP++S+
Sbjct  226   PEVLKRNYGQEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAVDFKREPWPRVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML  +P  R+T +EVL H W+QNA+  PNV LG+ V +R++QF++MNKFKK+
Sbjct  286   NAKDLVKRMLVPDPKRRLTAQEVLDHPWLQNAKKAPNVNLGDTVRSRLQQFSVMNKFKKK  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IKEMF  MD + NG ++FEELK GL  +G  V D DVQ+LM+AA
Sbjct  346   ALRVVAEHLSVEEVADIKEMFQKMDINNNGRVTFEELKYGLHKLGHQVPDSDVQILMEAA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD NG L+  EF+ +++H+  + ND++LHKAF  FDK+ S YIE EELRD L + D   
Sbjct  406   DVDANGTLDYGEFVAMSIHIRKIGNDEHLHKAFAYFDKNRSEYIEIEELRDSLAD-DLGP  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   ++LS++L KD S
Sbjct  465   NHEEVINAIIHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFSSLSLKLQKDGS  524

Query  1698  VQ  1703
             +Q
Sbjct  525   LQ  526



>ref|NP_568281.1| calmodulin-domain protein kinase 7 [Arabidopsis thaliana]
 sp|Q38873.1|CDPK7_ARATH RecName: Full=Calcium-dependent protein kinase 7; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 7 [Arabidopsis 
thaliana]
 gb|AAK32802.1|AF361634_1 AT5g19450/F7K24_200 [Arabidopsis thaliana]
 gb|AAB03247.1| calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis 
thaliana]
 emb|CAC42909.1| calcium-dependent protein kinase-like protein [Arabidopsis thaliana]
 gb|AED91815.1| calmodulin-domain protein kinase 7 [Arabidopsis thaliana]
Length=535

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 389/480 (81%), Gaps = 0/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  IS +Y+ G+E+GRGEFG+TYLCT+KETGE  ACK ISK KLRT +D+EDVRREVEI
Sbjct  51    TGHDISLQYDLGREVGRGEFGITYLCTDKETGEKYACKSISKKKLRTAVDIEDVRREVEI  110

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+H+PKHPN+VS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  111   MKHMPKHPNVVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEV  170

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHK GV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  171   VQICHKQGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPE  230

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+ A
Sbjct  231   VLRRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDSA  290

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ ML+ +P  R+T  +VL H WI NA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  291   KDLVRKMLEPDPKKRLTAAQVLEHTWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  350

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DV
Sbjct  351   RVIAEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADTDLQILMEATDV  410

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE +ELR+ L +  D+  +
Sbjct  411   DGDGTLNYSEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIDELREALNDELDNTSS  470

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  471   EEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  530



>ref|XP_009116455.1| PREDICTED: calcium-dependent protein kinase 32 [Brassica rapa]
Length=541

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 392/482 (81%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS+KY+ G+ELGRGEFGVTYLCT+KET E  ACK I K KLRT +D+EDVRREV
Sbjct  56    DPTGREISQKYKLGRELGRGEFGVTYLCTDKETEEVFACKSILKKKLRTAVDIEDVRREV  115

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+
Sbjct  116   EIMRHMPEHPNVVTLKETYEDEIAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIM  175

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  176   EVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  235

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  ++F+RDPWPK+SE
Sbjct  236   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVALAIIRSQLNFRRDPWPKVSE  295

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  296   NAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  355

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT++ G ++ +ELK GL  +G  V   D+Q+LMDA 
Sbjct  356   ALRVIAEHLSDEEASGIREGFQIMDTNQRGKINIDELKIGLQKLGHAVPQDDLQILMDAG  415

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + N ++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  416   DIDKDGYLDCDEFIAISVHLRKMGNGEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  473

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV+ II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S +L +D S
Sbjct  474   TSEEVVEAIIRDVDTDKDGRISYEEFATMMKTGTDWRKASRQYSRERFNSISQKLMQDAS  533

Query  1698  VQ  1703
             + 
Sbjct  534   LH  535



>ref|XP_009104064.1| PREDICTED: calcium-dependent protein kinase 32 [Brassica rapa]
Length=538

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 386/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I +KY  G+ELGRGEFGVTYLCT+KETGE +ACK I K KLRT +D+EDVRRE 
Sbjct  53    DPTGREIEQKYTLGRELGRGEFGVTYLCTDKETGEVLACKSILKKKLRTAVDIEDVRREA  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  113   EIMRHMPEHPNLVTLKETYEDEYAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTII  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSQLDFRRDPWPKVSE  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDL++ MLD +   R+T ++VL H W+QNA T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   HAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNANTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHNIPQDDIQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  413   DTDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+    ++S++L +D S
Sbjct  471   TSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFTSISLKLMQDAS  530

Query  1698  VQ  1703
             + 
Sbjct  531   LH  532



>ref|XP_006489930.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X2 
[Citrus sinensis]
Length=532

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 388/480 (81%), Gaps = 2/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++YE G+ELGRGEFGVTYLCT++E G++ ACK ISK KLRT +D+EDVRREV+I
Sbjct  49    TGREIEERYELGRELGRGEFGVTYLCTDRENGDAFACKSISKKKLRTAVDIEDVRREVDI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKH NIV  K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  109   MRHLPKHQNIVCLKDTYEDDTAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  169   VQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGEKFSEIVGSPYYMAPE  228

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE+A
Sbjct  229   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSENA  288

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  289   KDLVRKMLDPDPKQRLTAQQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  348

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+A++LS ++V  IKE FHMMD    G ++ +EL+ GL  +G  + D DVQ+LMDA DV
Sbjct  349   KVIAQHLSVEEVAGIKEGFHMMDIGNRGKINIDELRVGLHKLGHQIPDTDVQILMDAGDV  408

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VHL  + ND++LHKAF  FD++ +GYIE EELRD L   D+ + +
Sbjct  409   DKDGYLDYGEFVAISVHLRKMGNDEHLHKAFQFFDQNQTGYIELEELRDAL--ADEVDTS  466

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++VV  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD S+Q
Sbjct  467   EEVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQ  526



>emb|CDX67695.1| BnaA07g17350D [Brassica napus]
Length=536

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 386/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I +KY  G+ELGRGEFGVTYLCT+KETGE +ACK I K KLRT +D+EDVRRE 
Sbjct  51    DPTGREIEQKYTLGRELGRGEFGVTYLCTDKETGEVLACKSILKKKLRTAVDIEDVRREA  110

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  111   EIMRHMPEHPNLVTLKETYEDEYAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTII  170

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  171   EVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  230

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  231   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSQLDFRRDPWPKVSE  290

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDL++ MLD +   R+T ++VL H W+QNA T PNV LGE V  R+KQFT+MNK KKR
Sbjct  291   HAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNANTAPNVSLGETVRARLKQFTVMNKLKKR  350

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  351   ALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHNIPQDDIQILMDAG  410

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  411   DTDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  468

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+    ++S++L +D S
Sbjct  469   TSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFTSISLKLMQDAS  528

Query  1698  VQ  1703
             + 
Sbjct  529   LH  530



>ref|XP_002529620.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF32765.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=529

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/494 (64%), Positives = 396/494 (80%), Gaps = 4/494 (1%)
 Frame = +3

Query  222   ISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLR  401
             +S ++ VL    + TG  I ++YE G ELGRGEFGVTYLCT+KE+GE  ACK ISK KLR
Sbjct  35    VSHRLTVLK---DPTGREIEQRYELGGELGRGEFGVTYLCTDKESGEKFACKSISKKKLR  91

Query  402   TeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYT  581
             T +D+EDVRREV+IM+HLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIV++GHYT
Sbjct  92    TAVDIEDVRREVQIMKHLPKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVSRGHYT  151

Query  582   ERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQR  761
             ERAAA VTKTI+EV+Q+CHKHGV+HRDLKPENFL+AN  E+A LKAIDFGLS+FFKPG+R
Sbjct  152   ERAAAAVTKTIVEVVQMCHKHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFKPGER  211

Query  762   FKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDI  941
             F EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +
Sbjct  212   FNEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVV  271

Query  942   DFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRI  1121
             DFKRDPWPK+S++AKDLVK MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+
Sbjct  272   DFKRDPWPKVSDNAKDLVKKMLDPDPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVKARL  331

Query  1122  KQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPV  1301
             KQF++MNK KKR L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +G  +
Sbjct  332   KQFSVMNKLKKRALRVIAEHLSVEEVAGIKEGFRLMDTSNKGKINLDELRIGLQKLGHQI  391

Query  1302  ADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEE  1481
              D DVQ+LM+A DVD +G L+  EF+T++VHL  + ND++L KAF  FDK+ SG+IE EE
Sbjct  392   TDTDVQMLMEAGDVDRDGHLDYGEFVTISVHLRKMGNDEHLRKAFEYFDKNQSGHIEIEE  451

Query  1482  LRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVML  1661
             LR+ L +  D+N +++++  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   
Sbjct  452   LRNALADELDEN-SEEIISAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERF  510

Query  1662  NALSVRLFKDKSVQ  1703
             N LS++L KD S+Q
Sbjct  511   NNLSLKLMKDGSLQ  524



>gb|ABY59017.1| calcium-dependent protein kinase [Triticum aestivum]
Length=543

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/544 (60%), Positives = 415/544 (76%), Gaps = 15/544 (3%)
 Frame = +3

Query  99    MGACVSLHSAL---------TMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNE  251
             MG C +   A+           K P+ R+   P       +R+  P + ++     VL E
Sbjct  1     MGNCCATPPAVDGGGGGGGKQQKEPKQRKGKKPNPFSIEYNRSAPPGASRLV----VLRE  56

Query  252   SHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrr  431
                 TG  I+++YE G ELGRGEFGVTYLCT++ T E++ACK ISK KLRT +DVEDVRR
Sbjct  57    P-TGTGRDIAERYELGGELGRGEFGVTYLCTDRATREALACKSISKKKLRTAVDVEDVRR  115

Query  432   eveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKT  611
             EVEIMRHLPKHPNIV+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKT
Sbjct  116   EVEIMRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKT  175

Query  612   ILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYY  791
             I+EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FF PG+RF EIVGSPYY
Sbjct  176   IVEVVQMCHKHGVMHRDLKPENFLFANKKETAVLKAIDFGLSVFFTPGERFTEIVGSPYY  235

Query  792   MAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKI  971
             MAPEVL+R+YG EVDVWSAGVILY+LLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++
Sbjct  236   MAPEVLKRNYGQEVDVWSAGVILYVLLCGVPPFWAETEQGVAQAIIRSGIDFKRDPWPRV  295

Query  972   SEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFK  1151
             S++AKDLV+GML+ +P  R+T ++VL H W+Q+ +  PNV LGE V  R++QF++MNKFK
Sbjct  296   SDNAKDLVRGMLNPDPRRRLTAQQVLDHPWLQSIKRAPNVNLGETVKARLQQFSVMNKFK  355

Query  1152  KRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMD  1331
             K  L V+AE+LS ++V  IK+MF  MD +K+  ++F+ELK GL+ +G  + D DVQ+LMD
Sbjct  356   KHALRVIAEHLSVEEVAGIKDMFEKMDLNKDSMINFDELKLGLNKLGHQMPDADVQILMD  415

Query  1332  AADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDD  1511
             AAD DGNG L+  EF+TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D 
Sbjct  416   AADADGNGCLDYGEFVTLSVHLKKIGNDEHLHKAFGYFDRNKSGYIEIDELRESLAD-DL  474

Query  1512  DNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
                +++V+  II D D DKDG+ISF EF AMM  GTDW+ ASR+YS+    +LS++L KD
Sbjct  475   GPNHEEVINAIIRDVDTDKDGKISFDEFVAMMKAGTDWRKASRQYSRERFTSLSLKLQKD  534

Query  1692  KSVQ  1703
              S+Q
Sbjct  535   GSLQ  538



>gb|EAZ04388.1| hypothetical protein OsI_26532 [Oryza sativa Indica Group]
Length=550

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/504 (63%), Positives = 401/504 (80%), Gaps = 8/504 (2%)
 Frame = +3

Query  192   SRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVA  371
             +R+ AP   ++     VL E    TG  I+ +YE G ELGRGEFGVTYLCTE+ETG++ A
Sbjct  50    NRSSAPSGHRLV----VLREP---TGRDIAARYELGGELGRGEFGVTYLCTERETGDAYA  102

Query  372   CKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELF  551
             CK ISK KLRT +D+EDVRREV+IMR LPKHPNIV+ ++ YED  AV+LVMELCEGGELF
Sbjct  103   CKSISKKKLRTAVDIEDVRREVDIMRQLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELF  162

Query  552   DRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFG  731
             DRIVA+GHYTERAAALVT+TI+EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFG
Sbjct  163   DRIVARGHYTERAAALVTRTIVEVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFG  222

Query  732   LSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEG  911
             LS+FF PG+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G
Sbjct  223   LSVFFTPGERFTEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQG  282

Query  912   IAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNV  1091
             +A AI+R  IDFKRDPWP++S++AKDLVKGML+ +P  R+  ++VL H W+QN +  PNV
Sbjct  283   VAQAIIRSVIDFKRDPWPRVSDNAKDLVKGMLNPDPRRRLNAQQVLDHPWLQNIKKAPNV  342

Query  1092  PLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELK  1271
              LGE V  R++QF++MNKFKK  L V+AE+LS ++V  IK+MF  MD +K+  ++F+ELK
Sbjct  343   NLGETVKARLQQFSVMNKFKKHALRVIAEHLSVEEVAGIKDMFEKMDLNKDNMINFDELK  402

Query  1272  DGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDK  1451
              GL  +G  +AD DVQ+LMDAADVDGNG L+  EF+ L+VHL  + ND++LHKAF  FD+
Sbjct  403   LGLHKLGHQMADADVQILMDAADVDGNGSLDYGEFVALSVHLRKIGNDEHLHKAFAYFDR  462

Query  1452  DNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKM  1631
             + SGYIE +ELR+ L + D    +++V+  II D D DKDG+IS+ EF AMM  GTDW+ 
Sbjct  463   NQSGYIEIDELRESLAD-DLGANHEEVINAIIRDVDTDKDGKISYDEFAAMMKAGTDWRK  521

Query  1632  ASRKYSKVMLNALSVRLFKDKSVQ  1703
             ASR+YS+    +LS++L KD S+Q
Sbjct  522   ASRQYSRERFTSLSLKLQKDGSLQ  545



>ref|XP_008810968.1| PREDICTED: calcium-dependent protein kinase 8-like [Phoenix dactylifera]
Length=534

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 388/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFGVTYLCT+K TGE+ ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGRDIGSRYELGQELGRGEFGVTYLCTDKATGEAFACKSISKKKLRTTVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IMRHLP HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+G YTERAAA +T+TI+
Sbjct  108   DIMRHLPSHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGRYTERAAAAITRTIV  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL++N  E +PLKAIDFGLS+FF+PG+RF EIVGSPYYMA
Sbjct  168   EVVQMCHKHGVMHRDLKPENFLFSNRKETSPLKAIDFGLSVFFRPGERFTEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKR+PWPK+S+
Sbjct  228   PEVLKRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAVDFKREPWPKVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T + VL H W+QNA   PNV LGE V  R++QF++MNKFKK+
Sbjct  288   NAKDLVKRMLDPDPKRRLTAQAVLDHPWLQNASKAPNVNLGETVRARLQQFSVMNKFKKK  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IK+MF  MD + NG ++FEELK GL  +G  +AD D Q+LM+AA
Sbjct  348   ALRVVAEHLSVEEVADIKDMFQKMDINNNGKITFEELKFGLHKLGHQIADSDAQILMEAA  407

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDGNG L+  EF+ +++H+  + ND++LHKAF  FDK+ SGYIE EELRD L + D   
Sbjct  408   DVDGNGTLDYGEFVAVSIHIRKIGNDEHLHKAFAYFDKNRSGYIEIEELRDSLAD-DLGP  466

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   + LS+ L KD S
Sbjct  467   NSEEVMNAIIHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFSNLSLNLQKDGS  526

Query  1698  VQ  1703
             +Q
Sbjct  527   LQ  528



>gb|AHG06453.1| calcium-dependent protein kinase 32 [Brassica napus]
Length=538

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 386/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I +KY  G+ELGRGEFGVTYLCT+KETGE +ACK I K KLRT +D+EDVRRE 
Sbjct  53    DPTGREIEQKYTLGRELGRGEFGVTYLCTDKETGEVLACKSILKKKLRTAVDIEDVRREA  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  113   EIMRHMPEHPNLVTLKETYEDEYAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTII  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSQLDFRRDPWPKVSE  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDL++ MLD +   R+T ++VL H W+QNA T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   HAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNANTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFRIMDTSQRGKINIDELKIGLQKLGHNIPQDDIQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  413   DTDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--SDEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ A R+YS+   N++S++L +D S
Sbjct  471   TSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKAFRQYSRERFNSISLKLMQDAS  530

Query  1698  VQ  1703
             + 
Sbjct  531   LH  532



>gb|KDO53691.1| hypothetical protein CISIN_1g009367mg [Citrus sinensis]
Length=532

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/480 (65%), Positives = 388/480 (81%), Gaps = 2/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++YE G+ELGRGEFG+TYLCT++E G++ ACK ISK KLRT +D+EDVRREV+I
Sbjct  49    TGREIEERYELGRELGRGEFGITYLCTDRENGDAFACKSISKKKLRTAVDIEDVRREVDI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKH NIV  K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  109   MRHLPKHQNIVCLKDTYEDDTAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  169   VQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGEKFSEIVGSPYYMAPE  228

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE+A
Sbjct  229   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSENA  288

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  289   KDLVRKMLDPDPKRRLTAQQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  348

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+A++LS ++V  IKE FHMMD    G ++ +EL+ GL  +G  + D DVQ+LMDA DV
Sbjct  349   KVIAQHLSVEEVAGIKEGFHMMDIGNRGKINIDELRVGLHKLGHQIPDTDVQILMDAGDV  408

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VHL  + ND++LHKAF  FD++ +GYIE EELRD L   D+ + +
Sbjct  409   DKDGYLDYGEFVAISVHLRKMGNDEHLHKAFQFFDQNQTGYIELEELRDAL--ADEVDTS  466

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++VV  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD S+Q
Sbjct  467   EEVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQ  526



>ref|XP_009617561.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana 
tomentosiformis]
 ref|XP_009617562.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana 
tomentosiformis]
Length=528

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/480 (64%), Positives = 388/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  KY+ G+ELGRGEFGVTYLCT+ +TG+  ACK ISK KLRT +D++DVRREVEI
Sbjct  45    TGQNIHDKYDLGRELGRGEFGVTYLCTDVDTGDKYACKSISKKKLRTAVDIDDVRREVEI  104

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLPKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA + +T++EV
Sbjct  105   MKHLPKHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAGILRTVVEV  164

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CH+HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  165   VQMCHRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  224

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++A
Sbjct  225   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNA  284

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T E VL H W+QN +  PNV LGE V  R+KQF++MNK KK+ L
Sbjct  285   KDLVKKMLDPDPSRRLTAERVLEHPWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKKAL  344

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE LS ++V  +++ F MMDT K G ++  ELK+GL  +G   +D D+Q+LM+AADV
Sbjct  345   TVIAEFLSAEEVAGMRDAFEMMDTGKKGQINLGELKNGLQKLGHQSSDADLQILMEAADV  404

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR  L + +DDN +
Sbjct  405   DGDGSLNYAEFVAVSVHLRKMANDEHLHKAFSFFDKNQSGYIEIEELRSALSD-EDDNNS  463

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDG IS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  464   EEVINAIMHDVDTDKDGCISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  523



>ref|XP_006421421.1| hypothetical protein CICLE_v10004707mg [Citrus clementina]
 gb|ESR34661.1| hypothetical protein CICLE_v10004707mg [Citrus clementina]
Length=532

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 388/480 (81%), Gaps = 2/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++YE G+ELGRGEFGVTYLCT++E G++ ACK ISK KLRT +D+EDVRREV+I
Sbjct  49    TGREIEERYELGRELGRGEFGVTYLCTDRENGDAFACKSISKKKLRTAVDIEDVRREVDI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKH NIV  K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  109   MRHLPKHQNIVCLKDTYEDDTAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  169   VQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGEKFSEIVGSPYYMAPE  228

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE+A
Sbjct  229   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSENA  288

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  289   KDLVRKMLDPDPKRRLTAQQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  348

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+A++LS ++V  IKE FHMMD    G ++ +EL+ GL  +G  + D DVQ+LMDA DV
Sbjct  349   KVIAQHLSVEEVAGIKEGFHMMDIGNRGKINIDELRVGLHKLGHQIPDTDVQILMDAGDV  408

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VHL  + ND++LHKAF  FD++ +GYIE EELRD L   D+ + +
Sbjct  409   DKDGYLDYGEFVAISVHLRKMGNDEHLHKAFQFFDQNQTGYIELEELRDAL--ADEVDTS  466

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++VV  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD S+Q
Sbjct  467   EEVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQ  526



>ref|XP_009386117.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=527

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/480 (66%), Positives = 385/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  +YE G+ LGRGEFGVTYLCT+K TGE +ACK ISK KLRT +D+EDVRREVEI
Sbjct  48    TGRDIGSRYELGQVLGRGEFGVTYLCTDKATGEHLACKSISKKKLRTAVDIEDVRREVEI  107

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP HPNIV  K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EV
Sbjct  108   MRHLPAHPNIVKLKDTYEDDGAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIIEV  167

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             IQVCHKHGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FF+PG  F EIVGSPYYMAPE
Sbjct  168   IQVCHKHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFRPGDCFTEIVGSPYYMAPE  227

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAE+E+G+A AI+R  IDFKR+PWPK+S+ A
Sbjct  228   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAESEQGVAQAILRSVIDFKREPWPKVSDSA  287

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R T ++V+ H W+QNA   PNV LGE V  R++QF++MNKFKK+ L
Sbjct  288   KDLVRHMLDPDPKQRFTAQQVIDHSWLQNATKAPNVNLGETVRARLQQFSVMNKFKKKAL  347

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVAE LS ++V  IK+MF  MD +KNG ++FEELK GL  +G  + D DVQ+LM+AADV
Sbjct  348   RVVAEYLSVEEVADIKDMFEKMDINKNGKITFEELKFGLRKLGHQIPDADVQILMEAADV  407

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG G L+  EF+ +++HL  + ND++LHKAF  FD++ SGYIE EELRD L++ D    +
Sbjct  408   DGTGTLDYGEFVAVSIHLRKIGNDEHLHKAFSYFDQNKSGYIEIEELRDSLVD-DLGTNH  466

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   ++LS +L KD S+Q
Sbjct  467   EEVINAIIHDVDTDKDGRISYEEFTAMMKAGTDWRKASRQYSRERFSSLSSKLLKDGSLQ  526



>ref|XP_011090028.1| PREDICTED: calcium-dependent protein kinase 8-like [Sesamum indicum]
Length=533

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 392/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+++Y+ G+ELGRGEFGVTYLCT+ ETGE  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGHNINERYDLGRELGRGEFGVTYLCTDVETGEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIVS K+ +ED  AV++VMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  107   EIMKHMPKHPNIVSLKDTFEDDSAVHIVMELCEGGELFDRIVARGHYTERAAAVVMRTIM  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  167   EVVQMCHRHGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEHFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T  +VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPSRRLTAHQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVA++LS ++V  IKE F MMD+ K G ++ EE + GL  +G  + D D+Q+LM+AA
Sbjct  347   ALRVVADHLSVEEVAGIKEAFDMMDSGKKGKVNLEEFRIGLHKLGHQIPDADIQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR  L + +D N
Sbjct  407   DVDGDGTLNYGEFVAVSVHLRKMANDEHLHKAFSFFDRNESGYIEMEELRAALSDEEDAN  466

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              N++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  467   -NEEVIIAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  525

Query  1698  VQ  1703
             ++
Sbjct  526   LK  527



>ref|XP_010419839.1| PREDICTED: calcium-dependent protein kinase 7-like [Camelina 
sativa]
Length=535

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/535 (60%), Positives = 405/535 (76%), Gaps = 5/535 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C    S+ T    +  +P +  N       T   RS     ++ VL    N TG  I
Sbjct  1     MGNCCGSPSSAT-SESKQGKPKNKSNPFYSNEYTATDRS-GAGFELSVLK---NPTGHDI  55

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
             S +Y+ G+E+GRGEFG+TYLCT+KETG+  ACK ISK KLRT +D++DVRREVEIM+++P
Sbjct  56    SLQYDLGREVGRGEFGITYLCTDKETGDKYACKSISKKKLRTAVDIQDVRREVEIMKNMP  115

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHP +VS K+ +ED + V++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV+Q+CH
Sbjct  116   KHPIVVSLKDAFEDDDDVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICH  175

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             K GVIHRDLKPENFL+AN  E APLKAIDFGLSIFFKPG +F EIVGSPYYMAPEVLRR+
Sbjct  176   KQGVIHRDLKPENFLFANKKETAPLKAIDFGLSIFFKPGDQFTEIVGSPYYMAPEVLRRN  235

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+ AKDLV+
Sbjct  236   YGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDSAKDLVR  295

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R+T  +VL H WI NA+  PNV LGE V  R+KQF++MNK KKR L V+AE
Sbjct  296   KMLEPDPKKRLTAAQVLEHSWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAE  355

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             +LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DVDG+G 
Sbjct  356   HLSVEEAAGIKEAFEMMDVNKRGKINLEELKVGLQKAGQQIADADLQILMEATDVDGDGT  415

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  DD  +++V+ 
Sbjct  416   LNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELREALNDELDDTSSEEVIV  475

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              I  D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  476   AIRQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  530



>ref|NP_191312.2| calcium-dependent protein kinase 32 [Arabidopsis thaliana]
 sp|Q6NLQ6.1|CDPKW_ARATH RecName: Full=Calcium-dependent protein kinase 32 [Arabidopsis 
thaliana]
 gb|AAS47636.1| At3g57530 [Arabidopsis thaliana]
 gb|AAS76761.1| At3g57530 [Arabidopsis thaliana]
 gb|AEE79668.1| calcium-dependent protein kinase 32 [Arabidopsis thaliana]
Length=538

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/483 (64%), Positives = 389/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
             ++ TG  I  KY  G+ELGRGEFGVTYLCT+KET +  ACK I K KLRT +D+EDVRRE
Sbjct  52    NDPTGREIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRRE  111

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI
Sbjct  112   VEIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTI  171

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             +EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYM
Sbjct  172   MEVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYM  231

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S
Sbjct  232   APEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVS  291

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             E+AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KK
Sbjct  292   ENAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKK  351

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             R L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA
Sbjct  352   RALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDA  411

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
              D+D +G L+C+EFI ++VHL  + ND++L KAF  FD++N+GYIE EELR+ L   D+ 
Sbjct  412   GDIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIEELREAL--SDEL  469

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D 
Sbjct  470   GTSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDA  529

Query  1695  SVQ  1703
             S+Q
Sbjct  530   SLQ  532



>ref|XP_011025545.1| PREDICTED: calcium-dependent protein kinase 8-like [Populus euphratica]
 ref|XP_011025546.1| PREDICTED: calcium-dependent protein kinase 8-like [Populus euphratica]
Length=533

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 386/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I   Y+ G+ELGRGEFG+TYLCT+  +G+  ACK ISK KLRT +D++DVRREVEI
Sbjct  52    TGRDILAHYDLGRELGRGEFGITYLCTDVNSGDKFACKSISKKKLRTAVDIDDVRREVEI  111

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP HPNIV+ K  YED  AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+EV
Sbjct  112   MKHLPSHPNIVTLKASYEDDTAVHIVMELCEGGELFDRIVARGHYTERAAAAVMRTIVEV  171

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  172   VQMCHKHGVMHRDLKPENFLFANKKETAVLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  231

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             +LRR+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  232   ILRRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSFIDFKRDPWPRVSDNA  291

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK ML+ +P  R+T ++VL H WIQNA+  PNVPLGE V  R+KQF++MNK KKR L
Sbjct  292   KDLVKKMLNPDPKLRLTAQQVLEHPWIQNAKKAPNVPLGETVRARLKQFSVMNKLKKRAL  351

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++V  IKE F MMDT K G+++ EEL+ GL  +GQ +AD D+Q+LM+AADV
Sbjct  352   RVIAEHLSVEEVAGIKEAFDMMDTGKRGSINLEELRVGLQKLGQNIADADLQILMEAADV  411

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VH+  + ND++LHKAF  FD++ SGYIE EELR+ L + D D  N
Sbjct  412   DGDGALNYGEFVAISVHIKKMGNDEHLHKAFAFFDRNQSGYIEIEELRESLND-DVDTNN  470

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             + V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N LS+ L +D S+Q
Sbjct  471   EDVINAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNNLSITLRRDGSLQ  530



>ref|XP_002283549.2| PREDICTED: calcium-dependent protein kinase 32 [Vitis vinifera]
Length=526

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/482 (65%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFG+T+LCT+K TG+  ACK ISK KLRT +D++DVRREV
Sbjct  43    DPTGREIELRYELGRELGRGEFGITHLCTDKSTGDVYACKSISKKKLRTAVDIDDVRREV  102

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  103   EIMKHLPKHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIV  162

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  163   EVVQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  222

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+SE
Sbjct  223   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFKRDPWPKVSE  282

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R++ +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  283   NAKDLVKKMLDPDPKRRLSAQEVLDHPWLQNAKKAPNVSLGETVRARLKQFSMMNKLKKR  342

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +G  + + D+Q+LM+A 
Sbjct  343   ALRVIAEHLSVEEVAGIKEGFQLMDTGNKGKINMDELRVGLQKLGHQIPEQDLQILMEAG  402

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G L+  EF+ ++VHL  + NDD+L KAF  FD++NSGYIE EELRD L    + N
Sbjct  403   DVDGDGHLDYGEFVAISVHLRKMGNDDHLLKAFEFFDQNNSGYIEIEELRDALAGELESN  462

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N LS++L +D S
Sbjct  463   -SEEVINAIIHDVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIRDGS  521

Query  1698  VQ  1703
             ++
Sbjct  522   LE  523



>gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium catenatum]
Length=536

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/505 (64%), Positives = 394/505 (78%), Gaps = 10/505 (2%)
 Frame = +3

Query  192   SRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVA  371
             +RT  P + K++    VL ES   TG  I  +Y+ G ELGRGEFG+TYLC +K+TGE  A
Sbjct  35    NRTPIPGALKLT----VLKES---TGKDIGSRYQLGSELGRGEFGITYLCIDKDTGEKFA  87

Query  372   CKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELF  551
             CK ISK KLRT +D+EDVRREV+IMRH+P HPN+VS K+ YED  AV++VMELCEGGELF
Sbjct  88    CKSISKKKLRTAVDIEDVRREVQIMRHMPPHPNVVSLKDTYEDDNAVHIVMELCEGGELF  147

Query  552   DRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFG  731
             DRIVA+GHYTERAAA VTKTI+EV+QVCHKHGV++RDLKPENFL+AN  E A LK IDFG
Sbjct  148   DRIVARGHYTERAAAAVTKTIVEVVQVCHKHGVMNRDLKPENFLFANKKETAALKVIDFG  207

Query  732   LSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEG  911
             LS+ FKPG+ F EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G
Sbjct  208   LSVDFKPGEHFSEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQG  267

Query  912   IAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNV  1091
             +A AI+R  +DFKRDPWPK+S+ AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV
Sbjct  268   VAQAIIRSVVDFKRDPWPKVSDTAKDLVKKMLDPDPKRRLTAQEVLDHPWLQNAKKAPNV  327

Query  1092  PLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELK  1271
              LGE V  R++QF++MNKFKKR L VVAE+LS ++V  IKEMF  +D D NG ++ EELK
Sbjct  328   NLGESVRARLQQFSVMNKFKKRALRVVAEHLSVEEVADIKEMFKKLDVDDNGRITIEELK  387

Query  1272  DGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDK  1451
              GL  +G  + D DVQ+LMDAADVDG+G L   EF+ L++H+  L ND++LHKAF  FD+
Sbjct  388   SGLHRLGHQIPDADVQILMDAADVDGDGTLEFGEFVALSIHIKKLGNDEHLHKAFAYFDQ  447

Query  1452  DNSGYIEFEELRDYLLEIDDDNKN-DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWK  1628
             + SGYIE EEL D L   DD   N ++V+  II D D DKDG+IS+ EF AMM  GTDW+
Sbjct  448   NKSGYIEIEELSDALQ--DDLGPNYEEVINAIIRDVDTDKDGKISYEEFAAMMKAGTDWR  505

Query  1629  MASRKYSKVMLNALSVRLFKDKSVQ  1703
              ASR+YS+    +LS++L KD S+Q
Sbjct  506   KASRQYSRERFTSLSLKLIKDGSLQ  530



>gb|EMT32905.1| hypothetical protein F775_52262 [Aegilops tauschii]
Length=542

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/482 (65%), Positives = 393/482 (82%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
               TG  I+++YE G ELGRGEFGVTYLCT++ T E++ACK ISK KLRT +DVEDVRREV
Sbjct  18    TGTGRDIAERYELGGELGRGEFGVTYLCTDRATREALACKSISKKKLRTAVDVEDVRREV  77

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLPKHPNIV+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+
Sbjct  78    EIMRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIV  137

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FF PG+RF EIVGSPYYMA
Sbjct  138   EVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFTPGERFTEIVGSPYYMA  197

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  198   PEVLKRNYGQEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  257

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+GML+ +P  R+T ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK 
Sbjct  258   NAKDLVRGMLNPDPRRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKH  317

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IK+MF  MD +K+  ++F+ELK GL+ +G  + D DVQ+LMDAA
Sbjct  318   ALRVIAEHLSVEEVAGIKDMFEKMDLNKDSMINFDELKLGLNKLGHQMPDADVQILMDAA  377

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D DGNG L+  EF+TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D   
Sbjct  378   DADGNGCLDYGEFVTLSVHLKKIGNDEHLHKAFGYFDRNKSGYIEIDELRESLAD-DLGP  436

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDG+ISF EF AMM  GTDW+ ASR+YS+    +LS++L KD S
Sbjct  437   NHEEVINAIIRDVDTDKDGKISFDEFVAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGS  496

Query  1698  VQ  1703
             +Q
Sbjct  497   LQ  498



>ref|XP_010923436.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Elaeis guineensis]
 ref|XP_010923437.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Elaeis guineensis]
Length=532

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/480 (65%), Positives = 388/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  +YE G ELGRGEFG+TYLCT+K+TGE+ ACK ISK KLRT +D++DVRREV+I
Sbjct  48    TGRDIGSRYELGAELGRGEFGITYLCTDKDTGEAFACKSISKKKLRTAVDIDDVRREVDI  107

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MR LP HPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EV
Sbjct  108   MRFLPSHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEV  167

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL++N  E + LKAIDFGLSIFF+PG+RF EIVGSPYYMAPE
Sbjct  168   VQMCHKHGVMHRDLKPENFLFSNKKETSALKAIDFGLSIFFRPGERFTEIVGSPYYMAPE  227

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKR+PWP++S++A
Sbjct  228   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSIIDFKREPWPRVSDNA  287

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             K+LVK MLD +P  R+T +EVL H W QNA+  PNV LGE V  R++QF++MNKFKK+ L
Sbjct  288   KNLVKRMLDPDPKRRLTAQEVLDHPWFQNAKKAPNVNLGEAVRARLQQFSVMNKFKKKAL  347

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVAE+LS ++V  IK+MF  MD + NG ++FEELK GL  +G  V D DV++LM+AADV
Sbjct  348   RVVAEHLSVEEVADIKDMFQKMDINNNGKITFEELKYGLHKLGHQVPDSDVKILMEAADV  407

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+  EF+ +++H+  + ND++LHKAF  FDK+ SGYIE EELRD L + D    +
Sbjct  408   DGNGTLDYGEFVAVSIHIRKIGNDEHLHKAFAYFDKNRSGYIEIEELRDSLAD-DLGPNH  466

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   + LS++L KD S+Q
Sbjct  467   EEVINAIIHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFSNLSLKLQKDGSLQ  526



>gb|AAZ30035.1| putative calcium-dependent protein kinase [Isatis tinctoria]
 gb|ABF47341.1| calcium-dependent protein kinase [Isatis tinctoria]
 gb|ABF50790.1| calcium-dependent protein kinase [Isatis tinctoria]
Length=537

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 390/482 (81%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I +KY+ G+ELGRGEFGVTYLCT+KET E +ACK I K KLRT +D+EDVRREV
Sbjct  52    DPTGREIEQKYKLGRELGRGEFGVTYLCTDKETDEVLACKSILKKKLRTAVDIEDVRREV  111

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  112   EIMRHMPVHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIM  171

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCH +GV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  172   EVVQVCHNNGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  231

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  232   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSQLDFRRDPWPKVSE  291

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  292   NAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  351

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  352   ALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDAG  411

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD++++GYIE EELR+ L   D+  
Sbjct  412   DIDKDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNDNGYIEIEELREAL--SDEVG  469

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  470   TSEEVVDAIIRDVDTDKDGRISYEEFATMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  529

Query  1698  VQ  1703
             +Q
Sbjct  530   LQ  531



>ref|XP_010092921.1| Calcium-dependent protein kinase 8 [Morus notabilis]
 gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis]
Length=530

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/483 (65%), Positives = 390/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG+ I   YE G+ELGRGEFG+TYLCT+K TGE+ ACK ISK KLRT ID+EDVRREV
Sbjct  43    DPTGEEIELSYELGRELGRGEFGITYLCTDKATGETFACKSISKKKLRTAIDIEDVRREV  102

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMR +P+HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  103   EIMRQMPRHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIV  162

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+ +  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  163   EVVQVCHKHGVMHRDLKPENFLFGSKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  222

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+SE
Sbjct  223   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFKRDPWPKVSE  282

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  283   NAKDLVRKMLDPDPRRRLTAQEVLDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKR  342

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT K G ++ +EL+ GL  +G  + D D+Q+LM+A 
Sbjct  343   ALRVIAEHLSVEEVAGIKEGFLLMDTSKRGKINVDELRTGLHKLGHQIPDADLQILMEAG  402

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSND-DNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             DVD +G L+  EF+ ++VHL  + ND ++LHKAF  FDK+ +GYIE EELR  L +  +D
Sbjct  403   DVDKDGYLDYGEFVAISVHLRKMGNDEEHLHKAFEFFDKNQTGYIEIEELRHALADEVED  462

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             N N++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+ + N+LS+RL K+ 
Sbjct  463   N-NEEVINAIMQDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRELFNSLSLRLMKEG  521

Query  1695  SVQ  1703
             S+Q
Sbjct  522   SLQ  524



>ref|XP_010516369.1| PREDICTED: calcium-dependent protein kinase 32 [Camelina sativa]
Length=537

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 386/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  KY  G+ELGRGEFGVTYLCT+KE  +  ACK I K KLRT +D+EDVRREV
Sbjct  53    DPTGREIESKYTLGRELGRGEFGVTYLCTDKENDDVFACKSILKKKLRTAVDIEDVRREV  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  113   EIMRHMPVHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIM  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S+
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSD  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   NAKDLIRKMLDPDQRRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  V   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFQIMDTSQRGRINIDELKIGLQKLGHAVPQDDLQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  413   DIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--ADEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  471   TSEEVVDAIIHDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  530

Query  1698  VQ  1703
             +Q
Sbjct  531   LQ  532



>ref|XP_009394399.1| PREDICTED: calcium-dependent protein kinase 8-like [Musa acuminata 
subsp. malaccensis]
Length=525

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/481 (65%), Positives = 389/481 (81%), Gaps = 1/481 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +Y+ G+ELGRGEFGVTYLCT+K TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  45    DPTGRDIGSRYDLGQELGRGEFGVTYLCTDKATGELFACKSISKKKLRTVVDIEDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP HPNIVS K+ YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  105   EIMRHLPTHPNIVSLKDTYEDEGAVHLVMELCEGGELFDRIVARGHYTERAAAMVIRTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q CH HGV+HRDLKPENFL+AN  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVVQNCHTHGVMHRDLKPENFLFANKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCG+PPFWAETE+GIA AI+R  +DFKR+PWPK+S+
Sbjct  225   PEVLKRNYGPEVDVWSAGVILYILLCGIPPFWAETEQGIAQAIIRSVVDFKREPWPKVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R++QF++MNK KKR
Sbjct  285   TAKDLVKQMLDPDPKRRLTAQEVLDHPWLQNAKKAPNVNLGETVRARLQQFSVMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IK+MF  +D +K G L+ E+LK GL  +G  +AD DV++LM+AA
Sbjct  345   ALRVVAEHLSMEEVADIKDMFDKLDINKKGQLTLEDLKYGLHKLGHQMADEDVKILMEAA  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDGNG L+  EF+ +++HL  + ND++LHKAF  FD++ SGYIE EELRD L + D   
Sbjct  405   DVDGNGTLDYGEFVAISIHLKKIGNDEHLHKAFQYFDQNKSGYIEIEELRDCLAD-DIGP  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+ +L +LS +L KD S
Sbjct  464   NHEEVINAIICDVDTDKDGKISYEEFATMMKAGTDWRKASRQYSRELLYSLSSKLKKDGS  523

Query  1698  V  1700
             +
Sbjct  524   L  524



>emb|CAB66110.1| calcium-dependent protein kinase [Arabidopsis thaliana]
Length=560

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/483 (64%), Positives = 389/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
             ++ TG  I  KY  G+ELGRGEFGVTYLCT+KET +  ACK I K KLRT +D+EDVRRE
Sbjct  52    NDPTGREIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRRE  111

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI
Sbjct  112   VEIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTI  171

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             +EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYM
Sbjct  172   MEVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYM  231

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S
Sbjct  232   APEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVS  291

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             E+AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KK
Sbjct  292   ENAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKK  351

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             R L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA
Sbjct  352   RALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDA  411

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
              D+D +G L+C+EFI ++VHL  + ND++L KAF  FD++N+GYIE EELR+ L   D+ 
Sbjct  412   GDIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIEELREAL--SDEL  469

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D 
Sbjct  470   GTSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDA  529

Query  1695  SVQ  1703
             S+Q
Sbjct  530   SLQ  532



>ref|XP_009767518.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana 
sylvestris]
Length=534

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I++KY+ G+ELGRGEFGVTYLCT+ +TGE  ACK ISK KLRT +D++DVRREV
Sbjct  48    DPTGHNINEKYDLGRELGRGEFGVTYLCTDVDTGEKYACKSISKKKLRTAVDIDDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ ++ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA + +TI+
Sbjct  108   EIMKHLPKHPNIVTLRDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAGIMRTIV  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  168   EVVQMCHRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGEHFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  228   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QN +  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   NAKDLVKKMLDPDPTRRLTAQQVLEHTWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE LS ++V  +KE F  MDT K G ++  ELK GL  +G  + D D+Q+LM+AA
Sbjct  348   ALTVIAEFLSAEEVAGMKEAFDQMDTGKKGKINLGELKIGLQKLGHQIPDADLQILMEAA  407

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR  L + DD N
Sbjct  408   DVDRDGYLNYAEFVAVSVHLRKMANDEHLHKAFSFFDRNQSGYIEIEELRSALSDEDDGN  467

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  468   -SEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  526

Query  1698  VQ  1703
             +Q
Sbjct  527   LQ  528



>gb|KCW87677.1| hypothetical protein EUGRSUZ_A00058 [Eucalyptus grandis]
Length=423

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 360/417 (86%), Gaps = 0/417 (0%)
 Frame = +3

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP+HPNIVS KE +ED++AVY+VMELCEGGELFDRIV +GH+TER A  + +TILE+
Sbjct  1     MRHLPRHPNIVSLKEAFEDRDAVYIVMELCEGGELFDRIVERGHFTERDAVTIARTILEI  60

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             + VCH+HGVIHRDLKPENFL+AN ++++PLKAIDFGLS FF+PGQ F+EIVGSPYYMAPE
Sbjct  61    VSVCHEHGVIHRDLKPENFLFANSSDSSPLKAIDFGLSTFFEPGQHFREIVGSPYYMAPE  120

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRRDYG EVDVWSAGVILYILLCGVPPFWAETEEGIA AIV+G+IDF+RDPWPK+SE+A
Sbjct  121   VLRRDYGPEVDVWSAGVILYILLCGVPPFWAETEEGIAQAIVQGEIDFERDPWPKVSEEA  180

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ ML+ NPY+R+T++EVL HKWIQN +   NV LG+ V TRIKQF+LMNKFKK+VL
Sbjct  181   KDLVRNMLEPNPYTRLTVQEVLEHKWIQNVDKASNVSLGQNVRTRIKQFSLMNKFKKKVL  240

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA+NL  +QV+ IKEMFH+MDTDKNG+L+FEELK GL   GQ VAD DVQ+LMDAAD 
Sbjct  241   RVVADNLPDEQVDHIKEMFHVMDTDKNGDLTFEELKHGLHKCGQQVADPDVQMLMDAADE  300

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LNC+EF+T++VHL  + +DD+L +AF  FDK+ SGYIEF+EL++ L++ +    N
Sbjct  301   DGSGTLNCQEFVTMSVHLRRIGSDDHLTQAFEFFDKNRSGYIEFDELKEALIDDNLGPNN  360

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             ++ +++IIFDADLDKDGRI + EFK MM  G DWKMASR+YS+ MLNALS ++FKDK
Sbjct  361   EKFIEDIIFDADLDKDGRIGYDEFKVMMKMGMDWKMASRQYSRAMLNALSQKMFKDK  417



>gb|KGN48128.1| hypothetical protein Csa_6G439940 [Cucumis sativus]
Length=529

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/535 (59%), Positives = 406/535 (76%), Gaps = 9/535 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C +  S  + K     +  +P   + G              +++VL++    TG  I
Sbjct  1     MGNCCATPSTPSAKPKGKNKKANPFPAKDGEKNANGH-----GNKLQVLSDP---TGHNI  52

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
             S  Y+ G+ELGRGEFGVTYLCT+  TGE  ACK ISK KLRT +D+EDVRREV+IM+HLP
Sbjct  53    SAHYDLGRELGRGEFGVTYLCTDTNTGEKFACKSISKKKLRTAVDIEDVRREVQIMKHLP  112

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
              HPN+V  K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA+V +TI+EV+Q CH
Sbjct  113   NHPNVVRLKDTYEDDQAVHIVMELCEGGELFDRIVARGHYTERAAAVVMRTIVEVVQACH  172

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             KHGV+HRDLKPENFL+AN  E++PLKAIDFGLSI FKPG  F EIVGSPYYMAPEVL+R+
Sbjct  173   KHGVMHRDLKPENFLFANKKESSPLKAIDFGLSITFKPGDLFNEIVGSPYYMAPEVLKRN  232

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCG+PPFWAETE+G+A AI+R  IDF+RDPWP++SE+AKDLV+
Sbjct  233   YGPEVDVWSAGVILYILLCGIPPFWAETEQGVAQAIIRSVIDFRRDPWPRVSENAKDLVR  292

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R+T +EVL H W+QNA+  PNVPLGE V  R+KQF++MNK KKR L V+AE
Sbjct  293   KMLNPDPKRRLTAQEVLDHPWLQNAKKAPNVPLGETVKARLKQFSVMNKLKKRALRVIAE  352

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             +LS ++V  IKE F MMD +K G ++ EEL+ GL  +GQ + + D+Q+LM+AA V  +G 
Sbjct  353   HLSVEEVAGIKEAFDMMDVEKRGKINLEELRSGLQKLGQQIPEADLQILMEAAGVQDDGA  412

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LN  EF+ +++HL  ++ND++LHKAF  FD++ SG+IE EELR  LL  D++  ++ VV 
Sbjct  413   LNYGEFVAVSIHLKRMANDEHLHKAFAFFDQNQSGFIEIEELRAVLLN-DEETNSEDVVN  471

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++LF++ S++
Sbjct  472   AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLFREGSLK  526



>ref|XP_008344697.1| PREDICTED: calcium-dependent protein kinase 8-like [Malus domestica]
Length=533

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 388/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISTQYDLGRELGRGEFGVTYLCTEASSNEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP HPNIV+ K+ YED +A+++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMRHLPPHPNIVTLKDTYEDDDAIHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCG PPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGXPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H WIQNA+  PNVPLGE V  R+KQF++MNK KKR
Sbjct  287   NAKDLVKKMLNPDPKKRLTAQEVLDHHWIQNAKKAPNVPLGETVRARLKQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+A++LS ++V  IKE F MMD    G ++ EEL+ G+  +GQ + D D+Q+LM+AA
Sbjct  347   ALGVIADHLSVEEVAGIKEAFQMMDAGNKGKVTIEELRSGIQQLGQNIPDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L + D D 
Sbjct  407   DVDGDGALNYGEFVAVTVHLKRMANDEHLHKAFSFFDQNQSGYIEIEELRNALTD-DVDT  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525

Query  1698  VQ  1703
             +Q
Sbjct  526   LQ  527



>ref|XP_008449704.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis melo]
 ref|XP_008449705.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis melo]
Length=529

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/542 (58%), Positives = 411/542 (76%), Gaps = 23/542 (4%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDP-------ENVRGGGSRTRAPRSQKISRQIRVLNESH  257
             MG C +  S  + K     +  +P       +NV G G++            ++VL++  
Sbjct  1     MGNCCATPSTPSAKPKGKNKKTNPFSAKDVEKNVNGHGNK------------LQVLSDP-  47

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
               TG  IS  Y+ G+ELGRGEFGVTYLCT+  TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    --TGHNISAHYDLGRELGRGEFGVTYLCTDTNTGEKFACKSISKKKLRTSVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IM+HLP HPN+V  K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  106   QIMKHLPNHPNVVMLKDTYEDDQAVHIVMELCEGGELFDRIVARGHYTERAAAVVMRTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q CHKHGV+HRDLKPENFL+AN  E++PLKAIDFGLSI FKPG  F EIVGSPYYMA
Sbjct  166   EVVQACHKHGVMHRDLKPENFLFANKKESSPLKAIDFGLSITFKPGDVFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCG+PPFWAETE+G+A AI+R  IDF+RDPWP++SE
Sbjct  226   PEVLKRNYGPEVDVWSAGVILYILLCGIPPFWAETEQGVAQAIIRSVIDFRRDPWPRVSE  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ ML+ +P  R+T +EVL H W+QNA+  PNVPLGE V  R+KQF++MNK KKR
Sbjct  286   NAKDLVRKMLNPDPKRRLTAQEVLDHPWLQNAKKAPNVPLGETVKARLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F MMD +K G ++ EEL+ GL  +GQ + + D+Q+L++AA
Sbjct  346   ALRVIAEHLSVEEVAGIKEAFDMMDVEKRGKINLEELRSGLQKLGQQIPEADLQILIEAA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
              V  +G LN  EF+ +++HL  ++ND++LHKAF  FD++ SG+IE EELR  LL+ D++ 
Sbjct  406   GVQDDGALNYGEFVAVSIHLKRMANDEHLHKAFAFFDQNQSGFIEIEELRAVLLD-DEET  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              ++ VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++LF++ S
Sbjct  465   NSEDVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLFREGS  524

Query  1698  VQ  1703
             ++
Sbjct  525   LK  526



>gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album]
Length=529

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 385/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG+ I + YE G+ELGRGEFG+TYLCT+K T E  ACKKISK KLRT ID+EDVRREVEI
Sbjct  45    TGNNIEENYELGRELGRGEFGITYLCTDKLTAEVYACKKISKKKLRTAIDIEDVRREVEI  104

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRH+PKHPNIV+ K+ YED  AV+LVMELCEGGELFDRIV++GHYTERAAA+V KTI+EV
Sbjct  105   MRHMPKHPNIVTLKDTYEDDYAVHLVMELCEGGELFDRIVSRGHYTERAAAIVMKTIVEV  164

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FF PG+RF EIVGSPYYMAPE
Sbjct  165   VQACHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFTPGERFNEIVGSPYYMAPE  224

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWP++S++A
Sbjct  225   VLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFKRDPWPRVSDNA  284

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T ++VL H W+QN +  PNV LGE V  R+KQF++MNK KKR L
Sbjct  285   KDLVKKMLDPDPARRLTAQQVLDHPWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKRAL  344

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++V  IKE F +MDT K G +  +ELK GL  +G  +++ D+ +LMDA DV
Sbjct  345   RVIAEHLSVEEVAGIKEGFALMDTGKRGKIGIDELKSGLHKLGHQISEADLHILMDAGDV  404

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G LN  EF+ +AVHL  + ND++L KAFL FD++ +GYIE EELR  L +  DDN +
Sbjct  405   DKDGFLNYGEFVAIAVHLRKMGNDEHLQKAFLFFDQNKNGYIEIEELRHSLADELDDN-S  463

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N LS++L KD S+Q
Sbjct  464   EEVINAIMRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQ  523



>ref|XP_002513496.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF48899.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/497 (63%), Positives = 393/497 (79%), Gaps = 4/497 (1%)
 Frame = +3

Query  213   SQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKS  392
             S  I  ++ VL E    TG  IS  Y+ G+ELGRGEFG+TYLCT+  T E +ACK ISK 
Sbjct  41    SGYIDHKLVVLKEP---TGRDISAHYDLGRELGRGEFGITYLCTDVNTDEKLACKSISKK  97

Query  393   KLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKG  572
             KLRT +D+EDVRREVEIM+HLP HPNIVS +  YED  AV++VMELCEGGELFDRIVA+G
Sbjct  98    KLRTAVDIEDVRREVEIMKHLPHHPNIVSLRATYEDDNAVHIVMELCEGGELFDRIVARG  157

Query  573   HYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP  752
             HYTERAAA V +TI+EV+Q+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKP
Sbjct  158   HYTERAAAAVMRTIVEVVQMCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKP  217

Query  753   GQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVR  932
             G+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R
Sbjct  218   GERFNEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIR  277

Query  933   GDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVT  1112
               IDFKRDPWPK+S++AKDLVK ML+ +P  R+T ++VL H W+QNA+  PNV LGE V 
Sbjct  278   SVIDFKRDPWPKVSDNAKDLVKKMLNPDPKLRLTAQQVLGHPWLQNAKKAPNVSLGETVK  337

Query  1113  TRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG  1292
              R+KQF++MNK KKR L VVAE+LS ++V  IKE F MMDT + G ++ EEL+ GL  +G
Sbjct  338   ARLKQFSVMNKLKKRALRVVAEHLSVEEVAGIKEAFDMMDTTRRGKINLEELRIGLQKIG  397

Query  1293  QPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIE  1472
             Q + D D+Q+LM+AADVDG+G LN  EF+ ++VHL  + ND+++HKAF  FD++ SGYIE
Sbjct  398   QQIPDADLQILMEAADVDGDGSLNYGEFVAVSVHLKKMGNDEHIHKAFAFFDQNQSGYIE  457

Query  1473  FEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSK  1652
              EELR+ L + + D  ++ V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+
Sbjct  458   IEELREALND-EVDTCSEDVINAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSR  516

Query  1653  VMLNALSVRLFKDKSVQ  1703
                N+LS++L +D S+Q
Sbjct  517   ERFNSLSLKLMRDGSLQ  533



>ref|XP_010492013.1| PREDICTED: calcium-dependent protein kinase 7-like [Camelina 
sativa]
 ref|XP_010492014.1| PREDICTED: calcium-dependent protein kinase 7-like [Camelina 
sativa]
Length=536

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/535 (60%), Positives = 404/535 (76%), Gaps = 4/535 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C    S+ T    +  +P +  N       T   RS     ++ VL    N TG  +
Sbjct  1     MGNCCGNPSSAT-SESKQGKPKNKSNPFYSNEYTSTDRSGGDGFKLSVLK---NPTGHDM  56

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
             S +Y+ G+E+GRGEFG+TYLCT+KETG+  ACK ISK KLR  ID+EDVRREVEIM+++P
Sbjct  57    SLQYDLGREVGRGEFGITYLCTDKETGDKYACKSISKKKLRAAIDIEDVRREVEIMKNMP  116

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHP IVS K+ +ED + V++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV+Q+CH
Sbjct  117   KHPIIVSLKDAFEDDDDVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICH  176

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             K GVIHRDLKPENFL+AN  E +PLKAIDFGLSI FKPG++F EIVGSPYYMAPEVLRR 
Sbjct  177   KQGVIHRDLKPENFLFANKKETSPLKAIDFGLSICFKPGEQFSEIVGSPYYMAPEVLRRS  236

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+ AKDLV+
Sbjct  237   YGPEIDVWSAGVILYILLCGVPPFWAETEQGVAEAIIRSVIDFKRDPWPRVSDSAKDLVR  296

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R+T  +VL H WI NA+  PNV LGE V  R+KQF++MNK KKR L V+AE
Sbjct  297   KMLEPDPKKRLTAAQVLEHSWILNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAE  356

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             +LS ++   IKE F MMD +K G ++ EELK GL   GQ +AD D+Q+LM+A DVDG+G 
Sbjct  357   HLSVEEAAGIKEAFEMMDVNKRGKINLEELKVGLQKAGQQIADADLQILMEATDVDGDGT  416

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L +  DD  +++V+ 
Sbjct  417   LNYGEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELREALNDELDDTSSEEVIA  476

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  477   AIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  531



>ref|XP_002463047.1| hypothetical protein SORBIDRAFT_02g036730 [Sorghum bicolor]
 gb|EER99568.1| hypothetical protein SORBIDRAFT_02g036730 [Sorghum bicolor]
Length=543

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 390/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I+ +YE G ELGRGEFGVTYLCT++ +GE++ACK ISK KLRT +D+EDVRREVEI
Sbjct  60    TGRDIAARYELGAELGRGEFGVTYLCTDRASGEALACKSISKKKLRTPVDIEDVRREVEI  119

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPN+V+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAALVT+TI+EV
Sbjct  120   MRHLPKHPNVVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVTRTIVEV  179

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E+A LKAIDFGLS+FF PG+RF EIVGSPYYMAPE
Sbjct  180   VQMCHKHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFTPGERFTEIVGSPYYMAPE  239

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  240   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAIDFKRDPWPRVSDNA  299

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+GML+ +P  R+T ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK  L
Sbjct  300   KDLVRGMLNPDPKRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHAL  359

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IK+MF  MD +K+  LSF+ELK GL   G  + D DVQ+LM+AAD 
Sbjct  360   RVIAEHLSVEEAADIKDMFEKMDLNKDQMLSFDELKLGLHKFGHQMPDADVQILMEAADA  419

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+  EF+TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D    +
Sbjct  420   DGNGSLDYGEFVTLSVHLRKIGNDEHLHKAFAYFDRNKSGYIEIDELRESLAD-DLGQNH  478

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+     LS++L KD S+Q
Sbjct  479   EEVINAIIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRERFTNLSLKLQKDGSLQ  538



>ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase 8-like [Solanum tuberosum]
Length=533

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 383/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             T   I  KY+ G+ELGRGEFGVTYLCT+ E GE  ACK ISK KLRT +D++DVRREVEI
Sbjct  50    TRQNIHDKYDLGRELGRGEFGVTYLCTDLEGGEKYACKSISKKKLRTAVDIDDVRREVEI  109

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP HPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA + KT++EV
Sbjct  110   MKHLPVHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAGILKTVVEV  169

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CH+HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+ F EIVGSPYYMAPE
Sbjct  170   VQMCHRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGEHFNEIVGSPYYMAPE  229

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++A
Sbjct  230   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNA  289

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T  +VL H W+ N +  PNV LGE V  R+KQF++MNK KK+ L
Sbjct  290   KDLVKKMLDPDPTRRLTAHQVLEHPWLHNIKKAPNVSLGETVKARLKQFSVMNKLKKKAL  349

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE LS ++V  +KE F MMDT K G ++ EELKDGL  +G  + D D+Q+LM+AADV
Sbjct  350   AVIAEFLSAEEVAGMKEAFEMMDTGKKGKINLEELKDGLQKLGHQIPDADLQILMEAADV  409

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ +++HL  ++ND++LHKAF  FDK+ SGYIE EELR  L + DD N +
Sbjct  410   DGDGSLNYPEFVAVSIHLRKMANDEHLHKAFSFFDKNQSGYIEIEELRSALSDEDDSN-S  468

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V   I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  469   EEVTNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  528



>ref|XP_008450417.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis melo]
Length=531

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 390/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G ELGRGEFGVTYLCT++ TGE +ACK ISK KLRT +D++DVRREV
Sbjct  45    DPTGRDISALYDLGIELGRGEFGVTYLCTDRNTGEKLACKSISKKKLRTAVDIDDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM++LPKHPNIVS ++ YED+ AV++VMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  105   EIMKNLPKHPNIVSLRDTYEDEHAVHIVMELCEGGELFDRIVARGHYTERAAAVVMRTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+ N  E  PLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVVQMCHKHGVMHRDLKPENFLFGNKKETTPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
              EVL+R+YG +VDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP +S+
Sbjct  225   LEVLKRNYGPKVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPIVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  285   NAKDLVKKMLDPDPKRRLTAQEVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F MMDT K G ++ +EL+ GL  +GQ + D D+Q+L++AA
Sbjct  345   ALRVIAEHLSVEEVAGIKEAFEMMDTGKRGKINLDELRVGLQKLGQQIPDPDLQILVEAA  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+DG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ SGYIE EELR+ L + DD+ 
Sbjct  405   DLDGDGTLNYSEFVAVSVHLKKMANDEHLHKAFSFFDKNQSGYIEIEELRNALND-DDET  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               + V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  464   NGEDVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  523

Query  1698  VQ  1703
             + 
Sbjct  524   LH  525



>ref|NP_001147084.1| LOC100280693 [Zea mays]
 gb|ACG25392.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
 gb|ACN27836.1| unknown [Zea mays]
 tpg|DAA41148.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=539

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 392/480 (82%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I+++YE G ELGRGEFGVTYLCT++ +GE++ACK ISK KLRT +DVEDVRREVEI
Sbjct  56    TGRDIAERYELGAELGRGEFGVTYLCTDRASGEALACKSISKKKLRTPVDVEDVRREVEI  115

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPNIV+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAALVT+TI+EV
Sbjct  116   MRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVTRTIVEV  175

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E+A LKAIDFGLS+FF PG+RF EIVGSPYYMAPE
Sbjct  176   VQMCHKHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFTPGERFTEIVGSPYYMAPE  235

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAE+E+G+A AI+R  IDFKRDPWP++S++A
Sbjct  236   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAESEQGVAQAIIRSVIDFKRDPWPRVSDNA  295

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+GML+ +P  R+T ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK  L
Sbjct  296   KDLVRGMLNPDPKRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHAL  355

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IK+MF  MD +K+  L+F+ELK GL   G  + D DVQ+LM+AAD 
Sbjct  356   RVIAEHLSVEEAADIKDMFEKMDLNKDQMLNFDELKLGLHKFGHQIPDADVQILMEAADA  415

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+  EF+TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D    +
Sbjct  416   DGNGSLDYGEFVTLSVHLRKIGNDEHLHKAFAYFDRNQSGYIEIDELRESLAD-DLGQNH  474

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+    +LS++L KD S+Q
Sbjct  475   EEVINAIIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQ  534



>ref|XP_006290868.1| hypothetical protein CARUB_v10016977mg [Capsella rubella]
 gb|EOA23766.1| hypothetical protein CARUB_v10016977mg [Capsella rubella]
Length=539

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 386/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  KY  G+ELGRGEFGVTYLCT+KET +  ACK I K KLRT +D+EDVRREV
Sbjct  53    DPTGREIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRREV  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  113   EIMRHMPVHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIM  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSE  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   SAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFQVMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD++N+GYIE EELR+ L   D+  
Sbjct  413   DIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIEELREAL--SDEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  471   TSEEVIDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  530

Query  1698  VQ  1703
             +Q
Sbjct  531   LQ  532



>ref|XP_009126361.1| PREDICTED: calcium-dependent protein kinase 8 [Brassica rapa]
 ref|XP_009126362.1| PREDICTED: calcium-dependent protein kinase 8 [Brassica rapa]
Length=534

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   EIMKHMPKHPNIVTLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK+GV+HRDLKPENFL+AN  EN+PLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  168   EVVQICHKNGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRHYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRRMLEPDPKKRLSAAEVLEHPWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D D+Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKHGLHKLGQQQIPDTDLQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ S YIE EELR+ L + + D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDKNQSNYIEIEELREALND-EVD  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>emb|CDY44918.1| BnaA02g04230D [Brassica napus]
Length=534

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   EIMKHMPKHPNIVTLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK+GV+HRDLKPENFL+AN  EN+PLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  168   EVVQICHKNGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRHYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRRMLEPDPKKRLSAAEVLEHPWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D D+Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKHGLHKLGQQQIPDTDLQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ S YIE EELR+ L + + D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDKNQSDYIEIEELREALND-EVD  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>ref|XP_010427632.1| PREDICTED: calcium-dependent protein kinase 32-like [Camelina 
sativa]
Length=537

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 385/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  KY  G+ELGRGEFGVTYLCT+KE  +  ACK I K KLRT +D+EDV REV
Sbjct  53    DPTGREIESKYTLGRELGRGEFGVTYLCTDKENDDVFACKSILKKKLRTAVDIEDVWREV  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  113   EIMRHMPVHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIM  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S+
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSD  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   NAKDLIRKMLDPDQRRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  V   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFQIMDTSQRGRINIDELKIGLQKLGHAVPQDDLQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  413   DIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--ADEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  471   TSEEVVDAIIHDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  530

Query  1698  VQ  1703
             +Q
Sbjct  531   LQ  532



>gb|AGG35977.1| calcium-dependent protein kinase 8, partial [Brassica napus]
 emb|CDY42266.1| BnaC02g08720D [Brassica napus]
Length=534

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 391/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   EIMKHMPKHPNIVTLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK+GV+HRDLKPENFL+AN  EN+PLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  168   EVVQICHKNGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRHYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRRMLEPDPKKRLSAAEVLEHPWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D D+Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKHGLHKLGQQQIPDTDLQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FDK+ S YIE EELR+ L + + D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDKNQSDYIEIEELREALND-EVD  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFAAMMRAGTDWRKASRQYSRERFNSLSLKLMRDG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>ref|XP_011015928.1| PREDICTED: calcium-dependent protein kinase 32-like [Populus 
euphratica]
Length=532

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I ++YE G+ELGRGEFG+TYLCT+KETGE+ ACK ISK KLRT +D+EDVRREV
Sbjct  46    DPTGKEIEQRYELGRELGRGEFGITYLCTDKETGENFACKSISKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+P+HPN+V+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  106   EIMKHMPQHPNLVTLKDTYEDDSAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  166   EVVQICHEHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+SE
Sbjct  226   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSE  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V TR+KQF++MNK KKR
Sbjct  286   HAKDLVRKMLDPDPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVRTRLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +GQ V + D+Q+LM+  
Sbjct  346   ALRVIAEHLSVEEVAGIKEGFQVMDTGNKGKINIDELRVGLQKLGQQVPETDLQILMEVG  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+  EF+ + VHL  + ND++L KAF  FD++ SG+IE +ELRD L + + D 
Sbjct  406   DADRDGYLDYGEFMAITVHLRKMGNDEHLRKAFEFFDQNQSGHIEIDELRDALAD-EVDG  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              N+ V+  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+  LN LS++L KD S
Sbjct  465   SNEDVINAIIHDVDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERLNNLSLKLMKDGS  524

Query  1698  VQ  1703
             ++
Sbjct  525   LK  526



>ref|XP_009120885.1| PREDICTED: calcium-dependent protein kinase 8-like [Brassica 
rapa]
Length=534

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 392/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+  Y+ G+E+GRGEFG+TYLCT+  TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDITLMYDLGREVGRGEFGITYLCTDINTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   EIMKHMPKHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHK+GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FF+PG+ F EIVGSPYYMA
Sbjct  168   EVVQVCHKNGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFRPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRKMLEPDPKKRLSAAEVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD++K G ++ E+LK GL  +G Q +AD D+Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSNKTGKINLEQLKHGLHKLGQQQMADADLQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR  L + ++D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSNYIEIEELRQALND-EED  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>gb|AHN16203.1| CPK8-2.1 [Brassica napus]
Length=534

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 392/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+  Y+ G+E+GRGEFG+TYLCT+  TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDITLMYDLGREVGRGEFGITYLCTDINTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   EIMKHMPKHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHK+GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FF+PG+ F EIVGSPYYMA
Sbjct  168   EVVQVCHKNGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFRPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRKMLEPDPKKRLSAAEVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD++K G ++ E+LK GL  +G Q +AD D+Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSNKTGKINLEQLKHGLHKLGQQQMADADLQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR  L + ++D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSNYIEIEELRQALND-EED  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>ref|XP_011078890.1| PREDICTED: calcium-dependent protein kinase 32-like [Sesamum 
indicum]
Length=525

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/534 (60%), Positives = 400/534 (75%), Gaps = 13/534 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C ++    T    R +   +P     GGS     +S  +S          N TG  I
Sbjct  1     MGNCCAVPQ--TSDENRGKHKPNPYATDYGGSVPNGGKSTVLS----------NPTGYNI  48

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
              + YE G+ELGRGEFG+TYLCT+K  GE  ACK ISK KLRT +D+EDVRREVEIMRHLP
Sbjct  49    KEFYELGRELGRGEFGITYLCTDKSNGEIFACKSISKKKLRTRVDIEDVRREVEIMRHLP  108

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EVIQ CH
Sbjct  109   KHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEVIQNCH  168

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             KHGV+HRDLKPENFL++N  E APLKAIDFGLSIFFKPG+RF EIVGSPYYMAPEVL+R+
Sbjct  169   KHGVMHRDLKPENFLFSNKKETAPLKAIDFGLSIFFKPGERFDEIVGSPYYMAPEVLKRN  228

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCG+PPFWAETE+G+A AI+R  +DFKRDPWPK+S+ AKDLVK
Sbjct  229   YGPEVDVWSAGVILYILLCGIPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSDKAKDLVK  288

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R+T +EVL H W+QNA++ PNV LGE V  R+KQF++MNK KKR L V+AE
Sbjct  289   KMLNPDPKQRLTAQEVLDHPWLQNAKSAPNVSLGETVRARLKQFSMMNKLKKRALRVIAE  348

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             +LS ++V  IKE F +MDT   G +   EL+ GL  +G  + + D+ +LM+A DVD +G 
Sbjct  349   HLSVEEVAGIKEGFQLMDTGNKGKIDINELRTGLHKLGHQIPEADLLVLMEAGDVDKDGY  408

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             L+C EF+ ++VHL  + N+D+L KAF  FDK+ +GYIE EELRD   + + +  +++V+ 
Sbjct  409   LDCGEFVAISVHLRKMGNEDHLRKAFEFFDKNETGYIEIEELRDAFAD-EAEPTSEEVIN  467

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
              II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L KD S+
Sbjct  468   AIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSL  521



>ref|XP_002313342.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE87297.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=533

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 386/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I   Y+ G+ELGRGEFG+TYLCT+  +G+  ACK ISK KLRT +D++DVRREVEI
Sbjct  52    TGRDILAHYDLGRELGRGEFGITYLCTDVNSGDKFACKSISKKKLRTAVDIDDVRREVEI  111

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP HPNIV+ K  YED  AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+EV
Sbjct  112   MKHLPAHPNIVTLKASYEDDTAVHIVMELCEGGELFDRIVARGHYTERAAAAVMRTIVEV  171

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  172   VQMCHKHGVMHRDLKPENFLFANKKETAVLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  231

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             +L+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  232   ILKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSFIDFKRDPWPRVSDNA  291

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK ML+ +P  R+T ++VL H WIQNA+  PNVPLGE V  R+KQF++MNK KKR L
Sbjct  292   KDLVKKMLNPDPKLRLTAQQVLEHPWIQNAKKAPNVPLGETVRARLKQFSVMNKLKKRAL  351

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++V  IKE F MMDT K G+++ EEL+ GL  +GQ +AD D+++LM+AADV
Sbjct  352   RVIAEHLSVEEVAGIKEAFDMMDTGKRGSINLEELRVGLQKLGQNIADADLRILMEAADV  411

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VH+  + ND++LHKAF  FD++ SGYIE EELR+ L + D D  N
Sbjct  412   DGDGALNYGEFVAISVHIKKMGNDEHLHKAFAFFDRNQSGYIEIEELRESLND-DVDTNN  470

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             + V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N LS+ L +D S+Q
Sbjct  471   EDVINAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNNLSITLRRDGSLQ  530



>ref|XP_002878160.1| calcium-dependent protein kinase 32 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54419.1| calcium-dependent protein kinase 32 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 389/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  255   HNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrre  434
             ++ TG  I  KY  G+ELGRGEFGVTYLCT+KET +  ACK I K KLRT +D+EDVRRE
Sbjct  52    NDPTGREIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRRE  111

Query  435   veiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTI  614
             VEIMRH+P+HPN+V+ KE +ED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI
Sbjct  112   VEIMRHMPEHPNVVTLKETFEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTI  171

Query  615   LEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYM  794
             +EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYM
Sbjct  172   MEVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFDEIVGSPYYM  231

Query  795   APEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKIS  974
             APEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S
Sbjct  232   APEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVS  291

Query  975   EDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKK  1154
             E+AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KK
Sbjct  292   ENAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKK  351

Query  1155  RVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDA  1334
             R L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA
Sbjct  352   RALRVIAEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDA  411

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
              D+D +G L+C+EFI ++VHL  + ND++L KAF  FD++N+GYIE +ELR+ L   D+ 
Sbjct  412   GDIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIDELREAL--SDEL  469

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D 
Sbjct  470   GTSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDA  529

Query  1695  SVQ  1703
             S+Q
Sbjct  530   SLQ  532



>ref|XP_010555020.1| PREDICTED: calcium-dependent protein kinase 8 [Tarenaya hassleriana]
 ref|XP_010555021.1| PREDICTED: calcium-dependent protein kinase 8 [Tarenaya hassleriana]
 ref|XP_010555022.1| PREDICTED: calcium-dependent protein kinase 8 [Tarenaya hassleriana]
Length=531

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 391/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+ELGRGEFG+TYLC++  TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  45    DPTGHDISGMYDLGRELGRGEFGITYLCSDIRTGEEYACKSISKKKLRTAVDIEDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  105   EIMKHMPKHPNIVTLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLSIFFKPG+RF EIVGSPYYMA
Sbjct  165   EVVQMCHKHGVMHRDLKPENFLFANKKETSVLKAIDFGLSIFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  225   PEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WI NA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  285   SAKDLVRKMLEPDPKKRLSASEVLEHPWILNAKKAPNVSLGETVKARLKQFSVMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F MMDT+K G ++ +EL++GL  +GQ + D DVQ+LM++A
Sbjct  345   ALRVIAEHLSVEEVAGIKEAFDMMDTNKKGKINLDELRNGLQKLGQQIPDADVQILMESA  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EEL + L + + D 
Sbjct  405   DVDGDGTLNYAEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIEELHEALND-EVDT  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ S
Sbjct  464   SSEEVVSAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS  523

Query  1698  VQ  1703
             +Q
Sbjct  524   LQ  525



>ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase 8-like [Fragaria 
vesca subsp. vesca]
Length=532

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 391/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCT+  +GE  ACK ISK KLRT +D+EDVRREV
Sbjct  46    DPTGKDISAQYDLGRELGRGEFGVTYLCTDLSSGEKYACKSISKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP+HPNIVS K+ YED EAV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  106   EIMRHLPQHPNIVSLKDTYEDDEAVHIVMELCEGGELFDRIVARGHYTERAAAAVMRTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             E++Q CHKHGV+HRDLKPENFL+AN  E+A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  166   EIVQSCHKHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFKPGEQFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  226   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV  MLD +P  R+T + VL H WIQNA+  PNVPLGE V  R+KQF++MNK KKR
Sbjct  286   NAKDLVTKMLDPDPKKRLTAQGVLDHPWIQNAKKAPNVPLGETVRARLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MD D  G +S ++L+ G+  +GQ + D D+++LM+AA
Sbjct  346   ALGVIAEHLSVEEVAGIKEAFQLMDADNKGKVSLDQLRSGIQKLGQQIPDPDLKILMEAA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++L KAF  FD++ SGYIE EELR+ L + D D 
Sbjct  406   DVDGDGALNYGEFVAVSVHLKKMANDEHLRKAFEFFDQNQSGYIEIEELRNALND-DVDA  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM +GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  465   GGEEVIHAIMHDVDTDKDGRISYEEFVAMMKSGTDWRKASRQYSRERFNSISLKLMREGS  524

Query  1698  VQ  1703
             +Q
Sbjct  525   LQ  526



>ref|XP_007028795.1| Calcium-dependent protein kinase 19 [Theobroma cacao]
 gb|EOY09297.1| Calcium-dependent protein kinase 19 [Theobroma cacao]
Length=533

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 391/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I + YE G+ELGRGEFG+TYLCT+K TG++ ACK ISK KLRT +D++DVRREV
Sbjct  47    DPTGTEIEQSYELGRELGRGEFGITYLCTDKVTGDTFACKSISKKKLRTAVDIDDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+
Sbjct  107   EIMKHLPKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKPGERFTEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  227   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSFIDFKRDPWPKVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ ML+ +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  287   NAKDLVRKMLNPDPKQRLTAQEVLDHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE+F +MDT   G ++ +EL+ GL  +G  + D D+Q+LM+A 
Sbjct  347   ALRVIAEHLSVEEVAGIKEVFQLMDTGNRGKINIDELRVGLHKLGHTIPDADLQILMEAG  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+  EF+ ++VHL  + ND++L KAF  FD++ SG+IE EELRD L +  + N
Sbjct  407   DVDRDGYLDYGEFVAISVHLRKMGNDEHLKKAFEFFDRNQSGFIEIEELRDALADEVETN  466

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  467   -SEEVISAIMHDVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  525

Query  1698  VQ  1703
             +Q
Sbjct  526   LQ  527



>ref|XP_006489929.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X1 
[Citrus sinensis]
Length=536

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/484 (64%), Positives = 388/484 (80%), Gaps = 6/484 (1%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++YE G+ELGRGEFGVTYLCT++E G++ ACK ISK KLRT +D+EDVRREV+I
Sbjct  49    TGREIEERYELGRELGRGEFGVTYLCTDRENGDAFACKSISKKKLRTAVDIEDVRREVDI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKH NIV  K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  109   MRHLPKHQNIVCLKDTYEDDTAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP----GQRFKEIVGSPYY  791
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKP    G++F EIVGSPYY
Sbjct  169   VQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPVTSAGEKFSEIVGSPYY  228

Query  792   MAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKI  971
             MAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+
Sbjct  229   MAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKV  288

Query  972   SEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFK  1151
             SE+AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK K
Sbjct  289   SENAKDLVRKMLDPDPKQRLTAQQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLK  348

Query  1152  KRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMD  1331
             KR L V+A++LS ++V  IKE FHMMD    G ++ +EL+ GL  +G  + D DVQ+LMD
Sbjct  349   KRALKVIAQHLSVEEVAGIKEGFHMMDIGNRGKINIDELRVGLHKLGHQIPDTDVQILMD  408

Query  1332  AADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDD  1511
             A DVD +G L+  EF+ ++VHL  + ND++LHKAF  FD++ +GYIE EELRD L   D+
Sbjct  409   AGDVDKDGYLDYGEFVAISVHLRKMGNDEHLHKAFQFFDQNQTGYIELEELRDAL--ADE  466

Query  1512  DNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
              + +++VV  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD
Sbjct  467   VDTSEEVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKD  526

Query  1692  KSVQ  1703
              S+Q
Sbjct  527   GSLQ  530



>emb|CDY14001.1| BnaC09g38250D [Brassica napus]
Length=530

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 392/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+  Y+ G+E+GRGEFG+TYLCT+  TG+  ACK ISK KLRT +D+EDVRREV
Sbjct  44    DPTGHDITLMYDLGREVGRGEFGITYLCTDVNTGDKYACKSISKKKLRTAVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  104   EIMKHMPKHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHK+GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FF+PG+ F EIVGSPYYMA
Sbjct  164   EVVQVCHKNGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFRPGEGFNEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE
Sbjct  224   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSE  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  284   TAKDLVRKMLEPDPKKRLSAAEVLEHPWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD++K G ++ E+LK GL  +G Q +AD D+Q+LM+A
Sbjct  344   ALRVIAEHLSVEEVAGIKEAFEMMDSNKTGKINLEQLKHGLHKLGQQQMADADLQILMEA  403

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR  L + ++D
Sbjct  404   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSDYIEIEELRQALND-EED  462

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  463   TSSEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  522

Query  1695  SVQ  1703
             S+Q
Sbjct  523   SLQ  525



>ref|XP_010546723.1| PREDICTED: calcium-dependent protein kinase 32-like [Tarenaya 
hassleriana]
Length=533

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/480 (65%), Positives = 384/480 (80%), Gaps = 2/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  KY  G+ELGRGEFGVTYLCT+KETG + ACK I K KLRT +D+EDVRREVEI
Sbjct  49    TGREIGLKYTLGRELGRGEFGVTYLCTDKETGVNFACKSILKKKLRTAVDIEDVRREVEI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP+HPNIVS KE YED  AV+LVMELCEGGELFDRIVAKGHYTERAAA VTKTI+EV
Sbjct  109   MKHLPEHPNIVSLKETYEDANAVHLVMELCEGGELFDRIVAKGHYTERAAASVTKTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+A+  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  169   VQMCHKHGVMHRDLKPENFLFADKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  228

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+RDYG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPKIS++A
Sbjct  229   VLKRDYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKISQNA  288

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R+T  +VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  289   KDLVRKMLDPDPKRRLTAHQVLDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKRAL  348

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F +MDT++ G ++ +EL+ GL  +G  V++ D+Q+LM+A DV
Sbjct  349   RVIAEHLSVEEASGIKEGFQVMDTNQRGKINIDELRLGLQKLGHNVSEDDLQILMEAGDV  408

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+C EF+ ++VHL  + ND +L KAF  FD+D SG+IE EELRD L   D+ +  
Sbjct  409   DKDGYLDCNEFVAISVHLRKMGNDVHLKKAFEFFDRDRSGFIEIEELRDAL--SDEVDST  466

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++VV  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N LS+ L +D S Q
Sbjct  467   EEVVDAIIRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLNLMRDGSFQ  526



>emb|CDX92529.1| BnaA10g15680D [Brassica napus]
Length=534

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 392/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+  Y+ G+E+GRGEFG+TYLCT+  TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDITLMYDLGREVGRGEFGITYLCTDINTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   EIMKHMPKHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHK+GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FF+PG+ F EIVGSPYYMA
Sbjct  168   EVVQVCHKNGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFRPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  228   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRRMLEPDPKKRLSAAEVLEHPWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD++K G ++ E+LK GL  +G Q +AD D+Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSNKTGKINLEQLKHGLHKLGQQQMADADLQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR  L + ++D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSNYIEIEELRQALND-EED  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>ref|XP_006400505.1| hypothetical protein EUTSA_v10013210mg [Eutrema salsugineum]
 gb|ESQ41958.1| hypothetical protein EUTSA_v10013210mg [Eutrema salsugineum]
Length=534

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/536 (60%), Positives = 410/536 (76%), Gaps = 8/536 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C +   + T  +  N +P +  N     + T   RS     ++ VL    + TG  I
Sbjct  1     MGNCCASPGSDTGSK--NGKPKNKSNPFYSEAYTTTNRSGA-GFKLSVLK---DPTGHDI  54

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
             S  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREVEIM+H+P
Sbjct  55    SLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMP  114

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTILEV+Q+CH
Sbjct  115   KHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTILEVVQICH  174

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             K+GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+ F EIVGSPYYMAPEVLRR 
Sbjct  175   KNGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEGFNEIVGSPYYMAPEVLRRH  234

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+ AKDLV+
Sbjct  235   YGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDTAKDLVR  294

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R++  EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR L V+AE
Sbjct  295   KMLEPDPKKRLSAAEVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAE  354

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDAADVDGNG  1355
             +LS ++V  IKE F MMD +K G ++ EELK GL  +G Q + D D+Q+LM+AADVDG+G
Sbjct  355   HLSVEEVAGIKEAFEMMDINKTGKINLEELKHGLHKLGQQQIPDADLQILMEAADVDGDG  414

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
              LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR  L + +DD  +++V+
Sbjct  415   TLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSNYIEIEELRQALND-EDDTSSEEVI  473

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
               I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ S+Q
Sbjct  474   AAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMREGSLQ  529



>ref|XP_009603083.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 387/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I++KY+ G ELGRGEFGVTYLCT+ +TGE  ACK ISK KLRT +D++DVRREV
Sbjct  49    DPTGHNINEKYDLGCELGRGEFGVTYLCTDVDTGEKYACKSISKKKLRTAVDIDDVRREV  108

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ ++ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA + +TI+
Sbjct  109   EIMKHLPKHPNIVTLRDTYEDDSAVHIVMELCEGGELFDRIVARGHYTERAAAGIMRTIV  168

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  169   EVVQMCHRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGEHFNEIVGSPYYMA  228

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  229   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  288

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QN +  PNV LGE V  R+KQF++MNK KKR
Sbjct  289   NAKDLVKKMLDPDPTRRLTAQQVLEHTWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKR  348

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE LS ++V  +KE F  MDT K G ++  ELK GL  +G  + D D+Q+LM+AA
Sbjct  349   ALTVIAEFLSAEEVAGMKEAFDQMDTGKKGKINLGELKIGLQKLGHQIPDADLQILMEAA  408

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR  L + DD N
Sbjct  409   DVDRDGCLNYAEFVAVSVHLRKMANDEHLHKAFSFFDRNQSGYIEIEELRSALSDEDDGN  468

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  469   -SEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  527

Query  1698  VQ  1703
             +Q
Sbjct  528   LQ  529



>gb|KDO53692.1| hypothetical protein CISIN_1g009367mg [Citrus sinensis]
Length=536

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 388/484 (80%), Gaps = 6/484 (1%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++YE G+ELGRGEFG+TYLCT++E G++ ACK ISK KLRT +D+EDVRREV+I
Sbjct  49    TGREIEERYELGRELGRGEFGITYLCTDRENGDAFACKSISKKKLRTAVDIEDVRREVDI  108

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKH NIV  K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  109   MRHLPKHQNIVCLKDTYEDDTAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  168

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP----GQRFKEIVGSPYY  791
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKP    G++F EIVGSPYY
Sbjct  169   VQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPVTSAGEKFSEIVGSPYY  228

Query  792   MAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKI  971
             MAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+
Sbjct  229   MAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKV  288

Query  972   SEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFK  1151
             SE+AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK K
Sbjct  289   SENAKDLVRKMLDPDPKRRLTAQQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLK  348

Query  1152  KRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMD  1331
             KR L V+A++LS ++V  IKE FHMMD    G ++ +EL+ GL  +G  + D DVQ+LMD
Sbjct  349   KRALKVIAQHLSVEEVAGIKEGFHMMDIGNRGKINIDELRVGLHKLGHQIPDTDVQILMD  408

Query  1332  AADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDD  1511
             A DVD +G L+  EF+ ++VHL  + ND++LHKAF  FD++ +GYIE EELRD L   D+
Sbjct  409   AGDVDKDGYLDYGEFVAISVHLRKMGNDEHLHKAFQFFDQNQTGYIELEELRDAL--ADE  466

Query  1512  DNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
              + +++VV  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD
Sbjct  467   VDTSEEVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKD  526

Query  1692  KSVQ  1703
              S+Q
Sbjct  527   GSLQ  530



>gb|KDP22101.1| hypothetical protein JCGZ_25932 [Jatropha curcas]
Length=537

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/480 (64%), Positives = 386/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I+  Y+ G+ELGRGEFGVTYLCT+   GE  ACK ISK KLRT +D+EDVRREVEI
Sbjct  56    TGRDITAHYDLGRELGRGEFGVTYLCTDINNGEKFACKSISKKKLRTAVDIEDVRREVEI  115

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP HPNIV+    YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+EV
Sbjct  116   MKHLPIHPNIVTLTATYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMRTIVEV  175

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  176   VQMCHKHGVMHRDLKPENFLFANRKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  235

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++A
Sbjct  236   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNA  295

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK ML+ +P  R+T  +VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  296   KDLVKKMLNPDPKLRLTAHQVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  355

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVAE+LS ++V  +KE F MMDT + G ++ EEL+ GL  +GQ + D D+++LMDAADV
Sbjct  356   RVVAEHLSVEEVAGLKEAFEMMDTTQRGKINIEELRIGLQRLGQQIPDADLRILMDAADV  415

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ ++VH+  ++ND++LHKAF  FD++ SGYIE EELR+ L + + D  +
Sbjct  416   DGDGTLNYGEFVAVSVHIRKMANDEHLHKAFAFFDQNQSGYIEIEELREALSD-EVDTCS  474

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             + ++  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  475   EDIINAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  534



>ref|XP_008648353.1| PREDICTED: calcium-dependent protein kinase 8-like [Zea mays]
 gb|AFW74233.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
 tpg|DAA63193.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=539

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/483 (65%), Positives = 388/483 (80%), Gaps = 3/483 (1%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+ +YE G ELGRGEFGVTYLCT++ +GE++ACK ISK KLRT +D+EDVRREV
Sbjct  54    DPTGRDIAARYELGAELGRGEFGVTYLCTDRASGEALACKSISKKKLRTAVDLEDVRREV  113

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLPKHPN+V+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAALV +TI+
Sbjct  114   EIMRHLPKHPNVVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVLRTIV  173

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E+A LKAIDFGLS+FF PG+RF EIVGSPYYMA
Sbjct  174   EVVQMCHKHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFTPGERFSEIVGSPYYMA  233

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  234   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  293

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+GML+ +P  R+T  +VL H W+QN +  PNV LGE V  R++QF++MNKFKK 
Sbjct  294   NAKDLVRGMLNPDPKRRLTAHQVLGHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKH  353

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   IK+MF  MD +K+  LSFEELK GL   G  + D DVQ LM+AA
Sbjct  354   ALRVIAEHLSVEEAADIKDMFEKMDLNKDQMLSFEELKLGLHKFGHQMPDADVQTLMEAA  413

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D DGNG LN  EF+TL VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L   DD  
Sbjct  414   DADGNGSLNYGEFVTLFVHLRKIGNDEHLHKAFAYFDRNQSGYIEIDELRESL--ADDLG  471

Query  1518  KN-DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             +N ++++  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+    +LS++L KD 
Sbjct  472   QNREEIINAIIRDVDTDKDGKISYDEFATMMKAGTDWRKASRQYSRERFTSLSLKLQKDG  531

Query  1695  SVQ  1703
             S+Q
Sbjct  532   SLQ  534



>ref|NP_001151532.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
 gb|ACG43195.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
Length=539

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/483 (65%), Positives = 388/483 (80%), Gaps = 3/483 (1%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I+ +YE G ELGRGEFGVTYLCT++ +GE++ACK ISK KLRT +D+EDVRREV
Sbjct  54    DPTGRDIAARYELGAELGRGEFGVTYLCTDRASGEALACKSISKKKLRTAVDLEDVRREV  113

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLPKHPN+V+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAALV +TI+
Sbjct  114   EIMRHLPKHPNVVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVLRTIV  173

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E+A LKAIDFGLS+FF PG+RF EIVGSPYYMA
Sbjct  174   EVVQMCHKHGVMHRDLKPENFLFANKKESAALKAIDFGLSVFFTPGERFSEIVGSPYYMA  233

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  234   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  293

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+GML+ +P  R+T  +VL H W+QN +  PNV LGE V  R++QF++MNKFKK 
Sbjct  294   NAKDLVRGMLNPDPKRRLTAHQVLGHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKH  353

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   IK+MF  MD +K+  LSFEELK GL   G  + D DVQ LM+AA
Sbjct  354   ALRVIAEHLSVEEAADIKDMFEKMDLNKDQMLSFEELKLGLHKFGHQMPDADVQTLMEAA  413

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D DGNG LN  EF+TL VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L   DD  
Sbjct  414   DADGNGSLNYGEFVTLFVHLRKIGNDEHLHKAFAYFDRNQSGYIEIDELRESL--ADDLG  471

Query  1518  KN-DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             +N ++++  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+    +LS++L KD 
Sbjct  472   QNREEIINAIIRDVDTDKDGKISYDEFATMMKAGTDWRKASRQYSRERFTSLSLKLQKDG  531

Query  1695  SVQ  1703
             S+Q
Sbjct  532   SLQ  534



>ref|XP_002299904.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE84709.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=534

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/497 (63%), Positives = 389/497 (78%), Gaps = 10/497 (2%)
 Frame = +3

Query  240   VLNESHNA---------TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKS  392
             V+NES N          TG  I   Y+ G+ELGRGEFGVTYLCT+  TGE  ACK ISK 
Sbjct  36    VINESGNVDKLGVLKEPTGRDILAHYDLGRELGRGEFGVTYLCTDINTGEKFACKSISKK  95

Query  393   KLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKG  572
             KLRT +D+EDVRREVEIM+HLP HPNIVS K  YED  AV++VMELCEGGELFDRIVA+G
Sbjct  96    KLRTAVDIEDVRREVEIMKHLPAHPNIVSLKASYEDDSAVHIVMELCEGGELFDRIVARG  155

Query  573   HYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP  752
             HYTERAAA V +TI+EV+Q+CHKHGVIHRDLKPENFL+AN  E + LK IDFGLS+FFKP
Sbjct  156   HYTERAAAAVMRTIVEVVQMCHKHGVIHRDLKPENFLFANKKETSALKTIDFGLSVFFKP  215

Query  753   GQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVR  932
             G+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R
Sbjct  216   GERFNEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIR  275

Query  933   GDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVT  1112
               IDFKRDPWP++S++AK LV  ML+ +P  R+T ++VL H WIQNA+  PNVPLGE V 
Sbjct  276   SVIDFKRDPWPRVSDNAKGLVMKMLNPDPKLRLTAQQVLEHPWIQNAKKAPNVPLGETVK  335

Query  1113  TRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG  1292
              R+KQF++MNK KKR L V+AE+LS ++V  IK+ F  MDT K G+++ EEL+ GL  +G
Sbjct  336   ARLKQFSVMNKLKKRALRVIAEHLSVEEVAGIKDAFDSMDTGKKGSINLEELRVGLQKLG  395

Query  1293  QPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIE  1472
             Q +AD D+Q+LM+AAD+DG+G LN  EF+ ++VH+  + ND++LHKAF  FD++ SGYIE
Sbjct  396   QHIADADLQILMEAADIDGDGALNYGEFVAISVHIKKMGNDEHLHKAFAFFDRNQSGYIE  455

Query  1473  FEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSK  1652
              EELR+ L + D D  ++ V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+
Sbjct  456   IEELRESLND-DIDTSSEDVINAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSR  514

Query  1653  VMLNALSVRLFKDKSVQ  1703
                N+LS+ L +D S+Q
Sbjct  515   ERFNSLSITLRRDGSLQ  531



>gb|KFK35001.1| hypothetical protein AALP_AA5G221300 [Arabis alpina]
Length=535

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 387/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  KY+ G+ELGRGEFGVTYLCT+KET +  ACK I K KLRT +D+EDVRREV
Sbjct  50    DPTGREIEVKYKLGRELGRGEFGVTYLCTDKETEDVFACKSILKKKLRTAVDIEDVRREV  109

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P+HPN+V+ KE YED+ AV+LVMELCEGGELFDRIVA+G YTERAAA VTKTI+
Sbjct  110   EIMRHMPEHPNVVTLKETYEDEIAVHLVMELCEGGELFDRIVARGRYTERAAAAVTKTIM  169

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  170   EVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  229

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE
Sbjct  230   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSQLDFRRDPWPKVSE  289

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  290   NAKDLIRKMLDPDQKRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  349

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  +   D+Q+LMDA 
Sbjct  350   ALRVIAEHLSDEEASGIREGFQIMDTSQRGRINIDELKIGLQKLGHTIPQDDLQILMDAG  409

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD++N+GYIE EELR  L   D+  
Sbjct  410   DIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQNNNGYIEIEELRVAL--SDEVG  467

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  468   TSEEVVDAIIRDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  527

Query  1698  VQ  1703
             +Q
Sbjct  528   LQ  529



>ref|XP_006446133.1| hypothetical protein CICLE_v10014873mg [Citrus clementina]
 ref|XP_006446134.1| hypothetical protein CICLE_v10014873mg [Citrus clementina]
 ref|XP_006470625.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Citrus sinensis]
 ref|XP_006470626.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 
[Citrus sinensis]
 ref|XP_006470627.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X3 
[Citrus sinensis]
 gb|ESR59373.1| hypothetical protein CICLE_v10014873mg [Citrus clementina]
 gb|ESR59374.1| hypothetical protein CICLE_v10014873mg [Citrus clementina]
 gb|KDO61234.1| hypothetical protein CISIN_1g009594mg [Citrus sinensis]
 gb|KDO61235.1| hypothetical protein CISIN_1g009594mg [Citrus sinensis]
Length=531

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/535 (60%), Positives = 409/535 (76%), Gaps = 7/535 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C +   + + KR + ++  +  N   G     A  S  + R + VL E    +G  I
Sbjct  1     MGNCCARPDSSSGKRAKGKK--EKPNPFYGDEYVVANGSTVVHR-LCVLKEP---SGQDI  54

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
             S  Y+ G+ELGRGEFGVTYLCT+   GE  ACK ISK KLRT +D+EDVRREV+IM+HLP
Sbjct  55    SIDYDLGRELGRGEFGVTYLCTDVNNGEKFACKSISKKKLRTAVDIEDVRREVQIMKHLP  114

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
             KHPNIVS K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+EV+QVCH
Sbjct  115   KHPNIVSLKDTYEDDSAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQVCH  174

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             + GV+HRDLKPENFL+AN  E++PLKAIDFGLS+FF+PG++F EIVGSPYYMAPEVL+R+
Sbjct  175   EQGVMHRDLKPENFLFANKKESSPLKAIDFGLSVFFRPGEQFNEIVGSPYYMAPEVLKRN  234

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+SE+AKDLVK
Sbjct  235   YGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSENAKDLVK  294

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              ML+ +P  R+T EEVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L VVAE
Sbjct  295   KMLNPDPKQRLTAEEVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRALQVVAE  354

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
              LS ++V  +KE F MMDT+K G ++ EEL+ GL   GQ + + D+Q+LM+AADVDG+G 
Sbjct  355   FLSVEEVAGLKEAFEMMDTNKRGKINLEELRLGLLKGGQNIPEADLQILMEAADVDGDGS  414

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             LN  EF+ ++VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L + + D   + V+ 
Sbjct  415   LNYGEFVAVSVHLKKMANDEHLHKAFSFFDRNRSGFIEIEELRNALND-EVDTSGEDVIN  473

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N++S++L +++ +Q
Sbjct  474   AIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSISLKLMREEGLQ  528



>ref|XP_009369698.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Pyrus x bretschneideri]
Length=533

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGRELGRGEFGVTYLCTETSSDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMQHLPPHPNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R++QF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPKKRLTAKEVLDHPWIQNAKKAPNVPLGETVRARLQQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS  +V  IKE F MMDT   G ++ EEL+ G+  +GQ ++D D+Q+LM+AA
Sbjct  347   ALGVIAEHLSVAEVAGIKEAFQMMDTGNKGKVTIEELRSGIQQLGQNISDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L   D D 
Sbjct  407   DVDGDGALNYGEFVVVTVHLKKMANDEHLHKAFAFFDQNQSGHIEIEELRNALTN-DVDI  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525



>ref|XP_009369699.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 
[Pyrus x bretschneideri]
Length=532

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGRELGRGEFGVTYLCTETSSDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMQHLPPHPNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R++QF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPKKRLTAKEVLDHPWIQNAKKAPNVPLGETVRARLQQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS  +V  IKE F MMDT   G ++ EEL+ G+  +GQ ++D D+Q+LM+AA
Sbjct  347   ALGVIAEHLSVAEVAGIKEAFQMMDTGNKGKVTIEELRSGIQQLGQNISDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L   D D 
Sbjct  407   DVDGDGALNYGEFVVVTVHLKKMANDEHLHKAFAFFDQNQSGHIEIEELRNALTN-DVDI  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525



>ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum tuberosum]
Length=532

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 387/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + T   I +KY+ G ELGRGEFGVTYLCT+ +TG+  ACK ISK KLRT +D++DVRREV
Sbjct  45    DPTRHNIQEKYDLGCELGRGEFGVTYLCTDVDTGDKYACKSISKKKLRTAVDIDDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA++ KTI+
Sbjct  105   EIMKHLPKHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAVIMKTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH HGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVVQMCHMHGVMHRDLKPENFLFGNKKEAAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  225   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QN +  PNV LGE V  R+KQF++MNK KKR
Sbjct  285   NAKDLVKKMLDPDPTRRLTAQQVLEHTWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L ++AE LS ++V  +KE F MMDT K G ++  EL++GL  +G  + D D+Q+LM+AA
Sbjct  345   ALTIMAEFLSAEEVAGMKEAFDMMDTGKKGKINLGELRNGLQKLGHQIPDADLQILMEAA  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G LN  EF+ ++VHL  ++ND++LHKAF +FD+D SGYIE EELR  L + D  N
Sbjct  405   DVDRDGSLNYGEFVAVSVHLRKMANDEHLHKAFSVFDRDQSGYIEIEELRSALSDEDGGN  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  465   -SEEVINAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  523

Query  1698  VQ  1703
             +Q
Sbjct  524   IQ  525



>emb|CDP20654.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 388/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++Y+ G ELGRGEFGVTYLCT+ +T +  ACK ISK KLRT +D+EDVRREVEI
Sbjct  48    TGHDIYERYDLGGELGRGEFGVTYLCTDVDTADKYACKSISKKKLRTAVDIEDVRREVEI  107

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP+HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHY+ERAAA+V KTI+EV
Sbjct  108   MKHLPEHPNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYSERAAAVVMKTIVEV  167

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +QVCH+HGV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+ F EIVGSPYYMAPE
Sbjct  168   VQVCHRHGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGEHFNEIVGSPYYMAPE  227

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+ A
Sbjct  228   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDTA  287

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+   +VL H W+QNA+  PNVPLGE V  R+KQF++MNK KKR L
Sbjct  288   KDLVKKMLDPDPSRRLAASQVLEHPWLQNAKKAPNVPLGETVKARLKQFSVMNKLKKRAL  347

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVAE+LS ++V  I+E F MMD  K G ++ +EL++GL  +G  + D D+Q+L+++ADV
Sbjct  348   KVVAEHLSVEEVAGIRETFEMMDIGKRGKINMDELRNGLKKLGHQIPDADLQILVESADV  407

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G LN  EF+ ++VH+  ++ND++LHKAF  FD++ SGYIE +ELRD L +  D N  
Sbjct  408   DRDGTLNYGEFVAVSVHIRKMANDEHLHKAFAFFDRNQSGYIEIDELRDALSDEGDTNTE  467

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             D V+  I+ D D+DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  468   D-VIAAIMHDVDIDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  526



>ref|XP_011033316.1| PREDICTED: calcium-dependent protein kinase 32-like [Populus 
euphratica]
Length=532

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I ++YE G+ELGRGEFG+TYLCT+KETGE+ ACK ISK KLRT +D+EDVRREV
Sbjct  46    DPTGKEIEQRYELGRELGRGEFGITYLCTDKETGENFACKSISKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+P+HPN+V+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  106   EIMKHMPQHPNLVTLKDTYEDDSAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  166   EVVQICHEHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  226   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V TR+KQF++MNK KKR
Sbjct  286   NAKDLVRKMLDPDPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVRTRLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +GQ V + D+Q+LM+  
Sbjct  346   ALRVIAEHLSVEEVAGIKEGFQVMDTGNKGKINIDELRVGLQKLGQQVPETDLQILMEVG  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+  EF+ + VHL  + ND++L KAF  FD++ SG+IE +ELRD L + + D 
Sbjct  406   DADRDGYLDYGEFMAITVHLRKMGNDEHLRKAFEFFDQNQSGHIEIDELRDALAD-EVDG  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              N+ V+  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+   N LS++L KD S
Sbjct  465   SNEDVINAIIHDVDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGS  524

Query  1698  VQ  1703
             ++
Sbjct  525   LK  526



>ref|XP_004958070.1| PREDICTED: calcium-dependent protein kinase 7-like [Setaria italica]
Length=541

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 390/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I+ +YE G ELGRGEFGVTYLCT++++GE++ACK ISK KLRT +D+EDVRREVEI
Sbjct  58    TGREIAARYELGGELGRGEFGVTYLCTDRDSGEALACKSISKKKLRTPVDIEDVRREVEI  117

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLPKHPN+V+ ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAALVT+TI+EV
Sbjct  118   MRHLPKHPNVVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVTRTIVEV  177

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FF PG+RF EIVGSPYYMAPE
Sbjct  178   VQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFTPGERFTEIVGSPYYMAPE  237

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  238   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAIDFKRDPWPRVSDNA  297

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+GML+ +P  R+T ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK  L
Sbjct  298   KDLVRGMLNPDPKRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHAL  357

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IK+MF  MD +K+  L+F+ELK GL   G  + D DVQ+LM+AAD 
Sbjct  358   RVIAEHLSVEEAADIKDMFEKMDLNKDQMLNFDELKLGLHKFGHQMPDADVQILMEAADA  417

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+  EF+TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D    +
Sbjct  418   DGNGSLDYGEFVTLSVHLRKIGNDEHLHKAFAYFDRNESGYIEIDELRESLAD-DLGQNH  476

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+    +LS++L KD S+Q
Sbjct  477   EEVINAIIRDVDTDKDGKISYDEFATMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQ  536



>ref|XP_008339082.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Malus domestica]
 ref|XP_008339083.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Malus domestica]
Length=533

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGRELGRGEFGVTYLCTEASSDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMQHLPPHPNIVTLKDTYEDGDAVHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R++QF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPKKRLTAKEVLDHPWIQNAKKAPNVPLGETVRARLQQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS  +V  IKE F MMDT   G ++ EEL+ G+  +GQ ++D D+Q+LM+AA
Sbjct  347   ALGVIAEHLSVAEVAGIKEAFQMMDTGNKGKVTIEELRSGIQXLGQNISDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L   D D 
Sbjct  407   DVDGDGALNYGEFVVVTVHLKKMANDEHLHKAFAFFDQNQSGHIEIEELRNALXN-DVDV  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525



>ref|XP_009395591.1| PREDICTED: calcium-dependent protein kinase 8-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/480 (66%), Positives = 383/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  +Y+ G+ELGRGEFGVT LCT+K TGE  ACK ISK KLRT +DVEDVRREVEI
Sbjct  47    TGRDIESRYDLGQELGRGEFGVTCLCTDKATGEHFACKSISKKKLRTAVDVEDVRREVEI  106

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP HPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+V +TI+EV
Sbjct  107   MRHLPSHPNIVSLKDTYEDDTAVHLVMELCEGGELFDRIVARGHYTERAAAMVMRTIVEV  166

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q CHK+GV+HRDLKPENFL+ +  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  167   VQNCHKYGVMHRDLKPENFLFGSKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPE  226

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+RDYG EVDVWSAGVILYILLCGVPPFWAE+E+GIA AI+R  IDFKRDPWPKIS+ A
Sbjct  227   VLKRDYGPEVDVWSAGVILYILLCGVPPFWAESEQGIARAIIRSVIDFKRDPWPKISDTA  286

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T +EVL H W+QNA   PNV LGE V +R++QF++MNK KK+ L
Sbjct  287   KDLVKRMLDPDPKRRLTAQEVLDHPWLQNANKAPNVNLGETVRSRLQQFSVMNKLKKKAL  346

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVAE+LS ++V  IK MF  MD +K G ++ EELK GL  +G  + D DV +LM+AAD 
Sbjct  347   RVVAEHLSVEEVADIKNMFEKMDVNKKGQITLEELKYGLHKLGHHIPDADVIILMEAADA  406

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG L+  EF+ +++HL  + ND++LHKAF  FD++ SGYIE EELRD L + D    +
Sbjct  407   DGNGSLDYGEFVAVSIHLKKIGNDEHLHKAFQYFDQNKSGYIEIEELRDCLAD-DLGPNH  465

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+   N+LS +L KD S+Q
Sbjct  466   EEVINSIIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRERFNSLSSKLMKDGSLQ  525



>ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa]
 gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa]
Length=532

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 388/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I ++YE G+ELGRGEFG+TYLCT+KETGE+ ACK ISK KLRT +D+EDVRREV
Sbjct  46    DPTGKEIEQRYELGRELGRGEFGITYLCTDKETGENFACKSISKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+ +P+HPN+V+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  106   EIMKQMPQHPNLVTLKDTYEDDSAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  166   EVVQICHEHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+SE
Sbjct  226   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSE  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V TR+KQF++MNK KKR
Sbjct  286   NAKDLVRKMLDPDPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVRTRLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +GQ V + D+Q+LM+  
Sbjct  346   ALRVIAEHLSVEEVAGIKEGFQLMDTGNKGKINIDELRVGLQKLGQQVPEIDLQILMEVG  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D D +G L+  EF+ + VHL  + ND++L KAF  FD++ SG+IE +ELRD L + + D 
Sbjct  406   DADRDGYLDYGEFVAITVHLRKMGNDEHLRKAFEFFDQNQSGHIEIDELRDALAD-EVDG  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              N+ V+  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+   N LS++L KD S
Sbjct  465   SNEDVINAIIHDVDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGS  524

Query  1698  VQ  1703
             ++
Sbjct  525   LK  526



>ref|XP_010523987.1| PREDICTED: calcium-dependent protein kinase 32 [Tarenaya hassleriana]
Length=536

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/476 (64%), Positives = 382/476 (80%), Gaps = 2/476 (0%)
 Frame = +3

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I  KY  G+ELGRGEFGVTYLCT+KETGE+ ACK I K KLRT +D+EDVRREVEIMR L
Sbjct  54    IGSKYTLGRELGRGEFGVTYLCTDKETGETFACKSILKKKLRTAVDIEDVRREVEIMRQL  113

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             P+HPNIVS KE YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV+Q+C
Sbjct  114   PQHPNIVSLKEAYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEVVQMC  173

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPEVL+R
Sbjct  174   HKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR  233

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+SE+AKDLV
Sbjct  234   NYGQEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSENAKDLV  293

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             + MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L V+A
Sbjct  294   RKMLDPDPKRRLTAQQVLDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKRALTVIA  353

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             E+LS ++   IKE F +MDT++ G ++ +EL+ GL  +G  + D DVQ+LM+A D+D +G
Sbjct  354   EHLSAEEASGIKEGFQVMDTNRRGKINIDELRIGLQKLGHHIPDDDVQVLMEAGDLDKDG  413

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
              L+  EF+ ++VHL  + ND++L KAF  FD++ SGYIE EELRD L   D+ + +++V+
Sbjct  414   YLDVNEFVAISVHLRKMGNDEHLKKAFQFFDQNKSGYIEIEELRDAL--ADEVDTSEEVI  471

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
               I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+     LS++L +D S+Q
Sbjct  472   DAIMHDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRERFKNLSLKLMRDGSLQ  527



>ref|XP_006843576.1| hypothetical protein AMTR_s00007p00105480 [Amborella trichopoda]
 gb|ERN05251.1| hypothetical protein AMTR_s00007p00105480 [Amborella trichopoda]
Length=526

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/476 (65%), Positives = 386/476 (81%), Gaps = 1/476 (0%)
 Frame = +3

Query  273   GISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRH  452
             G+ +KY   +ELGRGEFGVTYLC ++ T E +ACK ISK KLRT +D+EDVRREV IM H
Sbjct  46    GVDEKYVVDRELGRGEFGVTYLCIDRSTQELLACKSISKRKLRTTVDIEDVRREVAIMNH  105

Query  453   LPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQV  632
             LP H NIVS KE  ED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV+QV
Sbjct  106   LPIHSNIVSLKETCEDENAVHLVMELCEGGELFDRIVARGHYTERAAAGVTKTIMEVVQV  165

Query  633   CHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLR  812
             CHKHGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG+ F EIVGSPYYMAPEVL+
Sbjct  166   CHKHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGETFSEIVGSPYYMAPEVLK  225

Query  813   RDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDL  992
             R+YG E+D+WSAGVILYILLCGVPPFWAE+E+G+A AI+RG IDFKRDPWP ISE+AK L
Sbjct  226   RNYGPEIDIWSAGVILYILLCGVPPFWAESEQGVAQAILRGLIDFKRDPWPSISENAKSL  285

Query  993   VKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVV  1172
             V+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V TR+KQF+++N+FK+R L V+
Sbjct  286   VRQMLEPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDIVKTRLKQFSMLNRFKRRALRVI  345

Query  1173  AENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGN  1352
             AE+LS ++VE IKEMF MMDTD +G +++EELK G+  +G  +++ DVQLLM+A D DGN
Sbjct  346   AEHLSIEEVEDIKEMFKMMDTDNDGTVTYEELKAGIQKLGSQLSEADVQLLMEAVDADGN  405

Query  1353  GMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQV  1532
             G L+  EFI +++HL  ++ND++L KAF  FDKD +G+IE EELR+ L+E D    +  V
Sbjct  406   GTLDYGEFIAVSLHLQRMANDEHLRKAFSYFDKDGNGFIEPEELREALVE-DGITDSVDV  464

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
               +I  + D DKDGRIS+ EF AMM TGTDW+ ASR YS+   N+LS+RL KD S+
Sbjct  465   ANDIFLEVDTDKDGRISYEEFLAMMKTGTDWRKASRHYSRGRFNSLSIRLMKDGSL  520



>ref|XP_009374942.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 
[Pyrus x bretschneideri]
Length=532

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGRELGRGEFGVTYLCTETSSDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMQHLPPHPNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R++QF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPKKRLTAKEVLDHPWIQNAKKAPNVPLGETVRARLQQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS  +V  IKE F +MDT   G ++ EEL+ G+  +GQ ++D D+Q+LM+AA
Sbjct  347   ALGVIAEHLSVAEVAGIKEAFQIMDTGNKGKVTIEELRSGIQQLGQNISDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L   D D 
Sbjct  407   DVDGDGALNYGEFVVVTVHLKKMANDEHLHKAFAFFDQNQSGHIEIEELRNALTN-DVDI  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525



>ref|XP_010504682.1| PREDICTED: calcium-dependent protein kinase 32-like [Camelina 
sativa]
Length=537

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 384/482 (80%), Gaps = 2/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  KY  G+ELGRGEFGVTYLCT+KE  +  ACK I K KLRT +D+EDVRREV
Sbjct  53    DPTGREIESKYTLGRELGRGEFGVTYLCTDKENDDVFACKSILKKKLRTAVDIEDVRREV  112

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P HPN+V+ KE YED+ AV+LV ELCEGGELFDRIVA+ HYTERAAA VTKTI+
Sbjct  113   EIMRHMPVHPNVVTLKETYEDEHAVHLVTELCEGGELFDRIVARDHYTERAAAAVTKTIM  172

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+QVCHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  173   EVVQVCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  232

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S+
Sbjct  233   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVLDFRRDPWPKVSD  292

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDL++ MLD +   R+T ++VL H W+QNA+T PNV LGE V  R+KQFT+MNK KKR
Sbjct  293   NAKDLIRKMLDPDQRRRLTAQQVLDHPWLQNAKTAPNVSLGETVRARLKQFTVMNKLKKR  352

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   I+E F +MDT + G ++ +ELK GL  +G  V   D+Q+LMDA 
Sbjct  353   ALRVIAEHLSDEEASGIREGFQIMDTSQRGRINIDELKIGLQKLGHAVPQDDLQILMDAG  412

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+C+EFI ++VHL  + ND++L KAF  FD+DN+GYIE EELR+ L   D+  
Sbjct  413   DIDRDGYLDCDEFIAISVHLRKMGNDEHLKKAFAFFDQDNNGYIEIEELREAL--ADEVG  470

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  II D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N++S++L +D S
Sbjct  471   TSEEVVDAIIHDVDTDKDGRISYEEFVTMMKTGTDWRKASRQYSRERFNSISLKLMQDAS  530

Query  1698  VQ  1703
             +Q
Sbjct  531   LQ  532



>ref|XP_009374937.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009374938.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009374940.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009374941.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Pyrus x bretschneideri]
Length=533

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGRELGRGEFGVTYLCTETSSDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMQHLPPHPNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R++QF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPKKRLTAKEVLDHPWIQNAKKAPNVPLGETVRARLQQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS  +V  IKE F +MDT   G ++ EEL+ G+  +GQ ++D D+Q+LM+AA
Sbjct  347   ALGVIAEHLSVAEVAGIKEAFQIMDTGNKGKVTIEELRSGIQQLGQNISDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L   D D 
Sbjct  407   DVDGDGALNYGEFVVVTVHLKKMANDEHLHKAFAFFDQNQSGHIEIEELRNALTN-DVDI  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525



>gb|KHG04812.1| Calcium-dependent protein kinase 7 [Gossypium arboreum]
Length=553

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/513 (62%), Positives = 399/513 (78%), Gaps = 27/513 (5%)
 Frame = +3

Query  231   QIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTei  410
             ++RVL E    TG  IS +Y+ G+ELGRGEFGVTYLCT+  TGE  ACK ISK KLRT +
Sbjct  43    KLRVLKE---LTGQDISSQYDLGRELGRGEFGVTYLCTDVNTGEKYACKSISKKKLRTAV  99

Query  411   dvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERA  590
             D+EDVRREVEIM+HLPKH NIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERA
Sbjct  100   DIEDVRREVEIMKHLPKHTNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERA  159

Query  591   AALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPG-----  755
             AA+V +TI+EV+Q+CHKHGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG     
Sbjct  160   AAVVMRTIVEVVQMCHKHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGLLQLS  219

Query  756   -----------------QRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVP  884
                              +RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVP
Sbjct  220   PFYIYAQAAQECSLLTGERFNEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVP  279

Query  885   PFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWI  1064
             PFWAETE+G+A AI+R  IDFKRDPWPK+S++AKDLVK ML+ +P  R+T  EVL H W+
Sbjct  280   PFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNAKDLVKKMLNPDPKQRLTALEVLEHPWL  339

Query  1065  QNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKN  1244
             QNA+  PNVPLGE V  R+KQF++MNK KKR L V+AE+LS ++V  IKE F +MDT K 
Sbjct  340   QNAKKAPNVPLGETVKARLKQFSVMNKLKKRALRVIAEHLSVEEVAGIKEAFDVMDTGKR  399

Query  1245  GNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNL  1424
             G ++ EEL+ GL  +GQ + D D+Q+L++AADVDG+G LN  EF+ ++VHL  ++ND++L
Sbjct  400   GKINLEELRMGLQKLGQQIPDADLQILVEAADVDGDGTLNYGEFVAVSVHLRKMANDEHL  459

Query  1425  HKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAM  1604
             HKAF  FD + SG++E E+LRD L   D+ + +++V+  I+ D D DKDGRIS+ EF AM
Sbjct  460   HKAFAFFDLNQSGFLEIEDLRDSL--NDEVDTSEEVINAIMHDVDTDKDGRISYEEFVAM  517

Query  1605  MTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             M  GTDW+ ASR+YS+   N+LS++L +D S+Q
Sbjct  518   MKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQ  550



>ref|XP_008339084.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 
[Malus domestica]
Length=532

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G+ELGRGEFGVTYLCTE  + E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGRELGRGEFGVTYLCTEASSDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA V +TI+
Sbjct  107   EIMQHLPPHPNIVTLKDTYEDGDAVHIVMELCEGGELFDRIVARGHYTERAAAGVMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H WIQNA+  PNVPLGE V  R++QF++MNK KKR
Sbjct  287   NAKDLVKKMLDPDPKKRLTAKEVLDHPWIQNAKKAPNVPLGETVRARLQQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS  +V  IKE F MMDT   G ++ EEL+ G+  +GQ ++D D+Q+LM+AA
Sbjct  347   ALGVIAEHLSVAEVAGIKEAFQMMDTGNKGKVTIEELRSGIQXLGQNISDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SG+IE EELR+ L   D D 
Sbjct  407   DVDGDGALNYGEFVVVTVHLKKMANDEHLHKAFAFFDQNQSGHIEIEELRNALXN-DVDV  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525



>ref|XP_009366097.1| PREDICTED: calcium-dependent protein kinase 8-like [Pyrus x bretschneideri]
Length=533

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 386/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS +Y+ G ELGRGEFGVTYLCTE    E  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGRDISAQYDLGCELGRGEFGVTYLCTEASLDEKFACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP HPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA + +TI+
Sbjct  107   EIMRHLPPHPNIVTLKDTYEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAGIMRTIV  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  167   EVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  227   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAIDFKRDPWPRVSD  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H WIQNA+  PNVPLGE V  R+KQF++MNK KKR
Sbjct  287   NAKDLVKKMLNPDPKKRLTAQEVLDHHWIQNAKKAPNVPLGETVRARLKQFSIMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+A++LS ++V  IKE F MMD    G ++ EEL+ G+  +GQ + D D+Q+LM+AA
Sbjct  347   ALGVIADHLSVEEVAGIKEAFQMMDAGNKGKVTIEELRSGIQQLGQNIPDPDLQILMEAA  406

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ + VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L + D D 
Sbjct  407   DVDGDGALNYGEFVAVMVHLKRMANDEHLHKAFSFFDQNQSGYIEIEELRNALTD-DVDI  465

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               ++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N++S++L ++ S
Sbjct  466   GGEEVIHAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSISLKLMREGS  525

Query  1698  VQ  1703
             +Q
Sbjct  526   LQ  527



>ref|XP_009393522.1| PREDICTED: calcium-dependent protein kinase 8-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/474 (64%), Positives = 390/474 (82%), Gaps = 2/474 (0%)
 Frame = +3

Query  282   KKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPK  461
             ++Y  G ELGRGEFGVT  CT+ ETGE++ACK ISK K+R+  D+ DVRREVEIM+ L +
Sbjct  63    QRYLLGAELGRGEFGVTRRCTDNETGEALACKIISKRKIRSMEDMVDVRREVEIMKTLSE  122

Query  462   HPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHK  641
             HPNIVS +E YED E+VYL+ME+CEGGELFDRIVAKGHY+ERAAA V KTI+EV+Q+CHK
Sbjct  123   HPNIVSLREAYEDGESVYLIMEVCEGGELFDRIVAKGHYSERAAANVAKTIVEVVQLCHK  182

Query  642   HGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDY  821
             HGVIHRDLKPENFL+AN +E++PLKAIDFGLS+FFKPGQRF E+VGSPYY+APEVL+R Y
Sbjct  183   HGVIHRDLKPENFLFANNSEDSPLKAIDFGLSVFFKPGQRFTEVVGSPYYIAPEVLKRSY  242

Query  822   GHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKG  1001
             G EVDVWSAGVILYILLCGVPPFWAE +EGI  +I+   IDF+R+PWPKIS +AKDLV+ 
Sbjct  243   GPEVDVWSAGVILYILLCGVPPFWAENDEGIIQSILNSSIDFEREPWPKISRNAKDLVQL  302

Query  1002  MLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAEN  1181
             MLD NP +R+T ++VL H W+Q+A   PNV LGE V TR++QF++MN+FKK+ L VVAE 
Sbjct  303   MLDPNPSTRLTAQQVLDHPWLQHANKAPNVSLGETVRTRLQQFSVMNRFKKKALRVVAEQ  362

Query  1182  LSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGML  1361
             L  ++V +IK++F+MMD DKNG L+ EELK+GL ++G PV + DV++L++AADVDGNG L
Sbjct  363   LPIEEVANIKKIFYMMDKDKNGTLTLEELKEGLHIIGNPVPEPDVKMLLEAADVDGNGTL  422

Query  1362  NCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQE  1541
             +CEEF+T++VHL  +S+++ L KAF  FDKD SGYIE +ELR+ L+E   D   +QV+ E
Sbjct  423   DCEEFMTVSVHLKKISSEEQLTKAFNYFDKDGSGYIEMDELREALVE--GDAPTEQVIWE  480

Query  1542  IIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             II D D DKDGRIS+ EF+ MM +G+DW+  SR+YS+ + N L+ +LFKD S++
Sbjct  481   IISDVDTDKDGRISYKEFELMMKSGSDWRNGSRQYSRQLFNNLTKKLFKDSSLK  534



>gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum]
Length=530

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 382/482 (79%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I   YE G+ELGRGEFGVTYLCT+K  GE  ACK ISK KLRT +D+EDVRREV
Sbjct  44    NPTGADIEATYELGRELGRGEFGVTYLCTDKANGEVYACKSISKKKLRTRVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  104   EIMKHLPKHPNIVTLKDTYEDNDAVHIVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQ+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG RF EIVGSPYYMA
Sbjct  164   EVIQMCHKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGGRFNEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+RDYG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ++FKRDPWPK+S+
Sbjct  224   PEVLKRDYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVNFKRDPWPKVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  284   NAKDLVKKMLNPDPSKRLTAQEVLDHPWIQNAKKAPNVSLGETVKARLKQFSMMNKLKKR  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+L+ D+V  IKE F +MD    G +   EL+ GL  +G  + + DV +LMD  
Sbjct  344   ALRVIAEHLTVDEVAGIKEGFQLMDIGNKGKIDLNELRVGLQKLGHQIPESDVHILMDVG  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+  EF+ ++VHL  ++ND++L KAF  FDK+ SGYIE EELR+ L +  + N
Sbjct  404   DVDKDGYLDYGEFVAISVHLRKMANDEHLKKAFEFFDKNQSGYIEIEELREALADEIETN  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N+LS++L KD S
Sbjct  464   -SEEVINAIMHDVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGS  522

Query  1698  VQ  1703
             +Q
Sbjct  523   LQ  524



>ref|XP_009767418.1| PREDICTED: calcium-dependent protein kinase 32-like [Nicotiana 
sylvestris]
Length=530

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 382/482 (79%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I   YE G+ELGRGEFGVTYLCT+K  GE  ACK ISK KLRT +D+EDVRREV
Sbjct  44    NPTGADIEATYELGRELGRGEFGVTYLCTDKANGEVYACKSISKKKLRTRVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  104   EIMKHLPKHPNIVTLKDTYEDNDAVHIVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQ+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  164   EVIQMCHKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+RDYG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ++FKRDPWPK+S+
Sbjct  224   PEVLKRDYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVNFKRDPWPKVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  284   NAKDLVKKMLNPDPSKRLTAQEVLDHPWIQNAKKAPNVSLGETVKARLKQFSMMNKLKKR  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+L+ D+V  IKE F +MD    G +   EL+ GL  +G  + + DV +LMD  
Sbjct  344   ALRVIAEHLTVDEVAGIKEGFQLMDIGNKGKIDVNELRVGLQKLGHQIPESDVHILMDVG  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+  EF+ ++VHL  ++ND++L KAF  FDK+ SGYIE EELR  L +  + N
Sbjct  404   DVDKDGYLDYGEFVAISVHLRKMANDEHLKKAFEFFDKNQSGYIEIEELRGALADEIETN  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N+LS++L KD S
Sbjct  464   -SEEVINAIMHDVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGS  522

Query  1698  VQ  1703
             +Q
Sbjct  523   LQ  524



>ref|NP_197446.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 ref|NP_850853.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 sp|Q42438.1|CDPK8_ARATH RecName: Full=Calcium-dependent protein kinase 8; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK19; Short=AtCDPK19 
[Arabidopsis thaliana]
 gb|AAA67655.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAA67658.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AED92708.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 gb|AED92709.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
Length=533

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 390/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGHDISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+P+HPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  107   EIMKHMPRHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  167   EVVQICHKHGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEGFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE
Sbjct  227   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSE  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  +VL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  287   TAKDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D D+Q+LM+A
Sbjct  347   ALRVIAEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKFGLHKLGQQQIPDTDLQILMEA  406

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR+ L +  D 
Sbjct  407   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSDYIEIEELREALNDEVDT  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             N +++VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ 
Sbjct  467   N-SEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREG  525

Query  1695  SVQ  1703
             S+Q
Sbjct  526   SLQ  528



>gb|KHG11892.1| Calcium-dependent protein kinase 32 [Gossypium arboreum]
Length=531

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/479 (64%), Positives = 387/479 (81%), Gaps = 1/479 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I ++YE G+ELGRGEFG+TYLCT+K+TGE+ ACK ISK KLRT +D+EDVRRE++I
Sbjct  47    TGREIEQRYELGRELGRGEFGITYLCTDKDTGENFACKSISKKKLRTAVDIEDVRREIKI  106

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP+HPNIV+ K+ +ED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  107   MKHLPEHPNIVTLKDTFEDENAVHLVMELCEGGELFDRIVARGHYTERAAAAVAKTIVEV  166

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+ N  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  167   VQMCHKHGVMHRDLKPENFLFENKKETAALKAIDFGLSVFFKPGERFTEIVGSPYYMAPE  226

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ++FKRDPWPK+S  A
Sbjct  227   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAILRSVVEFKRDPWPKVSASA  286

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK ML+ +P  R+T +EVLAH W+QNA+T PNV LGE V  R+KQF++MNK KKR L
Sbjct  287   KDLVKKMLNPDPKRRLTAQEVLAHPWLQNAKTAPNVSLGETVKARLKQFSVMNKLKKRAL  346

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+L+ ++   IKE F +MDT   G ++ +EL+DGL  +GQ ++D D+Q+LMDA DV
Sbjct  347   RVIAEHLTVEETADIKERFQVMDTGNRGKINIDELRDGLHKLGQIISDADLQVLMDAGDV  406

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             + +G L+  EF  +++HL  + ND++L KAF  FDKD SGYIE EELRD L +  + N  
Sbjct  407   NRDGYLDYGEFTAISIHLRKMGNDNHLKKAFEFFDKDQSGYIEIEELRDELADELETN-G  465

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N LS++L KD S+
Sbjct  466   EEVITAIMHDVDTDKDGRISYDEFVAMMKAGTDWRKASRQYSRQRFNNLSLKLMKDGSL  524



>ref|XP_002873948.1| calcium-dependent protein kinase 19 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50207.1| calcium-dependent protein kinase 19 [Arabidopsis lyrata subsp. 
lyrata]
Length=533

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 389/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+E+GRGEFG+TYLCT+  TG+  ACK ISK KLRT +D+EDVRREV
Sbjct  47    DPTGHDISLMYDLGREVGRGEFGITYLCTDINTGDKYACKSISKKKLRTAVDIEDVRREV  106

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  107   EIMKHMPKHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  166

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  167   EVVQICHKHGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEGFNEIVGSPYYMA  226

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE
Sbjct  227   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSE  286

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  +VL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  287   TAKDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  346

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D D+Q+LM+A
Sbjct  347   ALRVIAEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKFGLHKLGQQQIPDTDLQILMEA  406

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR+ L + + D
Sbjct  407   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSNYIEIEELREALND-EID  465

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ 
Sbjct  466   TSSEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREG  525

Query  1695  SVQ  1703
             S+Q
Sbjct  526   SLQ  528



>ref|XP_009396383.1| PREDICTED: calcium-dependent protein kinase 7-like [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/519 (61%), Positives = 400/519 (77%), Gaps = 8/519 (2%)
 Frame = +3

Query  159   PIDPENVRGGGSRTRAPRS----QKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFG  326
             P+DPE  +    +   P S       +  + VL +S    G  I  +Y+ G+ELGRGEFG
Sbjct  8     PVDPEKKKAKKKKKPNPFSTDGHHGPTPSLVVLKDS---AGRDIRSRYDLGRELGRGEFG  64

Query  327   VTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKE  506
             +TYLCT+K++G+  ACK ISK KLRT +D+EDVRREVEIMRHLP HPNIVS ++ YED  
Sbjct  65    ITYLCTDKDSGDLFACKSISKKKLRTIVDIEDVRREVEIMRHLPSHPNIVSLRDTYEDDA  124

Query  507   AVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLY  686
             AV+LVMELCEGGELFDRIVA+GHYTERAAA+V +TI++V+Q CH HGV+HRDLKPENFL+
Sbjct  125   AVHLVMELCEGGELFDRIVARGHYTERAAAMVIRTIVQVVQNCHMHGVMHRDLKPENFLF  184

Query  687   ANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYI  866
              N NENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMAPEVL+R+YG E+DVWSAGVILYI
Sbjct  185   GNKNENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKRNYGPEIDVWSAGVILYI  244

Query  867   LLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEV  1046
             LLCGVPPFWAETE+GIA AI+R  IDF+RDPWPK+S+ AKDLVK MLD +P  R+T +EV
Sbjct  245   LLCGVPPFWAETEQGIAQAIIRSVIDFRRDPWPKVSDAAKDLVKRMLDPDPNKRLTAQEV  304

Query  1047  LAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHM  1226
             L H W+QNA+  PNV LGE V  R++QF++MNKFKK+ L VVAE+LS ++V  IK+MF  
Sbjct  305   LDHPWLQNAKKAPNVNLGESVRARLQQFSVMNKFKKKALRVVAEHLSVEEVADIKDMFEK  364

Query  1227  MDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNL  1406
             +D +  G ++ EELK GL  +  P++D D+++LMDAAD DGNG LN  EF+ +++H+  +
Sbjct  365   IDVNSKGQITLEELKHGLHKLEYPISDADLKILMDAADADGNGSLNYREFVAVSIHIRKI  424

Query  1407  SNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISF  1586
              ND++LHKAF  FD++N+GYIE EEL D L +    N +++V+  II D D DKDG+IS+
Sbjct  425   GNDEHLHKAFRYFDRNNTGYIEIEELSDCLADELGPN-HEEVINAIIRDVDTDKDGKISY  483

Query  1587  PEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
              EF  MM  GTDW+ ASR+YS+   + LS +L KD S+Q
Sbjct  484   EEFATMMKAGTDWRKASRQYSRERFSNLSSKLMKDGSLQ  522



>ref|XP_009597085.1| PREDICTED: calcium-dependent protein kinase 32-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/482 (64%), Positives = 383/482 (79%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I   YE G+ELGRGEFGVTYLCT+K  GE  ACK ISK KLRT +D+EDVRREV
Sbjct  44    NPTGADIEATYELGRELGRGEFGVTYLCTDKANGEVYACKSISKKKLRTRVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED +AV++VMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  104   EIMKHLPKHPNIVTLKDTYEDNDAVHIVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQ+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  164   EVIQMCHKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+RDYG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ++FKRDPWPK+S+
Sbjct  224   PEVLKRDYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVNFKRDPWPKVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  284   NAKDLVKKMLNPDPSKRLTAQEVLDHPWIQNAKKAPNVSLGETVKARLKQFSMMNKLKKR  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+L+ D+V  IKE F +MD    G +   EL+ GL  +G  + + DV +LMD  
Sbjct  344   ALRVIAEHLTVDEVAGIKEGFQLMDIGNKGKIDVNELRVGLQKLGHQIPESDVHILMDVG  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+  EF+ ++VHL  ++ND++L KAF  FDK+ +GYIE EELR+ L +  + N
Sbjct  404   DVDKDGYLDYGEFVAISVHLRKMANDEHLKKAFEFFDKNQTGYIEIEELREALADEIETN  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDGRIS+ EF  MM TGTDW+ ASR+YS+   N+LS++L KD S
Sbjct  464   -SEEVINAIMQDVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGS  522

Query  1698  VQ  1703
             +Q
Sbjct  523   LQ  524



>gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Erythranthe guttata]
Length=530

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 383/482 (79%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I + YE G+ELGRGEFGVTYLCT+K + +  ACK ISK KLRT +D+EDVRREV
Sbjct  45    NPTGHNIEEFYELGRELGRGEFGVTYLCTDKTSKDVFACKSISKKKLRTRVDIEDVRREV  104

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  105   EIMKHLPKHPNIVSLKDTYEDDYAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  164

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQ CHKHGV+HRDLKPENFL++N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  165   EVIQNCHKHGVMHRDLKPENFLFSNNKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  224

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCG+PPFWAETE+G+A AI+R  ++F RDPWP +S+
Sbjct  225   PEVLKRNYGPEVDVWSAGVILYILLCGIPPFWAETEQGVAQAIIRSVVNFTRDPWPLVSD  284

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLVK ML+ +P  R+T +EVL H W+QNA++ PNV LGE V  R+KQF++MNK KKR
Sbjct  285   KAKDLVKKMLNPDPKQRLTAQEVLDHPWLQNAKSAPNVSLGETVRARLKQFSMMNKLKKR  344

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F +MDT   G +   EL+ GL  +G  + + D+Q+LM+A 
Sbjct  345   ALRVIAEHLSVEEVAGIKEGFQLMDTGNKGKIDIHELRAGLHKLGHQIPESDIQVLMEAG  404

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+C EF+ ++VHL  + NDD+L KAF  FD++ SGYIE EELRD   + + + 
Sbjct  405   DVDKDGYLDCAEFVAISVHLRKMGNDDHLRKAFQFFDRNESGYIEIEELRDAFAD-EAEA  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDGRISF EF AMM +GTDW+ ASR+YS+   N+LS++L  D S
Sbjct  464   TSEEVINAIIQDVDTDKDGRISFEEFAAMMKSGTDWRKASRQYSRERYNSLSLKLMTDGS  523

Query  1698  VQ  1703
             +Q
Sbjct  524   LQ  525



>ref|XP_004228520.1| PREDICTED: calcium-dependent protein kinase 8 [Solanum lycopersicum]
 ref|XP_010315159.1| PREDICTED: calcium-dependent protein kinase 8 [Solanum lycopersicum]
Length=533

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 381/480 (79%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  KY+ G ELGRGEFGVTYLCT+ E GE  ACK ISK KLRT +D++DVRREVEI
Sbjct  50    TGQNIHDKYDLGHELGRGEFGVTYLCTDLEGGEKYACKSISKKKLRTAVDIDDVRREVEI  109

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+HLP HPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA + KT++EV
Sbjct  110   MKHLPVHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAGILKTVVEV  169

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CH+ GV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  170   VQMCHRQGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  229

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++A
Sbjct  230   VLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNA  289

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T  +VL H W+ N +  PNV LGE V  R+KQF++MNK KK+ L
Sbjct  290   KDLVKKMLDPDPTRRLTAHQVLEHPWLHNIKKAPNVSLGETVKARLKQFSVMNKLKKKAL  349

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE LS ++V  +KE F MMDT K G ++  ELKDGL  +G  + D D+ +LM+AADV
Sbjct  350   TVIAEFLSAEEVAGMKEAFEMMDTGKKGKINLNELKDGLQKLGHQIPDADLHILMEAADV  409

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G LN  EF+ +++HL  ++ND++LHKAF  FDK+ SG+IE EELR  L + DD N +
Sbjct  410   DGDGSLNYPEFVAVSIHLRKMANDEHLHKAFSFFDKNQSGFIEIEELRSALRDEDDSN-S  468

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V   I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ S+Q
Sbjct  469   EEVTNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGSLQ  528



>ref|XP_011045425.1| PREDICTED: calcium-dependent protein kinase 7-like [Populus euphratica]
 ref|XP_011045426.1| PREDICTED: calcium-dependent protein kinase 7-like [Populus euphratica]
Length=534

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/497 (63%), Positives = 389/497 (78%), Gaps = 10/497 (2%)
 Frame = +3

Query  240   VLNESHNA---------TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKS  392
             V NES N          TG  I   Y+ G+ELGRGEFGVTYLCT+ +TGE  ACK ISK 
Sbjct  36    VTNESGNVDKLGVLKEPTGRDILAHYDLGRELGRGEFGVTYLCTDIKTGEKFACKSISKK  95

Query  393   KLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKG  572
             KLRT +D+EDVRREVEIM+HLP HPNIVS K  YED  AV++VMELCEGGELFDRIVA+G
Sbjct  96    KLRTAVDIEDVRREVEIMKHLPAHPNIVSLKASYEDDSAVHIVMELCEGGELFDRIVARG  155

Query  573   HYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKP  752
             HYTERAAA V +TI+EV+Q+CHK+GVIHRDLKPENFL+AN  E + LK IDFGLS+FFKP
Sbjct  156   HYTERAAAAVMRTIVEVVQMCHKNGVIHRDLKPENFLFANKKETSALKTIDFGLSVFFKP  215

Query  753   GQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVR  932
             G+RF EIVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R
Sbjct  216   GERFNEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIR  275

Query  933   GDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVT  1112
               IDFKRDPWP++S++AK LV  ML+ +P  R+T ++VL H WIQNA+  PNVPLGE V 
Sbjct  276   SVIDFKRDPWPRVSDNAKGLVMKMLNPDPKLRLTAQQVLEHPWIQNAKKAPNVPLGETVK  335

Query  1113  TRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG  1292
              R+KQF++MNK KKR L V+AE+LS ++V  IK+ F  MDT K G+++ EEL+ GL  +G
Sbjct  336   ARLKQFSVMNKLKKRALRVIAEHLSVEEVAGIKDAFDSMDTGKKGSINLEELRVGLQKLG  395

Query  1293  QPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIE  1472
             Q +AD D+Q+LM+AADVDG+G LN  EF+ ++VH+  + ND++LHKAF  FD++ SGYIE
Sbjct  396   QHIADADLQILMEAADVDGDGALNYGEFVAISVHIKKMGNDEHLHKAFAFFDRNQSGYIE  455

Query  1473  FEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSK  1652
              EELR+ L + D D  ++ V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+
Sbjct  456   IEELRESLND-DIDTSSEDVINAIMHDVDTDKDGRISYEEFAMMMKAGTDWRKASRQYSR  514

Query  1653  VMLNALSVRLFKDKSVQ  1703
                N+LS+ L +D S+Q
Sbjct  515   ERFNSLSITLRRDGSLQ  531



>ref|XP_009758772.1| PREDICTED: calcium-dependent protein kinase 7-like isoform X1 
[Nicotiana sylvestris]
Length=529

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/539 (61%), Positives = 402/539 (75%), Gaps = 20/539 (4%)
 Frame = +3

Query  99    MGACVSLHSALTM---KRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNAT  266
             MG C ++ S   +   KR +N+  P    N   GG  +             VL    N T
Sbjct  1     MGNCCAVPSTTDIDEQKRGKNKPNPFSTHNHGNGGYNSY------------VL---ENPT  45

Query  267   GDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiM  446
             G  I   YE G+ELGRGEFGVTYLCTEK TGE  ACK ISK KLRT ID+EDVRREVEIM
Sbjct  46    GHDIETTYELGRELGRGEFGVTYLCTEKATGEFYACKSISKKKLRTRIDIEDVRREVEIM  105

Query  447   RHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVI  626
             ++LP+HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EVI
Sbjct  106   KNLPQHPNIVTLKDTYEDDIAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEVI  165

Query  627   QVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEV  806
             Q+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPEV
Sbjct  166   QMCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEV  225

Query  807   LRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAK  986
             L+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S++AK
Sbjct  226   LKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFRRDPWPKVSDNAK  285

Query  987   DLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLM  1166
             DLVK ML+ +P  R+T +EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR L 
Sbjct  286   DLVKKMLNPDPSKRLTAQEVLDHPWIQNAKKAPNVSLGETVKARLKQFSMMNKLKKRALR  345

Query  1167  VVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVD  1346
             V+AE+LS ++V  IKE F +MD    G +   ELK GL  +G  V D DVQ+LMDA DVD
Sbjct  346   VIAEHLSVEEVAGIKEGFKLMDIGNKGKIDMNELKVGLQKLGHQVPDTDVQILMDAGDVD  405

Query  1347  GNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND  1526
              +G L+  EF+ ++VHL  + ND++L KAF  FDK+ +GYIE +ELR+ L +  + N ++
Sbjct  406   KDGYLDYGEFVAISVHLRKMGNDEHLEKAFEFFDKNQTGYIEIDELREALSDEIETN-SE  464

Query  1527  QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +V+  I+ D D DKDGRISF EF AMM  GTDW+ ASR+YS+   N+LS++L  D S++
Sbjct  465   EVISTIMQDVDTDKDGRISFEEFTAMMKAGTDWRKASRQYSRERYNSLSLKLMSDGSLK  523



>gb|AAB88537.1| calcium-dependent protein kinase [Fragaria x ananassa]
Length=529

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 384/483 (80%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I + YE G+ELGRGEFG+TYLCT+K T E+ ACK ISK KLRT +D+EDVRREV
Sbjct  42    NPTGTEIEQTYELGRELGRGEFGITYLCTDKATNENYACKSISKQKLRTAVDIEDVRREV  101

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIV++GHYTERAAA VTKTI+
Sbjct  102   EIMKHLPKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVSRGHYTERAAAAVTKTIV  161

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  162   EVVQMCHKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFSEIVGSPYYMA  221

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  222   PEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  281

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KK 
Sbjct  282   NAKDLVKKMLDPDPKRRLTAQQVLDHTWLQNAKRAPNVSLGETVRARLKQFSVMNKLKKS  341

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LSQ++V  I+E F +MDT   G ++ +EL+ GL  +G  + D DV +LM+A 
Sbjct  342   ALKVIAEHLSQEEVAGIQEGFKIMDTSNKGKINIDELRVGLHKLGHQIPDADVHILMEAG  401

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDD-NLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             DVD +G L+  EF+ ++VHL  + NDD +L KAF  FD++ SG+IE EELR  L    DD
Sbjct  402   DVDNDGYLDYGEFVAISVHLRRMGNDDEHLRKAFDFFDQNKSGFIEVEELRTALATEVDD  461

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             +  D V+  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  462   HVED-VISAIISDVDTDKDGKISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  520

Query  1695  SVQ  1703
             S++
Sbjct  521   SLE  523



>dbj|BAE99123.1| calcium-dependent protein kinase [Arabidopsis thaliana]
Length=478

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/473 (65%), Positives = 385/473 (81%), Gaps = 2/473 (0%)
 Frame = +3

Query  288   YEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHP  467
             Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREVEIM+H+P+HP
Sbjct  2     YDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMPRHP  61

Query  468   NIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHG  647
             NIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTILEV+Q+CHKHG
Sbjct  62    NIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTILEVVQICHKHG  121

Query  648   VIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGH  827
             V+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG+ F EIVGSPYYMAPEVLRR+YG 
Sbjct  122   VMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEGFNEIVGSPYYMAPEVLRRNYGP  181

Query  828   EVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGML  1007
             EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE AKDLV+ ML
Sbjct  182   EVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSETAKDLVRKML  241

Query  1008  DANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLS  1187
             + +P  R++  +VL H WIQNA+  PNV LGE V  R+KQF++MNK KKR L V+AE+LS
Sbjct  242   EPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAEHLS  301

Query  1188  QDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDAADVDGNGMLN  1364
              ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D D+Q+LM+AADVDG+G LN
Sbjct  302   VEEVAGIKEAFEMMDSKKTGKINLEELKFGLHKLGQQQIPDTDLQILMEAADVDGDGTLN  361

Query  1365  CEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEI  1544
               EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR+ L +  D N +++VV  I
Sbjct  362   YGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSDYIEIEELREALNDEVDTN-SEEVVAAI  420

Query  1545  IFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             + D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ S+Q
Sbjct  421   MQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGSLQ  473



>gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum]
Length=550

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/491 (64%), Positives = 391/491 (80%), Gaps = 4/491 (1%)
 Frame = +3

Query  231   QIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTei  410
             ++ VLN   + TG  I ++YE G+ELGRGEFG+T+LCT+KETG++ ACK ISK KLRT +
Sbjct  43    KLTVLN---DPTGGEIEQRYELGRELGRGEFGITFLCTDKETGDTFACKSISKKKLRTAV  99

Query  411   dvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERA  590
             D+EDVRREVEIM+HLP HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERA
Sbjct  100   DIEDVRREVEIMKHLPHHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERA  159

Query  591   AALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKE  770
             AA VTKTI+EV+QVCHKHGV+HRDLKPENFL+AN  E A LK+IDFGLS+FFKPG+ F E
Sbjct  160   AAAVTKTIVEVVQVCHKHGVMHRDLKPENFLFANKKETAALKSIDFGLSVFFKPGEIFTE  219

Query  771   IVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFK  950
             IVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFK
Sbjct  220   IVGSPYYMAPEVLKRNYGREVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFK  279

Query  951   RDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQF  1130
             RDPWPK+SE+AKDLV+ ML+ +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF
Sbjct  280   RDPWPKVSENAKDLVRKMLNPDPKRRLTAQEVLDHPWLQNAKKAPNVSLGETVKARLKQF  339

Query  1131  TLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADH  1310
             ++MNK KKR L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +G  + D 
Sbjct  340   SVMNKLKKRALKVIAEHLSVEEVAGIKEGFQLMDTANRGKINIDELRVGLHKLGHTIPDA  399

Query  1311  DVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRD  1490
             D+Q+LM+A DVD +G L+  EF+ ++VHL  + ND++L KAF  FD++ SGYIE EELRD
Sbjct  400   DLQILMEAGDVDKDGYLDYGEFVAISVHLRKMGNDEHLKKAFESFDRNQSGYIEIEELRD  459

Query  1491  YLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNAL  1670
              L +  + N  ++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N L
Sbjct  460   ALTDEVETN-GEEVISAIMHDVDTDKDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNL  518

Query  1671  SVRLFKDKSVQ  1703
             S++L KD S+Q
Sbjct  519   SLKLMKDGSLQ  529



>ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=529

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/480 (63%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I + YE G+ELGRGEFG+TYLCT+K +GE +ACKKISK KLRT ID+EDVRREVEI
Sbjct  45    TGHNIEENYELGRELGRGEFGITYLCTDKTSGEVLACKKISKKKLRTAIDIEDVRREVEI  104

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+H+PKHPNIV+ K+ +ED  AV+LVMELCEGGELFDRIV++GHYTERAAA+V +TI+E+
Sbjct  105   MKHIPKHPNIVTLKDTFEDDYAVHLVMELCEGGELFDRIVSRGHYTERAAAIVMRTIVEI  164

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG++F EIVGSPYYMAPE
Sbjct  165   VQACHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKPGEKFNEIVGSPYYMAPE  224

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++A
Sbjct  225   VLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDNA  284

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R++ ++VL H W+QN +  PNV LGE V  R+KQF++MNK KKR L
Sbjct  285   KDLVRKMLDPDPARRLSAQQVLDHPWLQNIKKAPNVSLGETVKARLKQFSVMNKLKKRAL  344

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++V  IKE F +MDT K G +  +ELK GL  +G  +++ D+ +LMDA D+
Sbjct  345   RVIAEHLSVEEVAGIKEGFALMDTGKKGKIGIDELKSGLHKLGHQISEADLHILMDAGDI  404

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G LN  EF+ +AVHL  + ND++L KAFL FD++ +GYIE EELR Y L  + D+ +
Sbjct  405   DKDGYLNYGEFVAIAVHLRKMGNDEHLQKAFLFFDQNRNGYIEVEELR-YALADELDDNS  463

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N LS++L KD S+Q
Sbjct  464   EEVISAIMRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQ  523



>ref|XP_010057284.1| PREDICTED: calcium-dependent protein kinase 32 [Eucalyptus grandis]
 gb|KCW90203.1| hypothetical protein EUGRSUZ_A02375 [Eucalyptus grandis]
Length=525

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 384/483 (80%), Gaps = 4/483 (1%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFG+TYLCT+KET E +ACK I K KLRT +D+EDVRREV
Sbjct  46    DPTGTDIGLRYELGRELGRGEFGITYLCTDKETREELACKSILKKKLRTAVDIEDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
              IM+HLPKHPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  106   AIMKHLPKHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVIKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQVCHKHGV+HRDLKPENFL+AN  E +PLK IDFGLS+FFKPG +F EIVGSPYYMA
Sbjct  166   EVIQVCHKHGVMHRDLKPENFLFANRKETSPLKTIDFGLSMFFKPGDKFSEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETE+GIA AI+R  +DFKRDPWPK+S 
Sbjct  226   PEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGIAQAIIRSVVDFKRDPWPKVSP  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R++ +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  286   NAKDLVKKMLEPDPKRRLSAQEVLDHPWVQNAKRAPNVSLGETVRARLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  I+E F +MDTD  G ++ +EL+ GL  +G  + D D+Q+LMDA 
Sbjct  346   ALKVIAEHLSVEEVAGIREGFQLMDTDNKGKINVDELRVGLHKLGHQIPDADLQILMDAG  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLL-EIDDD  1514
             DVD +G L+  EF+ ++VHL  + ++D+L KAF  FD++ SGYIE EELRD L  E+D  
Sbjct  406   DVDRDGYLDYGEFVAISVHLRKMGSEDHLQKAFEFFDRNQSGYIEIEELRDALANEVD--  463

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N LS++L +D 
Sbjct  464   -TSEEVISAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIRDG  522

Query  1695  SVQ  1703
             S+Q
Sbjct  523   SLQ  525



>ref|XP_010102356.1| Calcium-dependent protein kinase 8 [Morus notabilis]
 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis]
Length=579

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/482 (64%), Positives = 391/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS++Y+ G+ELGRGEFG+TYLC +  TGE  ACK ISK KLRT +D++DVRREV
Sbjct  46    DPTGRDISEQYDLGRELGRGEFGITYLCMDVSTGEKFACKSISKKKLRTSVDIDDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HL  H NIVS K+ +ED+ AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  106   EIMKHLRNHQNIVSLKDTFEDESAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q CH+HGV+HRDLKPENFL+AN  EN+PLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  166   EVVQNCHEHGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGV+LYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S+
Sbjct  226   PEVLKRNYGPEVDVWSAGVVLYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  286   NAKDLVKKMLDPDPKRRLTAQEVLEHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F  +D  K G ++ EEL+ GL  +GQ + D D+Q+LMD+A
Sbjct  346   ALGVIAEHLSVEEVAGIKEAFDTIDIGKKGKVNLEELRIGLLKLGQQIPDPDLQILMDSA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L + + D+
Sbjct  406   DVDGDGTLNYGEFVAVSVHLRRMANDEHLHKAFAYFDQNRSGYIEIEELRNALND-EVDS  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  465   SSEEVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  524

Query  1698  VQ  1703
             +Q
Sbjct  525   LQ  526



>ref|XP_006287466.1| hypothetical protein CARUB_v10000678mg [Capsella rubella]
 gb|EOA20364.1| hypothetical protein CARUB_v10000678mg [Capsella rubella]
Length=533

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/492 (63%), Positives = 395/492 (80%), Gaps = 5/492 (1%)
 Frame = +3

Query  231   QIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTei  410
             ++RVL    + TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TG+  ACK ISK KLRT +
Sbjct  41    KLRVLK---DPTGHDISLMYDLGREVGRGEFGITYLCTDIKTGDKYACKSISKKKLRTAV  97

Query  411   dvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERA  590
             D+EDVRREV+IM+H+P+HPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERA
Sbjct  98    DIEDVRREVQIMKHMPRHPNIVSLKDAFEDDDAVHIVMELCEGGELFDRIVARGHYTERA  157

Query  591   AALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKE  770
             AA V KTILEV+Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG+ F E
Sbjct  158   AAAVMKTILEVVQICHKHGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEGFNE  217

Query  771   IVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFK  950
             IVGSPYYMAPEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFK
Sbjct  218   IVGSPYYMAPEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFK  277

Query  951   RDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQF  1130
             RDPWP++SE AKDLV+ ML+ +P  R++  +VL H WIQNA+  PNV LGE V  R+KQF
Sbjct  278   RDPWPRVSETAKDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARLKQF  337

Query  1131  TLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVAD  1307
             ++MNK KKR L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D
Sbjct  338   SVMNKLKKRALRVIAEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKYGLHKLGQQQIPD  397

Query  1308  HDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELR  1487
              ++Q+LM+AADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR
Sbjct  398   TELQILMEAADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSDYIEIEELR  457

Query  1488  DYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNA  1667
             + L + + D  +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+
Sbjct  458   EALND-EVDTSSEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNS  516

Query  1668  LSVRLFKDKSVQ  1703
             LS++L ++ S+Q
Sbjct  517   LSLKLMREGSLQ  528



>dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas]
 gb|KDP26038.1| hypothetical protein JCGZ_21071 [Jatropha curcas]
Length=531

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/536 (60%), Positives = 404/536 (75%), Gaps = 12/536 (2%)
 Frame = +3

Query  99    MGACVSLHSAL-TMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C    SA+ +    ++++  +P  +  G       ++  +  ++ VL E    TG  
Sbjct  1     MGNCCVTPSAVPSPDNKKHKKKQNPFAIDYG-------QNNGVHHKLTVLKEP---TGRE  50

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I ++YE G ELGRGEFG+TYLCT+KET E  ACK ISK KLRT +D+EDVRREV+IMRHL
Sbjct  51    IEQRYELGGELGRGEFGITYLCTDKETAEKYACKSISKKKLRTAVDIEDVRREVQIMRHL  110

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVS K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV+Q+C
Sbjct  111   PKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEVVQMC  170

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HK GV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPEVL+R
Sbjct  171   HKQGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR  230

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S++AKDLV
Sbjct  231   NYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSDNAKDLV  290

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             K MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF+LMNK KKR L V+A
Sbjct  291   KKMLDPDPNRRLTAQQVLDHPWLQNAKKAPNVSLGETVKARLKQFSLMNKLKKRALRVIA  350

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             E+LS ++V  IKE F +MDT   G ++ ++L+ GL  +G  + + D+Q LM+A D+D +G
Sbjct  351   EHLSVEEVAGIKEGFQVMDTSNKGKINIDDLRIGLQKLGHQITETDLQFLMEAGDLDRDG  410

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVV  1535
              L+  EF+T++VHL  + ND++L KAF  FD++ SGYIE EELR  L +   +N  D V+
Sbjct  411   HLDYGEFVTISVHLRKMGNDEHLRKAFEFFDRNQSGYIEIEELRHALADEVVENIED-VI  469

Query  1536  QEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
               II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   + LS++L KD S+Q
Sbjct  470   NAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFSNLSLKLMKDGSLQ  525



>gb|AIU98506.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=530

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 387/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             ++ G  I  +Y+ G+ELGRGEFG+TYLCT+K++G+  ACK ISK KLRT +D+EDVRREV
Sbjct  44    DSAGRDIRSRYDLGRELGRGEFGITYLCTDKDSGDLFACKSISKKKLRTIVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRHLP HPNIVS ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+V +TI+
Sbjct  104   EIMRHLPSHPNIVSLRDTYEDDAAVHLVMELCEGGELFDRIVARGHYTERAAAMVIRTIV  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             +V+Q CH HGV+HRDLKPENFL+ N NENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  164   QVVQNCHMHGVMHRDLKPENFLFGNKNENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG E+DVWSAGVILYILLCGVPPFWAETE+GIA AI+R  IDF+RDPWPK+S+
Sbjct  224   PEVLKRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGIAQAIIRSVIDFRRDPWPKVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R++QF++MNKFK++
Sbjct  284   AAKDLVKRMLDPDPNRRLTAQEVLDHPWLQNAKKAPNVNLGESVRARLQQFSVMNKFKEK  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L VVAE+LS ++V  IK+MF  +D +  G ++ EELK GL  +  P++D D+++LMDAA
Sbjct  344   ALRVVAEHLSVEEVADIKDMFEKIDVNSKGQITLEELKHGLHKLEYPISDADLKILMDAA  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D DGNG LN  EF+ +++H+  + ND++LHKAF  FD++N+GYIE EEL D L +    N
Sbjct  404   DADGNGSLNYREFVAVSIHIRKIGNDEHLHKAFRYFDRNNTGYIEIEELSDCLADELGPN  463

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   + LS +L KD S
Sbjct  464   -HEEVINAIIRDVDTDKDGKISYEEFAMMMKAGTDWRKASRQYSRERFSNLSSKLMKDGS  522

Query  1698  VQ  1703
             +Q
Sbjct  523   LQ  524



>ref|XP_009615654.1| PREDICTED: calcium-dependent protein kinase 32-like [Nicotiana 
tomentosiformis]
Length=529

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/539 (60%), Positives = 402/539 (75%), Gaps = 20/539 (4%)
 Frame = +3

Query  99    MGACVSLHSALTM---KRPRNR-RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNAT  266
             MG C ++ S   +   KR +N+  P    N   GG ++             VL    N T
Sbjct  1     MGNCCAVPSTTDIDEQKRGKNKPNPFSTHNHGNGGCKSY------------VL---ENPT  45

Query  267   GDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiM  446
             G  I   YE G+ELGRGEFGVTYLCTEK TGE  ACK ISK KLRT ID+EDVRREVEIM
Sbjct  46    GHDIETTYELGRELGRGEFGVTYLCTEKSTGEFYACKSISKKKLRTRIDIEDVRREVEIM  105

Query  447   RHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVI  626
             ++LP+HPNIV+ K+ YED  AV+LVMELCEGGELFDRIV +GHYTERAAA VT+TI+EVI
Sbjct  106   KNLPQHPNIVTLKDTYEDDIAVHLVMELCEGGELFDRIVTRGHYTERAAAAVTRTIVEVI  165

Query  627   QVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEV  806
             Q+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMAPEV
Sbjct  166   QMCHKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEV  225

Query  807   LRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAK  986
             L+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DF+RDPWPK+S++AK
Sbjct  226   LKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFRRDPWPKVSDNAK  285

Query  987   DLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLM  1166
             DLVK ML+ +P  R+T +EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR L 
Sbjct  286   DLVKKMLNPDPSKRLTAQEVLDHPWIQNAKRAPNVSLGETVKARLKQFSMMNKLKKRALR  345

Query  1167  VVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVD  1346
             V+AE+LS ++V  IKE F +MD    G +   ELK GL  +G  V D DVQ+LM+A DVD
Sbjct  346   VIAEHLSVEEVAGIKEGFKLMDIGNKGKIDMNELKVGLQKLGHQVPDTDVQILMEAGDVD  405

Query  1347  GNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND  1526
              +G L+  EF+ ++VHL  + ND++L KAF  FDK+ +GYIE +ELR+ L +  + N ++
Sbjct  406   KDGYLDYGEFVAISVHLRKMGNDEHLKKAFEFFDKNQTGYIEIDELREALSDEIETN-SE  464

Query  1527  QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +V+  I+ D D DKDGRISF EF AMM  GTDW+ ASR+YS+   N+LS++L KD S+ 
Sbjct  465   EVISAIMQDVDTDKDGRISFDEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLH  523



>gb|KHN25281.1| Calcium-dependent protein kinase 24 [Glycine soja]
Length=425

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/418 (70%), Positives = 357/418 (85%), Gaps = 0/418 (0%)
 Frame = +3

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP+HPNIV++KE YEDK+AVYLVMELCEGGELFDRIVAKGHYTERAAA V KTILEV
Sbjct  1     MRHLPQHPNIVAFKEAYEDKDAVYLVMELCEGGELFDRIVAKGHYTERAAADVAKTILEV  60

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
              +VCH+HGVIHRDLKPENFL+A+ +E APLK+IDFGLS F+  G+RF EIVGSPYYMAPE
Sbjct  61    CKVCHEHGVIHRDLKPENFLFADSSETAPLKSIDFGLSTFYVSGERFSEIVGSPYYMAPE  120

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG E+DVWSAGVILYILLCGVPPFWAE+EEGIA AI+RG +DF RDPWPK+S++A
Sbjct  121   VLRRNYGPEIDVWSAGVILYILLCGVPPFWAESEEGIAQAIIRGKVDFTRDPWPKVSDEA  180

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             K LVK MLD NP++R+T++EVL + WIQN E    + LG+ V  RIKQF+LMN+FK++VL
Sbjct  181   KHLVKRMLDPNPFTRITVQEVLDNSWIQNREHGRTISLGDQVRMRIKQFSLMNRFKRKVL  240

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              VVA+NLS +QV+  K+MF MMD DKNGNLSFEEL+DGLSM+G  + D DVQ+LMDAAD+
Sbjct  241   RVVADNLSDEQVDVFKQMFDMMDKDKNGNLSFEELRDGLSMIGHAIPDPDVQMLMDAADI  300

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DGNG LN +EFIT++VHL  + +D++L +AF  FDK+ SGY+EFEEL+D L + D +  +
Sbjct  301   DGNGTLNYDEFITMSVHLRKIESDEHLSEAFRYFDKNQSGYVEFEELKDALSDDDLEASD  360

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
             DQVV++I+ D DLDKDGRISF EFKAMM TG DWK+ASR+YS+ +LNALS ++FKD S
Sbjct  361   DQVVKDILNDVDLDKDGRISFEEFKAMMKTGGDWKLASRQYSRALLNALSFKMFKDTS  418



>gb|EMS57373.1| Calcium-dependent protein kinase 7 [Triticum urartu]
Length=548

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/469 (66%), Positives = 385/469 (82%), Gaps = 1/469 (0%)
 Frame = +3

Query  297   GKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHPNIV  476
             G ELGRGEFGVTYLCT++ T E++ACK ISK KLRT +DVEDVRREVEIMRHLPKHPNIV
Sbjct  37    GGELGRGEFGVTYLCTDRATREALACKSISKKKLRTAVDVEDVRREVEIMRHLPKHPNIV  96

Query  477   SYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIH  656
             + ++ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+EV+Q+CHKHGV+H
Sbjct  97    TLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIVEVVQMCHKHGVMH  156

Query  657   RDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVD  836
             RDLKPENFL+AN  E A LKAIDFGLS+FF PG+RF EIVGSPYYMAPEVL+R+YG EVD
Sbjct  157   RDLKPENFLFANKKETAALKAIDFGLSVFFTPGERFSEIVGSPYYMAPEVLKRNYGQEVD  216

Query  837   VWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDAN  1016
             VWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++S++AKDLV+GML+ +
Sbjct  217   VWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSDNAKDLVRGMLNPD  276

Query  1017  PYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQ  1196
             P  R+T ++VL H W+QN +  PNV LGE V  R++QF++MNKFKK  L V+AE+LS ++
Sbjct  277   PRRRLTAQQVLDHPWLQNIKKAPNVNLGETVKARLQQFSVMNKFKKHALRVIAEHLSVEE  336

Query  1197  VESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEF  1376
             V  IK+MF  MD +K+  ++F+ELK GL+ +G  + D DVQ+LMDAAD DGNG L+  EF
Sbjct  337   VAGIKDMFEKMDLNKDSMINFDELKLGLNKLGHQMPDADVQILMDAADADGNGCLDYGEF  396

Query  1377  ITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDA  1556
             +TL+VHL  + ND++LHKAF  FD++ SGYIE +ELR+ L + D    +++V+  II D 
Sbjct  397   VTLSVHLKKIGNDEHLHKAFGYFDRNKSGYIEIDELRESLAD-DLGPNHEEVINAIIRDV  455

Query  1557  DLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             D DKDG+ISF EF AMM  GTDW+ ASR+YS+    +LS++L KD S+Q
Sbjct  456   DTDKDGKISFDEFVAMMKAGTDWRKASRQYSRERFTSLSLKLQKDGSLQ  504



>ref|XP_010454221.1| PREDICTED: calcium-dependent protein kinase 8 [Camelina sativa]
 ref|XP_010454222.1| PREDICTED: calcium-dependent protein kinase 8 [Camelina sativa]
Length=534

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/481 (64%), Positives = 389/481 (81%), Gaps = 2/481 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV+I
Sbjct  50    TGHDISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVQI  109

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             M+H+P+HPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTILEV
Sbjct  110   MKHMPRHPNIVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTILEV  169

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG+ F EIVGSPYYMAPE
Sbjct  170   VQICHKHGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEGFNEIVGSPYYMAPE  229

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE A
Sbjct  230   VLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSETA  289

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ ML+ +P  R++  +VL H WIQNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  290   KDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKRAL  349

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDAAD  1340
              V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D ++Q+LM+AAD
Sbjct  350   RVIAEHLSVEEVAGIKEAFEMMDSKKLGKINLEELKYGLHKLGQQQIPDTELQILMEAAD  409

Query  1341  VDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNK  1520
             VDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR+ L + + D  
Sbjct  410   VDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSDYIEIEELREALND-EVDTS  468

Query  1521  NDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ S+
Sbjct  469   SEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGSL  528

Query  1701  Q  1703
             Q
Sbjct  529   Q  529



>ref|XP_010493012.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Camelina sativa]
 ref|XP_010493013.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 
[Camelina sativa]
 ref|XP_010493014.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 
[Camelina sativa]
Length=534

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 390/483 (81%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  IS  Y+ G+E+GRGEFG+TYLCT+ +TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  48    DPTGHDISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREV  107

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IM+H+P+HPNIVS K+ +ED +AV++VMELCEGGELFDRIVA+GHYTERAAA V KTIL
Sbjct  108   QIMKHMPRHPNIVSLKDSFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIL  167

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E + LKAIDFGLS+FFKPG+ F EIVGSPYYMA
Sbjct  168   EVVQICHKHGVMHRDLKPENFLFANKKETSALKAIDFGLSVFFKPGEGFNEIVGSPYYMA  227

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWP++SE
Sbjct  228   PEVLRRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPRVSE  287

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ ML+ +P  R++  +VL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  288   TAKDLVRKMLEPDPKKRLSAAQVLEHSWIQNAKKAPNVSLGETVKARLKQFSVMNKLKKR  347

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMG-QPVADHDVQLLMDA  1334
              L V+AE+LS ++V  IKE F MMD+ K G ++ EELK GL  +G Q + D ++Q+LM+A
Sbjct  348   ALRVIAEHLSVEEVAGIKEAFEMMDSKKLGKINLEELKYGLHKLGQQQIPDTELQILMEA  407

Query  1335  ADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             ADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ S YIE EELR+ L + + D
Sbjct  408   ADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFSFFDQNQSDYIEIEELREALND-EVD  466

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
               +++V+  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L ++ 
Sbjct  467   TSSEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREG  526

Query  1695  SVQ  1703
             S+Q
Sbjct  527   SLQ  529



>ref|XP_003554179.1| PREDICTED: calcium-dependent protein kinase 32-like [Glycine 
max]
Length=535

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 382/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  +YE G+ELGRGEFG+TYLCT+KETGE +ACK ISK KLRT ID++DVRREVEI
Sbjct  51    TGREIEARYELGRELGRGEFGITYLCTDKETGEELACKSISKKKLRTAIDIDDVRREVEI  110

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP+HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  111   MRHLPQHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  170

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHK GV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  171   VQMCHKQGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  230

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S++A
Sbjct  231   VLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSDNA  290

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK MLD +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  291   KDLVKKMLDPDPRRRLTAQEVLDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKRAL  350

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+L+ ++   +KE F +MDT+  G ++ +EL+ GL  +G  V + DVQ LM+A DV
Sbjct  351   RVIAEHLTVEEAAGLKEGFQLMDTNNRGKINIDELRVGLHKLGHQVPESDVQALMEAGDV  410

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             DG+G L+  EF+ ++VHL  + ND++L KAF  FD++ S YIE EELR  L + D D  +
Sbjct  411   DGDGHLDYGEFVAISVHLRKMGNDEHLRKAFQFFDQNKSEYIEIEELRSALSD-DLDTNS  469

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+    +LS+ L +D S+ 
Sbjct  470   EEVISAIMHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFASLSLTLMRDGSLH  529



>ref|XP_011071722.1| PREDICTED: calcium-dependent protein kinase 10-like [Sesamum 
indicum]
Length=539

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/513 (61%), Positives = 404/513 (79%), Gaps = 6/513 (1%)
 Frame = +3

Query  168   PENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTE  347
             P+  +  G R + P +Q  +  IRVL +    T   IS KY  G+ELGRGEFGVTYLCT+
Sbjct  20    PKPGKKPGERYQNPYAQSPA-PIRVLKDFFPRTR--ISDKYILGRELGRGEFGVTYLCTD  76

Query  348   KETGESVACKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVME  527
             +ET E++ACK ISK KLRT +D+EDVRREV IM  LP+HPNIV  +  YED EAV+LVME
Sbjct  77    RETREALACKSISKKKLRTAVDIEDVRREVAIMSSLPEHPNIVKLRATYEDNEAVHLVME  136

Query  528   LCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENA  707
             LCEGGELFDRIVA+GHY+ERAAA V KTI EV+++CH+HGV+HRDLKPENFL+AN  EN+
Sbjct  137   LCEGGELFDRIVARGHYSERAAAGVAKTIAEVVRMCHQHGVMHRDLKPENFLFANKKENS  196

Query  708   PLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPP  887
              LKAIDFGLS+FFKPG+RF EIVGSPYYMAPEVL+R+YG EVD+WSAGVILYILLCGVPP
Sbjct  197   ALKAIDFGLSVFFKPGERFSEIVGSPYYMAPEVLKRNYGPEVDIWSAGVILYILLCGVPP  256

Query  888   FWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQ  1067
             FWAETE+G+A AI+RG IDFKR+PWP++SE AK LV+ ML+ +P  R+T ++VL H WIQ
Sbjct  257   FWAETEQGVALAILRGVIDFKREPWPQVSESAKSLVRQMLEPDPKKRLTAQQVLDHPWIQ  316

Query  1068  NAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNG  1247
             NA+  PNVPLG+ V  R+KQF++MN+FKKR L V+AE+LS ++VE I++MF +MDTD +G
Sbjct  317   NAKKAPNVPLGDIVRARLKQFSVMNRFKKRALRVIAEHLSVEEVEVIRDMFALMDTDNDG  376

Query  1248  NLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLH  1427
              +++EELK GL  +G  +A+ +++LLMD ADVDGNG+L+  EF+ + +HL  + ND++  
Sbjct  377   KVTYEELKAGLRKVGSQLAEPEIKLLMDVADVDGNGVLDYGEFVAVTIHLQRMENDEHFR  436

Query  1428  KAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND-QVVQEIIFDADLDKDGRISFPEFKAM  1604
             +AF+ FDKD SGYIE +ELR+ L   D+  + D  V+ +I+ + D DKDG+IS+ EF AM
Sbjct  437   RAFMFFDKDGSGYIELDELREAL--ADESGETDLDVLNDIMREVDTDKDGQISYDEFVAM  494

Query  1605  MTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             M TGTDW+ ASR+YS+    +LS+ L KD S+Q
Sbjct  495   MKTGTDWRKASRQYSRERFKSLSLNLMKDGSLQ  527



>ref|XP_004304393.1| PREDICTED: calcium-dependent protein kinase 8-like [Fragaria 
vesca subsp. vesca]
Length=529

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 383/483 (79%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N  G  I + YE G+ELGRGEFG+TYLCT+K T E+ ACK ISK KLRT +D+EDVRREV
Sbjct  42    NPNGTEIEQTYELGRELGRGEFGITYLCTDKATNENYACKSISKQKLRTAVDIEDVRREV  101

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIVS K+ YED  AV+LVMELCEGGELFDRIV++GHYTERAAA VTKTI+
Sbjct  102   EIMKHLPKHPNIVSLKDTYEDDNAVHLVMELCEGGELFDRIVSRGHYTERAAAAVTKTIV  161

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  162   EVVQMCHKHGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGERFSEIVGSPYYMA  221

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVLRR+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  222   PEVLRRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  281

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KK 
Sbjct  282   NAKDLVKKMLDPDPKRRLTAQQVLDHTWLQNAKRAPNVSLGETVRARLKQFSVMNKLKKS  341

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LSQ++V  I+E F +MDT   G ++ +EL+ GL  +G  + D DV +LM+A 
Sbjct  342   ALKVIAEHLSQEEVAGIQEGFKIMDTSNKGKINIDELRVGLHKLGHQIPDADVHILMEAG  401

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDD-NLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             DVD +G L+  EF+ ++VHL  + NDD +L KAF  FD++ SG+IE EELR  L    DD
Sbjct  402   DVDNDGYLDYGEFVAISVHLKRMGNDDEHLRKAFDFFDQNKSGFIEVEELRTALATEVDD  461

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             +  D V+  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   N+LS++L +D 
Sbjct  462   HVED-VISAIISDVDTDKDGKISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMRDG  520

Query  1695  SVQ  1703
             S++
Sbjct  521   SLE  523



>ref|XP_011020349.1| PREDICTED: calcium-dependent protein kinase 32-like [Populus 
euphratica]
Length=528

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/482 (63%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  + ++YE G ELGRGEFG+TYLCT+KETGE+ ACK ISK KL+T ID+EDVRREV
Sbjct  42    DPTGKELEQRYELGTELGRGEFGITYLCTDKETGENFACKCISKKKLKTAIDIEDVRREV  101

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+ +P+HPN+V+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  102   EIMKRMPQHPNLVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAGVTKTIV  161

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  162   EVVQICHKHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMA  221

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  222   PEVLKRNYGQEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSD  281

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T ++VL H W+QNA+  PNV LGE V +++KQF++MNK KKR
Sbjct  282   NAKDLVRKMLDPDPKCRLTAQQVLDHPWLQNAKKAPNVSLGETVRSKLKQFSIMNKLKKR  341

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              + V+AE+LS ++V  IKE F +MDT  NG ++ +EL+ GL  +GQ V + D+Q+LM+  
Sbjct  342   AMRVIAEHLSVEEVAGIKEGFQLMDTANNGKINIDELRVGLQKLGQHVLESDLQILMEVG  401

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D +G L+  EF+ + VHL  + ND++L +AF  FD++ SGYIE +ELR  L + + D 
Sbjct  402   DIDRDGYLDYGEFVAITVHLKKMGNDEHLRQAFKFFDQNQSGYIEIDELRGALAD-EVDG  460

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              N++V+  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  461   SNEEVINAIINDVDTDKDGKISYEEFTTMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  520

Query  1698  VQ  1703
             ++
Sbjct  521   LK  522



>gb|EYU31372.1| hypothetical protein MIMGU_mgv1a004319mg [Erythranthe guttata]
Length=533

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/493 (63%), Positives = 392/493 (80%), Gaps = 4/493 (1%)
 Frame = +3

Query  225   SRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRT  404
             S+++ VL    + TG  +  K++ G ELGRGEFGVTYL T+ ET E  ACK ISK KLRT
Sbjct  39    SKKLVVLK---DPTGHDLIDKFDIGCELGRGEFGVTYLSTDVETREKFACKSISKKKLRT  95

Query  405   eidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTE  584
              +D+EDVRREVEIM+H+PKHPNIVS K+ YED  AV++VMELCEGGELFDRIVA+GHYTE
Sbjct  96    AVDIEDVRREVEIMKHMPKHPNIVSLKDTYEDDSAVHIVMELCEGGELFDRIVARGHYTE  155

Query  585   RAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRF  764
             RAAA + KTI+EV+Q+CH++GV+HRDLKPENFL+AN  E +PLKAIDFGLS+FFKPG+RF
Sbjct  156   RAAAFIMKTIVEVVQMCHRNGVMHRDLKPENFLFANKKETSPLKAIDFGLSVFFKPGERF  215

Query  765   KEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDID  944
              EIVGSPYYMAPEVL+R+YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ID
Sbjct  216   NEIVGSPYYMAPEVLKRNYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSAID  275

Query  945   FKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIK  1124
             FKRDPWPK+S++AKDLVK MLD +P  R+T ++VL H W+ NA+   NV LGE V  R+K
Sbjct  276   FKRDPWPKVSDNAKDLVKKMLDPDPTRRLTAQQVLEHPWLLNAKKASNVSLGETVKARLK  335

Query  1125  QFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVA  1304
             QF++MNK KKR L VVAE+LS ++V  IKE F  MDT K G L+ EE K GL  +G  + 
Sbjct  336   QFSVMNKLKKRALRVVAEHLSVEEVAGIKEAFDTMDTGKRGKLNLEEFKIGLHKLGHQIP  395

Query  1305  DHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEEL  1484
             + DVQ+LM+AADVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE +EL
Sbjct  396   EPDVQILMEAADVDGDGALNYGEFVAVSVHLRKMANDEHLHKAFAFFDRNESGYIEIDEL  455

Query  1485  RDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLN  1664
             RD L + DD N +++V+  I+ D D DKDGRIS+ EF +MM  GTDW+ ASR+YS+   N
Sbjct  456   RDALSDEDDAN-SEEVIIAIMHDVDTDKDGRISYEEFASMMKAGTDWRKASRQYSRERFN  514

Query  1665  ALSVRLFKDKSVQ  1703
             +LS++L K+ S+ 
Sbjct  515   SLSLKLMKEGSLH  527



>ref|XP_010922561.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
13-like [Elaeis guineensis]
Length=549

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 393/483 (81%), Gaps = 3/483 (1%)
 Frame = +3

Query  261   ATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreve  440
             A   GI +KY   +ELGRGEFGVTYLC +++T E +ACK ISK KLRT IDVEDVRREV 
Sbjct  64    ALAGGIEEKYLLDRELGRGEFGVTYLCMDRDTKEVLACKSISKRKLRTAIDVEDVRREVA  123

Query  441   iMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILE  620
             IMRHLPK P+IVS KE  ED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+E
Sbjct  124   IMRHLPKSPSIVSLKEACEDENAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVE  183

Query  621   VIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAP  800
             V+Q+CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F EIVGSPYYMAP
Sbjct  184   VVQLCHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFSEIVGSPYYMAP  243

Query  801   EVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISED  980
             EVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG IDFKR+PWP +SE+
Sbjct  244   EVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGIIDFKREPWPSVSEN  303

Query  981   AKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRV  1160
             AK+LV+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQF+ MN+FK+R 
Sbjct  304   AKNLVRQMLEPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDVVKSRLKQFSRMNRFKRRA  363

Query  1161  LMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAAD  1340
             L V+A++LS ++VE IK+MF MMDTD +G++S+EELK+GL+  G  + + +VQ+L++A D
Sbjct  364   LRVIADHLSIEEVEDIKDMFKMMDTDNDGSVSYEELKNGLAKFGSHLVESEVQMLIEAVD  423

Query  1341  VDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNK  1520
              +G G L+  EF+ +++HL  ++ND++LH+AF  FDKD +GYIE EELR+ L+E D    
Sbjct  424   TNGKGKLDYGEFVAVSLHLQRMANDEHLHRAFSYFDKDGNGYIEPEELREALVE-DGTGA  482

Query  1521  NDQ--VVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
              D   V  +I+ + D DKDGRIS+ EF AMM TGTDW+ ASR YS+   N+LSVRL KD 
Sbjct  483   TDSMDVANDILQEVDTDKDGRISYDEFVAMMKTGTDWRKASRHYSRGRFNSLSVRLMKDG  542

Query  1695  SVQ  1703
             S+ 
Sbjct  543   SLS  545



>ref|XP_006646451.1| PREDICTED: calcium-dependent protein kinase 13-like [Oryza brachyantha]
Length=542

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/494 (63%), Positives = 398/494 (81%), Gaps = 5/494 (1%)
 Frame = +3

Query  228   RQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTe  407
             +++ VL E       GI  KY   +ELGRGEFGVTYLC +++T E +ACK ISK KLRT 
Sbjct  48    KRLPVLGEEGCELIGGIDDKYALDRELGRGEFGVTYLCMDRDTKELLACKSISKRKLRTA  107

Query  408   idvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTER  587
             +DVEDVRREV IMRHLPK  +IVS +E  ED+ AV+LVMELCEGGELFDRIVA+GHYTER
Sbjct  108   VDVEDVRREVAIMRHLPKSASIVSLREACEDEGAVHLVMELCEGGELFDRIVARGHYTER  167

Query  588   AAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFK  767
             AAA VT+TI+EV+Q+CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F 
Sbjct  168   AAANVTRTIVEVVQLCHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFS  227

Query  768   EIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDF  947
             EIVGSPYYMAPEVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG+IDF
Sbjct  228   EIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDF  287

Query  948   KRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQ  1127
             KR+PWP +SE+AKDLV+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQ
Sbjct  288   KREPWPNVSENAKDLVRRMLEPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDIVKSRLKQ  347

Query  1128  FTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVAD  1307
             F+ MN+FK+R L V+A++LS ++VE IKEMF  MDTD NG +S+EELK G++  G  +A+
Sbjct  348   FSRMNRFKRRALRVIADHLSAEEVEDIKEMFKAMDTDNNGIVSYEELKSGIAKFGSHLAE  407

Query  1308  HDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELR  1487
              +VQ+L++A D +G G L+  EF+ +++HL  ++ND++L +AFL FDKD +GYIE EELR
Sbjct  408   SEVQMLIEAVDTNGKGALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGYIEPEELR  467

Query  1488  DYLLEIDDDNKND--QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVML  1661
             + L+   DD   D  +VV +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   
Sbjct  468   EALV---DDGAGDSMEVVNDILQEVDTDKDGKISYDEFVAMMKTGTDWRKASRHYSRGRF  524

Query  1662  NALSVRLFKDKSVQ  1703
             N+LS++L KD SV+
Sbjct  525   NSLSMKLIKDGSVK  538



>ref|XP_004963720.1| PREDICTED: calcium-dependent protein kinase 13-like, partial 
[Setaria italica]
Length=567

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/492 (62%), Positives = 398/492 (81%), Gaps = 1/492 (0%)
 Frame = +3

Query  228   RQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTe  407
             +++ VL E     G GI  KY   +ELGRGEFGVTYLC ++ T E +ACK ISK KLRT 
Sbjct  73    KRLSVLGEEGCDVGAGIEDKYALDRELGRGEFGVTYLCMDRGTRELLACKSISKRKLRTP  132

Query  408   idvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTER  587
             +DVEDVRREV IMRHLPK P+IVS +E  ED  AV+LVMELCEGGELFDRIVA+GHYTER
Sbjct  133   VDVEDVRREVAIMRHLPKSPSIVSLREACEDDGAVHLVMELCEGGELFDRIVARGHYTER  192

Query  588   AAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFK  767
             AAA VT+TI+EV+Q+CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F 
Sbjct  193   AAAAVTRTIVEVVQLCHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFS  252

Query  768   EIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDF  947
             EIVGSPYYMAPEVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG+IDF
Sbjct  253   EIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDF  312

Query  948   KRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQ  1127
             KR+PWP +S++AKDLV+ ML  +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQ
Sbjct  313   KREPWPNVSDNAKDLVRQMLQPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDIVKSRLKQ  372

Query  1128  FTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVAD  1307
             F+ MN+FK+R L V+A++LS ++VE IKEMF +MDTD +G +S+EELK+G++  G  +A+
Sbjct  373   FSRMNRFKRRALRVIADHLSAEEVEDIKEMFKVMDTDNDGKVSYEELKNGIAKFGSHLAE  432

Query  1308  HDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELR  1487
              +VQ+L++A D +G G L+  EF+ +++HL  ++ND++L +AFL FDKD +G+IE EEL+
Sbjct  433   SEVQMLIEAVDTNGRGALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGFIEPEELQ  492

Query  1488  DYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNA  1667
             + L+E D    +  VV +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   N+
Sbjct  493   EALVE-DGGADSMDVVNDILHEVDTDKDGKISYEEFVAMMKTGTDWRKASRHYSRGRFNS  551

Query  1668  LSVRLFKDKSVQ  1703
             LS++L KD S++
Sbjct  552   LSIKLIKDGSLK  563



>ref|XP_011087204.1| PREDICTED: calcium-dependent protein kinase 10 [Sesamum indicum]
Length=544

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/537 (58%), Positives = 410/537 (76%), Gaps = 7/537 (1%)
 Frame = +3

Query  99    MGAC-VSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C   +  + +   P+  +P  P+  +    R   P +Q  +  +RVL +    T   
Sbjct  1     MGNCNACIRPSASEPEPQAPKPTTPKPRKKTRERYPNPYAQSPA-PVRVLKDFAPRTR--  57

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             IS KY  G+ELGRGEFGVTYLCT++ET E++ACK ISK KLRT +D+EDVRREV IM  L
Sbjct  58    ISDKYVLGRELGRGEFGVTYLCTDRETREALACKSISKKKLRTVVDIEDVRREVAIMSSL  117

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             P+HPNIV  +  YED EAV+LVMELCEGGELFDRIVA+GHY+ERAAA V KT+ EV+++C
Sbjct  118   PEHPNIVKLRATYEDNEAVHLVMELCEGGELFDRIVARGHYSERAAAGVAKTVAEVVRMC  177

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             H+HGV+HRDLKPENFL+AN  E++ LKAIDFGLS+FFKPG+RF EIVGSPYYMAPEVL+R
Sbjct  178   HQHGVMHRDLKPENFLFANKKEHSALKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKR  237

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+RG IDFKR+PWP++SE AK LV
Sbjct  238   NYGPEVDIWSAGVILYILLCGVPPFWAETEQGVALAILRGVIDFKREPWPQVSESAKSLV  297

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             + ML+ +P  R+T ++VL H WIQNA+  PNVPLG+ V  R+KQF+ MN+FKK+ L V+A
Sbjct  298   RQMLEPDPKKRLTAQQVLDHPWIQNAKRAPNVPLGDIVKARLKQFSGMNRFKKKALRVIA  357

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             E+LS ++VE I++MF +MDTD +G ++FEELK GL  +G  +A+ +++LLMD ADVDGNG
Sbjct  358   EHLSVEEVEVIRDMFSLMDTDNDGKVTFEELKAGLRKVGSQLAEPEIKLLMDVADVDGNG  417

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND-QV  1532
             +L+  EF+ + +HL  + ND++  +AF+ FDKD SGYIE +ELR+ L  ID+  + D  V
Sbjct  418   VLDYGEFVAVTIHLQRMENDEHFRRAFMFFDKDGSGYIELDELREAL--IDESGETDPDV  475

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +  I+ + D DKDG+IS+ EF AMM  GTDW+ ASR+YS+    +LS+ L KD S+Q
Sbjct  476   LNNIMREVDTDKDGQISYDEFVAMMKAGTDWRKASRQYSRERFKSLSLNLMKDGSLQ  532



>ref|XP_008465111.1| PREDICTED: calcium-dependent protein kinase 32-like [Cucumis 
melo]
Length=535

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 385/483 (80%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I  +YE G+ELGRGEFG+T+LCT+K TGE  ACK ISK KLRT +D+EDVRREV
Sbjct  51    NPTGCEIGLQYELGRELGRGEFGITHLCTDKVTGEKFACKSISKKKLRTAVDIEDVRREV  110

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IMRHLPKH NIVS K+ +ED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+
Sbjct  111   QIMRHLPKHQNIVSLKDTFEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIV  170

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  171   EVVQMCHKHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  230

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  231   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSD  290

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T + VL H W+QN +  PNV LGE V  R+KQF++MNK KKR
Sbjct  291   NAKDLVRKMLDPDPKRRLTAQGVLDHPWLQNVKKAPNVSLGETVRARLKQFSVMNKLKKR  350

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F  MDT   G ++ +EL+ GL  +G  + D D+Q+LM+A 
Sbjct  351   ALRVIAEHLSVEEVAGIKEGFEKMDTGNKGKINIDELRVGLHKLGHQIEDADLQILMEAG  410

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSND-DNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             DVD +G L+C EF+ ++VHL  + +D ++L KAF  FD++ SGYIE EELR  L +  D+
Sbjct  411   DVDNDGYLDCREFVAISVHLRRIGDDEEHLRKAFDFFDQNLSGYIEIEELRSTLADEIDE  470

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             N +++V+  II D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS+ L +D 
Sbjct  471   N-SEEVINAIINDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFNSLSLNLMRDG  529

Query  1695  SVQ  1703
             S+Q
Sbjct  530   SLQ  532



>gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis]
Length=532

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 389/482 (81%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I ++Y+ G+ELGRGEFG+TYLC +  TGE  ACK ISK KLRT +DV+DVRREV
Sbjct  46    DPTGRDILERYDLGRELGRGEFGITYLCIDVSTGEKFACKSISKKKLRTSVDVDDVRREV  105

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HL  H NIVS K+ +ED+ AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  106   EIMKHLRNHQNIVSLKDTFEDESAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIV  165

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q CH+HGV+HRDLKPENFL+AN  EN+PLKAIDFGLS+FFKPG++F EIVGSPYYMA
Sbjct  166   EVVQNCHEHGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGEQFNEIVGSPYYMA  225

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGV+LYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWP++S+
Sbjct  226   PEVLKRNYGPEVDVWSAGVVLYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPRVSD  285

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK MLD +P  R+T ++VL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  286   NAKDLVKKMLDPDPKRRLTAQKVLEHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKR  345

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F  +D  K G ++ EEL+ GL  +GQ + D D+Q+LMD+A
Sbjct  346   ALGVIAEHLSVEEVAGIKEAFDTIDIAKKGKVNLEELRIGLLKLGQQIPDPDLQILMDSA  405

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELR+ L + + D 
Sbjct  406   DVDGDGALNYGEFVAVSVHLRRMANDEHLHKAFAYFDQNRSGYIEIEELRNALND-EVDT  464

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++VV  I+ D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  465   SSEEVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS  524

Query  1698  VQ  1703
             +Q
Sbjct  525   LQ  526



>ref|XP_004150764.1| PREDICTED: calcium-dependent protein kinase 7-like [Cucumis sativus]
 ref|XP_004163290.1| PREDICTED: calcium-dependent protein kinase 7-like [Cucumis sativus]
 gb|KGN53866.1| hypothetical protein Csa_4G172540 [Cucumis sativus]
Length=535

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/483 (64%), Positives = 385/483 (80%), Gaps = 2/483 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I  +YE G+ELGRGEFG+T+LCT+K TGE  ACK ISK KLRT ID+EDVRREV
Sbjct  51    NPTGCEIGLQYELGRELGRGEFGITHLCTDKVTGEKFACKSISKKKLRTAIDIEDVRREV  110

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IMRHLPKH NIVS K+ +ED  AV+LVMELCEGGELFDRIVA+GHYTERAAA+VTKTI+
Sbjct  111   QIMRHLPKHQNIVSLKDTFEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAVVTKTIV  170

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHK GV+HRDLKPENFL+ N  ENAPLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  171   EVVQMCHKQGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  230

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFKRDPWPK+S+
Sbjct  231   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFKRDPWPKVSD  290

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV+ MLD +P  R+T + VL H W+QN +  PNV LGE V  R+KQF++MNK KKR
Sbjct  291   NAKDLVRKMLDPDPKRRLTAQGVLDHPWLQNVKKAPNVSLGETVRARLKQFSVMNKLKKR  350

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F  MDT   G ++ +EL+ GL  +G  +AD D+Q+LM+A 
Sbjct  351   ALRVIAEHLSVEEVAGIKEGFEKMDTGNKGKINIDELRVGLHKLGHQIADADLQILMEAG  410

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSND-DNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDD  1514
             D D +G L+C EF+ ++VHL  + +D ++L KAF  FD++ SGYIE EELR  L +  D+
Sbjct  411   DADNDGYLDCREFVAISVHLRRMGDDEEHLRKAFDFFDQNLSGYIEIEELRSTLADEIDE  470

Query  1515  NKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDK  1694
             N +++V+  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS+ L +D 
Sbjct  471   N-SEEVINAIINDVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLNLMRDG  529

Query  1695  SVQ  1703
             S+Q
Sbjct  530   SLQ  532



>gb|KEH23659.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=533

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 387/480 (81%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG+ I  +YE G+ELGRGEFGVTYLCT+KET E +ACK ISK KLRT ID+EDVRREVEI
Sbjct  50    TGNEIETRYELGRELGRGEFGVTYLCTDKETREELACKSISKKKLRTAIDIEDVRREVEI  109

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRH+PKH NIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  110   MRHMPKHNNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  169

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  170   VQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  229

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S++A
Sbjct  230   VLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSDNA  289

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK ML+ +P  R+T +EVL H W+ NA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  290   KDLVKKMLNPDPKRRLTAQEVLDHPWLINAKKAPNVSLGETVRARLKQFSVMNKLKKRAL  349

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   +KE F++MDT   G ++ +EL+ GL  +G  V D D+Q+LM+A D+
Sbjct  350   RVIAEHLSVEEAAGLKEGFNLMDTTNRGKINIDELRTGLHKLGHQVPDSDLQILMEAGDI  409

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  E++ ++VHL  + ND++LHKAF  FD++ +GYIE EELR+ L +  + N +
Sbjct  410   DRDGYLDYGEYVAISVHLRKMGNDEHLHKAFDFFDQNQTGYIEIEELRNALSDEIETN-S  468

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V+  I+ D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD S+Q
Sbjct  469   EEVISAIMHDVDTDKDGKISYEEFANMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQ  528



>gb|AFW78312.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=540

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/492 (62%), Positives = 396/492 (80%), Gaps = 1/492 (0%)
 Frame = +3

Query  228   RQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTe  407
             +++ VL E     G GI +KY   +ELGRGEFGVTYLC ++ T E +ACK ISK KLRT 
Sbjct  46    KRLSVLGEEGCDVGAGIEEKYALDRELGRGEFGVTYLCMDRGTRELLACKSISKRKLRTP  105

Query  408   idvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTER  587
             +DVEDVRREV IMRHLPK P IVS +E  ED  AV+LVMELCEGGELFDRIVA+GHYTER
Sbjct  106   VDVEDVRREVAIMRHLPKSPTIVSLREACEDDGAVHLVMELCEGGELFDRIVARGHYTER  165

Query  588   AAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFK  767
             AAA VT+TILEV+Q+CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F 
Sbjct  166   AAAAVTRTILEVVQLCHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFS  225

Query  768   EIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDF  947
             EIVGSPYYMAPEVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG++DF
Sbjct  226   EIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNVDF  285

Query  948   KRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQ  1127
             KR+PWP +S++AKDLV+ ML  +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQ
Sbjct  286   KREPWPNVSDNAKDLVRQMLQPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDIVKSRLKQ  345

Query  1128  FTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVAD  1307
             F+ MN+FK+R L V+A++LS ++V+ IKEMF +MDTD +G +S+EELK G++  G  +A+
Sbjct  346   FSRMNRFKRRALRVIADHLSAEEVQDIKEMFKVMDTDNDGIVSYEELKSGIANFGSHLAE  405

Query  1308  HDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELR  1487
              +VQ+L++A D +G G L+  EF+ +++HL  ++ND++L +AFL FDKD +G+IE EEL+
Sbjct  406   SEVQMLIEAVDTNGRGALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGFIEPEELQ  465

Query  1488  DYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNA  1667
             + L+E D       VV +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   N+
Sbjct  466   EALME-DGGADTMDVVNDILQEVDTDKDGKISYDEFVAMMKTGTDWRKASRHYSRGRFNS  524

Query  1668  LSVRLFKDKSVQ  1703
             LS++L KD SV+
Sbjct  525   LSIKLIKDGSVK  536



>ref|XP_007162235.1| hypothetical protein PHAVU_001G135300g [Phaseolus vulgaris]
 gb|ESW34229.1| hypothetical protein PHAVU_001G135300g [Phaseolus vulgaris]
Length=538

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 383/480 (80%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  +YE G+ELGRGEFGVTYLCT+KE+GE +ACK ISK KLRT ID+EDVRREVEI
Sbjct  51    TGREIEARYELGRELGRGEFGVTYLCTDKESGEELACKSISKKKLRTAIDIEDVRREVEI  110

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRHLP+HPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+EV
Sbjct  111   MRHLPQHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIVEV  170

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LK IDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  171   VQMCHKHGVMHRDLKPENFLFANKKETAALKTIDFGLSVFFKPGERFNEIVGSPYYMAPE  230

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S++A
Sbjct  231   VLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSIVDFKRDPWPKVSDNA  290

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLV+ MLD +P  R+T +EV+ H W+QNA+  PNV LGE V  R+KQF++MNK KKR L
Sbjct  291   KDLVRKMLDPDPRRRLTAQEVIDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKRAL  350

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+L+ ++   +KE F +MDT+  G ++ +EL+ GL  +G  V D DVQ+LM+A DV
Sbjct  351   RVIAEHLTVEEAAGLKEGFKLMDTNNRGKINIDELRVGLHKLGHQVPDSDVQILMEAGDV  410

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VHL  + ND++L KAF  FD++ SGYIE EELR+ L +  + N +
Sbjct  411   DKDGHLDYGEFVAISVHLRKMGNDEHLRKAFQFFDENQSGYIEIEELRNALSDEVETN-S  469

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V   I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+    +LS+ L +D S+ 
Sbjct  470   EEVTNAIMHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFASLSLTLMRDGSLH  529



>ref|NP_001266123.1| calcium-dependent protein kinase 32-like [Cicer arietinum]
 gb|AAP72282.2| calcium-dependent calmodulin-independent protein kinase isoform 
2 [Cicer arietinum]
Length=540

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/482 (63%), Positives = 388/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  I  +YE G+ELGRGEFG+TYLCT+KE GE +ACK ISK KLRT +D+EDVRREV
Sbjct  52    DPTGREIEVRYELGRELGRGEFGITYLCTDKENGEELACKSISKKKLRTLVDIEDVRREV  111

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K+ YED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VTKTI+
Sbjct  112   EIMKHMPKHPNIVTLKDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIV  171

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FF PG++F EIVGSPYYMA
Sbjct  172   EVVQMCHKHGVMHRDLKPENFLFANKKETAALKAIDFGLSVFFTPGEKFNEIVGSPYYMA  231

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVD+WSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKRDPWPK+S+
Sbjct  232   PEVLKRNYGPEVDIWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKRDPWPKVSD  291

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  292   NAKDLVKRMLNPDPKRRLTAQEVLDHPWLQNAKKAPNVSLGETVRARLKQFSVMNKLKKR  351

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   +KE F +MDT   G ++ +EL+ GL  +G  + D DVQ+LM+A 
Sbjct  352   ALRVIAEHLSVEEAAGLKEGFKLMDTSNKGKINIDELRIGLHKLGHQIPDADVQILMEAG  411

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVD +G L+  E++ ++VHL  + ND++LHKAF  FD++ +GYIE EELR+ L +  + N
Sbjct  412   DVDRDGHLDYGEYVAISVHLRKMGNDEHLHKAFDFFDQNQTGYIEIEELRNALSDEIETN  471

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDG+IS+ EF +MM  GTDW+ ASR+YS+   N+LS++L +D S
Sbjct  472   -SEEVISAIMHDVDTDKDGKISYEEFASMMKLGTDWRKASRQYSRERFNSLSLKLMRDGS  530

Query  1698  VQ  1703
             +Q
Sbjct  531   LQ  532



>ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum 
lycopersicum]
 ref|XP_010312078.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum 
lycopersicum]
Length=525

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/484 (64%), Positives = 382/484 (79%), Gaps = 5/484 (1%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             N TG  I   YE G+ELGRGEFGVTYL T+K +GE  ACK ISK KLRT +D+EDVRREV
Sbjct  44    NPTGTDIEATYELGRELGRGEFGVTYLSTDKVSGEVYACKSISKKKLRTRVDIEDVRREV  103

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+HLPKHPNIV+ K+ YED  AV++VMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  104   EIMKHLPKHPNIVTLKDTYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  163

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQ+CHKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+RF EIVGSPYYMA
Sbjct  164   EVIQMCHKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMA  223

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+RDYG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ++FKRDPWPK+S+
Sbjct  224   PEVLKRDYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVNFKRDPWPKVSD  283

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLVK ML+ +P  R+T +EVL H WIQNA+  PNV LGE V  R+KQF++MNK KKR
Sbjct  284   NAKDLVKKMLNPDPSQRLTAQEVLDHPWIQNAKKAPNVSLGETVKARLKQFSMMNKLKKR  343

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+L+ D+V  IKE F +MD    G +   EL+ GL  +G  + + DVQ+LMD  
Sbjct  344   ALRVIAEHLTVDEVAGIKEGFQLMDISNKGKIDVNELRVGLQKLGHQIPESDVQILMDVG  403

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDD--  1511
             DVD +G L+  EF+ ++VHL  ++N+++L KAF  FD++ +GYIE EELR+ L   DD  
Sbjct  404   DVDKDGFLDYGEFVAISVHLRKMANEEHLKKAFDFFDRNQNGYIEIEELREAL---DDEI  460

Query  1512  DNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKD  1691
             +  +++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N+LS++L KD
Sbjct  461   ETNSEEVINAIMQDVDTDKDGRISYDEFSTMMKAGTDWRKASRQYSRERYNSLSLKLMKD  520

Query  1692  KSVQ  1703
              S+Q
Sbjct  521   GSLQ  524



>ref|XP_008662648.1| PREDICTED: calcium-dependent protein kinase 8-like [Zea mays]
Length=566

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/482 (61%), Positives = 390/482 (81%), Gaps = 6/482 (1%)
 Frame = +3

Query  261   ATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreve  440
             A+ + + ++Y+ G+ELGRGEFGVT  CT+  TGE +ACK ISK KLR+ +D+EDVRREV 
Sbjct  70    ASAEELLRRYQLGEELGRGEFGVTRRCTDTSTGEVLACKSISKRKLRSSVDIEDVRREVA  129

Query  441   iMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILE  620
             IMR LP+HPN+V  +E +ED + V+LVME+CEGGELFDRIV++GHYTERAAA V +TI+E
Sbjct  130   IMRSLPEHPNVVRLREAFEDADTVHLVMEVCEGGELFDRIVSRGHYTERAAACVMRTIME  189

Query  621   VIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAP  800
             V+  CHKHGVIHRDLKPENFLYAN +EN+ LK IDFGLS+ FKPG RF EIVGSPYYMAP
Sbjct  190   VVLHCHKHGVIHRDLKPENFLYANTSENSALKVIDFGLSVCFKPGDRFSEIVGSPYYMAP  249

Query  801   EVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISED  980
             EVL+R+YG E+D+WSAGVILYILLCGVPPFWAET+EGIA AI+R +IDF+R+PW K+SE+
Sbjct  250   EVLKRNYGQEIDIWSAGVILYILLCGVPPFWAETDEGIAQAIIRSNIDFRREPWSKVSEN  309

Query  981   AKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRV  1160
             AKDLV+ MLD +PY R+T ++VL H WIQNA   PN+PLGE V +R+KQFT+MNKFKK+ 
Sbjct  310   AKDLVRKMLDPSPYCRLTAQQVLEHPWIQNASAAPNIPLGEAVRSRLKQFTVMNKFKKKA  369

Query  1161  LMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAAD  1340
             L+VVAE L  +++E+I+E+F ++DT+K+G+L+ EEL+ G+ ++G  V D DV +LM+AAD
Sbjct  370   LLVVAEYLPAEELEAIRELFQLLDTNKDGHLTIEELRKGMRLIGHNVHDTDVDMLMEAAD  429

Query  1341  VDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNK  1520
             +DGNG L+C+EF+T+++HL  + ++D+L K F  FDK+ SGYIE EEL++ L       +
Sbjct  430   IDGNGTLDCKEFVTVSIHLKKIRSEDHLPKVFSYFDKNGSGYIEIEELKEAL-----SPR  484

Query  1521  NDQ-VVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              DQ  +++II D D+D+DG+IS+ EF+ MM  G DW+  SR+YS+ + N LS ++FKD S
Sbjct  485   GDQKAIEDIILDVDIDRDGKISYEEFELMMKAGVDWRNTSRQYSRAVYNTLSRKMFKDAS  544

Query  1698  VQ  1703
             ++
Sbjct  545   LK  546



>ref|XP_002442035.1| hypothetical protein SORBIDRAFT_08g007660 [Sorghum bicolor]
 gb|EES15873.1| hypothetical protein SORBIDRAFT_08g007660 [Sorghum bicolor]
Length=569

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/504 (59%), Positives = 399/504 (79%), Gaps = 6/504 (1%)
 Frame = +3

Query  198   TRAPRSQKISRQIRVLNE--SHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVA  371
              RA  +++    + VL +  +  A+ + + ++Y+ G+ELGRGEFGVT  CT+  TGE +A
Sbjct  51    ARATTTEQARTPLTVLGKGLAAEASAEELLRRYQLGEELGRGEFGVTRRCTDTSTGEVLA  110

Query  372   CKKISKSKLRTeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELF  551
             CK ISK KLR+ +D+EDVRREV IM  LP+HPN+V  +E +ED + V+LVME+CEGGELF
Sbjct  111   CKSISKRKLRSSVDIEDVRREVSIMGSLPEHPNVVRLREAFEDGDTVHLVMEVCEGGELF  170

Query  552   DRIVAKGHYTERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFG  731
             DRIV++GHYTERAAA V +TI+EV+  CHKHGV+HRDLKPENFLYAN +EN+ LK IDFG
Sbjct  171   DRIVSRGHYTERAAANVMRTIMEVVLHCHKHGVMHRDLKPENFLYANTSENSALKVIDFG  230

Query  732   LSIFFKPGQRFKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEG  911
             LS+ FKPG RF EIVGSPYYMAPEVL+R+YG EVD+WSAGVILYILLCGVPPFWAET+EG
Sbjct  231   LSVCFKPGDRFSEIVGSPYYMAPEVLKRNYGQEVDIWSAGVILYILLCGVPPFWAETDEG  290

Query  912   IAHAIVRGDIDFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNV  1091
             IA AI+R  IDF+R+PWPK+SE+AKDLV+ MLD +PYSR+T ++VL H WIQNA   PN+
Sbjct  291   IAQAIIRSSIDFQREPWPKVSENAKDLVRKMLDPSPYSRLTAQQVLEHPWIQNASAAPNI  350

Query  1092  PLGEGVTTRIKQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELK  1271
             PLGE V +R+KQFT+MNKFKK+ L+VVA+ L  +++E+I+E+FHM+DT+K+G+L+ EEL+
Sbjct  351   PLGEAVRSRLKQFTVMNKFKKKALLVVADYLPAEELEAIRELFHMLDTNKDGHLTIEELR  410

Query  1272  DGLSMMGQPVADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDK  1451
              GL ++G  V D DV +LM+AAD+DGNG L+C+EF+T+++HL  + ++D+L K F  FDK
Sbjct  411   KGLRLIGHNVHDTDVDMLMEAADMDGNGTLDCKEFVTVSIHLKKIRSEDHLPKVFSYFDK  470

Query  1452  DNSGYIEFEELRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKM  1631
             + SGYIE EEL++ L    D    ++ + +II D D DKDG+IS+ EF+ MM  G DW+ 
Sbjct  471   NGSGYIEIEELKEALSPRGD----EKAIDDIILDVDKDKDGKISYEEFELMMKAGVDWRN  526

Query  1632  ASRKYSKVMLNALSVRLFKDKSVQ  1703
              SR+YS+ + N LS ++FKD S++
Sbjct  527   TSRQYSRAVYNTLSRKMFKDVSLK  550



>gb|EPS73534.1| calcium-dependent protein kinase 8, partial [Genlisea aurea]
Length=533

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/482 (63%), Positives = 386/482 (80%), Gaps = 1/482 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG+ I+ KY+ G+ LGRGEFGVTYLCT+ ETGE +ACK ISK KLRT +DVEDVRREV
Sbjct  49    DPTGNDINGKYDLGRVLGRGEFGVTYLCTDVETGEKLACKSISKKKLRTTVDVEDVRREV  108

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIM+H+PKHPNIV+ K  YED  AV++VMELCEGGELFDRIVA+GHYTERAAA V KTI+
Sbjct  109   EIMKHMPKHPNIVTLKATYEDDNAVHIVMELCEGGELFDRIVARGHYTERAAAHVMKTII  168

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EVIQ CH+ GV+HRDLKPENFL++N  E + LKAIDFGLSIFFK G+RF EIVGSPYYMA
Sbjct  169   EVIQACHEQGVMHRDLKPENFLFSNKKETSTLKAIDFGLSIFFKNGERFNEIVGSPYYMA  228

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI++  IDFKRDPWPK+S+
Sbjct  229   PEVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAIIQCVIDFKRDPWPKVSD  288

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
             +AKDLV  ML+ +P  R+T  +VL H W+QN E  PNV LGE V  R+KQF++MNK KKR
Sbjct  289   NAKDLVMKMLEPDPNKRLTARQVLEHPWLQNIEKAPNVSLGETVKARLKQFSVMNKLKKR  348

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IKE F MMD++K G ++ EE K GL  +G  + + D+Q+LM+AA
Sbjct  349   ALRVIAEHLSVEEVAGIKEAFDMMDSEKKGKINLEEFKVGLQKLGHQIPETDIQILMEAA  408

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             DVDG+G LN  EF+ ++VHL  ++ND++LHKAF  FD++ SGYIE EELRD L + D  N
Sbjct  409   DVDGDGTLNYGEFVAVSVHLRKMANDEHLHKAFAFFDRNGSGYIEIEELRDALSDEDGAN  468

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              +++V+  I+ D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   N+LS++L ++ S
Sbjct  469   -SEEVITAIMHDVDTDKDGKISYDEFAGMMKAGTDWRKASRQYSRERFNSLSLKLMREGS  527

Query  1698  VQ  1703
             +Q
Sbjct  528   LQ  529



>gb|AGI21022.1| calcium-dependent protein kinase 2 [Dendrobium catenatum]
Length=541

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/493 (62%), Positives = 388/493 (79%), Gaps = 1/493 (0%)
 Frame = +3

Query  222   ISRQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLR  401
             + R   + + S +A   GI +KY    ELGRGEFGVTYLC  ++T E +ACK ISK KLR
Sbjct  43    VKRLTVLTDGSWDARSGGIEEKYMIDGELGRGEFGVTYLCMNRDTRELLACKSISKRKLR  102

Query  402   TeidvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYT  581
             T +DVEDVRREV IMRHLP++P+IVS +E  ED  AV+LVMELCEGGELFDRIVA+GHYT
Sbjct  103   TSVDVEDVRREVAIMRHLPRNPSIVSLREACEDDNAVHLVMELCEGGELFDRIVARGHYT  162

Query  582   ERAAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQR  761
             ERAAA VTKTI+EV+Q+CH HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG+R
Sbjct  163   ERAAAAVTKTIMEVVQLCHLHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGER  222

Query  762   FKEIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDI  941
             F EIVGSPYYMAPEVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG++
Sbjct  223   FSEIVGSPYYMAPEVLKRNYGQEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNL  282

Query  942   DFKRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRI  1121
             DFKR+PWP +SE+AKDLV+ ML+ +P  R+  ++VL H WIQNA+  PNVPLG+ V +R+
Sbjct  283   DFKREPWPNVSENAKDLVRQMLEPDPKKRLIAKQVLEHPWIQNAKKAPNVPLGDVVKSRL  342

Query  1122  KQFTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPV  1301
             KQFT MN+FK+R L V+AE+LS ++VE +K  F MMDTD +G +S EELK+GL   G P+
Sbjct  343   KQFTRMNRFKRRALRVIAEHLSTEEVEDMKGKFKMMDTDNDGIISCEELKNGLVKFGSPL  402

Query  1302  ADHDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEE  1481
              + ++Q+L++A D  G G L+  EF+ +++H   ++ND++L +AF  FDKD +GYIE EE
Sbjct  403   VESELQMLIEAVDTSGKGKLDYGEFVAISLHSQKMANDEHLRRAFSYFDKDGNGYIEAEE  462

Query  1482  LRDYLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVML  1661
             LRD L E D    N  V  +I+ + D DKDGRIS+ EF AMM TGTDW+ ASR YS+   
Sbjct  463   LRDALAE-DGATDNADVANDILQEVDTDKDGRISYDEFVAMMKTGTDWRKASRHYSRGRF  521

Query  1662  NALSVRLFKDKSV  1700
             N+LS+RL KD S+
Sbjct  522   NSLSIRLMKDGSL  534



>ref|XP_009344460.1| PREDICTED: calcium-dependent protein kinase 8-like [Pyrus x bretschneideri]
Length=531

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/537 (59%), Positives = 404/537 (75%), Gaps = 14/537 (3%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPI-DPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDG  275
             MG C +         P+   P+ D +N +   SR   P       ++ VL +    TG  
Sbjct  1     MGNCCAT--------PQTGSPLKDKKNRKNPFSRNYVPGQGNGGSKLCVLKD---PTGAE  49

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             I ++YE G+ELGRGEFG+TYLCT+K++GE  ACK ISKSKLRT +D+EDV REVEIM+HL
Sbjct  50    IEQRYELGRELGRGEFGITYLCTDKDSGEKFACKSISKSKLRTAVDIEDVTREVEIMKHL  109

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PKHPNIVS K+ YED  AV++VMELCEGGELFDRIV++GHYTERAAA VTKTI+EV+Q+C
Sbjct  110   PKHPNIVSLKDTYEDDHAVHIVMELCEGGELFDRIVSRGHYTERAAAAVTKTIVEVVQMC  169

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGV+HRDLKPENFL+ N  E APLKAIDFGLS+FFKPG+ F EIVGSPYYMAPEVL+R
Sbjct  170   HKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGEVFNEIVGSPYYMAPEVLKR  229

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG E+DVWSAGVILYILLCGVPPFWAETE+G+A AI+R  ++FK+DPWP +S++AKDLV
Sbjct  230   NYGPEIDVWSAGVILYILLCGVPPFWAETEQGVAEAIIRSVVNFKKDPWPLVSDNAKDLV  289

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             K ML+ +P  R+T +EVL H W+QNA+  PNV LGE V +R+KQF++MNK KK  L V+A
Sbjct  290   KKMLNPDPKQRLTAQEVLDHPWLQNAKKAPNVSLGETVRSRLKQFSVMNKLKKSALKVIA  349

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             E+LS ++V  I+E F +MD +  G ++ +EL+ GL  +G  + D D+ +LM+A DVD +G
Sbjct  350   EHLSMEEVGGIQEGFKLMDINNKGKINIDELRVGLHKLGHQIPDGDLHILMEAGDVDNDG  409

Query  1356  MLNCEEFITLAVHLTNLSND-DNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQV  1532
              L+  EF+ ++VHL  + ND ++L KAF  FDKD +GYIE EELRD L    DDN  D V
Sbjct  410   YLDYGEFVAISVHLRRMGNDEEHLRKAFEFFDKDRNGYIEIEELRDALSNEVDDNIED-V  468

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +  II D D DKDGRIS+ EF AMM  GTDW+ ASR+YS+   N+LS++LFKD  ++
Sbjct  469   INAIINDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRDRFNSLSLKLFKDGPLE  525



>ref|XP_004981335.1| PREDICTED: calcium-dependent protein kinase 7-like [Setaria italica]
Length=531

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/534 (58%), Positives = 402/534 (75%), Gaps = 8/534 (1%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNRRPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATGDGI  278
             MG C    +       R +   +P NV    +R  AP   +    + VL    + TG  +
Sbjct  1     MGNCCGAPATQGDSNRRKKPKANPYNV--AYNRGAAPAPARPG--LVVL---RDPTGRDL  53

Query  279   SKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHLP  458
               +Y+ G ELGRGEFG+TYLCTE  TG   ACK ISK KLRT +DVEDVRREV+IMRH+P
Sbjct  54    GAQYDLGGELGRGEFGITYLCTEVATGARYACKSISKRKLRTPVDVEDVRREVDIMRHMP  113

Query  459   KHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVCH  638
              HPNIVS +  YED+EAV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EV+Q+CH
Sbjct  114   SHPNIVSLRAAYEDEEAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEVVQMCH  173

Query  639   KHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRRD  818
             +HGV+HRDLKPENFLYAN  E++PLKAIDFGLS+FF+PG+RF EIVGSPYYMAPEVL+R+
Sbjct  174   RHGVMHRDLKPENFLYANKKESSPLKAIDFGLSVFFRPGERFTEIVGSPYYMAPEVLKRN  233

Query  819   YGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLVK  998
             YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKR+PWP++SE AKDLV 
Sbjct  234   YGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSKVDFKREPWPRVSEPAKDLVM  293

Query  999   GMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVAE  1178
              MLD NP +R T  +VL H W+ +++ +P+VPLG+ V  R++QF+ MNK KK+ L V+AE
Sbjct  294   RMLDPNPNTRFTAAQVLEHPWLHDSKKMPDVPLGDAVRARLQQFSAMNKLKKKALRVIAE  353

Query  1179  NLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNGM  1358
             +LS ++   IK+MF  MD  KNG L+FEE K GL  +G  + D D+++LMDAADVD NG 
Sbjct  354   HLSVEEAADIKQMFDKMDVSKNGKLTFEEFKAGLRKLGNQMPDSDLRILMDAADVDKNGT  413

Query  1359  LNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQVVQ  1538
             L+  EF+T++VH+  + ND+++ KAF  FD++ SGYIE EELR+ L++ + +  ++ ++ 
Sbjct  414   LDYAEFVTVSVHVRKIGNDEHIQKAFTYFDRNKSGYIEIEELREALVD-ELEGTDEDIIN  472

Query  1539  EIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
              II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+   + LS++L KD S+
Sbjct  473   GIIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRQRFSNLSLKLQKDGSI  526



>gb|KHG01410.1| Calcium-dependent protein kinase 32 [Gossypium arboreum]
Length=535

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/491 (63%), Positives = 391/491 (80%), Gaps = 4/491 (1%)
 Frame = +3

Query  231   QIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTei  410
             ++ VLN   + TG  I ++YE G ELGRGEFG+TYLCT+KETG++ ACK ISK KLRT++
Sbjct  43    KLTVLN---DPTGREIEQRYELGCELGRGEFGITYLCTDKETGDTFACKSISKKKLRTDV  99

Query  411   dvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERA  590
             D+EDVRREVEIM+HLP HPNIV+ K+ YED  +V+LVMELCEGGELFDRIVA+GHYTERA
Sbjct  100   DIEDVRREVEIMKHLPHHPNIVTLKDTYEDDNSVHLVMELCEGGELFDRIVARGHYTERA  159

Query  591   AALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKE  770
             AA VTKTI+EV+Q+CHKHGV+HRDLKPENFL+AN  E A LK+IDFGLS+FFKPG+ F E
Sbjct  160   AAAVTKTIVEVVQMCHKHGVMHRDLKPENFLFANKKETAALKSIDFGLSVFFKPGEIFTE  219

Query  771   IVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFK  950
             IVGSPYYMAPEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  IDFK
Sbjct  220   IVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVIDFK  279

Query  951   RDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQF  1130
             RDPWPK+S++AKDLV+ ML+ +P  R+T +EVL H W+QNA+  PNV LGE V  R+KQF
Sbjct  280   RDPWPKVSDNAKDLVRKMLNPDPKQRLTAQEVLDHPWLQNAKKAPNVSLGETVKARLKQF  339

Query  1131  TLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADH  1310
             ++MNK KKR L V+AE+LS ++V  IKE F +MDT   G ++ +EL+ GL  +G  + D 
Sbjct  340   SVMNKLKKRALKVIAEHLSVEEVAGIKEGFQLMDTANRGKINIDELRVGLHKLGHTIPDA  399

Query  1311  DVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRD  1490
             D+Q+LM+A DVD +G L+  EF+ ++VHL  + ND++L KAF  FD++ SGYIE EELRD
Sbjct  400   DLQILMEAGDVDKDGYLDYGEFVAISVHLRKMGNDEHLKKAFEFFDRNQSGYIEIEELRD  459

Query  1491  YLLEIDDDNKNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNAL  1670
              L +  + N +++V+  I+ D D DKDGRIS+ EF  MM  GTDW+ ASR+YS+   N L
Sbjct  460   ALSDEVETN-SEEVISAIMHDVDTDKDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNL  518

Query  1671  SVRLFKDKSVQ  1703
             S++L  D S+Q
Sbjct  519   SLKLMMDGSLQ  529



>ref|XP_008654304.1| PREDICTED: uncharacterized protein LOC100192661 isoform X1 [Zea 
mays]
 gb|ACN29191.1| unknown [Zea mays]
 gb|AFW84687.1| putative calcium-dependent protein kinase family protein [Zea 
mays]
Length=536

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/477 (63%), Positives = 392/477 (82%), Gaps = 0/477 (0%)
 Frame = +3

Query  273   GISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRH  452
             GI  KY   +ELGRGEFGVTYLC ++ T E +ACK ISK KLRT +DVEDVRREV IMRH
Sbjct  56    GIDDKYVLDRELGRGEFGVTYLCMDRGTKELLACKSISKRKLRTAVDVEDVRREVAIMRH  115

Query  453   LPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQV  632
             LPK P++VS +E  ED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TILEV+Q+
Sbjct  116   LPKSPSVVSLREACEDDGAVHLVMELCEGGELFDRIVARGHYTERAAASVTRTILEVVQL  175

Query  633   CHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLR  812
             CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F EIVGSPYYMAPEVL+
Sbjct  176   CHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFSEIVGSPYYMAPEVLK  235

Query  813   RDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDL  992
             R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG+IDFKR+PWP +SE+AKDL
Sbjct  236   RNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDFKREPWPNVSENAKDL  295

Query  993   VKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVV  1172
             V+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQF+ MN+FK+R L V+
Sbjct  296   VRHMLEPDPKLRLTAKQVLEHHWLQNAKKAPNVPLGDIVKSRLKQFSRMNRFKRRALRVI  355

Query  1173  AENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGN  1352
             A++LS ++VE IK+MF  MDTD +G +S+EELK G++ +G  +A+ +VQ+L++A D +G 
Sbjct  356   ADHLSAEEVEDIKDMFKTMDTDNDGIVSYEELKTGIAKLGSHLAESEVQMLIEAVDTNGR  415

Query  1353  GMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQV  1532
             G L+  EF+ +++HL  ++ND++L +AFL FDKD +G+IE EELR+ L++    +  ++V
Sbjct  416   GALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGFIEPEELREALVDDGAADSMEEV  475

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             V +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   N+LS++L KD SV+
Sbjct  476   VNDILQEVDTDKDGKISYEEFVAMMKTGTDWRKASRHYSRGRFNSLSMKLIKDGSVK  532



>ref|XP_002456584.1| hypothetical protein SORBIDRAFT_03g038870 [Sorghum bicolor]
 gb|EES01704.1| hypothetical protein SORBIDRAFT_03g038870 [Sorghum bicolor]
Length=545

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/479 (64%), Positives = 394/479 (82%), Gaps = 5/479 (1%)
 Frame = +3

Query  273   GISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRH  452
             GI  KY   +ELGRGEFGVTYLC +++T E +ACK ISK KLRT +DVEDVRREV IMRH
Sbjct  66    GIDDKYVLDRELGRGEFGVTYLCMDRDTKELLACKSISKRKLRTAVDVEDVRREVAIMRH  125

Query  453   LPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQV  632
             LPK P+IVS +E  ED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EV+Q+
Sbjct  126   LPKSPSIVSLREACEDEGAVHLVMELCEGGELFDRIVARGHYTERAAANVTRTIVEVVQL  185

Query  633   CHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLR  812
             CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F EIVGSPYYMAPEVL+
Sbjct  186   CHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFSEIVGSPYYMAPEVLK  245

Query  813   RDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDL  992
             R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG+IDFKR+PWP +SE+AKDL
Sbjct  246   RNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDFKREPWPNVSENAKDL  305

Query  993   VKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVV  1172
             V+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQF+ MN+FK+R L V+
Sbjct  306   VRRMLEPDPKLRLTAKQVLEHHWLQNAKKAPNVPLGDIVKSRLKQFSRMNRFKRRALRVI  365

Query  1173  AENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGN  1352
             A++LS ++VE IKEMF  MDTD +G +S+EELK G++ +G  +A+ +VQ+L++A D +G 
Sbjct  366   ADHLSAEEVEDIKEMFKTMDTDNDGIVSYEELKTGIAKLGSHLAESEVQMLIEAVDTNGR  425

Query  1353  GMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND--  1526
             G L+  EF+ +++HL  ++ND++L +AFL FDKD +G+IE EELR+ L+   DD   D  
Sbjct  426   GALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGFIEPEELREALV---DDGAADSM  482

Query  1527  QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             +VV +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   N+LS++L KD SV+
Sbjct  483   EVVNDILQEVDTDKDGKISYDEFVAMMKTGTDWRKASRHYSRGRFNSLSMKLIKDGSVK  541



>ref|XP_002466239.1| hypothetical protein SORBIDRAFT_01g004150 [Sorghum bicolor]
 gb|EER93237.1| hypothetical protein SORBIDRAFT_01g004150 [Sorghum bicolor]
Length=532

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/537 (59%), Positives = 407/537 (76%), Gaps = 13/537 (2%)
 Frame = +3

Query  99    MGACVSLHSALTMKRPRNR---RPIDPENVRGGGSRTRAPRSQKISRQIRVLNESHNATG  269
             MG C +  + LT +  +NR   +  +P NV    +R  AP S +    + VL    + TG
Sbjct  1     MGNCCA--APLTEESGKNRPKKQKANPYNV--AYNRGAAPPSARPG--LLVL---RDPTG  51

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
               +  +YE G ELGRGEFG+TYLCTE  TG   ACK ISK KLRT +DVEDVRREV+IMR
Sbjct  52    RDLGAQYELGGELGRGEFGITYLCTESATGARYACKSISKRKLRTPVDVEDVRREVDIMR  111

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
             H+P HPNIVS +  YED++AV+LVMELCEGGELFDRIVA+GHYTERAAA V +TI+EV+Q
Sbjct  112   HMPAHPNIVSLRAAYEDEDAVHLVMELCEGGELFDRIVARGHYTERAAAAVLRTIVEVVQ  171

Query  630   VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVL  809
             +CH+HGV+HRDLKPENFLYAN  E++PLKAIDFGLS+FF+PG+RF EIVGSPYYMAPEVL
Sbjct  172   MCHRHGVMHRDLKPENFLYANKKESSPLKAIDFGLSVFFRPGERFSEIVGSPYYMAPEVL  231

Query  810   RRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKD  989
             +R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKR+PWP++SE AKD
Sbjct  232   KRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKREPWPRVSEPAKD  291

Query  990   LVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMV  1169
             LV+ MLD NP +R T  +VL H W+ +++ +P++ LG+ V  R++QF  MNK KK+ L V
Sbjct  292   LVRRMLDPNPLTRFTAAQVLEHPWLHDSKKMPDISLGDTVRARLQQFAAMNKLKKKALRV  351

Query  1170  VAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDG  1349
             +AE+LS ++V  IK+MF  MD +KNG L+FEE K GL  +G  + D D+Q+LMDAAD+D 
Sbjct  352   IAEHLSVEEVADIKQMFDKMDVNKNGKLTFEEFKAGLRKLGNQMPDSDLQILMDAADIDK  411

Query  1350  NGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQ  1529
             NG L+  EF+T++VH+  + ND+++ KAF  FD++ SGYIE EELR+ L +  D N  D 
Sbjct  412   NGTLDYGEFVTVSVHVRKIGNDEHIEKAFTYFDRNKSGYIEIEELREALSDELDGNDED-  470

Query  1530  VVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             ++  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+   + LS++L KD S+
Sbjct  471   IINGIIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRQRFSNLSLKLQKDGSL  527



>gb|EEC71743.1| hypothetical protein OsI_04311 [Oryza sativa Indica Group]
Length=551

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/494 (62%), Positives = 398/494 (81%), Gaps = 5/494 (1%)
 Frame = +3

Query  228   RQIRVLNESHNATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTe  407
             +++ VL E       GI  KY   +ELGRGEFGVTYLC +++T E +ACK ISK KLRT 
Sbjct  57    KRLPVLGEEGCELIGGIDDKYALDRELGRGEFGVTYLCMDRDTKELLACKSISKRKLRTA  116

Query  408   idvedvrreveiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTER  587
             +DVEDVRREV IMRHLPK  +IVS +E  ED+ AV+LVMELCEGGELFDRIVA+GHYTER
Sbjct  117   VDVEDVRREVAIMRHLPKSASIVSLREACEDEGAVHLVMELCEGGELFDRIVARGHYTER  176

Query  588   AAALVTKTILEVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFK  767
             AAA VT+TI+EV+Q+CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F 
Sbjct  177   AAANVTRTIVEVVQLCHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFS  236

Query  768   EIVGSPYYMAPEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDF  947
             EIVGSPYYMAPEVL+R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG+IDF
Sbjct  237   EIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDF  296

Query  948   KRDPWPKISEDAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQ  1127
             KR+PWP +SE+AKDLV+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQ
Sbjct  297   KREPWPNVSENAKDLVRRMLEPDPKLRLTAKQVLEHPWLQNAKKAPNVPLGDIVKSRLKQ  356

Query  1128  FTLMNKFKKRVLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVAD  1307
             F+ MN+FK+R L V+A++LS ++VE IKEMF  MDTD +G +S+EELK G++  G  +A+
Sbjct  357   FSRMNRFKRRALRVIADHLSAEEVEDIKEMFKAMDTDNDGIVSYEELKSGIAKFGSHLAE  416

Query  1308  HDVQLLMDAADVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELR  1487
              +VQ+L++A D +G G L+  EF+ +++HL  ++ND++L +AFL FDKD +GYIE EELR
Sbjct  417   SEVQMLIEAVDTNGKGALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGYIEPEELR  476

Query  1488  DYLLEIDDDNKND--QVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVML  1661
             + L+   DD   D  +VV +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   
Sbjct  477   EALV---DDGAGDSMEVVNDILQEVDTDKDGKISYDEFVAMMKTGTDWRKASRHYSRGRF  533

Query  1662  NALSVRLFKDKSVQ  1703
             N+LS++L KD SV+
Sbjct  534   NSLSMKLIKDGSVK  547



>ref|XP_006295937.1| hypothetical protein CARUB_v10025074mg [Capsella rubella]
 gb|EOA28835.1| hypothetical protein CARUB_v10025074mg [Capsella rubella]
Length=531

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/480 (64%), Positives = 379/480 (79%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I  KY+ G+ELGRGEFGVTYLCTE ETGE  ACK I K KL+T ID+EDV+REVEI
Sbjct  47    TGHEIKLKYKLGRELGRGEFGVTYLCTEIETGEVFACKSILKKKLKTSIDIEDVKREVEI  106

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MRH+P+HPNIV+ KE YED +AV+LVMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  107   MRHMPEHPNIVTLKETYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKTIIEV  166

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  167   VQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  226

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR YG E+D+WSAGVILYILLCGVPPFWAETE G+A AI++  +DF+R+PWPK+SE+A
Sbjct  227   VLRRSYGPEIDIWSAGVILYILLCGVPPFWAETEHGVAKAILKSVVDFRREPWPKVSENA  286

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDLVK ML  +P  R+T ++VL H WIQN +  PNV LGE V  R++QF++MNK KKR L
Sbjct  287   KDLVKKMLHPDPRRRLTAQQVLDHPWIQNGKNAPNVSLGETVRARLQQFSIMNKLKKRAL  346

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS+++   IK+ F +MDT   G ++  EL  GL  +G  V   D+Q+LMDA DV
Sbjct  347   RVIAEHLSEEETSCIKDRFQVMDTGNRGKITINELGIGLQKLGIVVPQDDIQILMDAGDV  406

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VH+  L ND++L KAF  FDK+ SGYIE EELRD L   D D  +
Sbjct  407   DKDGYLDVNEFVAISVHIKKLGNDEHLKKAFTFFDKNESGYIEIEELRDALAN-DVDTTS  465

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++V++ II D D +KDG+IS+ EF  MM TGTDW+ ASR+YS+ +  +LS++L KD S+Q
Sbjct  466   EEVIEAIILDVDTNKDGKISYEEFATMMKTGTDWRKASRQYSRDLFKSLSLKLMKDGSLQ  525



>gb|ACN39928.1| unknown [Picea sitchensis]
Length=529

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/477 (64%), Positives = 385/477 (81%), Gaps = 3/477 (1%)
 Frame = +3

Query  276   ISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRHL  455
             + +++   +ELGRGEFG+TYLCT++E+ E +ACK ISK KL+T ID+EDVRREV IM+HL
Sbjct  48    VEERFLLDRELGRGEFGITYLCTDRESRELLACKSISKRKLKTAIDIEDVRREVAIMKHL  107

Query  456   PKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQVC  635
             PK+ NIVS K   ED  AV+L+MELCEGGELFDRIVA+GHYTERAAA VT+TI+EV+Q+C
Sbjct  108   PKNNNIVSLKATCEDDNAVHLLMELCEGGELFDRIVARGHYTERAAAAVTRTIVEVVQLC  167

Query  636   HKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLRR  815
             HKHGVIHRDLKPENFL+AN  EN+PLKAIDFGLS+FFKPG RF EIVGSPYYMAPEVL+R
Sbjct  168   HKHGVIHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGDRFSEIVGSPYYMAPEVLKR  227

Query  816   DYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDLV  995
             +YG E+DVWSAGVILYILLCGVPPFWAE+E+G+A AI+RG +DFKR+PWPKISE AK LV
Sbjct  228   NYGPEIDVWSAGVILYILLCGVPPFWAESEQGVAQAILRGFVDFKREPWPKISETAKSLV  287

Query  996   KGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVVA  1175
             + ML+ +P  R+T ++V+ H W+QNA+  PNVPLG+ V TR+KQF++ NKFKKR L V+A
Sbjct  288   RQMLEPDPKRRLTAQQVIEHPWLQNAKKAPNVPLGDVVKTRLKQFSMTNKFKKRALRVIA  347

Query  1176  ENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGNG  1355
             ++LS ++ + IK+MF MMDTD +G++S+++LK GL  +G  + + +VQ+LMDAAD DGNG
Sbjct  348   DHLSVEETKGIKDMFKMMDTDNSGSISYDKLKAGLHKLGSQMDESEVQILMDAADADGNG  407

Query  1356  MLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKND-QV  1532
             ML+  EF+  ++H+ ++ NDD L KAFL FDKD SGYIE EE R+ L   DD   ND  V
Sbjct  408   MLDYREFVAASLHMQSIDNDDYLRKAFLFFDKDGSGYIEIEEFREAL--ADDFGPNDIDV  465

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             V  I  + D DKDGRIS+ EF +MM TGTDW+ ASR YS+   N LS++L +D S+Q
Sbjct  466   VNSIFNEVDADKDGRISYEEFASMMKTGTDWRKASRHYSRGRFNNLSIKLVRDGSLQ  522



>ref|NP_001051652.1| Os03g0808600 [Oryza sativa Japonica Group]
 gb|AAS07386.1| putative calmodulin-domain protein kinase [Oryza sativa Japonica 
Group]
 gb|AAT77923.1| putative calmodulin-domain protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99465.1| Calcium-dependent protein kinase, isoform AK1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13566.1| Os03g0808600 [Oryza sativa Japonica Group]
 gb|EAY92281.1| hypothetical protein OsI_14004 [Oryza sativa Indica Group]
 gb|EAZ29001.1| hypothetical protein OsJ_13049 [Oryza sativa Japonica Group]
 dbj|BAG90053.1| unnamed protein product [Oryza sativa Japonica Group]
Length=538

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/481 (62%), Positives = 385/481 (80%), Gaps = 1/481 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  +  +YE G ELGRGEFG+TYLCTE ETG+  ACK ISK KLRT +DVEDVRREV
Sbjct  54    DPTGRDLGARYELGGELGRGEFGITYLCTEAETGDRYACKSISKRKLRTPVDVEDVRREV  113

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             EIMRH+P HPNIVS +  YED++ V+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  114   EIMRHMPSHPNIVSLRAAYEDEDNVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  173

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFLYAN  +++PLKAIDFGLS+FF+PG+RF EIVGSPYYMA
Sbjct  174   EVVQMCHRHGVMHRDLKPENFLYANKKDSSPLKAIDFGLSVFFRPGERFTEIVGSPYYMA  233

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKR+PWP++SE
Sbjct  234   PEVLKRHYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKREPWPRVSE  293

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLVK MLD NP +R+T E+VL H W+ +++ +P++PLG+ V  R++QF  MNK KK+
Sbjct  294   PAKDLVKRMLDPNPMTRLTAEQVLEHPWLHDSKKMPDIPLGDAVRARLQQFAAMNKLKKK  353

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++   IK+MF  MD  KNG L+FE+ K G+  +G  + D D+++LMDAA
Sbjct  354   ALKVIAEHLSAEEAADIKDMFDKMDVSKNGQLTFEDFKAGIRKLGNQMPDSDLKILMDAA  413

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D NG+L+ +EF+ +++H+  + ND+++ KAF  FD++ SGYIE EELR+ L++  D N
Sbjct  414   DIDKNGILDYQEFVAVSIHVRKIGNDEHIQKAFSYFDQNKSGYIEIEELREALVDEIDGN  473

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
               D ++  II D D DKDG+IS+ EF  MM  GTDW+ ASR+YS+   + LS++L KD S
Sbjct  474   DED-IINSIIRDVDTDKDGKISYDEFAVMMKAGTDWRKASRQYSRQRFSNLSLKLQKDGS  532

Query  1698  V  1700
             +
Sbjct  533   I  533



>ref|XP_008370105.1| PREDICTED: calcium-dependent protein kinase 13 [Malus domestica]
 ref|XP_009377751.1| PREDICTED: calcium-dependent protein kinase 13-like [Pyrus x 
bretschneideri]
Length=527

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/477 (64%), Positives = 384/477 (81%), Gaps = 1/477 (0%)
 Frame = +3

Query  270   DGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMR  449
             + I +KY   +ELGRGEFGVTYLC ++ + E +ACK ISK KLRT +DVEDVRREV IM+
Sbjct  47    ENIEEKYLVDRELGRGEFGVTYLCIDRHSRELLACKSISKRKLRTAVDVEDVRREVAIMQ  106

Query  450   HLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQ  629
             HLPK+ +IVS KE  ED+ AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+EV+Q
Sbjct  107   HLPKNSSIVSLKEACEDENAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEVVQ  166

Query  630   VCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVL  809
             +CHKHGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG+RF EIVGSPYYMAPEVL
Sbjct  167   LCHKHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGERFSEIVGSPYYMAPEVL  226

Query  810   RRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKD  989
             +R+YG E+D+WSAGVILYILLCGVPPFWAE+E+G+A AI+RG IDFKRDPWP ISE AK 
Sbjct  227   KRNYGPEIDIWSAGVILYILLCGVPPFWAESEQGVAQAILRGLIDFKRDPWPNISESAKS  286

Query  990   LVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMV  1169
             LV+ ML+ +P  R+T ++VL H W+QNA+  PN+PLG+ V +R+KQF++MN+FK++ L V
Sbjct  287   LVRQMLEPDPKLRLTAKQVLEHPWLQNAKKAPNIPLGDVVKSRLKQFSMMNRFKRKALRV  346

Query  1170  VAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDG  1349
             +A+  S D+VE  KEMF  +DTD +G +S EELK GL   G  +AD D+QLL++A D +G
Sbjct  347   IADFFSVDEVEDSKEMFKKIDTDNDGIVSIEELKSGLRNFGSQLADSDIQLLIEAVDTNG  406

Query  1350  NGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQ  1529
              G L+C EFI + +HL  ++ND++LHKAF  FDK+N+GYIE +ELRD L+E   D+  D 
Sbjct  407   KGTLDCGEFIAVTLHLQRMANDEHLHKAFSYFDKNNNGYIEPDELRDALMEDGADDCTD-  465

Query  1530  VVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSV  1700
             V  +I  + D DKDGRIS+ EF AMM TGTDW+ ASR YS+   N+LS++L KD S+
Sbjct  466   VANDIFQEVDTDKDGRISYEEFVAMMKTGTDWRKASRHYSRGRFNSLSIKLMKDGSI  522



>ref|NP_181717.3| calcium-dependent protein kinase 14 [Arabidopsis thaliana]
 sp|P93759.1|CDPKE_ARATH RecName: Full=Calcium-dependent protein kinase 14 [Arabidopsis 
thaliana]
 gb|AAB63555.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAM14824.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|ABE65901.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AEC10041.1| calcium-dependent protein kinase 14 [Arabidopsis thaliana]
Length=530

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 377/480 (79%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I +KY+ G+ELGRGEFGVTYLCTE ETGE  ACK I K KL+T ID+EDV+REVEI
Sbjct  46    TGHEIKQKYKLGRELGRGEFGVTYLCTEIETGEIFACKSILKKKLKTSIDIEDVKREVEI  105

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MR +P+HPNIV+ KE YED +AV+LVMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  106   MRQMPEHPNIVTLKETYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKTIIEV  165

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  166   VQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  225

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR YG E+D+WSAGVILYILLCGVPPFWAETE G+A AI++  IDFKRDPWPK+S++A
Sbjct  226   VLRRSYGQEIDIWSAGVILYILLCGVPPFWAETEHGVAKAILKSVIDFKRDPWPKVSDNA  285

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDL+K ML  +P  R+T ++VL H WIQN +   NV LGE V  R+KQF++MNK KKR L
Sbjct  286   KDLIKKMLHPDPRRRLTAQQVLDHPWIQNGKNASNVSLGETVRARLKQFSVMNKLKKRAL  345

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F +MDT   G ++  EL  GL  +G  V   D+Q+LMDA DV
Sbjct  346   RVIAEHLSVEETSCIKERFQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDV  405

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VH+  L ND++L KAF  FDK+ SGYIE EELRD L + D D  +
Sbjct  406   DKDGYLDVNEFVAISVHIRKLGNDEHLKKAFTFFDKNKSGYIEIEELRDALAD-DVDTTS  464

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++VV+ II D D +KDG+IS+ EF  MM TGTDW+ ASR+YS+ +   LS++L +D S+Q
Sbjct  465   EEVVEAIILDVDTNKDGKISYDEFATMMKTGTDWRKASRQYSRDLFKCLSLKLMQDGSLQ  524



>gb|ABK28533.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 377/480 (79%), Gaps = 1/480 (0%)
 Frame = +3

Query  264   TGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrevei  443
             TG  I +KY+ G+ELGRGEFGVTYLCTE ETGE  ACK I K KL+T ID+EDV+REVEI
Sbjct  46    TGHEIKQKYKLGRELGRGEFGVTYLCTEIETGEIFACKSILKKKLKTSIDIEDVKREVEI  105

Query  444   MRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEV  623
             MR +P+HPNIV+ KE YED +AV+LVMELCEGGELFDRIVA+GHYTERAAA V KTI+EV
Sbjct  106   MRQMPEHPNIVTLKETYEDDKAVHLVMELCEGGELFDRIVARGHYTERAAASVIKTIIEV  165

Query  624   IQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPE  803
             +Q+CHKHGV+HRDLKPENFL+AN  E A LKAIDFGLS+FFKPG+RF EIVGSPYYMAPE
Sbjct  166   VQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFFKPGERFNEIVGSPYYMAPE  225

Query  804   VLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDA  983
             VLRR YG E+D+WSAGVILYILLCGVPPFWAETE G+A AI++  IDFKRDPWPK+S++A
Sbjct  226   VLRRSYGQEIDIWSAGVILYILLCGVPPFWAETEHGVAKAILKSVIDFKRDPWPKVSDNA  285

Query  984   KDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVL  1163
             KDL+K ML  +P  R+T ++VL H WIQN +   NV LGE V  R+KQF++MNK KKR L
Sbjct  286   KDLIKKMLHPDPRRRLTAQQVLDHPWIQNGKNASNVSLGETVRARLKQFSVMNKLKKRAL  345

Query  1164  MVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADV  1343
              V+AE+LS ++   IKE F +MDT   G ++  EL  GL  +G  V   D+Q+LMDA DV
Sbjct  346   RVIAEHLSVEETSCIKERFQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDV  405

Query  1344  DGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKN  1523
             D +G L+  EF+ ++VH+  L ND++L KAF  FDK+ SGYIE EELRD L + D D  +
Sbjct  406   DKDGYLDVNEFVAISVHIRKLGNDEHLKKAFTFFDKNKSGYIEIEELRDALAD-DVDTTS  464

Query  1524  DQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             ++VV+ II D D +KDG+IS+ EF  MM TGTDW+ ASR+YS+ +   LS++L +D S+Q
Sbjct  465   EEVVEAIILDVDTNKDGKISYDEFATMMKTGTDWRKASRQYSRDLFKCLSLKLMQDGSLQ  524



>tpg|DAA52087.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=535

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/481 (62%), Positives = 384/481 (80%), Gaps = 1/481 (0%)
 Frame = +3

Query  258   NATGDGISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrrev  437
             + TG  +  +YE G ELGRGEFGVTYLCTE  TG   ACK ISK KLRT +DVEDVRREV
Sbjct  51    DPTGRDLGAQYELGGELGRGEFGVTYLCTESATGARYACKSISKRKLRTPVDVEDVRREV  110

Query  438   eiMRHLPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTIL  617
             +IMRH+P HPNIVS +  YED++AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TI+
Sbjct  111   DIMRHMPPHPNIVSLRAAYEDEDAVHLVMELCEGGELFDRIVARGHYTERAAAAVTRTIV  170

Query  618   EVIQVCHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMA  797
             EV+Q+CH+HGV+HRDLKPENFLYA+  E++PLKAIDFGLS+FF+PG+RF EIVGSPYYMA
Sbjct  171   EVVQMCHRHGVMHRDLKPENFLYASKKESSPLKAIDFGLSVFFRPGERFTEIVGSPYYMA  230

Query  798   PEVLRRDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISE  977
             PEVL+R+YG EVDVWSAGVILYILLCGVPPFWAETE+G+A AI+R  +DFKR+PWP++SE
Sbjct  231   PEVLKRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVAQAIIRSVVDFKREPWPRVSE  290

Query  978   DAKDLVKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKR  1157
              AKDLV+ MLD NP +R T  +VL H W+ +++ +P++ LG+ V  R++QF  MNK KK+
Sbjct  291   PAKDLVRRMLDPNPLTRFTAAQVLEHPWLHDSKKMPDISLGDTVRARLQQFAAMNKLKKK  350

Query  1158  VLMVVAENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAA  1337
              L V+AE+LS ++V  IK+MF  MD  KNG L+FEE K GL  +G  + D D+Q++MDAA
Sbjct  351   ALRVIAEHLSVEEVADIKQMFEKMDVSKNGKLTFEEFKAGLRKLGNQMPDSDLQIMMDAA  410

Query  1338  DVDGNGMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDN  1517
             D+D NG L+ EEF+T++VH+  + ND+++ KAF  FD++ SGYIE EELR+ L + + + 
Sbjct  411   DIDKNGTLDYEEFVTVSVHVRKIGNDEHIQKAFTYFDRNKSGYIEIEELREALAD-ELEG  469

Query  1518  KNDQVVQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKS  1697
              ++ ++  II D D DKDG+IS+ EF AMM  GTDW+ ASR+YS+   + LS++L KD S
Sbjct  470   TDEDIINGIIRDVDTDKDGKISYDEFAAMMKAGTDWRKASRQYSRQRFSNLSLKLQKDGS  529

Query  1698  V  1700
             +
Sbjct  530   L  530



>ref|NP_001149916.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
 gb|ACG37185.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
Length=536

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/477 (63%), Positives = 392/477 (82%), Gaps = 0/477 (0%)
 Frame = +3

Query  273   GISKKYEFGKELGRGEFGVTYLCTEKETGESVACKKISKSKLRTeidvedvrreveiMRH  452
             GI  KY   +ELGRGEFGVTYLC ++ T E +ACK ISK KLRT +DVEDVRREV IMRH
Sbjct  56    GIDDKYVLDRELGRGEFGVTYLCMDRGTKELLACKSISKRKLRTAVDVEDVRREVAIMRH  115

Query  453   LPKHPNIVSYKEVYEDKEAVYLVMELCEGGELFDRIVAKGHYTERAAALVTKTILEVIQV  632
             LPK P++VS +E  ED  AV+LVMELCEGGELFDRIVA+GHYTERAAA VT+TILEV+Q+
Sbjct  116   LPKSPSVVSLREACEDDGAVHLVMELCEGGELFDRIVARGHYTERAAASVTRTILEVVQL  175

Query  633   CHKHGVIHRDLKPENFLYANGNENAPLKAIDFGLSIFFKPGQRFKEIVGSPYYMAPEVLR  812
             CH+HGVIHRDLKPENFL+AN  EN+PLKAIDFGLSIFFKPG++F EIVGSPYYMAPEVL+
Sbjct  176   CHRHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIFFKPGEKFSEIVGSPYYMAPEVLK  235

Query  813   RDYGHEVDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGDIDFKRDPWPKISEDAKDL  992
             R+YG E+D+WSAGVILYILLCGVPPFWAETE+G+A AI+RG+IDFKR+PWP +S++AKDL
Sbjct  236   RNYGPEIDIWSAGVILYILLCGVPPFWAETEQGVAQAILRGNIDFKREPWPNVSDNAKDL  295

Query  993   VKGMLDANPYSRMTIEEVLAHKWIQNAETVPNVPLGEGVTTRIKQFTLMNKFKKRVLMVV  1172
             V+ ML+ +P  R+T ++VL H W+QNA+  PNVPLG+ V +R+KQF+ MN+FK+R L V+
Sbjct  296   VRHMLEPDPKLRLTAKQVLEHHWLQNAKKAPNVPLGDIVKSRLKQFSRMNRFKRRALRVI  355

Query  1173  AENLSQDQVESIKEMFHMMDTDKNGNLSFEELKDGLSMMGQPVADHDVQLLMDAADVDGN  1352
             A++LS ++VE IK+MF  MDTD +G +S+EELK G++ +G  +A+ +VQ+L++A D +G 
Sbjct  356   ADHLSAEEVEDIKDMFKTMDTDNDGIVSYEELKTGIAKLGSHLAESEVQMLIEAVDTNGR  415

Query  1353  GMLNCEEFITLAVHLTNLSNDDNLHKAFLIFDKDNSGYIEFEELRDYLLEIDDDNKNDQV  1532
             G L+  EF+ +++HL  ++ND++L +AFL FDKD +G+IE EELR+ L++    +  ++V
Sbjct  416   GALDYGEFLAVSLHLQRMANDEHLRRAFLFFDKDGNGFIEPEELREALVDDGAADSMEEV  475

Query  1533  VQEIIFDADLDKDGRISFPEFKAMMTTGTDWKMASRKYSKVMLNALSVRLFKDKSVQ  1703
             V +I+ + D DKDG+IS+ EF AMM TGTDW+ ASR YS+   N+LS++L KD SV+
Sbjct  476   VNDILQEVDTDKDGKISYEEFVAMMKTGTDWRKASRHYSRGRFNSLSMKLIKDGSVK  532



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5003565261950