BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24761_g2_i2 len=2264 path=[12247:0-457 7015:458-502 27999:503-565
7113:566-604 13501:605-622 7170:623-702 28181:703-718 7266:719-776

                                                                      Score     E

ref|XP_009775967.1|  PREDICTED: pentatricopeptide repeat-containi...    990   0.0      
ref|XP_009619976.1|  PREDICTED: pentatricopeptide repeat-containi...    965   0.0      
ref|XP_006360680.1|  PREDICTED: pentatricopeptide repeat-containi...    960   0.0      
ref|XP_004240287.1|  PREDICTED: pentatricopeptide repeat-containi...    924   0.0      
ref|XP_010647149.1|  PREDICTED: pentatricopeptide repeat-containi...    909   0.0      
emb|CDP02638.1|  unnamed protein product                                906   0.0      
ref|XP_011073672.1|  PREDICTED: pentatricopeptide repeat-containi...    899   0.0      
ref|XP_010106892.1|  hypothetical protein L484_012985                   865   0.0      
ref|XP_009362610.1|  PREDICTED: pentatricopeptide repeat-containi...    852   0.0      
ref|XP_007047614.1|  Tetratricopeptide repeat (TPR)-like superfam...    850   0.0      
ref|XP_008237416.1|  PREDICTED: pentatricopeptide repeat-containi...    835   0.0      
gb|KDO78853.1|  hypothetical protein CISIN_1g004733mg                   835   0.0      
ref|XP_006466421.1|  PREDICTED: pentatricopeptide repeat-containi...    833   0.0      
emb|CAN71514.1|  hypothetical protein VITISV_021786                     831   0.0      Vitis vinifera
ref|XP_008342174.1|  PREDICTED: pentatricopeptide repeat-containi...    822   0.0      
ref|XP_004289369.1|  PREDICTED: pentatricopeptide repeat-containi...    818   0.0      
gb|KDP32117.1|  hypothetical protein JCGZ_12578                         796   0.0      
ref|XP_010033776.1|  PREDICTED: pentatricopeptide repeat-containi...    788   0.0      
ref|XP_008449638.1|  PREDICTED: pentatricopeptide repeat-containi...    783   0.0      
ref|XP_008449604.1|  PREDICTED: pentatricopeptide repeat-containi...    781   0.0      
ref|XP_010679679.1|  PREDICTED: pentatricopeptide repeat-containi...    781   0.0      
ref|XP_008449654.1|  PREDICTED: pentatricopeptide repeat-containi...    780   0.0      
ref|XP_004144368.1|  PREDICTED: pentatricopeptide repeat-containi...    780   0.0      
gb|KGN54739.1|  hypothetical protein Csa_4G439060                       778   0.0      
ref|XP_010028057.1|  PREDICTED: pentatricopeptide repeat-containi...    778   0.0      
ref|XP_006426143.1|  hypothetical protein CICLE_v10025041mg             776   0.0      
gb|EYU38664.1|  hypothetical protein MIMGU_mgv1a023275mg                776   0.0      
ref|XP_010276285.1|  PREDICTED: pentatricopeptide repeat-containi...    764   0.0      
ref|XP_007145640.1|  hypothetical protein PHAVU_007G256100g             759   0.0      
ref|XP_003537198.1|  PREDICTED: pentatricopeptide repeat-containi...    756   0.0      
gb|EPS71548.1|  hypothetical protein M569_03209                         753   0.0      
gb|KFK34244.1|  hypothetical protein AALP_AA5G119900                    744   0.0      
ref|XP_006404106.1|  hypothetical protein EUTSA_v10010148mg             736   0.0      
ref|XP_010547566.1|  PREDICTED: pentatricopeptide repeat-containi...    736   0.0      
ref|XP_010426500.1|  PREDICTED: pentatricopeptide repeat-containi...    733   0.0      
ref|XP_010923948.1|  PREDICTED: pentatricopeptide repeat-containi...    732   0.0      
gb|KEH41534.1|  PPR containing plant-like protein                       731   0.0      
ref|XP_004513641.1|  PREDICTED: pentatricopeptide repeat-containi...    730   0.0      
ref|XP_006292792.1|  hypothetical protein CARUB_v10019043mg             729   0.0      
ref|NP_190543.1|  pentatricopeptide repeat-containing protein           726   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875993.1|  pentatricopeptide repeat-containing protein        722   0.0      
ref|XP_010515337.1|  PREDICTED: pentatricopeptide repeat-containi...    714   0.0      
ref|XP_009136519.1|  PREDICTED: pentatricopeptide repeat-containi...    700   0.0      
ref|XP_002530609.1|  pentatricopeptide repeat-containing protein,...    617   0.0      Ricinus communis
ref|XP_008809853.1|  PREDICTED: pentatricopeptide repeat-containi...    591   0.0      
ref|XP_010507359.1|  PREDICTED: pentatricopeptide repeat-containi...    605   0.0      
gb|KFK34245.1|  hypothetical protein AALP_AA5G119900                    556   0.0      
ref|XP_007208178.1|  hypothetical protein PRUPE_ppa017277mg             554   0.0      
gb|KHN07819.1|  Pentatricopeptide repeat-containing protein             455   6e-149   
ref|XP_006575994.1|  PREDICTED: pentatricopeptide repeat-containi...    455   6e-149   
ref|XP_001774871.1|  predicted protein                                  439   3e-137   
ref|XP_010661558.1|  PREDICTED: putative pentatricopeptide repeat...    435   2e-136   
ref|XP_010255496.1|  PREDICTED: pentatricopeptide repeat-containi...    431   1e-134   
ref|XP_010090626.1|  hypothetical protein L484_003942                   424   1e-132   
ref|XP_008805366.1|  PREDICTED: pentatricopeptide repeat-containi...    427   6e-131   
gb|AEB39779.1|  pentatricopeptide repeat protein 98                     424   1e-130   
gb|AEB39776.1|  pentatricopeptide repeat protein 78                     424   3e-130   
ref|XP_001780298.1|  predicted protein                                  422   1e-129   
dbj|BAD67155.1|  PpPPR_98                                               421   1e-129   Physcomitrella patens
ref|XP_009116777.1|  PREDICTED: putative pentatricopeptide repeat...    412   4e-128   
ref|XP_010905005.1|  PREDICTED: pentatricopeptide repeat-containi...    419   1e-127   
ref|XP_010523729.1|  PREDICTED: pentatricopeptide repeat-containi...    410   3e-127   
ref|XP_009625829.1|  PREDICTED: pentatricopeptide repeat-containi...    410   2e-126   
ref|XP_010473800.1|  PREDICTED: pentatricopeptide repeat-containi...    406   3e-126   
ref|XP_008802215.1|  PREDICTED: putative pentatricopeptide repeat...    407   7e-126   
ref|XP_007051907.1|  Tetratricopeptide repeat-like superfamily pr...    406   1e-125   
ref|XP_004288861.1|  PREDICTED: pentatricopeptide repeat-containi...    406   1e-125   
ref|XP_010273294.1|  PREDICTED: pentatricopeptide repeat-containi...    408   2e-125   
dbj|BAD67156.2|  PpPPR_77                                               412   5e-125   Physcomitrella patens
gb|AES80039.2|  pentatricopeptide (PPR) repeat protein                  403   2e-124   
ref|XP_008232744.1|  PREDICTED: pentatricopeptide repeat-containi...    403   3e-124   
ref|XP_010655542.1|  PREDICTED: pentatricopeptide repeat-containi...    404   5e-124   
ref|XP_009340625.1|  PREDICTED: pentatricopeptide repeat-containi...    402   5e-124   
ref|XP_006292825.1|  hypothetical protein CARUB_v10019077mg             402   5e-124   
ref|XP_009351179.1|  PREDICTED: pentatricopeptide repeat-containi...    402   7e-124   
ref|XP_003623821.1|  Pentatricopeptide repeat-containing protein        402   8e-124   
gb|KGN54859.1|  hypothetical protein Csa_4G554180                       401   9e-124   
ref|XP_010244384.1|  PREDICTED: pentatricopeptide repeat-containi...    403   1e-123   
ref|XP_007139957.1|  hypothetical protein PHAVU_008G072900g             401   1e-123   
gb|KEH25607.1|  pentatricopeptide (PPR) repeat protein                  409   2e-123   
ref|XP_006479094.1|  PREDICTED: pentatricopeptide repeat-containi...    407   2e-123   
ref|XP_006402515.1|  hypothetical protein EUTSA_v10006471mg             400   3e-123   
ref|XP_009352737.1|  PREDICTED: pentatricopeptide repeat-containi...    401   7e-123   
ref|XP_001773953.1|  predicted protein                                  401   8e-123   
ref|XP_004485865.1|  PREDICTED: pentatricopeptide repeat-containi...    405   8e-123   
ref|XP_010512450.1|  PREDICTED: putative pentatricopeptide repeat...    399   9e-123   
gb|AEB39778.1|  pentatricopeptide repeat protein 77                     407   1e-122   
ref|XP_004504288.1|  PREDICTED: pentatricopeptide repeat-containi...    400   2e-122   
ref|XP_010266600.1|  PREDICTED: pentatricopeptide repeat-containi...    402   2e-122   
ref|XP_007030706.1|  Pentatricopeptide repeat (PPR) superfamily p...    404   2e-122   
ref|XP_010937493.1|  PREDICTED: putative pentatricopeptide repeat...    396   2e-122   
ref|XP_007025334.1|  Pentatricopeptide, putative                        399   2e-122   
ref|XP_008386813.1|  PREDICTED: pentatricopeptide repeat-containi...    404   2e-122   
ref|XP_011089782.1|  PREDICTED: pentatricopeptide repeat-containi...    403   3e-122   
ref|XP_010413449.1|  PREDICTED: putative pentatricopeptide repeat...    397   3e-122   
ref|XP_002285225.2|  PREDICTED: pentatricopeptide repeat-containi...    399   3e-122   Vitis vinifera
gb|ABR17838.1|  unknown                                                 397   3e-122   Picea sitchensis
ref|XP_004242544.1|  PREDICTED: pentatricopeptide repeat-containi...    398   4e-122   
ref|XP_010277283.1|  PREDICTED: pentatricopeptide repeat-containi...    404   5e-122   
ref|XP_009762759.1|  PREDICTED: pentatricopeptide repeat-containi...    399   6e-122   
ref|XP_009610200.1|  PREDICTED: pentatricopeptide repeat-containi...    398   7e-122   
gb|KDO86035.1|  hypothetical protein CISIN_1g003584mg                   396   7e-122   
ref|XP_009366439.1|  PREDICTED: pentatricopeptide repeat-containi...    403   8e-122   
emb|CBI36234.3|  unnamed protein product                                399   8e-122   
ref|XP_002282164.2|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    409   8e-122   Vitis vinifera
ref|XP_006366808.1|  PREDICTED: pentatricopeptide repeat-containi...    399   9e-122   
ref|XP_009366440.1|  PREDICTED: pentatricopeptide repeat-containi...    403   9e-122   
ref|XP_006339454.1|  PREDICTED: pentatricopeptide repeat-containi...    395   1e-121   
ref|XP_006838936.1|  hypothetical protein AMTR_s00002p00270380          399   2e-121   
ref|XP_006445136.1|  hypothetical protein CICLE_v10018890mg             395   3e-121   
gb|KDP34853.1|  hypothetical protein JCGZ_09141                         395   3e-121   
ref|XP_010686415.1|  PREDICTED: pentatricopeptide repeat-containi...    398   4e-121   
ref|XP_002533783.1|  pentatricopeptide repeat-containing protein,...    390   4e-121   Ricinus communis
ref|XP_008385706.1|  PREDICTED: pentatricopeptide repeat-containi...    395   4e-121   
ref|XP_009764400.1|  PREDICTED: pentatricopeptide repeat-containi...    400   4e-121   
ref|XP_004306236.1|  PREDICTED: pentatricopeptide repeat-containi...    393   5e-121   
ref|XP_002441797.1|  hypothetical protein SORBIDRAFT_08g002505          395   6e-121   Sorghum bicolor [broomcorn]
ref|XP_007217281.1|  hypothetical protein PRUPE_ppa017680mg             393   7e-121   
ref|XP_008366040.1|  PREDICTED: pentatricopeptide repeat-containi...    395   9e-121   
ref|XP_011089777.1|  PREDICTED: pentatricopeptide repeat-containi...    400   9e-121   
ref|XP_009602859.1|  PREDICTED: pentatricopeptide repeat-containi...    393   9e-121   
gb|EPS63127.1|  hypothetical protein M569_11659                         395   1e-120   
ref|XP_007030705.1|  Pentatricopeptide repeat superfamily protein...    405   1e-120   
ref|XP_004492675.1|  PREDICTED: pentatricopeptide repeat-containi...    392   2e-120   
ref|XP_002319164.2|  pentatricopeptide repeat-containing family p...    396   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006855406.1|  hypothetical protein AMTR_s00057p00151990          394   2e-120   
ref|XP_010325860.1|  PREDICTED: putative pentatricopeptide repeat...    392   2e-120   
ref|XP_010518772.1|  PREDICTED: pentatricopeptide repeat-containi...    396   2e-120   
ref|XP_004233816.1|  PREDICTED: pentatricopeptide repeat-containi...    399   3e-120   
ref|XP_011046269.1|  PREDICTED: pentatricopeptide repeat-containi...    394   3e-120   
ref|XP_006465408.1|  PREDICTED: pentatricopeptide repeat-containi...    394   4e-120   
ref|XP_008442211.1|  PREDICTED: putative pentatricopeptide repeat...    392   4e-120   
ref|XP_010916743.1|  PREDICTED: pentatricopeptide repeat-containi...    392   1e-119   
ref|XP_006430993.1|  hypothetical protein CICLE_v10011041mg             392   1e-119   
gb|EEE51385.1|  hypothetical protein OsJ_32436                          392   1e-119   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065364.2|  Os10g0558600                                       392   1e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006427149.1|  hypothetical protein CICLE_v10024866mg             392   2e-119   
ref|XP_004235725.1|  PREDICTED: pentatricopeptide repeat-containi...    392   2e-119   
ref|XP_002273710.2|  PREDICTED: pentatricopeptide repeat-containi...    393   2e-119   Vitis vinifera
gb|EYU44257.1|  hypothetical protein MIMGU_mgv1a021838mg                390   2e-119   
ref|XP_006482464.1|  PREDICTED: pentatricopeptide repeat-containi...    392   2e-119   
gb|AAK55452.1|AC069300_7  putative PPR repeat protein                   392   3e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912119.1|  PREDICTED: putative pentatricopeptide repeat...    389   3e-119   
gb|EYU21860.1|  hypothetical protein MIMGU_mgv1a025261mg                394   3e-119   
ref|XP_006347148.1|  PREDICTED: pentatricopeptide repeat-containi...    395   3e-119   
gb|KDO72337.1|  hypothetical protein CISIN_1g002718mg                   391   4e-119   
emb|CDX77129.1|  BnaC04g39240D                                          392   4e-119   
ref|XP_010272292.1|  PREDICTED: putative pentatricopeptide repeat...    386   4e-119   
ref|XP_010101628.1|  hypothetical protein L484_000697                   391   5e-119   
ref|XP_004293058.1|  PREDICTED: pentatricopeptide repeat-containi...    399   5e-119   
ref|XP_010086694.1|  hypothetical protein L484_016122                   391   5e-119   
ref|XP_009416987.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    389   5e-119   
ref|XP_007151839.1|  hypothetical protein PHAVU_004G079600g             395   6e-119   
ref|XP_006467621.1|  PREDICTED: pentatricopeptide repeat-containi...    390   6e-119   
ref|XP_010272290.1|  PREDICTED: putative pentatricopeptide repeat...    386   7e-119   
ref|XP_009398523.1|  PREDICTED: pentatricopeptide repeat-containi...    395   9e-119   
ref|XP_006341663.1|  PREDICTED: pentatricopeptide repeat-containi...    390   1e-118   
ref|XP_008802382.1|  PREDICTED: pentatricopeptide repeat-containi...    384   1e-118   
ref|XP_006282442.1|  hypothetical protein CARUB_v10004110mg             389   1e-118   
gb|EYU32070.1|  hypothetical protein MIMGU_mgv1a017635mg                385   1e-118   
ref|XP_006827122.1|  hypothetical protein AMTR_s00010p00246970          386   1e-118   
ref|XP_009790915.1|  PREDICTED: pentatricopeptide repeat-containi...    388   2e-118   
ref|XP_008787073.1|  PREDICTED: putative pentatricopeptide repeat...    390   2e-118   
ref|XP_002302563.2|  hypothetical protein POPTR_0002s15650g             387   2e-118   Populus trichocarpa [western balsam poplar]
gb|AHB18405.1|  pentatricopeptide repeat-containing protein             389   2e-118   
ref|XP_010653538.1|  PREDICTED: pentatricopeptide repeat-containi...    385   3e-118   
ref|XP_008783105.1|  PREDICTED: pentatricopeptide repeat-containi...    389   3e-118   
ref|XP_004289123.1|  PREDICTED: putative pentatricopeptide repeat...    384   3e-118   
ref|NP_180329.1|  pentatricopeptide repeat-containing protein           389   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243341.1|  PREDICTED: pentatricopeptide repeat-containi...    388   3e-118   
ref|XP_007202871.1|  hypothetical protein PRUPE_ppa015725mg             382   4e-118   
ref|XP_010934285.1|  PREDICTED: pentatricopeptide repeat-containi...    392   4e-118   
ref|XP_006592747.1|  PREDICTED: pentatricopeptide repeat-containi...    388   5e-118   
ref|XP_010473149.1|  PREDICTED: pentatricopeptide repeat-containi...    387   5e-118   
ref|XP_010107584.1|  hypothetical protein L484_024440                   385   6e-118   
emb|CAN67343.1|  hypothetical protein VITISV_038220                     384   6e-118   Vitis vinifera
ref|XP_003596787.1|  Pentatricopeptide repeat-containing protein        387   6e-118   
ref|XP_006487970.1|  PREDICTED: pentatricopeptide repeat-containi...    388   6e-118   
gb|ABA99524.2|  pentatricopeptide, putative, expressed                  394   6e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009804600.1|  PREDICTED: pentatricopeptide repeat-containi...    387   7e-118   
emb|CDX68846.1|  BnaC01g06070D                                          385   7e-118   
gb|KHN05841.1|  Pentatricopeptide repeat-containing protein             384   8e-118   
ref|NP_001066981.1|  Os12g0552300                                       394   8e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413852.1|  PREDICTED: pentatricopeptide repeat-containi...    385   9e-118   
gb|KDP37589.1|  hypothetical protein JCGZ_07935                         387   1e-117   
ref|XP_003539465.1|  PREDICTED: pentatricopeptide repeat-containi...    387   1e-117   
ref|XP_007214178.1|  hypothetical protein PRUPE_ppa019185mg             387   1e-117   
ref|XP_007022987.1|  Tetratricopeptide repeat (TPR)-like superfam...    386   1e-117   
ref|XP_008377600.1|  PREDICTED: pentatricopeptide repeat-containi...    387   1e-117   
ref|XP_008808560.1|  PREDICTED: pentatricopeptide repeat-containi...    386   1e-117   
ref|XP_008785200.1|  PREDICTED: pentatricopeptide repeat-containi...    390   1e-117   
ref|XP_004971430.1|  PREDICTED: pentatricopeptide repeat-containi...    385   2e-117   
gb|KHN00671.1|  Pentatricopeptide repeat-containing protein             392   2e-117   
ref|XP_010417911.1|  PREDICTED: pentatricopeptide repeat-containi...    386   2e-117   
ref|XP_011034449.1|  PREDICTED: pentatricopeptide repeat-containi...    396   2e-117   
ref|XP_006574752.1|  PREDICTED: pentatricopeptide repeat-containi...    391   2e-117   
ref|XP_008358674.1|  PREDICTED: pentatricopeptide repeat-containi...    388   2e-117   
ref|XP_010100885.1|  hypothetical protein L484_009655                   386   2e-117   
gb|EMT10346.1|  Pentatricopeptide repeat-containing protein             386   2e-117   
ref|XP_006664625.1|  PREDICTED: pentatricopeptide repeat-containi...    387   2e-117   
ref|XP_011091742.1|  PREDICTED: pentatricopeptide repeat-containi...    384   2e-117   
dbj|BAJ94557.1|  predicted protein                                      384   2e-117   
ref|XP_008338199.1|  PREDICTED: putative pentatricopeptide repeat...    382   3e-117   
ref|XP_011023411.1|  PREDICTED: pentatricopeptide repeat-containi...    384   3e-117   
ref|XP_002533488.1|  pentatricopeptide repeat-containing protein,...    387   4e-117   Ricinus communis
ref|XP_007050470.1|  Tetratricopeptide repeat-like superfamily pr...    388   4e-117   
ref|XP_002870024.1|  pentatricopeptide repeat-containing protein        385   5e-117   
ref|XP_010510757.1|  PREDICTED: pentatricopeptide repeat-containi...    385   5e-117   
gb|KDP37157.1|  hypothetical protein JCGZ_06213                         385   5e-117   
ref|XP_010528729.1|  PREDICTED: pentatricopeptide repeat-containi...    390   5e-117   
ref|XP_010100741.1|  hypothetical protein L484_005808                   385   6e-117   
ref|XP_011083198.1|  PREDICTED: putative pentatricopeptide repeat...    379   6e-117   
ref|XP_008784571.1|  PREDICTED: pentatricopeptide repeat-containi...    385   7e-117   
ref|XP_006414062.1|  hypothetical protein EUTSA_v10024377mg             385   8e-117   
ref|XP_010916984.1|  PREDICTED: pentatricopeptide repeat-containi...    385   8e-117   
emb|CDY01148.1|  BnaA04g06710D                                          389   8e-117   
ref|XP_009369307.1|  PREDICTED: pentatricopeptide repeat-containi...    385   9e-117   
ref|XP_008790066.1|  PREDICTED: pentatricopeptide repeat-containi...    385   9e-117   
ref|XP_009132154.1|  PREDICTED: pentatricopeptide repeat-containi...    384   1e-116   
ref|XP_009139606.1|  PREDICTED: pentatricopeptide repeat-containi...    389   1e-116   
ref|XP_009139607.1|  PREDICTED: pentatricopeptide repeat-containi...    389   1e-116   
ref|XP_002266026.1|  PREDICTED: putative pentatricopeptide repeat...    380   1e-116   Vitis vinifera
gb|KDP24314.1|  hypothetical protein JCGZ_25610                         382   1e-116   
gb|KDO55063.1|  hypothetical protein CISIN_1g040643mg                   387   1e-116   
ref|XP_008662428.1|  PREDICTED: pentatricopeptide repeat-containi...    384   1e-116   
gb|EEE53393.1|  hypothetical protein OsJ_36441                          390   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001785902.1|  predicted protein                                  385   1e-116   
ref|XP_007214267.1|  hypothetical protein PRUPE_ppa025121mg             382   2e-116   
ref|XP_010246570.1|  PREDICTED: putative pentatricopeptide repeat...    380   2e-116   
ref|XP_010909807.1|  PREDICTED: pentatricopeptide repeat-containi...    384   2e-116   
ref|XP_002879150.1|  pentatricopeptide repeat-containing protein        384   2e-116   
ref|XP_008451345.1|  PREDICTED: pentatricopeptide repeat-containi...    382   2e-116   
ref|XP_010652859.1|  PREDICTED: pentatricopeptide repeat-containi...    383   2e-116   
emb|CAN70631.1|  hypothetical protein VITISV_020725                     379   2e-116   Vitis vinifera
ref|XP_009612771.1|  PREDICTED: pentatricopeptide repeat-containi...    388   2e-116   
ref|XP_010686039.1|  PREDICTED: pentatricopeptide repeat-containi...    384   2e-116   
ref|XP_004289272.1|  PREDICTED: pentatricopeptide repeat-containi...    382   2e-116   
ref|XP_008228628.1|  PREDICTED: pentatricopeptide repeat-containi...    384   2e-116   
ref|XP_007214420.1|  hypothetical protein PRUPE_ppa026010mg             378   2e-116   
ref|XP_007046869.1|  Tetratricopeptide repeat-like superfamily pr...    379   3e-116   
ref|XP_010694524.1|  PREDICTED: pentatricopeptide repeat-containi...    383   3e-116   
ref|XP_009340714.1|  PREDICTED: putative pentatricopeptide repeat...    379   3e-116   
ref|XP_008777331.1|  PREDICTED: pentatricopeptide repeat-containi...    384   3e-116   
ref|XP_004491978.1|  PREDICTED: pentatricopeptide repeat-containi...    384   3e-116   
ref|XP_007158964.1|  hypothetical protein PHAVU_002G196700g             384   3e-116   
ref|XP_010537957.1|  PREDICTED: pentatricopeptide repeat-containi...    383   3e-116   
ref|XP_010246449.1|  PREDICTED: pentatricopeptide repeat-containi...    383   3e-116   
ref|XP_007220232.1|  hypothetical protein PRUPE_ppa001951mg             379   3e-116   
ref|XP_003629790.1|  Pentatricopeptide repeat-containing protein        384   3e-116   
ref|XP_010660541.1|  PREDICTED: pentatricopeptide repeat-containi...    380   3e-116   
ref|XP_010279265.1|  PREDICTED: pentatricopeptide repeat-containi...    385   4e-116   
ref|XP_010272360.1|  PREDICTED: pentatricopeptide repeat-containi...    382   4e-116   
ref|XP_008442216.1|  PREDICTED: putative pentatricopeptide repeat...    379   4e-116   
ref|XP_007025555.1|  Tetratricopeptide repeat-like superfamily pr...    385   4e-116   
ref|XP_010257871.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    383   5e-116   
ref|XP_006409754.1|  hypothetical protein EUTSA_v10017649mg             382   5e-116   
ref|XP_008225136.1|  PREDICTED: pentatricopeptide repeat-containi...    384   5e-116   
ref|XP_010942915.1|  PREDICTED: pentatricopeptide repeat-containi...    382   5e-116   
gb|AEB39781.1|  pentatricopeptide repeat protein 79                     381   5e-116   
ref|XP_008385425.1|  PREDICTED: pentatricopeptide repeat-containi...    382   7e-116   
ref|XP_006295891.1|  hypothetical protein CARUB_v10025021mg             382   7e-116   
ref|XP_008451344.1|  PREDICTED: pentatricopeptide repeat-containi...    382   8e-116   
emb|CDX78889.1|  BnaA01g09560D                                          382   9e-116   
ref|XP_007207533.1|  hypothetical protein PRUPE_ppa015196mg             378   9e-116   
emb|CDY52331.1|  BnaA09g38800D                                          379   9e-116   
ref|XP_008675521.1|  PREDICTED: pentatricopeptide repeat-containi...    380   1e-115   
ref|XP_008451343.1|  PREDICTED: pentatricopeptide repeat-containi...    381   1e-115   
ref|XP_010272359.1|  PREDICTED: pentatricopeptide repeat-containi...    383   2e-115   
ref|XP_007023977.1|  Tetratricopeptide repeat (TPR)-like superfam...    381   2e-115   
ref|XP_008239957.1|  PREDICTED: pentatricopeptide repeat-containi...    382   2e-115   
ref|XP_010269714.1|  PREDICTED: pentatricopeptide repeat-containi...    382   2e-115   
ref|XP_004487730.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-115   
ref|XP_009597833.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-115   
ref|XP_010036202.1|  PREDICTED: pentatricopeptide repeat-containi...    385   2e-115   
ref|XP_007206763.1|  hypothetical protein PRUPE_ppa025253mg             377   2e-115   
ref|XP_006412475.1|  hypothetical protein EUTSA_v10024468mg             378   3e-115   
gb|EYU35938.1|  hypothetical protein MIMGU_mgv1a001219mg                380   3e-115   
ref|XP_006849876.1|  hypothetical protein AMTR_s00022p00075660          376   3e-115   
ref|XP_002278668.2|  PREDICTED: pentatricopeptide repeat-containi...    380   3e-115   Vitis vinifera
ref|XP_003529817.1|  PREDICTED: pentatricopeptide repeat-containi...    381   3e-115   
gb|AEB39780.1|  pentatricopeptide repeat protein 45                     385   3e-115   
gb|KDP21395.1|  hypothetical protein JCGZ_21866                         385   3e-115   
ref|XP_008225340.1|  PREDICTED: pentatricopeptide repeat-containi...    380   4e-115   
ref|XP_006349117.1|  PREDICTED: pentatricopeptide repeat-containi...    380   4e-115   
ref|XP_010925117.1|  PREDICTED: putative pentatricopeptide repeat...    375   4e-115   
ref|XP_010249165.1|  PREDICTED: putative pentatricopeptide repeat...    377   4e-115   
ref|XP_009351131.1|  PREDICTED: pentatricopeptide repeat-containi...    379   5e-115   
ref|XP_006425632.1|  hypothetical protein CICLE_v10025033mg             375   5e-115   
ref|XP_004139569.1|  PREDICTED: pentatricopeptide repeat-containi...    380   5e-115   
ref|XP_006480654.1|  PREDICTED: pentatricopeptide repeat-containi...    377   6e-115   
dbj|BAP69206.1|  pentatricopeptide repeat protein                       385   6e-115   
emb|CAB36829.1|  putative protein                                       383   6e-115   
ref|XP_008786573.1|  PREDICTED: pentatricopeptide repeat-containi...    377   7e-115   
ref|XP_004308608.1|  PREDICTED: pentatricopeptide repeat-containi...    379   7e-115   
ref|XP_006827220.1|  hypothetical protein AMTR_s00010p00260120          378   7e-115   
ref|XP_010277183.1|  PREDICTED: pentatricopeptide repeat-containi...    377   8e-115   
ref|XP_007134422.1|  hypothetical protein PHAVU_010G046200g             380   9e-115   
ref|XP_010262348.1|  PREDICTED: pentatricopeptide repeat-containi...    383   1e-114   
ref|XP_009352868.1|  PREDICTED: pentatricopeptide repeat-containi...    380   1e-114   
ref|XP_007150084.1|  hypothetical protein PHAVU_005G125200g             379   1e-114   
ref|XP_008461062.1|  PREDICTED: pentatricopeptide repeat-containi...    379   1e-114   
ref|XP_008356624.1|  PREDICTED: pentatricopeptide repeat-containi...    379   1e-114   
ref|XP_008451342.1|  PREDICTED: pentatricopeptide repeat-containi...    381   1e-114   
gb|KGN45313.1|  hypothetical protein Csa_7G433910                       379   1e-114   
gb|KHN01357.1|  Pentatricopeptide repeat-containing protein, chlo...    379   1e-114   
ref|XP_010557596.1|  PREDICTED: pentatricopeptide repeat-containi...    377   1e-114   
ref|XP_009398438.1|  PREDICTED: pentatricopeptide repeat-containi...    383   1e-114   
gb|KDO70994.1|  hypothetical protein CISIN_1g005329mg                   374   1e-114   
gb|KGN65613.1|  hypothetical protein Csa_1G470290                       379   1e-114   
ref|XP_002264194.2|  PREDICTED: pentatricopeptide repeat-containi...    379   1e-114   
ref|XP_004136076.1|  PREDICTED: pentatricopeptide repeat-containi...    379   1e-114   
gb|KHN27656.1|  Pentatricopeptide repeat-containing protein             376   1e-114   
ref|XP_004158804.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    379   1e-114   
ref|XP_004163716.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    379   2e-114   
ref|XP_006466834.1|  PREDICTED: putative pentatricopeptide repeat...    374   2e-114   
ref|NP_193101.2|  pentatricopeptide repeat-containing protein           383   2e-114   
gb|AES60818.2|  pentatricopeptide (PPR) repeat protein                  384   2e-114   
ref|XP_004305312.1|  PREDICTED: pentatricopeptide repeat-containi...    379   2e-114   
gb|KHN18852.1|  Pentatricopeptide repeat-containing protein             380   2e-114   
ref|XP_008451337.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-114   
ref|XP_008663973.1|  PREDICTED: pentatricopeptide repeat-containi...    384   2e-114   
ref|NP_193610.1|  pentatricopeptide repeat protein DOT4                 379   2e-114   
ref|XP_010932118.1|  PREDICTED: putative pentatricopeptide repeat...    380   2e-114   
ref|XP_008451336.1|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-114   
ref|XP_009343153.1|  PREDICTED: pentatricopeptide repeat-containi...    375   2e-114   
ref|XP_010249162.1|  PREDICTED: putative pentatricopeptide repeat...    377   2e-114   
ref|XP_002868345.1|  pentatricopeptide repeat-containing protein        382   2e-114   
ref|XP_002268440.2|  PREDICTED: pentatricopeptide repeat-containi...    381   2e-114   
ref|XP_004293078.1|  PREDICTED: pentatricopeptide repeat-containi...    378   3e-114   
ref|XP_002305733.2|  hypothetical protein POPTR_0004s05810g             375   3e-114   
ref|XP_004294643.1|  PREDICTED: pentatricopeptide repeat-containi...    378   3e-114   
ref|XP_003567531.1|  PREDICTED: pentatricopeptide repeat-containi...    377   3e-114   
ref|XP_008387621.1|  PREDICTED: pentatricopeptide repeat-containi...    375   3e-114   
gb|KHN15677.1|  Pentatricopeptide repeat-containing protein             377   3e-114   
ref|XP_001775099.1|  predicted protein                                  376   3e-114   
ref|XP_002275537.1|  PREDICTED: pentatricopeptide repeat-containi...    373   3e-114   
ref|XP_004150218.1|  PREDICTED: pentatricopeptide repeat-containi...    379   3e-114   
ref|XP_010234956.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    377   4e-114   
ref|XP_010066066.1|  PREDICTED: pentatricopeptide repeat-containi...    375   4e-114   
ref|XP_006371982.1|  hypothetical protein POPTR_0018s06910g             377   4e-114   
ref|XP_007022988.1|  Tetratricopeptide repeat (TPR)-like superfam...    375   4e-114   
ref|XP_003621610.1|  Pentatricopeptide repeat-containing protein        378   5e-114   
ref|XP_010097404.1|  hypothetical protein L484_009628                   381   5e-114   
ref|XP_011011864.1|  PREDICTED: putative pentatricopeptide repeat...    380   5e-114   
emb|CDX75244.1|  BnaA01g04580D                                          374   6e-114   
ref|XP_007139372.1|  hypothetical protein PHAVU_008G023900g             378   6e-114   
ref|XP_002306231.2|  hypothetical protein POPTR_0004s19560g             373   6e-114   
ref|XP_002278218.1|  PREDICTED: pentatricopeptide repeat-containi...    381   7e-114   
gb|KHN31801.1|  Putative pentatricopeptide repeat-containing protein    370   7e-114   
emb|CAN74095.1|  hypothetical protein VITISV_023708                     378   7e-114   
ref|XP_009125997.1|  PREDICTED: pentatricopeptide repeat-containi...    374   8e-114   
ref|XP_010451385.1|  PREDICTED: pentatricopeptide repeat-containi...    376   9e-114   
gb|KHN38224.1|  Pentatricopeptide repeat-containing protein             377   9e-114   
ref|XP_003590567.1|  Pentatricopeptide repeat-containing protein        384   9e-114   
ref|NP_001061590.1|  Os08g0340900                                       375   9e-114   
ref|XP_010518818.1|  PREDICTED: pentatricopeptide repeat-containi...    377   9e-114   
gb|KHN13782.1|  Pentatricopeptide repeat-containing protein             372   1e-113   
emb|CAN83351.1|  hypothetical protein VITISV_028907                     379   1e-113   
ref|XP_002317690.2|  pentatricopeptide repeat-containing family p...    374   1e-113   
ref|XP_008232760.1|  PREDICTED: pentatricopeptide repeat-containi...    376   1e-113   
ref|XP_006403701.1|  hypothetical protein EUTSA_v10010938mg             374   1e-113   
ref|XP_003555371.1|  PREDICTED: pentatricopeptide repeat-containi...    377   1e-113   
dbj|BAD94843.1|  putative protein                                       372   1e-113   
emb|CDP02363.1|  unnamed protein product                                376   2e-113   
ref|XP_010089854.1|  hypothetical protein L484_022371                   375   2e-113   
ref|XP_010496887.1|  PREDICTED: pentatricopeptide repeat-containi...    372   2e-113   
ref|XP_011039995.1|  PREDICTED: pentatricopeptide repeat-containi...    375   3e-113   
ref|XP_002303270.2|  pentatricopeptide repeat-containing family p...    373   3e-113   
ref|XP_004251045.1|  PREDICTED: pentatricopeptide repeat-containi...    375   4e-113   
ref|XP_010029763.1|  PREDICTED: putative pentatricopeptide repeat...    370   4e-113   
ref|XP_007015858.1|  Tetratricopeptide repeat (TPR)-like superfam...    375   4e-113   
ref|XP_008795794.1|  PREDICTED: pentatricopeptide repeat-containi...    373   5e-113   
emb|CDP14333.1|  unnamed protein product                                377   5e-113   
ref|XP_002262885.1|  PREDICTED: pentatricopeptide repeat-containi...    374   5e-113   
gb|KHN29112.1|  Pentatricopeptide repeat-containing protein             374   5e-113   
ref|XP_010929076.1|  PREDICTED: pentatricopeptide repeat-containi...    375   6e-113   
ref|XP_004137966.1|  PREDICTED: pentatricopeptide repeat-containi...    372   6e-113   
ref|XP_003522204.2|  PREDICTED: putative pentatricopeptide repeat...    373   6e-113   
ref|XP_004289268.1|  PREDICTED: pentatricopeptide repeat-containi...    372   6e-113   
ref|XP_008239469.1|  PREDICTED: pentatricopeptide repeat-containi...    371   6e-113   
ref|XP_003532850.2|  PREDICTED: pentatricopeptide repeat-containi...    374   6e-113   
ref|XP_010439814.1|  PREDICTED: pentatricopeptide repeat-containi...    374   6e-113   
ref|XP_011090229.1|  PREDICTED: pentatricopeptide repeat-containi...    374   6e-113   
emb|CDO99505.1|  unnamed protein product                                372   7e-113   
ref|XP_010087106.1|  hypothetical protein L484_012535                   375   8e-113   
gb|AEB39774.1|  pentatricopeptide repeat protein 65                     371   9e-113   
ref|XP_006448816.1|  hypothetical protein CICLE_v10014257mg             374   9e-113   
ref|XP_008442662.1|  PREDICTED: pentatricopeptide repeat-containi...    372   9e-113   
ref|XP_010519389.1|  PREDICTED: pentatricopeptide repeat-containi...    378   1e-112   
ref|XP_008454911.1|  PREDICTED: pentatricopeptide repeat-containi...    372   1e-112   
ref|XP_010931018.1|  PREDICTED: pentatricopeptide repeat-containi...    374   1e-112   
ref|XP_009790676.1|  PREDICTED: pentatricopeptide repeat-containi...    374   1e-112   
ref|XP_009606215.1|  PREDICTED: pentatricopeptide repeat-containi...    375   1e-112   
ref|XP_004166371.1|  PREDICTED: pentatricopeptide repeat-containi...    372   1e-112   
gb|KCW87396.1|  hypothetical protein EUGRSUZ_B03875                     372   1e-112   
ref|XP_008443463.1|  PREDICTED: pentatricopeptide repeat-containi...    374   1e-112   
gb|KDO77573.1|  hypothetical protein CISIN_1g003150mg                   373   1e-112   
gb|KFK28546.1|  hypothetical protein AALP_AA7G010600                    373   1e-112   
ref|XP_004986208.1|  PREDICTED: pentatricopeptide repeat-containi...    374   1e-112   
ref|XP_006348570.1|  PREDICTED: pentatricopeptide repeat-containi...    373   1e-112   
gb|AES81809.2|  pentatricopeptide (PPR) repeat protein                  372   1e-112   
ref|XP_007148025.1|  hypothetical protein PHAVU_006G174200g             374   1e-112   
ref|XP_006449392.1|  hypothetical protein CICLE_v10018358mg             375   1e-112   
ref|XP_008393178.1|  PREDICTED: pentatricopeptide repeat-containi...    373   1e-112   
ref|XP_008229432.1|  PREDICTED: pentatricopeptide repeat-containi...    374   1e-112   
emb|CDY56690.1|  BnaCnng30980D                                          370   1e-112   
ref|XP_010249212.1|  PREDICTED: putative pentatricopeptide repeat...    372   1e-112   
emb|CDP14158.1|  unnamed protein product                                377   1e-112   
gb|KFK28709.1|  hypothetical protein AALP_AA7G036800                    371   1e-112   
ref|XP_006468372.1|  PREDICTED: pentatricopeptide repeat-containi...    373   2e-112   
ref|XP_003551291.1|  PREDICTED: putative pentatricopeptide repeat...    370   2e-112   
ref|XP_003619016.1|  Pentatricopeptide repeat-containing protein        376   2e-112   
ref|XP_010052618.1|  PREDICTED: pentatricopeptide repeat-containi...    374   2e-112   
ref|XP_008438212.1|  PREDICTED: pentatricopeptide repeat-containi...    374   2e-112   
emb|CAE06013.3|  OSJNBa0016O02.23                                       375   2e-112   
ref|XP_009395862.1|  PREDICTED: pentatricopeptide repeat-containi...    372   2e-112   
ref|XP_010920366.1|  PREDICTED: pentatricopeptide repeat-containi...    374   2e-112   
gb|KDO58054.1|  hypothetical protein CISIN_1g046257mg                   372   2e-112   
ref|XP_009373813.1|  PREDICTED: pentatricopeptide repeat-containi...    374   2e-112   
ref|XP_009385091.1|  PREDICTED: pentatricopeptide repeat-containi...    372   2e-112   
gb|KFK35316.1|  hypothetical protein AALP_AA5G268400                    368   2e-112   
ref|XP_009608542.1|  PREDICTED: pentatricopeptide repeat-containi...    372   3e-112   
ref|XP_002884708.1|  pentatricopeptide repeat-containing protein        376   3e-112   
ref|XP_010920594.1|  PREDICTED: pentatricopeptide repeat-containi...    375   3e-112   
gb|EPS70037.1|  hypothetical protein M569_04719                         369   3e-112   
gb|KCW56352.1|  hypothetical protein EUGRSUZ_I02086                     371   3e-112   
ref|XP_010690022.1|  PREDICTED: pentatricopeptide repeat-containi...    377   3e-112   
gb|KFK37790.1|  hypothetical protein AALP_AA3G029400                    373   4e-112   
ref|XP_007159760.1|  hypothetical protein PHAVU_002G264900g             372   4e-112   
ref|XP_010916776.1|  PREDICTED: pentatricopeptide repeat-containi...    368   4e-112   
ref|XP_011099068.1|  PREDICTED: pentatricopeptide repeat-containi...    373   4e-112   
ref|XP_007010243.1|  Pentatricopeptide repeat-containing protein        367   4e-112   
gb|KHN31649.1|  Putative pentatricopeptide repeat-containing protein    366   5e-112   
ref|XP_008241893.1|  PREDICTED: putative pentatricopeptide repeat...    366   5e-112   
ref|XP_010249164.1|  PREDICTED: putative pentatricopeptide repeat...    370   5e-112   
ref|XP_006597484.1|  PREDICTED: pentatricopeptide repeat-containi...    372   5e-112   
ref|XP_006467747.1|  PREDICTED: pentatricopeptide repeat-containi...    374   5e-112   
ref|XP_004973954.1|  PREDICTED: pentatricopeptide repeat-containi...    377   5e-112   
ref|XP_010045232.1|  PREDICTED: pentatricopeptide repeat-containi...    372   6e-112   
ref|XP_009407445.1|  PREDICTED: putative pentatricopeptide repeat...    367   6e-112   
gb|KDO41030.1|  hypothetical protein CISIN_1g046194mg                   373   6e-112   
gb|KDP31245.1|  hypothetical protein JCGZ_11621                         369   6e-112   
ref|XP_003608008.1|  Pentatricopeptide repeat-containing protein        379   6e-112   
ref|XP_007147878.1|  hypothetical protein PHAVU_006G162500g             366   7e-112   
ref|XP_011069446.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    369   7e-112   
gb|EYU24289.1|  hypothetical protein MIMGU_mgv1a024266mg                372   7e-112   
ref|XP_008454910.1|  PREDICTED: pentatricopeptide repeat-containi...    372   7e-112   
gb|KDP29535.1|  hypothetical protein JCGZ_19248                         367   8e-112   
ref|XP_010264952.1|  PREDICTED: pentatricopeptide repeat-containi...    365   8e-112   
ref|XP_010029438.1|  PREDICTED: pentatricopeptide repeat-containi...    372   9e-112   
ref|XP_001754449.1|  predicted protein                                  367   9e-112   
ref|XP_010931946.1|  PREDICTED: pentatricopeptide repeat-containi...    370   1e-111   
ref|XP_003625591.1|  Pentatricopeptide repeat-containing protein        371   1e-111   
ref|XP_010230598.1|  PREDICTED: pentatricopeptide repeat-containi...    376   1e-111   
ref|XP_010690503.1|  PREDICTED: putative pentatricopeptide repeat...    366   1e-111   
ref|XP_008462120.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    371   1e-111   
ref|XP_004134351.1|  PREDICTED: pentatricopeptide repeat-containi...    371   1e-111   
gb|AFW58542.1|  hypothetical protein ZEAMMB73_242801                    372   1e-111   
ref|XP_008663301.1|  PREDICTED: pentatricopeptide repeat-containi...    373   2e-111   
gb|KDO77668.1|  hypothetical protein CISIN_1g046775mg                   368   2e-111   
gb|EYU23583.1|  hypothetical protein MIMGU_mgv1a001176mg                370   2e-111   
ref|XP_007147877.1|  hypothetical protein PHAVU_006G162500g             366   2e-111   
ref|XP_009605798.1|  PREDICTED: pentatricopeptide repeat-containi...    370   2e-111   
ref|XP_010246088.1|  PREDICTED: pentatricopeptide repeat-containi...    373   2e-111   
ref|XP_010042435.1|  PREDICTED: pentatricopeptide repeat-containi...    366   2e-111   
emb|CDY34720.1|  BnaA01g33050D                                          370   2e-111   
ref|XP_004288922.1|  PREDICTED: putative pentatricopeptide repeat...    373   2e-111   
gb|KDP32392.1|  hypothetical protein JCGZ_13317                         368   2e-111   
ref|XP_007029836.1|  Tetratricopeptide repeat (TPR)-like superfam...    370   2e-111   
ref|XP_002310258.2|  pentatricopeptide repeat-containing family p...    364   2e-111   
ref|XP_009341645.1|  PREDICTED: pentatricopeptide repeat-containi...    367   3e-111   
ref|XP_009335038.1|  PREDICTED: pentatricopeptide repeat-containi...    367   3e-111   
ref|XP_010246013.1|  PREDICTED: pentatricopeptide repeat-containi...    372   3e-111   
ref|XP_004233195.1|  PREDICTED: pentatricopeptide repeat-containi...    369   3e-111   
ref|XP_011100928.1|  PREDICTED: pentatricopeptide repeat-containi...    370   3e-111   
ref|XP_011075167.1|  PREDICTED: pentatricopeptide repeat-containi...    367   3e-111   
ref|XP_009413784.1|  PREDICTED: pentatricopeptide repeat-containi...    370   3e-111   
ref|XP_010245939.1|  PREDICTED: pentatricopeptide repeat-containi...    373   3e-111   
ref|XP_004155862.1|  PREDICTED: pentatricopeptide repeat-containi...    371   4e-111   
emb|CDO96840.1|  unnamed protein product                                370   4e-111   
ref|XP_002520950.1|  pentatricopeptide repeat-containing protein,...    369   4e-111   
ref|XP_010048705.1|  PREDICTED: putative pentatricopeptide repeat...    369   4e-111   
ref|XP_010663367.1|  PREDICTED: pentatricopeptide repeat-containi...    369   4e-111   
ref|XP_011087320.1|  PREDICTED: pentatricopeptide repeat-containi...    372   5e-111   
emb|CAN83391.1|  hypothetical protein VITISV_041405                     370   5e-111   
ref|XP_009616910.1|  PREDICTED: pentatricopeptide repeat-containi...    370   5e-111   
ref|XP_004137118.1|  PREDICTED: pentatricopeptide repeat-containi...    369   5e-111   
ref|XP_009343228.1|  PREDICTED: pentatricopeptide repeat-containi...    367   5e-111   
ref|XP_003551787.1|  PREDICTED: pentatricopeptide repeat-containi...    369   6e-111   
ref|XP_010999774.1|  PREDICTED: pentatricopeptide repeat-containi...    369   6e-111   
ref|XP_010057614.1|  PREDICTED: putative pentatricopeptide repeat...    364   6e-111   
ref|XP_004984890.1|  PREDICTED: pentatricopeptide repeat-containi...    370   6e-111   
gb|EYU34910.1|  hypothetical protein MIMGU_mgv1a001179mg                369   6e-111   
ref|XP_006447804.1|  hypothetical protein CICLE_v10017893mg             373   8e-111   
ref|XP_008781925.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    369   9e-111   
ref|XP_011087319.1|  PREDICTED: pentatricopeptide repeat-containi...    372   9e-111   
ref|XP_009391126.1|  PREDICTED: pentatricopeptide repeat-containi...    370   9e-111   
ref|XP_010648772.1|  PREDICTED: putative pentatricopeptide repeat...    364   1e-110   
ref|XP_009412103.1|  PREDICTED: pentatricopeptide repeat-containi...    370   1e-110   
gb|EYU23441.1|  hypothetical protein MIMGU_mgv1a019365mg                367   1e-110   

>ref|XP_009775967.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
 ref|XP_009775968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
 ref|XP_009775969.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
 ref|XP_009775970.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]

 Score =   990 bits (2560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/715 (67%), Positives = 580/715 (81%), Gaps = 0/715 (0%)
 Frame = +3







             +MQREG+  DEFT+GS+L+SS+S+A  E+IL + +K  LILK EVSNA++SAFCK G I+






>ref|XP_009619976.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619977.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619979.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619981.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/715 (65%), Positives = 572/715 (80%), Gaps = 0/715 (0%)
 Frame = +3






                 TS++NA +TMY++C DL A  L+FER+KEKD VSWNAMITSYAQ +L   AI  YL

             +MQREG+  DEFT+GS+L+SS+S+   E+I  + +K  LILK EVSNA++SAFCK GE+ 

             QA + F DMF RNLISWN +ISGC  NG P++ L+LFS++++EGL PN +TLS +LS CA


             +I+AYAQHGKG EAVHCFE M + G V+PD  +F  VLSACSH+GL++ GI++F SM++ 



>ref|XP_006360680.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Solanum tuberosum]

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/723 (65%), Positives = 572/723 (79%), Gaps = 0/723 (0%)
 Frame = +3






             HA V + G  + TS++NA +TMY++C +L A  L+FER+K KD VSWNAMITSYAQ  L 

               AI AY++MQ+EG+  DEFT+GS+L+SS+S+   E+IL +V+K  LILK EVSNA++SA






Query  2253  VRS  2261
             + S
Sbjct  721   IGS  723

>ref|XP_004240287.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Solanum lycopersicum]

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/718 (63%), Positives = 562/718 (78%), Gaps = 1/718 (0%)
 Frame = +3






             + G  + TS++NA +TMY++C +L    L+FER++ KD VSWNAMITSYAQ  L   AI 

             AY++MQ+EG+  DEFT+GS+L+SS+S+   E+IL +V+K  LI K EVSNA++SAFCK G

             E++QAY+ F DMF RN+ISWN +ISGC  NG PM  L+LFSE+++E L PN +TLS +LS

              CA I + Q GK+IH +ILK G   E S+GN LI LY+KCG+LHWS +VFQIMT++D+VS




>ref|XP_010647149.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Vitis vinifera]
 ref|XP_002263704.2| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Vitis vinifera]
 ref|XP_010647150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Vitis vinifera]
 ref|XP_010647151.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Vitis vinifera]
 ref|XP_010647153.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Vitis vinifera]

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/719 (62%), Positives = 556/719 (77%), Gaps = 0/719 (0%)
 Frame = +3

             +N  E LIK+N LLA+ TR     +++ LF  IHSS+ L+PDH+TLS+ LTACA++++  




             D IT+N MI GL S+ R+EEAL+MF  M+   L PT LTFVS+MSSCS    + Q+HA  

             +K GF  CT VSNAAMTMYS+C +L A  ++F+R++EKD++SWN +I +YAQ N    AI



             S CA I + +HGKQIHGYIL+ G F  TS+GN LI +Y+KCG L WS R+F +M  RD+V


             MVN+YG +PG +H SCIVD+L RAGYL+EAE ++ +K++++ S++WWTLFS+ AAHG+ R


>emb|CDP02638.1| unnamed protein product [Coffea canephora]

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/721 (63%), Positives = 547/721 (76%), Gaps = 1/721 (0%)
 Frame = +3

             I  N  + LIKLN  L   TR  Q+  AL LF  I+SS  LRPDHYTLS  LTACA+++ 







             + G I QAYR F  M T+NLISWN +ISG Q NGFP+Q L  FS L+  G  PN +TLS 

             VL+ CA I + +HGKQ+H Y LK    LETS+ N  I LY+KCG L  S R+F  MT +D




Query  2259  S  2261
Sbjct  731   S  731

>ref|XP_011073672.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Sesamum indicum]
 ref|XP_011073673.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Sesamum indicum]

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/720 (63%), Positives = 547/720 (76%), Gaps = 0/720 (0%)
 Frame = +3

             P N  + LIKLNCLL +     QF  AL LF  IH SH L+PDHYT+ST LTACA++Q T




              D+ITYNA+IAGLV++E++E+AL +F  M+ + L PT LTFVS+M +C     A+Q+H  


              LAYL+MQR+G+  DEFT GSLL+SS+ +  AEMI ++VIKN LILK+EV N ++SAF +

              GEIEQA + F  M +RNLISWNA+ISG   NG P   L  F ++L  GL PN YTLS V

             LS CA     QHGKQ+H YILKFG F  T +GN L+ALYSKCG L+WS RVFQ +  +D 


              MVN YGI+P + HFSCIVD+L RAG+LD AE ++K + I VD +VWWTLFSS  AH + 


>ref|XP_010106892.1| hypothetical protein L484_012985 [Morus notabilis]
 gb|EXC12608.1| hypothetical protein L484_012985 [Morus notabilis]

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/735 (58%), Positives = 547/735 (74%), Gaps = 4/735 (1%)
 Frame = +3

             FSL +Q +      I +   E L++LN  L++  R +++  +L LF   HSS   R DHY

             TLS  +TACA+++  V GAQ+HA  +RAGL  + HV N LLS YAK+ DL  VKR+F EI



             VVDAC VFE+ +  V DQIT+N MI GL S+ R+EEAL MF  M  + L PT +TFVS+M

             SSCS    A Q+HA  +K GF   TSVSNAA+ MYS+C DL A  ++F R++ KDI+SWN

             +MI+S  Q N    A LAYL+MQREG+  DEFT GSLL+ ++S    EM+ +LVIKNGLI

             LKI+VSNA+VSA+ K G++  AY+ F D+  +N+ISWN IISG   NGFPM+ L  FS+L

             L   + PN YT + VLS C+ I + + GKQ+HGY +    F ET +GNTLI +Y+K GIL




Query  2217  RYRVIKQPGSSWVRS  2261
             R   +KQPG SW+ S
Sbjct  719   RKGTMKQPGCSWITS  733

>ref|XP_009362610.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Pyrus x bretschneideri]

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/716 (59%), Positives = 534/716 (75%), Gaps = 1/716 (0%)
 Frame = +3

             + ++KLN  LA+ TR  ++  AL LF  IHSS  +RPDHYTLS+ +TACA+ +   FG Q

             LHA  +++GL  + HV+N LLS YAK++DL  VK +F  I++PDVYSWTTLLSAC+KLG 

             V+YA +VFD+M ++  VA+WNA+ITGCAE   DEVA++ F +MH +GV HDNY FA+VLS

             LC L + G GRQVHS+V+KTGFL  +SV+NAL+TMYFNC+SV +A ++FE+A+  + DQI

             T+N MI GLVS  R++EAL MF  M+   L PT LTFVSLM+SCS    A  + A  VK 

             GF   TSVSNAA+TMYS C DL A   +F+ ++EKD++SWN MI++YAQ N    AIL Y

              +MQR GV  DEFT GSLL+SS+ +   +M+ +L  KNGLILKI VSNA+VSA+ KLG I

             + AY  F D+ ++NLISWNAI+SG   NG   + L  FS LL     P+  +LS +LS C

             +   + + GKQ+HGYILKFG   +  +GN LI +Y+KCG++ WS RVF  MT++D VSWN




>ref|XP_007047614.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007047615.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX91771.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX91772.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
isoform 1 [Theobroma cacao]

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/717 (57%), Positives = 530/717 (74%), Gaps = 2/717 (0%)
 Frame = +3

             N  + LI LN  LA  TR   +  AL+L     +    ++ DHYTLST L ACA++++  


             KLGE+ YA +VFD+M +++VAVWNA+ITGC +   ++    LF++MH LG  HD Y+FAS

             VLS+CS E  G GRQV ++VVKTGF    SV+NA++TMYFNC+ VV+AC VF++ +  V 

             D+IT+N MI GL+++ R E A +MF  M    L P+ LTFVSLMSSCS      Q++A  

             V  GF  CTSVSNAA+TMYS+C DL    ++FER++EKD+VSWN M++SY Q N G  A 

             L YLEMQR G+  DEFT GSLLS S+ +   EMI +LV KNGLI +I+VSNA+VS++ K 

             G++ QAY+ F+ M  +NLISWN IISG   NG P Q L   S+LL   L PNAYTLS  +

             S CA I S  HGKQ+HGYIL+   FLETS+GN LI +Y+KCG L+WS RVF  M  +D +


             MVN+YG  PG +H SC+VD+L+RAGYLDEAE ++ ++++E  S +WWTLFS+ AAH + R


>ref|XP_008237416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Prunus mume]

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/722 (58%), Positives = 535/722 (74%), Gaps = 1/722 (0%)
 Frame = +3

             I +  GE ++KLN  LA  TR   +  AL LF  I SS  +RPDHYTLS  +TACA+ + 


             CTKLG V+YA ++FD M  +R+VA+WNA+ITGCAE   +EVA+ LF +M  +GV HDNY+


              V DQIT+N MI GLV++ R+EEAL MF  M+ + L PT LTFVS+MSSCS    A  IH

             A  +K GF   TSVSNAA+TMYS C DL A  L+F+ ++EKD++SWN MI++Y+Q N   

              AIL YL+MQR  V  DEFT GSLL+SS+     + + +L  K+GLIL I+VSNA+VSA+

              K G +  AY+ F+D+   NLISWNAIISG   NG   + L  FS+LL     P+  TL+

             ++LS CA I + + GKQ+HGYILKFG F +  + N LI +Y+KCG++ WS RVF  M ++




Query  2256  RS  2261
Sbjct  733   ES  734

>gb|KDO78853.1| hypothetical protein CISIN_1g004733mg [Citrus sinensis]

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/715 (57%), Positives = 530/715 (74%), Gaps = 0/715 (0%)
 Frame = +3

             E L+KLN  LA+ +R   +  ALHLF  IHSSH L+PD Y+LST L ACA++++  FG Q


             V+YA +VFD+M  RD+ V+NA+ITGC E   +++ + LF++MH L V  DNY+FASVLS+

             C   L   GRQ+HS+V K+GF    SV+NAL+TMYFNC +VVDAC VFE+A   V D I+

             YN M+ GL S+ R EEAL+ F  M    L P+ LTFVS+MS+C  P    Q+HA  +K G


             EMQ  G+  DEFT GSLL+SS  +   EMI + V  NG+I  I+VSNA++SA+ K   I+

             QAY+ F +M  RN+I+WN +I+G   NGFP+Q L  FSELL   L P+ YTLS  LS+CA

              I S +HGKQIHGY+LK     + S+GN +I LY+KCG L  S RVF +M E+D +SWN+


             YG  P  +H SC++D+L RAGYLDEAE ++ +++I+  S  WW LFS+ AAHG+ RLGRI


>ref|XP_006466421.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Citrus sinensis]
 ref|XP_006478131.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Citrus sinensis]

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/715 (57%), Positives = 528/715 (74%), Gaps = 0/715 (0%)
 Frame = +3

             E L+KLN  LA+ +R   +  ALHLF  IHSSH L+PD Y+LST L ACA++++  FG Q


             V+YA +VFD+M  RD+ V+NA+ITGC E   +++ + LF++MH L V  DNY+FASVLS+

             C   L   GRQ+HS+V K+G     SV+NAL+TMYFNC +VVDAC VFE+A   V D I+

             YN M+ GL S+ R EEAL+ F  M    L P+ LTFVS+MS+C  P    Q+HA  +K G


             EMQ  G+  DEFT GSLL+SS  +   EMI + V  NG+I  I+VSNA++SA+ K   I+

             QAY+ F +M  RN+I+WN +I+G   NGFP+Q L  FSELL   L P+ YTLS  LS+CA

              I S +HGKQIH Y+LK     + S+GN +I LY+KCG L  S RVF +M E+D +SWN+


             YG  P  +H SC++D+L RAGYLDEAE ++ +++I+  S  WW LFS+ AAHG+ RLGRI


>emb|CAN71514.1| hypothetical protein VITISV_021786 [Vitis vinifera]

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/719 (58%), Positives = 522/719 (73%), Gaps = 45/719 (6%)
 Frame = +3

             +N  E LIK+N LLA+ TR     +++ LF  IHSS+ L+PDH+TLS+ LTACA++++  




             D IT+N MI GL S+ R+EEAL+MF  M+   L PT LTFVS+MSSCS    + Q+HA  

             +K GF  CT VSNAAMTMYS+C +L A  ++F+R+                  N    AI


             G+IEQAY                            Q L  F ELL   L PNAYTLS VL
Sbjct  420   GQIEQAY----------------------------QGLEQFYELLMSTLKPNAYTLSIVL  451

             S CA I + +HGKQIHGYIL+ G F  TS+GN LI +Y+KCG L WS R+F +M  RD+V


             MVN+YG +PG +H SCIVD+L RAGYL+EAE ++ +K++++ S++WWTLFS+ AAHG+ R


>ref|XP_008342174.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Malus domestica]

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/716 (59%), Positives = 525/716 (73%), Gaps = 1/716 (0%)
 Frame = +3

             + ++KLN  LA+ TR  ++  AL LF  IHSS  + PDHYTLS+ +TACA+ +   FG Q


             V+YA +VFD+M ++  VA+WNA+ITGCAE   D VA++ F +MH +GV HDNY FASVLS


             T+N MI GLVS  R++EAL MF  M+   L PT LTFVS+M+SCS    A  + A  VK 

             GF   TSVSNAA+TMYS C DL A   +F+ ++EKD++SWN MI++YAQ N    AIL Y

              +MQR GV  DEFT GSLL+SS+ +   +M  +L  KNGLILKI VSNA+VSA+ KLG I

             + AY  F D+ ++NLISWNAI+SG   NG   + L  FS LL     P+  TLS +LS C

             +   + + GKQ+HGYILKFG   +  +GN LI +Y+KCG++ WS RVF  MT++D VSWN




>ref|XP_004289369.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Fragaria vesca subsp. vesca]

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/722 (57%), Positives = 517/722 (72%), Gaps = 2/722 (0%)
 Frame = +3

             I +  GE ++KLN  L    R   +   L LF  I+SS  +RPDHYT+S  +TACA ++H

              VFG QLH   +R+GL  F HV+N LLS YA + DL  V+ +F EI  PDVY+WTTLLSA

             C KLGEVEYA +VFD++  + +VA+WNA+ITGCAE   +EVA  LF +M  +GV  DNY+


              V D+I++N MI GLV + R+EE L+MF  M+   L PT LTFVS+MSS      A  +H

             A  +K GF   TSVSNAA+T Y+ C D +A  L+F +++E+D++SWN+MI++YAQ N   

               IL YL+MQR G   DEFT GSLL+SS  +   +MI ++  KNGLI KI+VSNA+VSA+

              K G++  AY+ F+D   +NLI+WNAIISG   NG   + L  F ELL   L P+ YTLS

              +LS CA I S + GK +H YILKFG   +  +GN LI +Y+KCG+L WS RVF+ M E+




Query  2256  RS  2261
Sbjct  732   NS  733

>gb|KDP32117.1| hypothetical protein JCGZ_12578 [Jatropha curcas]

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/721 (55%), Positives = 516/721 (72%), Gaps = 4/721 (1%)
 Frame = +3

             + L EH  LIKLN  LA+ TR  Q+  ALHL           L+PD YTLS  LTACA+I

              +  FG +LHA  +++GL +F HV+N LLS YAK++D+  VK +F EI++PDVYS+TTLL

             S+ TK+G V+YA +VFD+M  RD+AVWNAIITGC E  ++E+  +LF+ M   GV HDNY

             +FA VLS C L +   G QVHS+V+KTG++  TSV+NAL+TMYF  ++++DA  VF + +

                 DQITYN MI GL+SM + EEAL+MF  M    L PT LTF+S MSS        QI

             H   +K GF   TS SNA ++MYS C DL A  ++F++++ KD+VSWN MI+SYAQ NL 

               AI  YLEMQR G+  DEFT GSLL+SS+     EMI +++++N LI  I++SNA+VSA

             + K G ++QAY+ F D+  RNLISWNAIISG  SNG P+Q L  FSELL     PN YTL

             S +LS CAGI + + GKQ+HGYIL  G   + S+ N LI +Y+KCG++ WS++VF  MT 


             IFNSM + YG+ PGV+HFSCIVD+L RAGY DE E I+K+++ E    +WWTL S+ AAH

             G+ +LGR+VAG LLE E + P+VYVLLSN+YA AG+WEE+A +R LM   R +KQ G SW

Query  2253  V  2255
Sbjct  739   I  739

>ref|XP_010033776.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 gb|KCW53586.1| hypothetical protein EUGRSUZ_J02857 [Eucalyptus grandis]

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/718 (55%), Positives = 518/718 (72%), Gaps = 2/718 (0%)
 Frame = +3

             ++  + L +LN LLA  TR   +   L LF  I  S  L+PDHYTLS+ +TACA+ ++ V

             FG QLHA  +RAG   + HV+N LL  YAK +D+  VK+LF EI++PDVYSWTT++SAC 



             D+IT NAMI GLV + R+EEAL+MF  M+   L PT LTFVSLMSSCS    A Q+H   

             +K+G   CT+V NAA+TMYS C  L+A +++F R  +KD+VSWNAMI+SYAQ NLG   I

             L +L+MQR G   DEFT GSLL+SS+S    EMI +L+ + GL+L I+ SNA+  A+ K 

             G++  AY+ FRD+  +NLISWN + SG  SNGFP+Q L   +E+    L PNAYTLS  L

             + CA + S  H KQIH YI++     E S+ N LI +YSKCG+L    RVF  M ERD V


             M+N +G+KP  + FSC++D+L RAGYLDEAE ++ +++ + +S   WTLFS+ A+H + R

             LGR+VA ++L+ E +NP+VYVLLSNIYA AG+W+E+A+VR++++ Y V KQ G SW+R

>ref|XP_008449638.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X2 [Cucumis melo]
 ref|XP_008449646.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X2 [Cucumis melo]

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/725 (53%), Positives = 520/725 (72%), Gaps = 2/725 (0%)
 Frame = +3

             L  I ++  + L++ N LLA+  R  ++  +L LF  IHSS    ++PDHY LST L  C

             A+ +   FG+QLH + +R+GL  + HV+N +LS Y+K +D   +KR F EI+ PDVYSWT

             TLLSAC K+G +EYA ++FD M + +VA WNA+ITG AE   D VA+N F +MH +GV  


               + EV DQITYN MI GLV + RNEEAL+MF  M+   L PT LTFVS+MSSCS    A

              Q+H+  +K GF   T V N+ +TMYS+C + +A   +F+ + EKD++SWNA+I+SY Q 

             N G  A+LA+L+MQR G+  DEFT GSLL  S+ +   EM+ + V KNGLIL IE+ NA+

             VSA+ K  +++Q+++ F ++ ++NLISWN +I G   NG P Q+L  FS+L+   L P+ 

             +TLS VLS CA I +   GKQIHGYIL+ G+  ETS+ N LI +YSKCG+L WS + F +


               QI ++M+ +Y + P ++  SCIVD++ R+GY+D+AE ++++      + VWW LFS+ 


Query  2244  SSWVR  2258
Sbjct  731   CSWIR  735

>ref|XP_008449604.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X1 [Cucumis melo]
 ref|XP_008449613.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X1 [Cucumis melo]
 ref|XP_008449621.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X1 [Cucumis melo]
 ref|XP_008449629.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X1 [Cucumis melo]

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/724 (53%), Positives = 519/724 (72%), Gaps = 2/724 (0%)
 Frame = +3

             L  I ++  + L++ N LLA+  R  ++  +L LF  IHSS    ++PDHY LST L  C

             A+ +   FG+QLH + +R+GL  + HV+N +LS Y+K +D   +KR F EI+ PDVYSWT

             TLLSAC K+G +EYA ++FD M + +VA WNA+ITG AE   D VA+N F +MH +GV  


               + EV DQITYN MI GLV + RNEEAL+MF  M+   L PT LTFVS+MSSCS    A

              Q+H+  +K GF   T V N+ +TMYS+C + +A   +F+ + EKD++SWNA+I+SY Q 

             N G  A+LA+L+MQR G+  DEFT GSLL  S+ +   EM+ + V KNGLIL IE+ NA+

             VSA+ K  +++Q+++ F ++ ++NLISWN +I G   NG P Q+L  FS+L+   L P+ 

             +TLS VLS CA I +   GKQIHGYIL+ G+  ETS+ N LI +YSKCG+L WS + F +


               QI ++M+ +Y + P ++  SCIVD++ R+GY+D+AE ++++      + VWW LFS+ 


Query  2244  SSWV  2255
Sbjct  731   CSWI  734

>ref|XP_010679679.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010679680.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010679681.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010679682.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Beta vulgaris subsp. vulgaris]

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/720 (55%), Positives = 528/720 (73%), Gaps = 3/720 (0%)
 Frame = +3

             +  +  + LI+LN  L+  TR  + Y  L LF  I+SS +  PDHY+LS+ LTA A+ ++


             CTKLG+V YA ++ D+MS R+V  WNA+ITGC+E   ++V  +LF++MH LGV HDNYTF

             A VLSLC++ EL+G G+QVHS++ K+GFL  +SV+N+L+TMYFN  +V+ AC VFE+ D+

              V D+ITYNAMI GL  +ER EEAL+MF +M    L PT LTFVSLMSS     T+ Q+H

             A  +K G+  CT+VSNAAM MY+    L + R IFE+++ KD+VSWN MI  YA  N   

              AILAY+EMQ+ G V DE+T+G+LLS S+S+   +M+ +LV+KNGL L  EV NA++SA 

              K G+I+ A + F +M  RN I+W+AIISG  SNG+P Q+L LF ++  +    +  TL+

              +LS C+GI   QHGKQ+H YIL+     E S+GN LI +Y+KCG+L WS +VF  M +R

             +VVSWN++ISA+AQ+G+G  AV  F  M     + PD+ATFT  LSAC   GLV DGI+I

             FNSMVN+Y +KPGV+HFSC+VD+L RAGY+DE E +V+++  + D  VWWTLFS+  A+G


>ref|XP_008449654.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
isoform X3 [Cucumis melo]

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/724 (53%), Positives = 519/724 (72%), Gaps = 2/724 (0%)
 Frame = +3

             L  I ++  + L++ N LLA+  R  ++  +L LF  IHSS    ++PDHY LST L  C

             A+ +   FG+QLH + +R+GL  + HV+N +LS Y+K +D   +KR F EI+ PDVYSWT

             TLLSAC K+G +EYA ++FD M + +VA WNA+ITG AE   D VA+N F +MH +GV  


               + EV DQITYN MI GLV + RNEEAL+MF  M+   L PT LTFVS+MSSCS    A

              Q+H+  +K GF   T V N+ +TMYS+C + +A   +F+ + EKD++SWNA+I+SY Q 

             N G  A+LA+L+MQR G+  DEFT GSLL  S+ +   EM+ + V KNGLIL IE+ NA+

             VSA+ K  +++Q+++ F ++ ++NLISWN +I G   NG P Q+L  FS+L+   L P+ 

             +TLS VLS CA I +   GKQIHGYIL+ G+  ETS+ N LI +YSKCG+L WS + F +


               QI ++M+ +Y + P ++  SCIVD++ R+GY+D+AE ++++      + VWW LFS+ 


Query  2244  SSWV  2255
Sbjct  731   CSWI  734

>ref|XP_004144368.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Cucumis sativus]

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/725 (53%), Positives = 520/725 (72%), Gaps = 2/725 (0%)
 Frame = +3

             L  I ++  + L++ N LLA+  R  ++  +L LF  IHSSH   ++PDHY LST L  C

             A+ +   FG+QLH + +R+GL  + HV+N +LS YAK +D   +KR F EI+ PDVYSWT

             TLLSACTK+G +EYA ++FD M + +VA WNA+ITG AE   D VA+N F +MH +GV  

             DNY+FA +LSLC+ E+  LGRQVHS V+K G+L  TSV+NAL+TMYF+ +++ DA  VFE

               + EV DQITYN MI GLV + RNEEAL+MF  M+   L PT LTFVS+MSSCS    A

              Q+H+  +K GF   T V N+ +TMY++C + +A   +F+ + EKD++SWNA+I+SY Q 

             N G  A+LA+L+MQR G+  DEFT GSLL  S+ +   EM+ + V KNGLIL IE+ NA+

             VSA+ K  +++Q+ + F ++ ++N+ISWN +I G   NG P+Q+L  FS+L+   L P+ 

             +TLS VLS CA I +   GKQIHGYIL+ G+  ETS+ N LI +YSKCG+L WS R F +


               QI + M+ +Y   P V+  SCIVD++ R+GY+D+AE ++++      + VWW LFS+ 


Query  2244  SSWVR  2258
Sbjct  731   CSWIR  735

>gb|KGN54739.1| hypothetical protein Csa_4G439060 [Cucumis sativus]

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/725 (53%), Positives = 519/725 (72%), Gaps = 2/725 (0%)
 Frame = +3

             L  I ++  + L++ N LLA+  R  ++  +L LF  IHSSH   ++PDHY LST L  C

             A+ +   FG+QLH + +R+GL  + HV+N +LS YAK +D   +KR F EI+ PDVYSWT

             TLLSACTK+G +EYA ++FD M + +VA WNA+ITG AE   D VA+N F +MH +GV  

             DNY+FA +LSLC+ E+  LGRQVHS V+K G+L  TSV+NAL+TMYF+ +++ DA  VFE

               + EV DQITYN MI GLV + RNEEAL+MF  M+   L PT LTFVS+MSSCS    A

              Q+H   +K GF   T V N+ +TMY++C + +A   +F+ + EKD++SWNA+I+SY Q 

             N G  A+LA+L+MQR G+  DEFT GSLL  S+ +   EM+ + V KNGLIL IE+ NA+

             VSA+ K  +++Q+ + F ++ ++N+ISWN +I G   NG P+Q+L  FS+L+   L P+ 

             +TLS VLS CA I +   GKQIHGYIL+ G+  ETS+ N LI +YSKCG+L WS R F +


               QI + M+ +Y   P V+  SCIVD++ R+GY+D+AE ++++      + VWW LFS+ 


Query  2244  SSWVR  2258
Sbjct  737   CSWIR  741

>ref|XP_010028057.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028058.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028059.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028060.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028061.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028062.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028063.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 ref|XP_010028064.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Eucalyptus grandis]
 gb|KCW54719.1| hypothetical protein EUGRSUZ_I00666 [Eucalyptus grandis]

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/718 (54%), Positives = 515/718 (72%), Gaps = 2/718 (0%)
 Frame = +3

             ++  + L +LN  LA  TR   +   L LF  I  S  L+PDHYTLS+ +TACA+ ++ V

             FG QLHA  +RAG   + HV+N LL  YAK +D+  VK++F EI++PDVYSWTT++SAC 

             KLGEV+YA + FD+M  R+VAVWNA+ITGCA+   +E+A   F++MH LGV HDNY+FA 


             D+IT NAMI GLV + R+EEAL+MF  M+   L PT LT+VSLMSSCS    A Q+H   

             +K+G   CT+V NAA+TMYS C  L+A + +F R  +KD+VSWNAMI+SYAQ NLG   I

             L +L+MQR G   DEFT GSLL+SS+S    EMI +L+ + GL+L I+ SNA+  A+ K 

             G++  AY+ FRD+  +NLISWN + SG  SNGFP+Q L    E+    L PNAYTLS  L

             + CA + S  H KQIH YI++     E S+ N LI +YSKCG+L    RVF  M ERD +


             M+N +G+KP  + FSC++D+L RAGYLDEAE ++ +++ + +S   WTLFS+ A+H + R

             LGR+VA ++L+ E +NP+VYVLLSNIYA AG+W+E+A+VR++++ Y V KQ G SW+R

>ref|XP_006426143.1| hypothetical protein CICLE_v10025041mg [Citrus clementina]
 gb|ESR39383.1| hypothetical protein CICLE_v10025041mg [Citrus clementina]

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/715 (55%), Positives = 505/715 (71%), Gaps = 37/715 (5%)
 Frame = +3

             E L+KLN  LA+ +R   +  ALHLF  IHSSH L+PD Y+LST L ACA++++  FG Q


             V+YA +VFD+M  RD+ V+NA+ITGC E   +++ + LF++MH L V  DNY+FASVLS+

             C   L   GRQ+HS+V K+GF    SV+NAL+TMYFNC +VVDAC VFE+A   V D I+

             YN M+ GL S+ R EEAL+ F  M    L P+ LTFVS+MS+C  P    Q+HA  +K G


             EMQ  G+  DEFT GSLL+SS  +   EMI + V  NG+I  I+VSNA++SA+ K   I+

             QAY+ F +M                                     P+ YTLS  LS+CA
Sbjct  439   QAYQIFHNM-------------------------------------PDEYTLSVALSSCA  461

              I S +HGKQIHGY LK     + S+GN +I LY+KCG L  S RVF +M E+D +SWN+


             YG  P  +H SC++D+L RAGYLDEAE ++ +++I+  S  WW LFS+ AAHG+ RLGRI


>gb|EYU38664.1| hypothetical protein MIMGU_mgv1a023275mg, partial [Erythranthe 

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/709 (56%), Positives = 500/709 (71%), Gaps = 25/709 (4%)
 Frame = +3

             + +P+N  + LIK+NCLL +     QF  ALHLF   HSS  LRPDHYT+ST LTACA+ 

               T  G QLHA  +++GL  F HV+N LLS YAKS  L                      
Sbjct  70    HETRVGDQLHAHSIQSGLKRFPHVTNTLLSLYAKSCHL----------------------  107

                  LGEV+YA  VFDQM + +VAVWNA+ITGC     DEVA +LF  MH+LGV  D Y


              EV D ITYNA+IAGLVS++R+EEAL +F  M+   L PT LTFVS+M +C     A Q+


              +A+LAYL+MQ   +  DEFT+GSLL+SS  V   EMI ++V+K  LI K+EVSNA++SA

             FCK GE EQA + F  M +RNLI+WN++ISG   NG P  +L  FS LL +G  PN YTL

             S VLS CA I   ++GKQ+H Y+L+FG F  T +GN LIALYSKCG L  S RVF+ MTE


              F+ MVN YGI P V+HFSCIVD+L RAG+LD A  ++K + + ++ +VWW+L SS AAH

             G  +LG I A  L+ET K++PA YV+LSN+YA+AGKWEESA +RELM++

>ref|XP_010276285.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nelumbo nucifera]
 ref|XP_010276286.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nelumbo nucifera]

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/722 (53%), Positives = 511/722 (71%), Gaps = 7/722 (1%)
 Frame = +3

             N  E L+KLN  +A  TR  Q   AL LF+ IHS+   RPD YTL++ L+ACA++Q  V 

             G QLHA+ +RAG   ++H+ N LLS YAK  DL  V R+F++I +PD Y+WTTLLSA TK

             LG+V +A Q+F++M  ++ +V+VWN++ITGC E    EVA  +F++MH LG+ HDNYTFA

             S+LS C S EL   GRQVHS+V++TGFL   SV+NA +TMYFNC  V DA  +FE+ +  

               +QIT NAMIAGL S  R+ EALM+F  M+  +L+P   TF S++SSCS         Q

             +HAL +K GF  CT V+NA +TMYS C DL A  ++FE ++ KD +SWN+MIT YAQ NL

                AI+ Y++MQR G+  DEFT+GSL+++S  +   EM+ + ++KN LI   +V NA++S

              + K  +++QA+R F  M +RNLISWN ++ GC  NG P   L+LF +L    L P+ Y+

             LS VLS CA     +HGKQ+H YI++ G  LET +GNTLI+ Y++CG L WS +VF  M 


              IF SM++++GI PGV+H+SCI+D+L RAG+LDEAE ++ T   + D  +WW + SS   


Query  2250  WV  2255
Sbjct  725   WV  726

>ref|XP_007145640.1| hypothetical protein PHAVU_007G256100g [Phaseolus vulgaris]
 gb|ESW17634.1| hypothetical protein PHAVU_007G256100g [Phaseolus vulgaris]

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/714 (54%), Positives = 507/714 (71%), Gaps = 4/714 (1%)
 Frame = +3

             L+KLN +L D TR    +    L   + +     PDHYTLS  LTA A+ ++  FGAQLH


             +ALQ+FD++ +R VAVWNA+ITGCA+   + +A NLF+ M  +G+  D YTFA++LSLCS

             LEL   GR VHS+V+K+G L  TSV+N+L+TMYF C  VVDAC VFE+A++    D +TY

             NAMI G  S ER+E+A +MF  M+     PT +TFVS+MSSCS      Q  A   K G 

              DC +V+NA MTMYS   ++   R IFER++E+D+VSWN M++   QENL  EAIL+YL+

             M+REG+  DEFT GSLL ++ S+   EMI SL+ K+GL+ KIEV N +VSA+C+ G+I+ 

             A++ F  +  +NLISWN+IISG   NG P+Q L  FS LL   + PNAY+LS VLS  + 

             + +   GKQ+HGYIL+     E S+GN L+ +Y+KCG L W+ RVF  M ERD +SWN++


             GI P V+HFSC+VD+L R+GYLDEAE ++K   +   S + W++FS+ AAHG+ +LGR V

             A +LLE + +NP+V+VLLSNI A AG+WEE+A +R++M+ +   KQPG SW+R+

>ref|XP_003537198.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
isoform X1 [Glycine max]

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/717 (54%), Positives = 514/717 (72%), Gaps = 5/717 (1%)
 Frame = +3

             E  IKLN +LA   R  Q      L   +H+     PDHY LST +TA A+ +   FGAQ


              VE+AL+VFD + +  +AVWNA+ITGCAE  + + A  LF+ M+ +GV  D YTFA++LS

             LCSLEL+  GR VHS+V+K+GFL  TSV+N+L+TMYF C  VVDAC VFE+A++    D 

             ++YNAMI G  S+ER+E+A ++F  M+     PT +TFVS+MSSCS      Q  +  +K

              GF  C +V+NA MTMYS   ++   + IFE ++E+D+VSWN M++ + QENL  EA+L+

             YL+M+REG+  DEFT GSLL+++ S+   EMI SL+ K+GL+ KIEV NA+VSA+C+ G+

             I++A++ F  +  ++LISWN+IISG   NG P+Q L  FS LL+  + PNAY+LS VLS 

             C+ + +  HGKQ+HGYIL+ G   E S+GN L+ +Y+KCG L  + RVF  M ERD ++W


               YG  P V+HFSCIVD+L R+GYLDEAE ++K+      S + W+LFS+ AAHG+  LG

             R VA ++LE + NNP+VYVLLSNI A AG+WEE+A++RE+M+ +  IKQPG SW+R+

>gb|EPS71548.1| hypothetical protein M569_03209, partial [Genlisea aurea]

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/725 (54%), Positives = 516/725 (71%), Gaps = 10/725 (1%)
 Frame = +3

             + +N G+ LI++NC L D  R  +F  ALH F  +HSSH L+ DHY++ST LTACA ++ 


               KLGEVEYA  +FD M +  V +WNA+ITGC   ++   A  LF++MH  G+  D+YT 

             ASVLS CSLE +  G+Q+HS+++KTGF+   SV+N+L+TMYF+C+S  +A  V+EDA  E

               D+IT+NAMI GLVS+ER +EAL+    M +  L PT  TFVS+M +C    +A Q+H 

             L +K    D TSVSNAA++MYS+  DL+AT  +F R+KEKD++SWNA+I SY +ENLG +

             A ++Y+EMQR G+  DEFT+GSLL SS  V   EM  ++ +KN LIL++EV NA++  F 

             + GEIE+A  +FR+M TRNL+SWNA+ISG   NG P   L  F ELL  G  PN +TLS 



              SMVN++G +P    FS +V +L R G+LD  A+ ++K   ++ +DS+VWW++ S  AA+

             G  +LG  VA ++L  EK+ P  +VYVLLSN+YA+AG+WE SA +RE M++  ++K+PG+

Query  2247  SWVRS  2261
             SW+ S
Sbjct  716   SWITS  720

>gb|KFK34244.1| hypothetical protein AALP_AA5G119900 [Arabis alpina]

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/727 (53%), Positives = 503/727 (69%), Gaps = 7/727 (1%)
 Frame = +3

             L+ I +NL   L+ +N  L  FTR  ++ +AL LF  +H    LRPD YT+S+ +TA   

             ++ T+FG Q+H + +R+G+   SHVSN LLS YA+  +L  +K+ F EI+ PDVYSWTTL

             LSA  KLG++EYA +VFD+M  RD VA+WNA+ITGC E      ++ LF++MH +GV HD

              + FA+VLS+C       G+QVHS+VVK G+L  +SV+NA++TMYFNC+ VVDA  VFED

             AD  V DQ+TYN +I GL   +R EE+L++F  M    L PT LTFVS+MSSCS      

             Q+H L +K G+ + T VSN+ MTMYS+ +D  A R +FE +KEKD+V+WN MI+ Y Q  

             LG  A+  Y +MQR GV  DEFT GSLL+SS  +   EM+   VI  GL  K+E+SNA++

             SA+ K GEI +A   F     +NLISWNAIISG   NG+P + L  FS LL   +   P+

             AYTLST+LS C  I S   GKQ H Y+L+ G F ET IGN LI +YS+CG L  S  VF 


             +G++IFNSMV  +G+ P V+HFSC+VD+L RAGYL EAE +VK   K+I     VWW LF

             S+ AAHGD +LG++VA +L+E EKN+P++YV L+NIYA AG W+E+   RE M     +K

Query  2235  QPGSSWV  2255
             Q G SW+
Sbjct  729   QRGCSWM  735

>ref|XP_006404106.1| hypothetical protein EUTSA_v10010148mg [Eutrema salsugineum]
 gb|ESQ45559.1| hypothetical protein EUTSA_v10010148mg [Eutrema salsugineum]

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/685 (53%), Positives = 477/685 (70%), Gaps = 6/685 (1%)
 Frame = +3

             RPDHY++S+ +TA   ++ T+FG Q+H + +R+G+   SHVSN LLS YA+S DL  +KR


             ++ LF++MH LGV HD + F++VLS+C       G+QVHS+V+K GFL  +SV+NAL+TM

             YFNC+  V A  +FE+AD  V DQ+T+N +I GL   ++ EE+LM+F  M    L P  L

             TFVS+MS  S      Q+H L +K G+ D T VSNA MTMYS  +D  A R +FE +KEK

             D+V+WN MI+ Y Q  LG  A+  Y +MQR GV  DEFT GSLL+SS  + + EMI    

             IK GL  KIE+SNA++SA+ K GE+ +A   F     +NLISWNAI+SG  +NGFP +SL

               FS LL   +   P+AYTLST+LS C  I S   GKQ H Y  + G   ET IGN LI 

             +YS+CG +  S  VF  M+++DVVSWNSMISAYA+HG+G  A+  ++TM D G+V+PD A


               K+I     VWW LFS+ AAHGD +LG++VA +L+E EKN+P+VYV ++NIYA +G W+

             E+   RE M     +KQ G SW+RS

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 98/197 (50%), Gaps = 7/197 (4%)
 Frame = +3

             L + N  ++G   +G    +L LF+++     L P+ Y++S+ ++A   +     G Q+H

              Y ++ G    + + NTL++LY++ G L    R F+ + E DV SW +++SA  + G   

              A   F+ M +      D A +  +++ C  +G     I++F  M +  G++     FS 

Query  1953  IVDILSRAGYLDEAEEI  2003
             ++  +   G LD  +++
Sbjct  196   VLS-MCYYGSLDFGKQV  211

>ref|XP_010547566.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Tarenaya hassleriana]

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/716 (52%), Positives = 489/716 (68%), Gaps = 6/716 (1%)
 Frame = +3

             L  +NC L   TR  +   A  LF  +H S  L+PDHY++S+ LTA A ++ T+FG Q+H

              + +R+GL  +SHV N LLS  A S D   +K++F EI+ PDVYSWTTLL AC KLG++E

             YA ++FD+M  RD  AVWNA+ITGC E    ++ +  FQ+MH+LGV HDNY+ ASVLS+C

             S     LG QVHS+V+K+G L   SV+N+L+TMYFNC+ V  A  VFE+ D  V DQIT+

             N MI GL    + EEAL++F  M  + L PT LTFVSLM SC       QIH L +K G+

               CTSV N+A+TMYS+  DL   R +FE + EKD+++WNAMI++Y    L   AIL Y +

             MQR G+  DE+T GSL+ SS++V   E I + V K+GL   IE+SNA++SA+ KLG I +

             A   FR M  +N+ISWN IISG   N  P+Q L  FS LL     P+ YTLST+LS C  

             + S + G Q+H YI + G F E SIGN LI +YS+CG LH S RVF  MTE+DVVSWNS+


             G+ P V+HFSC+VD+L+RAGYL +AE I    +   I     V W L+S+ AAHGD ++G

             + VA  L+E EKNNP++YVLLSNIYA AG+W+E+   RE M+    +KQPG S +R

>ref|XP_010426500.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Camelina sativa]

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/719 (53%), Positives = 496/719 (69%), Gaps = 8/719 (1%)
 Frame = +3

             L+ LN  L   TR  +  +AL LF ++H    LRPD Y++S  +TA   ++ T FG Q+H

             ++ +R+GL   SHVSN LLS YA+  +L  +K+ F EI+ PDVYSWTTLLSAC KLG++E

             YA +VFD+M  R DVAVWNA+ITGC E      ++ LFQ+MH LGV HD + FA+VLS+C

                    G+QVHS+V+K GFL  +SV+NAL+TMYFNC+ V DAC VFE+AD  V DQ+T+

             N +I GL   +R EE+L +F  M    L PT L+FVS+MSSCS      Q+H L +K G+

              D T V+NA MTMYS+ ++  A   +FE ++EKD+V+WN MI+SY Q  LG  A+  Y  

             M R GV  DEFT GSLL++S  +   EM+ + + K GL  KIE+SNA++SA+ K G+IE+

             A   F     +NLISWNA+ISG   NGFP + L  FS LL     + P+AYTLST+LS C

               I S   G Q H Y+L+ G F ET+ IGN LI +YS+CG +  S  VF+ M+E+DVVSW


               +G I P V+HFSC+VD+L RAG+LDEAE +VK   K+I     VWW LFS+ AAHGD 

             +LG++VA +L+E EKN+P+VYV LSNIYA AG W+E+   RE +     +KQ G SW+R

>ref|XP_010923948.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Elaeis guineensis]

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/729 (53%), Positives = 512/729 (70%), Gaps = 10/729 (1%)
 Frame = +3

             L+ +P NL ++    LI LN LL+  TR  +   AL LF HIH+S+ + PDHY+L++ L 

             ACA ++    GAQLH+  LR+ L +F+HV+N LLSFYA        + LF  I +PDVYS

             +TTL+SA  K G  + A+Q+FD M +R+ A WNA+ITG      +E AL +F +MH LGV


              VF +A   V D+ITYNA+IAGLV + R+ EALM+F  M+   +L+PT LTF S++S+C 

                  TQ+HA V++ G  D   V+NA +TMYSNC DL +    FE I EKDIVSWNA+IT

              Y+QEN    A+  Y +MQ+ G+  DEFT GSLL+ S+  A+ +MI +LVIKNG I   E

               NAI+SA+ K GEI  +Y+ F +M +RN+ISWN+IISG   +GFP++SL +FS L+   

             L PN+YTLSTVLS CA +P+ +HGK++H YIL+  +  +T + N+L+ +Y KCG L + +


             GLVE+G  IF SMV +YGI+PGV+H+SCI+D+L RAGYL+EAE ++ +    VDS +WW 

             L S+ + HG+ RLGRI A  LLETE  NP +YVLLSNI A  GKWEE++S+R+ MQR  V

Query  2229  IKQPGSSWV  2255
              K+PG SW+
Sbjct  728   AKKPGCSWI  736

>gb|KEH41534.1| PPR containing plant-like protein [Medicago truncatula]

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/720 (52%), Positives = 508/720 (71%), Gaps = 9/720 (1%)
 Frame = +3

             + ++KLN  L   T+  QFY +L LF  IHSSH  +PDH TLST +TA +  +H TVFG 

             QLH+F ++  L  +SHV+N LLS YAK+ DL  V+ +F +IQ PDVYSWTT+LSA ++L 

             +++YAL VFD+M +  VAVWNAIITGC++   ++VA  L + M  + V  DNYTFA++LS

             LC L E    GR VHS+VVK+GFL  TSV+N+L+TMYFNC  VVD   VFE+ +  V + 

             +TYNAMI G VS+ER E+A +MF  M    +  + +TFVS++SSC       Q   L +K

              GF DC  T+V+NA MTMYS    +   R +FE ++E +D+VSWN M++ + QEN+  +A

             IL Y++M+REG+  D FT GSLLS+S S+   EMI S++ KNGL  K+EV NA++S++ +

              G+I++A++ F D+  ++LISWN+IISG   NG+PMQ L  FS LL   L PNAY+LS  

             LS C+  P   HGKQ+HGYIL+ G   E S+GN L+ +YSKCG L  S  VF  M ERD 


              MVN YG  P V+HFSCIVD+L R+GYLDEAE +V          + W+LFS+ A HG+ 

              LGR VA +LLE E+NNP+VYVLL+NI A+AG+WEE+A +R++++++   KQPG SW+ +

>ref|XP_004513641.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Cicer arietinum]

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/721 (53%), Positives = 502/721 (70%), Gaps = 4/721 (1%)
 Frame = +3

             N  + ++KLN  L+  TR  QF  +LHLF  IHSSH  +PDHYTLSTV+TA +   H T 

             FG+QLH+F ++ GL   SHV+N LLS Y+KS+D+  V+ LF +I+ PDVYSWTTLLSA T

             KL   + AL VFD+M +  VAVWNAIITGC++   +  A   F+ M  + V  DNYTFA+

             +LSLC+LEL   G+ VHS+V K+GFL  TSV+N+L+TMYFNC  VV+A  VFE+ +  + 

             D +TYNAMI G VS+ER E+A +MF  M    +  T +TFVS+MSSC       Q  AL 

             VK GF     +V+NA MTMYS   ++   R +FER++E KD+VSWN MI+ + QEN+  E

             AIL YL+++R G+  DEFT GSLL +S S+   EMI SL+ K+GL  K+EV NA++S++ 

             + G+I  A++ F D+  ++LISWN+IISG   NG P+Q L  FS LL   L PNAY+LS 

             VLS C+ I +  HGKQ+HGYIL+     E S+GN L+ +YSKCG L  S  VF  M ERD

              ++WN++ISAY+QHG+G EAV CFE M  S  ++PD+ATFT VL+ACSH GLV++   IF

             + MV  YG  P V+HFSCIVD+L R+GYLDEAE ++        S + W+LFS+ AAHG+

              RLGR VA +LLE E NN +VYVLLSNI A AG+WEE+A +R+ M+++   KQPG SW+ 

Query  2259  S  2261
Sbjct  735   T  735

>ref|XP_006292792.1| hypothetical protein CARUB_v10019043mg [Capsella rubella]
 gb|EOA25690.1| hypothetical protein CARUB_v10019043mg [Capsella rubella]

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/717 (52%), Positives = 495/717 (69%), Gaps = 6/717 (1%)
 Frame = +3

             L+ LN  L   TR  +  +AL +F  +H   +LRPD Y++S  +TA   ++ T+FG Q+H

              + +R+GL + SHVSN LLS Y +  +L  +K+ F EI+ PD YSWTTLLSAC KLG++E

             YA +VFD+M  RD VAVWNA+ITGC E      ++ LFQ+MH LGV HD + FA+VLS+C

               +    G+QVHS+V+K GFL  +SV+NAL+TMYFNC+ V DA  VFE+AD  V DQ+T+

             N +I GL   +R E++L +F  M    L PT L+FVS+MSSCS      Q+H L +K G+

              D T V+N+ MTMYS+ +D  A R +FE ++EKD+V+WN MI+SY Q  +G  A+  Y  

             M R GV  D FT GSLL++S  + + EM+ + +IK GL  KIE+SNA++SA+ K G+IE+

             A   F     +NLISWNAIISG   NGFP + L  FS L+   + + P+AYTLST++S C

               I S   G Q H Y+L+ G F ET IGN LI +YS+CG +  S  VF  M+E+DVVSWN


              +G+ P  +HFSC+VD+L RAG+LD+AE +VK   K+I     V W LFS+ AAHGD +L

             G++VA +L+E EKN+P+VYV LSNIYA AG W+E+   RE M     +KQ G SW+R

>ref|NP_190543.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9M2Y4.1|PP276_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49740 
[Arabidopsis thaliana]
 emb|CAB66912.1| putative protein [Arabidopsis thaliana]
 gb|AEE78584.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/717 (51%), Positives = 487/717 (68%), Gaps = 6/717 (1%)
 Frame = +3

             L+ LN  L   TR  +  +AL LF  +H    LRPD Y++S  +T    ++ T+FG Q+H

              + +R+GL   SHVSN LLS Y +  +L  +K+ F EI  PDVYSWTTLLSA  KLG++E

             YA +VFD+M  RD VA+WNA+ITGC E    E ++ LF++MH LGV HD + FA++LS+C

                    G+QVHS+V+K GF   +SV+NAL+TMYFNC+ VVDAC VFE+ D  V DQ+T+

             N +I GL   +R +E+L++F  M    L PT LTFVS+M SCS      Q+H L +K G+

                T VSNA MTMYS+ +D  A   +FE ++EKD+V+WN MI+SY Q  LG  A+  Y  

             M   GV  DEFT GSLL++S  +   EM+ + +IK GL  KIE+SNA++SA+ K G+IE+

             A   F     +NLISWNAIISG   NGFP + L  FS LL     + P+AYTLST+LS C

                 S   G Q H Y+L+ G F ET IGN LI +YS+CG +  S  VF  M+E+DVVSWN


              +G+   V+HFSC+VD+L RAG+LDEAE +VK   K I     VWW LFS+ AAHGD +L

             G++VA +L+E EK++P+VYV LSNIYA AG W+E+   R  +     +KQ G SW+R

>ref|XP_002875993.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52252.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/717 (52%), Positives = 489/717 (68%), Gaps = 6/717 (1%)
 Frame = +3

             L+ LN  L   TR  +  +AL LF  +H    LRPD Y++S  +TA   ++ T+FG Q+H

              + +R+GL   SHVSN LLS YA+  +L  +KR F EI  PDVYSWTTLLSA  KLG++E

             YA +VFD+M  RD VAVWNA+ITGC E      ++ LF++MH LGV HD + FA+VLS+C

                    G+QVHS+V+K GF   +SV+NAL+TMYFNC+ VVDA  VFE+AD  V DQ+T+

             N +I GL   +R EE+L++F  M    L PT LTFVS+MSSCS      Q+H L +K G+

              + T VSN+ MTMYS+ +D  A   +FE ++EKD+++WN MI+ Y Q NLG  A+L Y  

             M   GV  DEFT GSLL+SS  +   EM+ + VIK GL  KIE+SNA++SA+ K G+I +

             A   F     +NLISWNAIISG   NGF  + L  FS LL AE L  P+AYTLS +LS C

               I S   G+Q H Y L+ G F ET IGN  I +YS+CG L  S  VF  M+++D VSWN


              +G+ P V+HFSC+VD+L RAG+LDEAE +VK   K I     VWW LFS+ AAHGD +L

             G++VA +L+E EKN+P+VYV LSNIYA AG W+E+   R+ +     +KQ G SW+R

>ref|XP_010515337.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Camelina sativa]

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/719 (52%), Positives = 486/719 (68%), Gaps = 8/719 (1%)
 Frame = +3

             L+ LN  L   TR  +  +AL LF  +H    LRPD Y++S  +TA   ++ T FG Q+H

             ++  R+GL   SHVSN LLS YA+  +L  +K+ F EI+ PDVYSWTTLLSAC KLG++E

             YA +VFD+M  R DVAVWNA+ITGC E      ++ LFQ+MH +GV HD + FA+VLS+C

                    G+QVHS+V+K GFL  +SV+NAL+TMYFNC+ V +AC VFE+AD  V DQ+T+

             N +I GL   +R EE+  +F  M    L PT L+FVS+MSSCS      Q+H L +K G+

              D T V+NA MTM S+ +D  A   +FE ++EKD+V+WN MI+SY Q  L   A+  Y  

             MQR GV  DEFT GSLL++S  +   EM+ + + K GL  KIE+SNA++SA+ K G+IE+

             A   F     +NLISWNAIISG   NG P + L  F  LL     + P+AYTLST+LS C

               I S   G Q H Y+L+ G F ET+ IGN LI +YS+CG +  S  VF  M+E D+VSW


               +G I P V+HFSC+VD+L RAG+LDEAE +VK   K+I     VWW LFS+ AAHGD 

             +LG++VA +L+E EKN+P+VYV LSNIYA AG W+E+   RE M     +KQ   SW+R

>ref|XP_009136519.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Brassica rapa]

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/685 (53%), Positives = 477/685 (70%), Gaps = 18/685 (3%)
 Frame = +3

             +PD YTLS+ +TA + ++ T  VFGAQLH++ +R+GL   SHVSN LLS YA+S  L  +

             K +F EI+ PDVYSWTTLLSA  KLG+++YA +VFD+M  RD  A+WNA+ITGC E    

               ++ LF++MH +GV HD + FA+VLS+CSL     G QVHS+VVK GFL+ +SV+NA++

             TMYFN + V DAC VFE+A   V DQ+T+N +I GL  ++R E +L++F  M    L PT

              LTFVS+MSSCS      Q+H L VK G+ D T VSN+ M+MYS+ +DL A R +FE ++

             E+D+V+WN MI+ Y Q  LG  A+L Y  M R GV  DEFT GSLL+SS  +   EM+ +

              VIK GL  K EVSNA++S + K G I +A   F     +NLISWNAIISGC  NGFP +

              L  FS LL   +   P+AYTLST+LS C  I S   GKQ H Y+++ G F ET I N L

             + +YS+CG +  S +VF  M+E+DVVSWNS+ISAYA+HG+G  AV  ++ M + G+V+ D


             K     VD+   W LFS+ AAHGD +LG++VA +++E EK++P +VYV LSNIYA AG W

             +E+   RE M      KQ G SW+R

>ref|XP_002530609.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
 gb|EEF31789.1| pentatricopeptide repeat-containing protein, putative [Ricinus 

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/609 (54%), Positives = 418/609 (69%), Gaps = 11/609 (2%)
 Frame = +3

             + L+KLN  LA  T   Q+  ALHL        + L+PDHYTLST LTACA++  T FG 

             +LHA+ +++ L T++HV+N LLS YAK++++  VK +F E ++PDVYS+ TL+SAC KLG

              V+YA  +FD M +RDV VWNA+ITGC E  ++E+ LN F+ M   GV HDNY+ ASVLS

              C L +   G QVHS+V+K+G L   SVINAL+TMYFNC++V+D   VFE+A+D V DQI

             TYN MI GLVS+ R EEAL++   M    L P  LTFVSLMSSC       Q HA  +K 


             LEM+R G   DEFT GSLL+SS+ +   EMI +LV +N LI  I+VSNA+ SA+ K G +

             EQ+Y+ F DM  R+LISWN+IISG   NG P+  L  FSEL       N YTL+ +LS C

             A IP+   GKQ+HGYI++ G   E S+GN LI  Y+KCG++ WS+RVF  + ++D VSWN

             ++ISAYAQHGKG EA++ FE M  S  V+PD ATF  VLSACSHA          N+M+ 

Query  1914  N--YGIKPG  1934
             N   GI+ G
Sbjct  619   NCLIGIRKG  627

>ref|XP_008809853.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Phoenix dactylifera]

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/560 (53%), Positives = 396/560 (71%), Gaps = 6/560 (1%)
 Frame = +3


             F+C  V+DAC VF +A   V D+ITYNA IAGLV   R+ EALM+F  +R   +L+PT L

             TF S++S+C      TQ+HA V++ G      V+NA +TMYSN  DL + +  FE + EK

             DIVSWNA+I+ Y+QEN    A+    +MQ+ G+  DEFT GSLL+ S+  A+ +MI +LV

             IKNG I  IEV NA +SA+ K G+I  +Y+ F +M  RN+ISWN+IISG   +GF ++ L

              +FS L+   L PN+YTLSTVLS CA + + +HGK++H Y L+  +  +T + N+LI +Y

              KCG L +S++VF  M +RD+VSWN++I+AYAQ+G G EA+H F+ M  SG + PD  TF


               VD  +WW L S+ + HG+ RLGRI A  LLETE  NP +YVLLSNI A  GKWEE++S

             VR+ MQ+  V K+PG SW+ 

 Score =   185 bits (470),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 149/579 (26%), Positives = 279/579 (48%), Gaps = 49/579 (8%)
 Frame = +3

             D YT ++V+  C S +    G QLH+  ++ G+        N L++ Y      CG+   

                           ++ AC          +VF +   RD   +NA I G      D  AL
Sbjct  66    --------------VIDAC----------EVFGEAVVRDEITYNAFIAGLVRWGRDVEAL  101

              +F+++     +     TFASVLS C S E   +G QVH+ V++ G  A+  V NA+VTM

             Y N   +V A   FE  +++  D +++NA+I+G       E A+ + + M+   + P   

             T+ SL++          I ALV+K GF     V NA ++ Y+ C D+ ++  +F  +  +

             +I+SWN++I+ Y       + +  +  + +  ++ + +TL ++LS+  +++   + + + 

             +  +++  I    + N++++ + K GE++ + + F  M  R+++SWNAII+    NG   

             ++++ F  +   G+ P+  T ++VLSAC+     + G+ I   +++ +G        + +

             I L  + G L  + R+   M  R D   W  ++SA + HG         + ++++   EP

             +  T   +LS  + A G  E+   + + M  N    KPG

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/332 (24%), Positives = 143/332 (43%), Gaps = 81/332 (24%)
 Frame = +3

             P   T ++VL+AC S +    G Q+HA  +R GL     V+N +++ Y+   DL   +  

Query  399   -----------------------------RLFSEIQS----PDVYSWTTLL---------  452
                                          R+  ++Q     PD +++ +LL         

Query  453   -----------------------SACTKLGEVEYALQVFDQMSRRDVAVWNAIITGCAEI  563
                                    SA  K G++  + QVF++M  R++  WN+II+G    

                   L +F  +    +  ++YT ++VLS C ++     G++VH+  ++   +  T ++

             N+L+TMY  C  +  +  VF        D +++NA+IA         EA+  F  M+   

             ++P  +TF S++S+CS        HA +V++G
Sbjct  410   IIPDNVTFTSVLSACS--------HAGLVEEG  433

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 81/172 (47%), Gaps = 41/172 (24%)
 Frame = +3

            P+ YTLSTVL+ CA++     G ++HA+ LR      + + N L++ Y K          

                                  GE++Y+ +VF+ M +RD+  WNAII   A+  D   A+

            + F+ M   G+  DN TF SVLS CS          H+ +V+ G    TS++

>ref|XP_010507359.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Camelina sativa]

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/627 (51%), Positives = 425/627 (68%), Gaps = 9/627 (1%)
 Frame = +3

             L+ LN  L   TR  +  +AL LF  +H    LRPD Y++S  +TA   ++ T FG Q+H

             ++ +R+GL   SHVSN LLS YA+  +L  +K+ F EI+ PDVYSWTTLLSAC KLG++E

             YA +VFD+M  RD VAVWNA+ITGC E      +  LFQ+MH LGVSHD + FA+VLS+C

                    G+QVH +V+K GFL  +SV+NAL+TMYFNC+ V +AC VFE+AD  V DQ+T+

             N +I GL   +R EE+L +F  M    L PT L+FVS+MSSCS      Q+H L +K G+

              D T V+N+ MTMYS+ ++  A   +F+ ++EKD+V+WN MI+SY Q  LG  A+  Y  

             M R GV  DEFT GSLL++S  +   EM+ + +IK GL  KIE+SNA++SA+ K+G+IE+

             A   F     +NLISWNAIISG   NGFP + L  FS LL     + P+AYTLST+LS C

               I S   G Q H Y+L+ G   ET+ IGN LI +YS+CG +  S  VF  M+E+DVVSW


              ++G+   V + + ++D L  AG+  E

 Score =   300 bits (769),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 193/521 (37%), Positives = 280/521 (54%), Gaps = 77/521 (15%)
 Frame = +3

             PD YTLST+L+ C SI   + G+Q HA+ LR G +   + + NGL++ Y++    CG   

                                      ++ +L+VF+QMS +DV  WN++I+  A   + E A
Sbjct  541   -------------------------IQKSLEVFNQMSEKDVVSWNSLISAYARHGEGESA  575

             +  ++ M   G V  D  TF +VLS CS          HS +V+ G     S++ +   +

               N   V+D                       GL   +R EE+L +F  M    L PT L
Sbjct  626   VPNXNVVID-----------------------GLAGFKR-EESLSVFKQMLEAGLRPTDL  661

             +FVS+MSSCS      Q+H L +K G+ D T V+N+ MTMYS+ ++  A   +F+ ++EK

             D+V+WN MI+SY Q  LG  A+  Y  M R GV  DEFT GSLL++S  +   EM+ + +

             IK GL  KIE+SNA++SA+ K+G+IE+A   F     +NLISWNAIISG   NGFP + L

               FS LL     + P+AYTLST+LS C  I S   G Q H Y+L+ G   ET++   ++ 

             L  + G L  +  + +I +E+ + S    W ++ SA A HG

 Score =   263 bits (672),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 189/758 (25%), Positives = 358/758 (47%), Gaps = 125/758 (16%)
 Frame = +3

             RP   +  +V+++C+ +     G Q+H   ++ G   ++ V+N  ++ Y+  ++   V +

                                            VFD +  +D+  WN +I+   +    E A
Sbjct  345   -------------------------------VFDSLEEKDLVTWNTMISSYNQAKLGESA  373

             ++++++MH +GV  D +TF S+L+  SL+L  L   V + ++K G  +   + NAL++ Y

                  +  A  +FE +  +  + I++NA+I+G        E L  F+ +    + ++P  

Query  936   LTFVSLMSSC---SDPMTATQIHALVVKQG---------------FGDCTSVS-------  1040
              T  +L+S C   S  +  +Q HA V++ G               +  C ++        

Query  1041  ----------NAAMTMYSNCQDLKATRLIFERIKEKDIVS--------------------  1130
                       N+ ++ Y+   + ++  L ++ ++++  V                     

                  +N+M+ S+           + L G    E++  + +M   G+   + +  S++SS

                V     +  L IK G      V+N+ ++ +    E +  ++ F  +  ++L++WN +

             IS          +++++  +   G+  + +T  ++L+    + + +    +   I+KFG 

               +  I N LI+ YSK G +  +  +F+   +++++SWN++IS +  +G   E +  F  

             +++S  R+ PD  T + +LS C     V     I  S  + Y ++ G ++  + IVD+L 

             RAG+LDEAE +VK   K+I     VWW LFS+ AAHGD +LG++VA +L+E EKN+P+VY

             V LSNIYA AG W+E+   RE M     +KQ G SW+R

>gb|KFK34245.1| hypothetical protein AALP_AA5G119900 [Arabis alpina]

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/726 (44%), Positives = 433/726 (60%), Gaps = 79/726 (11%)
 Frame = +3

             L+ I +NL   L+ +N  L  FTR  ++ +AL LF  +H    LRPD YT+S+ +TA   

             ++ T+FG Q+H + +R+G+   SHVSN LLS YA+  +L  +K+ F              

                    GE++            DV  W  +++   ++ D E A  +F KM       D+

                        + +W                      NA++T    C     +  +F + 
Sbjct  155   -----------VAIW----------------------NAMITGCKECGYHGTSVELFRE-  180

                 + ++TYN +I GL   +R EE+L++F  M    L PT LTFVS+MSSCS      Q

             +H L +K G+ + T VSN+ MTMYS+ +D  A R +FE +KEKD+V+WN MI+ Y Q  L

             G  A+  Y +MQR GV  DEFT GSLL+SS  +   EM+   VI  GL  K+E+SNA++S

             A+ K GEI +A   F     +NLISWNAIISG   NG+P + L  FS LL   +   P+A

             YTLST+LS C  I S   GKQ H Y+L+ G F ET IGN LI +YS+CG L  S  VF  


             G++IFNSMV  +G+ P V+HFSC+VD+L RAGYL EAE +VK   K+I     VWW LFS

             + AAHGD +LG++VA +L+E EKN+P++YV L+NIYA AG W+E+   RE M     +KQ

Query  2238  PGSSWV  2255
              G SW+
Sbjct  656   RGCSWM  661

>ref|XP_007208178.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica]
 gb|EMJ09377.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica]

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/595 (48%), Positives = 382/595 (64%), Gaps = 36/595 (6%)
 Frame = +3

             AL LF Q + S  V  D+YT ++ ++ C+       G Q+H+  ++TG  A   V N L+

Query  753   TMYFNCKSVVDACWVFEDADDEVVDQIT------------------------------YN  842
             ++Y   + +    WVF++ ++  V   T                              +N

             AMI G       E A+ +F  M  + +M    +F S++SSC+        A  IHA  +K

              GF   TSVSNAA+TMYS C DL A  L+F+ ++EKD++SWN MI++Y+Q N    AIL 

             YL+MQR  V  DEFT GSLL+SS+     + + +L  K+GLIL I+VSNA+VSA+ K G 

             +  AY+ F D+  +NLISWNAIISG   NG   + L  FS+LL     P+  TL+++LS 

             CA I + + GKQ+HGYILKFG   +  + N LI +Y+KCG++ WS RVF  M ++D VSW




 Score =   335 bits (859),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 212/568 (37%), Positives = 327/568 (58%), Gaps = 19/568 (3%)
 Frame = +3

             I +  GE ++KLN  LA  TR   +  AL LF  I SS  +RPDHYTLS  +TACA+ + 


             CTKLG V+YA ++FD M  +R+V +WNA+ITGCAE   +EVA+ LF +MH +GV HDNY+

             FASVLS C+LE  GL  +V    H+  +K GF A TSV NA +TMY  C  +  A  VF+

               +++  D I++N MI+       ++ A++++  M+   + P   TF SL++S     T 

               + AL  K G      VSNA ++ Y+   ++     +FE I  K+++SWNA+I+ +   

              L  E ++ + ++       D  TL S+LS   S++   + + +   ++K G   ++ + 

             NA+++ + K G I+ + R F  M  ++ +SWN++IS    +G   +++  F  +  +  +

              P+  T + VLSAC+       G +I +  I  +G   +    + ++ L  + G L  + 

              V     I T  ++  W ++IS+ A HG

>gb|KHN07819.1| Pentatricopeptide repeat-containing protein [Glycine soja]

 Score =   455 bits (1170),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 225/418 (54%), Positives = 299/418 (72%), Gaps = 2/418 (0%)
 Frame = +3

             F C  VVDAC VFE+A++    D  TYNAMI G  S ER+E+A +MF  M+     PT +

             TFVS+MSSC       Q  A  +K GF  C +V+NA MTMYS   ++   + IFE ++E+

             D+VSWN M++++ QENL  EA+L+YL+M+REG+  DEFT GSLL +S S+   EMI SL+

              K GL+ KIEV NA+VSA+C+ G I++A++ F  + ++NLISWN I+SG   NG P+Q L

               FS LL+  + PN+Y+LS VLS C+ + +  HGKQ+HGYIL+ G   E S+GN L+ +Y



 Score =   143 bits (361),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 114/423 (27%), Positives = 207/423 (49%), Gaps = 19/423 (4%)
 Frame = +3

             K G V  A +VF++       D   +NA+I G A  +  E A  +F+ M          T

             F SV+S C L L   G Q  +  +K GF+   +V NA++TMY     V +   +FE  ++

                D +++N M++  +     EEA++ +  MR   + P   T+ SL+ +         IH

             +L+ K G      V NA ++ Y    ++K    IF  +  K+++SWN +++ +       

              G E   A L +Q   V  + ++L    S+ SS  +V++ + +   ++++G   ++ + N

             A+V+ + K G +++A R F  M  R+ ISWNA+IS    +G   ++++ F  +  + G+ 

             P+  T ++VLSAC+       G  I   ++K   F+ +    + ++ L  + G L  + R

Query  1692  VFQ  1700
             V +
Sbjct  430   VIK  432

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 104/404 (26%), Positives = 190/404 (47%), Gaps = 57/404 (14%)
 Frame = +3

             P   T  +V+++C S++    G Q  A  ++ G      V+N +++ Y            

                                +  GEV     +F+ M  RDV  WN +++   + + +E A+

               + KM   G+  D +T+ S+L    SL  +E+      +HS++ K G L    V+NALV

             + Y    ++  A  +F     +  + I++N +++G +      + L  F+ + +I + P 

               +   ++S CS  M+A     Q+H  +++ GF    S+ NA +TMY+ C  L     +F

             + + E+D +SWNAMI++YAQ   G EA+  +  MQ   G+  D+ T  S+LS+      V

              +   IL  ++K  G +  ++  + IV    + G +++A R  +

 Score = 72.0 bits (175),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 89/183 (49%), Gaps = 17/183 (9%)
 Frame = +3

            +P+ Y+LS VL+ C+S+     G Q+H + LR G  +   + N L++ YAK   L    R

            +F  +   D  SW  ++SA  + G+ E A+  F+ M      + D A + ++++ C+   

             +DD    L+   K++    S D+++       C ++L G    +     V+K+G+    

Query  732  SVI  740
            S I
Sbjct  440  SNI  442

>ref|XP_006575994.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740-like 
[Glycine max]

 Score =   455 bits (1170),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 225/418 (54%), Positives = 299/418 (72%), Gaps = 2/418 (0%)
 Frame = +3

             F C  VVDAC VFE+A++    D  TYNAMI G  S ER+E+A +MF  M+     PT +

             TFVS+MSSC       Q  A  +K GF  C +V+NA MTMYS   ++   + IFE ++E+

             D+VSWN M++++ QENL  EA+L+YL+M+REG+  DEFT GSLL +S S+   EMI SL+

              K GL+ KIEV NA+VSA+C+ G I++A++ F  + ++NLISWN I+SG   NG P+Q L

               FS LL+  + PN+Y+LS VLS C+ + +  HGKQ+HGYIL+ G   E S+GN L+ +Y



 Score =   143 bits (361),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 114/423 (27%), Positives = 207/423 (49%), Gaps = 19/423 (4%)
 Frame = +3

             K G V  A +VF++       D   +NA+I G A  +  E A  +F+ M          T

             F SV+S C L L   G Q  +  +K GF+   +V NA++TMY     V +   +FE  ++

                D +++N M++  +     EEA++ +  MR   + P   T+ SL+ +         IH

             +L+ K G      V NA ++ Y    ++K    IF  +  K+++SWN +++ +       

              G E   A L +Q   V  + ++L    S+ SS  +V++ + +   ++++G   ++ + N

             A+V+ + K G +++A R F  M  R+ ISWNA+IS    +G   ++++ F  +  + G+ 

             P+  T ++VLSAC+       G  I   ++K   F+ +    + ++ L  + G L  + R

Query  1692  VFQ  1700
             V +
Sbjct  430   VIK  432

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 104/404 (26%), Positives = 190/404 (47%), Gaps = 57/404 (14%)
 Frame = +3

             P   T  +V+++C S++    G Q  A  ++ G      V+N +++ Y            

                                +  GEV     +F+ M  RDV  WN +++   + + +E A+

               + KM   G+  D +T+ S+L    SL  +E+      +HS++ K G L    V+NALV

             + Y    ++  A  +F     +  + I++N +++G +      + L  F+ + +I + P 

               +   ++S CS  M+A     Q+H  +++ GF    S+ NA +TMY+ C  L     +F

             + + E+D +SWNAMI++YAQ   G EA+  +  MQ   G+  D+ T  S+LS+      V

              +   IL  ++K  G +  ++  + IV    + G +++A R  +

 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 89/183 (49%), Gaps = 17/183 (9%)
 Frame = +3

            +P+ Y+LS VL+ C+S+     G Q+H + LR G  +   + N L++ YAK   L    R

            +F  +   D  SW  ++SA  + G+ E A+  F+ M      + D A + ++++ C+   

             +DD    L+   K++    S D+++       C ++L G    +     V+K+G+    

Query  732  SVI  740
            S I
Sbjct  440  SNI  442

>ref|XP_001774871.1| predicted protein [Physcomitrella patens]
 gb|EDQ60283.1| predicted protein [Physcomitrella patens]

 Score =   439 bits (1130),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 246/685 (36%), Positives = 378/685 (55%), Gaps = 41/685 (6%)
 Frame = +3

             PD  T+ + L++C S     +G ++H   ++AGL     V+N +L+ YAK          

                                   G +E A +VFD+M ++ V  W   I G A+    E A 
Sbjct  175   ----------------------GSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAF  212

              +FQKM   GV  +  T+ SVL +  S      G+ VHS ++  G  + T+V  ALV MY

               C S  D   VFE   +   D I +N MI GL      EEA  ++N M+   +MP  +T

             +V L+++C +        +IH+ V K GF     V NA ++MYS C  +K  RL+F+++ 

              KD++SW AMI   A+   G EA+  Y EMQ+ GV  +  T  S+L++  S A  E    

             I   V++ GL     V N +V+ +   G ++ A + F  M  R+++++NA+I G  ++  

               ++L LF  L  EGL P+  T   +L+ACA   S +  ++IH  + K G F +TS+GN 

             L++ Y+KCG    ++ VF+ MT+R+V+SWN++I   AQHG+G +A+  FE M   G V+P

             D  TF  +LSACSHAGL+E+G + F SM  ++ I P +EH+ C+VD+L RAG LDEAE +

             +KT   + ++ +W  L  +   HG+  +    A   L+ + +N  VYV LS++YA AG W

             + +A +R+LM++  V K+PG SW++

 Score =   233 bits (594),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 151/561 (27%), Positives = 280/561 (50%), Gaps = 15/561 (3%)
 Frame = +3

             + + A+++ Q +   G   ++  +  +L  C +E+  L  GRQVH  +++   +     +

             NAL+ MY  C S+ +A  V++          ++NAM+ G +     E+AL +   M+   

             L P   T +S +SSC  P       +IH   ++ G      V+N  + MY+ C  ++  R

              +F+++++K +VSW   I  YA       A   + +M++EGVV +  T  S+L   SS  

             ++   + + S ++  G      V  A+V  + K G  +   + F  +  R+LI+WN +I 

             G    G+  ++  +++++  EG+ PN  T   +L+AC    +   GK+IH  + K G   

             +  + N LI++YS+CG +  +  VF  M  +DV+SW +MI   A+ G G EA+  ++ M 

              +G VEP++ T+T +L+ACS    +E G +I   +V   G+       + +V++ S  G 

             + +A ++   + I+ D   +  +    AAH  G   L ++   +  E  K +   Y+ + 

             N  A++G  E +  +  L+++

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 84/188 (45%), Gaps = 19/188 (10%)
 Frame = +3

            +PD  T   +L ACA+     +  ++H    + G  + + V N L+S YAK         

            +F ++   +V SW  ++    + G  + ALQ+F++M     + D+  + ++++ C+    

             E     F  M     S D   FA + ++    C ++L G   Q+    +++    F A 

Query  729  TSVINALV  752
            T +  AL+
Sbjct  699  TRIWGALL  706

>ref|XP_010661558.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
 ref|XP_010661559.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
 ref|XP_010661560.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]

 Score =   435 bits (1118),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 244/681 (36%), Positives = 377/681 (55%), Gaps = 11/681 (2%)
 Frame = +3

             YT S     C  ++HT     +  F    G    S  SN +LS  +K   +   ++LF  

             +   D  SW T++ A    G +  A ++F +   R    W+++I+G      D  AL LF

              +M   G   + +T+ SVL +CS+  L   G+Q+H+  +KT F +   V+  LV MY  C

             K +++A ++FE A D+  + + + AM+ G        +A+  F  MR   +     TF S

             ++++C          Q+H  +V+ GFG    V +A + MYS C DL   R + E ++  D

              VSWN+MI    ++ LG EA+  +  M    +  DEFT  S+L   S    + NA  + S

             L++K G      V+NA+V  + K G  + A+  F  M  +++ISW ++++GC  NG   +

             +L LF E+   G+ P+   ++ VLSACA +   + GKQ+H   LK G     S+ N+L++

             +Y+KCG +  + +VF  M  +DV++W ++I  YAQ+G+G E+++ +  M+ SG V+PD  

             TF G+L ACSHAGLVE G   F SM   YGIKPG EH++C++D+L R+G L EA+E++  

               ++ D+TVW  L ++   HG+  LG   A  L E E  N   YVLLSN+Y+ AGKWEE+

             A  R LM+   V K+PG SW+

 Score =   159 bits (402),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 124/456 (27%), Positives = 208/456 (46%), Gaps = 47/456 (10%)
 Frame = +3

             + +T  ++LTAC SI    FGAQ+H   +R+G      V + L+  Y+K  DL   +R+ 

               ++  D  SW +++  C + G                                 E AL+
Sbjct  299   ETMEVDDPVSWNSMIVGCVRQGL-------------------------------GEEALS  327

             LF+ MH   +  D +T+ SVL+  S  +       VHS++VKTGF A   V NALV MY 

                    A  VFE   D+  D I++ +++ G V     EEAL +F  MR + + P  +  

              +++S+C++        Q+HA  +K G G   SV N+ ++MY+ C  ++    +F+ ++ 

             +D+++W A+I  YAQ   G E++  Y +M   GV  D  T   LL +       E     

               S+    G+    E    ++    + G++ +A      M  + +   W A+++ C+ +G

                   ++ N   EL  +   P  Y L + L + AG

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 71/149 (48%), Gaps = 5/149 (3%)
 Frame = +3

            PD   ++ VL+ACA +    FG Q+HA  L++GL +   V N L+S YAK   +    ++

            F  ++  DV +WT L+    + G    +L  ++ M     + D   +  ++  C+     

            E   + FQ M  + G+      +A ++ L

>ref|XP_010255496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nelumbo nucifera]

 Score =   431 bits (1107),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 232/681 (34%), Positives = 388/681 (57%), Gaps = 12/681 (2%)
 Frame = +3

             L + L +C    H +   Q   F L +   +F    VSN LL   +KS  +   ++LF +

             +   D +SW T++SA  +LG +  A Q+FDQ   +    W+A+I+G A   D   AL LF

              +M S G+  + YT  SVL  CS+  +   G Q+H+  +KT F     V+  LV MY  C

             + ++DA ++F    D+  + + + AM+ G         A+  F  MR   +     TF S

             ++++C+  +      Q+H  +++ GFG    V +A + MY+ C DL + R + E ++ +D

             IVSWN++I    ++    EAI  + +M    +  D+FT  S+L+S  SV +   A+ +  

             L++K G      VSNA++  + K G +  A+  F  M  ++++SW ++I+G   +GF   

             +L LF  +   G+ P+ + ++++LSACA +   + G+Q+H   ++ G     S+ N+L+ 

             +Y+KCG +  + +VF  M  RDVVSW ++I  +AQ+G+G  ++  ++ M+ +G + PD  

             TF G+L ACSHAGLVEDG + F SM + +GI PG EH++C++D+L R+G + +A+EI++ 

               I  D+TVW  + ++   HG+  LG   A  L E E  N   YVLL N+++ AG+W+++

             AS+R+LM+   + K+PG SW+

 Score =   156 bits (394),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 113/422 (27%), Positives = 197/422 (47%), Gaps = 42/422 (10%)
 Frame = +3

             R + +T  +VLTACA++    FG Q+H   +R G      V + LL  YAK  DL   +R

             +   ++  D+ SW +L+  C + G        F++ +                       
Sbjct  325   VLESMEVEDIVSWNSLIVGCVRQG--------FEREA-----------------------  353

             ++LF+KMH   +  D++T+ SVL SL S+      + VH ++VKTGF A   V NAL+ +

             Y    ++  A  VF    ++  D +++ ++I G       E AL +F +MR + + P   

                S++S+C++        Q+HA  ++ G     SV N+ +TMY+ C  ++    +F+ +

               +D+VSW A+I  +AQ   G  ++  Y +M   G+  D  T   LL +       E   

                 S+   +G+    E    ++    + G+I +A      M  R +   W A+++ C+ 

Query  1455  NG  1460
Sbjct  652   HG  653

>ref|XP_010090626.1| hypothetical protein L484_003942 [Morus notabilis]
 gb|EXB40230.1| hypothetical protein L484_003942 [Morus notabilis]

 Score =   424 bits (1091),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 220/644 (34%), Positives = 372/644 (58%), Gaps = 9/644 (1%)
 Frame = +3

             SN LL+  +KS  +   +++F ++ S D ++W T+++A +  G +  A ++F +   +  

               W+ +I+G    + +  A  LF +M   G     +T  S L LCS L L+  G Q+H  

              +KT F +   V+  LV MY  CK ++DA ++F  + +   + + + AM+ G        

             +A+  F  MR   +     TF  ++++C   S  +   Q+HA +V+ GFG    V +A +

              MYS C D  + + + E ++  D+VSWN++I    +  L  EA+  + +M+ + +  D F

             T  S+L+     + + N++ +  L+IK G    + V NA+V  + K G +  AY+ F  +

               ++++SW ++++G   NGFP +++ LF ++   G+ P+ + ++++LSACA +   + G+

             QIH    K G     S+ N L+ +Y+KCG +  + R+F  M  R+V++W ++I  YAQ+G

             +G E++  +  M+ +G ++PD  TF G+L ACSHAGL E+G   F SM   YGIKPG EH

             ++C++D+L RA  LDEAEE++    +E D+TVW TL ++   HG+  LG   A  LLE E

              +N   YVLLSN+Y+ AG+WE++A +R LM+   + K+PG SW+

 Score =   147 bits (372),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/345 (28%), Positives = 167/345 (48%), Gaps = 37/345 (11%)
 Frame = +3

             + +T   +LTACA++   +FGAQ+HA  +R+G      V + L+  Y+K  D    +R+ 

              +++  DV SW +L+  C +        ++F +                        AL 
Sbjct  295   EDMEVDDVVSWNSLIVGCVR-------CELFRE------------------------ALG  323

             LF+KM    +  D++T+ SVL+ L  ++     + VH +++KTGF A   V NALV MY 

                ++  A  +F    D+  D +++ +++ G       E+A+ +F  MR   + P     

              S++S+C+         QIHA   K G     SV NA +TMY+ C  ++    IF+ +  

             +++++W A+I  YAQ   G E++  Y +M   G+  D  T   LL

 Score =   110 bits (275),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 126/285 (44%), Gaps = 35/285 (12%)
 Frame = +3

            + ++  N L+    RC + +              ++ DH+T  +VL   A ++       

            +H   ++ G   +  V N L+  YAK  +L    ++F+ I   DV SWT+L         

                                  +TG A     E A+ LF+ M   GV  D +  AS+LS 

            C +L +   G+Q+H+   K+G  ++ SV NALVTMY  C  + +A  +F+      V  I

            T+ A+I G     R  E+L  +N M    + P  +TF+ L+ +CS

 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/149 (25%), Positives = 75/149 (50%), Gaps = 5/149 (3%)
 Frame = +3

            PD + ++++L+ACA++    FG Q+HA   ++GL +   V N L++ YAK   +    R+

            F  + + +V +WT L+    + G    +L+ ++QM       D   +  ++  C+    +

            E   + F+ M  + G+      +A ++ L

>ref|XP_008805366.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Phoenix dactylifera]
 ref|XP_008805367.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Phoenix dactylifera]

 Score =   427 bits (1099),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 243/684 (36%), Positives = 370/684 (54%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y LS+VL+AC    H   G Q+HA  ++ G ++ + V N L++ Y++    CG  R+

               EI                           F +M   D   +N +I+G A+  + E A+
Sbjct  367   AEEI---------------------------FSEMPNHDGVTYNTLISGHAQNGNSESAI  399

              +F++M   G   D+ T AS+L+ C S+     G+Q+HS V KTG  +   +  +L+ +Y

               C ++  A   F   D E V  + +N M+     M    ++  +F  M+   + P   T

             + S++ +C+         QIH L +K GF     VS+  + MYS C  LK+ R I ER+ 

             EKD+VSW AMI  YAQ  L  EA+  + EMQ  G+  D   L S +S+   +   E  L 

             +  +   +G    I V NA+++ + + G IE+AY     +  ++ ISWN +ISG   +G 

               ++L +F ++  EG+  +++T  + +SA A +   + GKQIH  I+K G   E  + N 

             L++LY+KCG +  +   F  M+ R+ VSWN+MI+ Y+QHG G EA+  FE M     ++P

             +  TF GVL+ACSH GLV +G+  F SM   +GI P  EH++C+VDIL RAG LD A E 

             ++   I  D+ VW TL S+   H +  +G + A  LLE E ++ A YVLLSN+YA AGKW

              +   VR++M+  RV K+PG SW+

 Score =   264 bits (674),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 179/602 (30%), Positives = 296/602 (49%), Gaps = 23/602 (4%)
 Frame = +3

             G+RA  +T++ + +  L+    S  L   KR+  +I        T L    + A    GE

                A+ +FD M+ R VA WN +I   ++  +  + L  F +M       +   FA+ L  

             C  +   W L +Q+H+ +++ GF     V N L+ +Y     V  A  VFE+   +  D 

             +++ AM++G        EAL +++ M    ++PT     S++S+C+         QIHA 

             V+KQGF   T V NA +T+YS C  L+    IF  +   D V++N +I+ +AQ      A

             I  + EMQ  G   D  T+ SLL++  S+ +    + + S V K GL  +  +  +++  

             + K   IE A  +F      N++ WN ++      G   +S +LF ++  EG+ PN YT 

              ++L  C  + +   G+QIH   +K G  L   + + LI +YSKCG L  +  + + +TE

             +DVVSW +MI+ YAQH    EA+  FE M   G + PD       +SAC+    +E G+Q

             I   + ++ Y     V   + ++++ +R G ++EA   ++T  ++ D   W  L S  A 

Query  2070  HG  2075
Sbjct  695   SG  696

 Score =   248 bits (634),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 164/599 (27%), Positives = 293/599 (49%), Gaps = 43/599 (7%)
 Frame = +3

             P+    +  L AC  + ++     Q+HA  +R G      V N L+  YAK+        

                                    G V+ A  VF+++  +D   W A+++G ++      A
Sbjct  261   -----------------------GYVDLARLVFEELYSKDNVSWVAMVSGFSQNGLGAEA  297

             L+L+ +MH  G+    Y  +SVLS C+  + +  G+Q+H+ V+K GF + T V NALVT+

             Y  C S+  A  +F +  +   D +TYN +I+G      +E A+ +F  M+     P  +

             T  SL+++C+   D     Q+H+ V K G      +  + + +Y  C  ++     F   

               +++V WN M+ +Y Q     ++   + +MQ EGV  +++T  S+L +   V      E

              I +L IK G  L + VS+ ++  + K G+++ A      +  ++++SW A+I+G   + 

               +++L  F E+   G+ P+   L++ +SACAGI + + G QIH      G   + S+GN

              LI LY++CG +  +    + +  +D +SWN +IS  AQ G   EA+  F  M   G V+

                 TF   +SA ++   ++ G QI   ++   G    +E  + +V + ++ G +++A+

 Score =   237 bits (604),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 158/528 (30%), Positives = 256/528 (48%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++LTACASI     G QLH++  + GL++   +   LL  Y K    C    

                                      +E AL+ F+   R +V +WN ++    ++ +   +
Sbjct  465   -------------------------IETALEFFNTTDRENVVLWNVMLVAYGQMGNLRKS  499

              +LF +M   GV  + YT+ S+L  C+ +    LG Q+H++ +KTGF     V + L+ M

             Y  C  +  A  + E   ++  D +++ AMIAG    E   EAL  F  M+   + P  +

                S +S+C+         QIHA     G+    SV NA + +Y+ C  ++      E +

             + KD +SWN +I+  AQ     EA+  +L+M REGV A  FT GS +S+S ++A+    +

              I + +IK G   +IEVSNA+VS + K G IE A   F  M  RN +SWNA+I+G   +G

                ++L LF ++  E L PN  T   VL+AC+       G+  F+     HG + +   +

                     ++ +  + G L  +    + M    D + W +++SA   H

 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 94/207 (45%), Gaps = 3/207 (1%)
 Frame = +3

             G P      F  L+ E G+  +  T +++L  C    S  + K+IHG ILK G   ET +

              N LI  Y   G    +  +F  M  R V SWN+MI  ++Q  +    +  F  M+   R

              +P+   F   L AC+        +Q  ++ +  YG +      + ++D+ ++ GY+D A

               +V  +    D+  W  + S  + +G

>gb|AEB39779.1| pentatricopeptide repeat protein 98 [Funaria hygrometrica]

 Score =   424 bits (1091),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 246/714 (34%), Positives = 377/714 (53%), Gaps = 43/714 (6%)
 Frame = +3

             N LL  + + R+ Y      H       ++PD YT   +L ACA  ++   G +L +  L

              AG  T                               D++  T L++   K G V+ AL+
Sbjct  233   NAGWDT-------------------------------DLFVGTALINMHIKCGGVDDALK  261

             VF+ + RRD+  W ++ITG A     + A NLFQ M   GV  D   F S+L  C+  E 

                G++VH+ + + G      V  AL++MY  C S+ DA  VF       V  +++ AMI

             AG     R EEA + FN M    + P  +TF+S++ +CS P       QIH  ++K G+ 

                 V  A ++MY+ C  L   R +FERI ++++V+WNAMIT+Y Q      A+  +  +

              +EG+  D  T  S+L+  +S    E+   + SL+I+ G    + + NA+VS F   G++

               A   F DM  R+L+SWN II+G   +G    + + F  +   G+ P+  T + +L+AC

             A   +   G+++H  I +     +  +G  LI++Y+KCG +  +  VF  + +++V SW 

             SMI+ YAQHG+G EA+  F  M   G V+PD  TF G LSAC+HAGL+++G+  F SM  

             ++ I+P +EH+ C+VD+  RAG L EA E +    ++ DS +W  L  +   H D  L  

              VA   LE + N+  VYV+LSNIYA AG W+E   +R++M    V+K+PG SW+

 Score =   270 bits (689),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 171/589 (29%), Positives = 302/589 (51%), Gaps = 24/589 (4%)
 Frame = +3

             LL    K ++L   +R+     FS+IQ PD++ W  L+S   K G    A Q+FD+M  +

             DV  WN ++ G  +    E A  L ++M   GV  D YTF  +L+ C+  +    G ++ 

             S+++  G+     V  AL+ M+  C  V DA  VF +      D IT+ +MI GL    +

              ++A  +F  M    + P  + FVSL+ +C+ P    Q   +HA + + G      V  A

              ++MY+ C  ++    +F  +K +++VSW AMI  +AQ     EA L + +M   G+  +

               T  S+L   S   ++     I   +IK G I    V  A++S + K G +  A   F 

              +  +N+++WNA+I+    +     ++  F  LL EG+ P++ T +++L+ C    + + 

             GK +   I++ G   +  I N L++++  CG L  +  +F  M ERD+VSWN++I+ + Q

             HG+   A   F+ M +SG V+PD+ TFTG+L+AC+    + +G ++ ++++    +   V

                + ++ + ++ G +D+A  +   +  KN+      W ++ +  A HG

 Score =   127 bits (319),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/331 (25%), Positives = 163/331 (49%), Gaps = 12/331 (4%)
 Frame = +3

             E +  K+    NA +   ++     EA+L  L +    +     T  SLL      +++ 

             + E I + +  + +   I + N ++S + K G    A + F +M  +++ SWN ++ G  

              +    ++  L  +++ +G+ P+ YT   +L+ACA   +   G ++   IL  G   +  

             +G  LI ++ KCG +  + +VF  +  RD+++W SMI+  A+H +  +A + F+ M + G

              V+PDK  F  +L AC+H   +E G ++   M    G+   +   + ++ + ++ G +++

             A E+   VK +N+      W  + +  A HG

>gb|AEB39776.1| pentatricopeptide repeat protein 78 [Funaria hygrometrica]

 Score =   424 bits (1090),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 241/682 (35%), Positives = 373/682 (55%), Gaps = 45/682 (7%)
 Frame = +3

             T   +L++C S      G ++H   ++A L    +V+N +L+ YAK              

                               G +  A +VFD+M  + V  W  II G A+    E+A  +FQ

             KM   GV  +  T+ +VL+  S      WG  + VHS ++  G  +  +V  ALV MY  

             C S  D   VFE   +   D I +N MI GL      EEA  +++ M+   +MP  +T+V

              L+++C +P       +IH+ VVK GF    SV NA ++MY+ C  +K  RL+F ++  K

             DI+SW AMI   A+  LG EA+  + +MQ+ G+  +  T  S+L++  S A       I 

               VI+ GL     V+N +V+ +   G ++ A + F  M  R+++++NA+I G  ++    

             ++L LF  L  EGL P+  T   +L+ACA   S +  K+IH  +LK G   +TS+GN L+

             + Y+KCG    +  VF  M +R+V+SWN++I   AQHG+G + +  FE M   G ++PD 

              TF  +LSACSHAGL+E+G + F SM  ++GI P +EH+ C+VD+L RAG LDE E ++K

             T   + ++ +W  L  +   HG+  +    A   L+ + +N AVYV LS++YA AG W+ 

             +A +R+LM++  V K+PG SW+

 Score =   238 bits (607),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 168/581 (29%), Positives = 275/581 (47%), Gaps = 47/581 (8%)
 Frame = +3

             P+  T   VL A +      +G  +H+  L AG  +   V   L+  YAK       +++

             F ++ + D+ +W T++    + G  E A +++ QM R                       
Sbjct  403   FEKLVNRDLIAWNTMIGGLAEGGNWEEASEIYHQMQRE----------------------  440

                      G+  +  T+  +L+ C +      GR++HS VVK GF+   SV NAL++MY

               C S+ DA  +F     +  D I++ AMI GL       EAL +F  M+   L P  +T

             + S++++CS P       +IH  V++ G      V+N  + MYS C  +K  R +F+R+ 

             ++DIV++NAMI  YA  NLG EA+  +  +Q EG+  D+ T  ++L   ++S S+  A+ 

             I SLV+K+G +    + NA+VS + K G    A   F  M  RN+ISWNAII GC  +G 

                 L LF  +  EG+ P+  T  ++LSAC+     + G++    + + FG         

              ++ L  + G L     + + M  + +   W +++ A   HG    A    E+   S ++

             +PD A     LS    A  + D       ++   G+  +PG

 Score =   217 bits (553),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 144/561 (26%), Positives = 275/561 (49%), Gaps = 15/561 (3%)
 Frame = +3

             I   + A+++ Q +   G   ++  +  +L  C +E+  L  GR+VH  +++   +    

              +NAL+ MY  C S+ +A  V+   +       ++NAM+ G V     EEAL +   M+ 

               L     T + L+SSC  P       +IH   +K       +V+N  + MY+ C  +  

              R +F++++ K +VSW  +I  YA       A   + +MQ+EGVV +  T  ++L   S 

               ++   + + S ++  G    + V  A+V  + K G  +   + F  +  R+LI+WN +

             I G    G   ++  ++ ++  EG+ PN  T   +L+AC    +   G++IH  ++K G 

               + S+ N LI++Y++CG +  +  +F  M  +D++SW +MI   A+ G G EA+  F+ 

             M  +G ++P++ T+T +L+ACS    ++ G +I   ++   G+       + +V++ S  

             G + +A ++   +  + D   +  +    AAH  G   L ++   +  E  K +   Y+ 

             + N  A++G  E +  +  L+

 Score =   132 bits (332),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 137/253 (54%), Gaps = 40/253 (16%)
 Frame = +3

            +P+  T +++L AC+S     +G ++H   + AGL T +HV+N L++ Y+    +C    

                                   G V+ A QVFD+M++RD+  +NA+I G A  +  + A
Sbjct  596  -----------------------GSVKDARQVFDRMTQRDIVAYNAMIGGYAAHNLGKEA  632

            L LF ++   G+  D  T+ ++L+ C    SLE W   +++HS+V+K G+L+ TS+ NAL

            V+ Y  C S  DA  VF+      V  I++NA+I G     R ++ L +F  M+   + P

Query  930  TGLTFVSLMSSCS  968
Sbjct  748  DIVTFVSLLSACS  760

 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 83/185 (45%), Gaps = 13/185 (7%)
 Frame = +3

            +PD  T   +L ACA+     +  ++H+  L+ G  + + + N L+S YAK         

            +F ++   +V SW  ++  C + G  +  LQ+F++M     + D+  + ++++ C+    

             E     F  M    G++     +      C ++L G   Q   V +++    F A T +

Query  738  INALV  752
Sbjct  820  WGALL  824

>ref|XP_001780298.1| predicted protein [Physcomitrella patens]
 gb|EDQ54857.1| predicted protein [Physcomitrella patens]

 Score =   422 bits (1084),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 236/685 (34%), Positives = 372/685 (54%), Gaps = 42/685 (6%)
 Frame = +3

             +PD  T  ++L ACA  ++   G +L+   L+AG  T                       
Sbjct  208   KPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDT-----------------------  244

                     D++  T L++   K G++  A +VFD +  RD+  W ++ITG A     + A

              NLFQ+M   GV  D   F S+L  C+  E    G++VH+ + + G+     V  A+++M

             Y  C S+ DA  VF+      V  +++ AMIAG     R +EA + FN M    + P  +

             TF+S++ +CS P       QI   +++ G+G    V  A ++MY+ C  LK    +FE+I

              ++++V+WNAMIT+Y Q      A+  +  + +EG+  +  T  S+L+   SS S+   +

              +  L++K GL   + VSNA+VS F   G++  A   F DM  R+L+SWN II+G   +G

                 + + F  +   G+ P+  T + +L+ACA   +   G+++H  I +     +  +G 

              LI++Y+KCG +  + +VF  + +++V SW SMI+ YAQHG+G EA+  F  M   G V+

             PD  TF G LSAC+HAGL+E+G+  F SM   + I+P +EH+ C+VD+  RAG L+EA E

              +    +E DS VW  L  +   H +  L    A   LE + N+  V+V+LSNIYA AG 

             W+E A +R++M    V+K+PG SW+

 Score =   221 bits (563),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/532 (25%), Positives = 276/532 (52%), Gaps = 12/532 (2%)
 Frame = +3

             +D    NA++   ++      A+ + +++ S  +     T++++L LC   +  G G ++

             ++ + K+G      + N L+ MY  C + + A  +F+D  ++  D  ++N ++ G V   

               EEA  +   M    + P   TFVS++++C+D        +++ L++K G+     V  

             A + M+  C D+     +F+ +  +D+V+W +MIT  A+     +A   +  M+ EGV  

             D+    SLL +    +++   + + + + + G   +I V  AI+S + K G +E A   F

               +  RN++SW A+I+G   +G   ++   F++++  G+ PN  T  ++L AC+   + +

              G+QI  +I++ G   +  +   L+++Y+KCG L  + RVF+ +++++VV+WN+MI+AY 

             QH +   A+  F+ ++  G ++P+ +TFT +L+ C  +  +E G  + + ++   G++  

             +   + +V +    G L  A+ +      + D   W T+ +    HG  ++ 

 Score =   197 bits (501),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 256/511 (50%), Gaps = 31/511 (6%)
 Frame = +3

             FLA +S +          ++T  F+ +     C VF D    + D    NA++  L    

             +  EA+ +   + + ++     T+ +L+  C    +     +I+  + K G      + N

               + MY+ C +  + + IF+ ++EKD+ SWN ++  Y Q  L  EA   + +M ++ V  

             D+ T  S+L++   +++V     + +L++K G    + V  A+++   K G+I  A + F

              ++ TR+L++W ++I+G   +G   Q+ NLF  +  EG+ P+     ++L AC    + +

              GK++H  + + G   E  +G  ++++Y+KCG +  +  VF ++  R+VVSW +MI+ +A

             QHG+  EA   F  M++SG +EP++ TF  +L ACS    ++ G QI + ++   YG   

              V   + ++ + ++ G L +A  + + K  + +   W  + ++   H   D  L    A 

             +L E  K N + +  + N+   +     GKW

>dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens]

 Score =   421 bits (1083),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 236/685 (34%), Positives = 372/685 (54%), Gaps = 42/685 (6%)
 Frame = +3

             +PD  T  ++L ACA  ++   G +L+   L+AG  T                       
Sbjct  208   KPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDT-----------------------  244

                     D++  T L++   K G++  A +VFD +  RD+  W ++ITG A     + A

              NLFQ+M   GV  D   F S+L  C+  E    G++VH+ + + G+     V  A+++M

             Y  C S+ DA  VF+      V  +++ AMIAG     R +EA + FN M    + P  +

             TF+S++ +CS P       QI   +++ G+G    V  A ++MY+ C  LK    +FE+I

              ++++V+WNAMIT+Y Q      A+  +  + +EG+  +  T  S+L+   SS S+   +

              +  L++K GL   + VSNA+VS F   G++  A   F DM  R+L+SWN II+G   +G

                 + + F  +   G+ P+  T + +L+ACA   +   G+++H  I +     +  +G 

              LI++Y+KCG +  + +VF  + +++V SW SMI+ YAQHG+G EA+  F  M   G V+

             PD  TF G LSAC+HAGL+E+G+  F SM   + I+P +EH+ C+VD+  RAG L+EA E

              +    +E DS VW  L  +   H +  L    A   LE + N+  V+V+LSNIYA AG 

             W+E A +R++M    V+K+PG SW+

 Score =   221 bits (564),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/532 (25%), Positives = 276/532 (52%), Gaps = 12/532 (2%)
 Frame = +3

             +D    NA++   ++      A+ + +++ S  +     T++++L LC   +  G G ++

             ++ + K+G      + N L+ MY  C + + A  +F+D  ++  D  ++N ++ G V   

               EEA  +   M    + P   TFVS++++C+D        +++ L++K G+     V  

             A + M+  C D+     +F+ +  +D+V+W +MIT  A+     +A   +  M+ EGV  

             D+    SLL +    +++   + + + + + G   +I V  AI+S + K G +E A   F

               +  RN++SW A+I+G   +G   ++   F++++  G+ PN  T  ++L AC+   + +

              G+QI  +I++ G   +  +   L+++Y+KCG L  + RVF+ +++++VV+WN+MI+AY 

             QH +   A+  F+ ++  G ++P+ +TFT +L+ C  +  +E G  + + ++   G++  

             +   + +V +    G L  A+ +      + D   W T+ +    HG  ++ 

 Score =   198 bits (504),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 256/511 (50%), Gaps = 31/511 (6%)
 Frame = +3

             FLA +S +          ++T  F+ +     C VF D    + D    NA++  L    

             +  EA+ +   + + ++     T+ +L+  C    +     +I+  + K G      + N

               + MY+ C +  + + IF+ ++EKD+ SWN ++  Y Q  L  EA   + +M ++ V  

             D+ T  S+L++   +++V     + +L++K G    + V  A+++   K G+I  A + F

              ++ TR+L++W ++I+G   +G   Q+ NLF  +  EG+ P+     ++L AC    + +

              GK++H  + + G   E  +G  ++++Y+KCG +  +  VF ++  R+VVSW +MI+ +A

             QHG+  EA   F  M++SG +EP++ TF  +L ACS    ++ G QI + ++   YG   

              V   + ++ + ++ G L +A  + + K  + +   W  + ++   H   D  L    A 

             +L E  K N + +  + N+   +     GKW

>ref|XP_009116777.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Brassica rapa]

 Score =   412 bits (1060),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 227/664 (34%), Positives = 374/664 (56%), Gaps = 20/664 (3%)
 Frame = +3

             +H+  +R+ L    H +N  L   +KS  +   ++LF ++   D Y+W T++ A +  G 

             +  A ++F +   ++   WNA+I+G C     DE AL+LF +M   G S + YT  SVL 

             +C SL L   G Q+H   VKT F +   V+N L+ MY  C+ V +A ++F+    E  + 

             +T+ +M+ G        +A+  F  MR     P   TF S++ +C          Q+H  

             +VK GF     V +A + MY+ C+DL+  R + + ++  D+VSWN+++    +E    EA

             +  +  M    +  DEFTL S+L     S ++ +  A  +  L++K G      VSNA+V

               + K G ++ A + F  M  ++++SW A+I+G   NG   ++L LF ++ AEG ++P+ 

                ++VLSA A +   + G+Q+H   +K G     S+ N+L+++Y+KCG L  +  VF  

             M  +D+++W ++I  YA++GK  +++  ++ M+D+G + PD  TF G+L ACSHAGL E+

               + F SM   Y I PG EH++C++D+  R+G   +AEE++    +E D+TVW  + ++S

               HG    G   A  L+E E NN   YVLLSN+Y+ AG+ EE+A++R LM+   + K+PG

Query  2244  SSWV  2255
Sbjct  671   CSWV  674

 Score =   141 bits (356),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 167/350 (48%), Gaps = 43/350 (12%)
 Frame = +3

             +P+ +T  +VL AC ++     G Q+H   +++G  T   V + +++ YAK +DL   + 

             L  +++  DV SW +L+  C + G  E AL +F +M  RD+ +                 

                           D +T  SVL+       E+  +   VH ++VKTG+ +   V NALV

              MY    ++  A  VFE   ++  D +++ A+I G  S    EEAL +F  MR    + P

               +   S++S+ ++        Q+H   +K GF    SV N+ ++MY+ C  L+    +F

               ++ KD+++W A+I  YA+     +++ AY  M   G+  D  T   LL

 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 119/251 (47%), Gaps = 40/251 (16%)
 Frame = +3

            D +TL +VL   AS +  +    + +H   ++ G  ++  VSN L+  YAK   +    +

            +F  +   DV SWT                               A+ITG    ++   A
Sbjct  389  VFERMIEKDVVSWT-------------------------------ALITGNGSYEE---A  414

            L LF KM +  G+S D    ASVLS  + L L   G+QVH   +K+GF A+ SV N+LV+

            MY  C S+ DA  VF     E  D IT+ A+I G     + +++L  +  M +  + P  

Query  936  LTFVSLMSSCS  968
            +TF+ L+ +CS
Sbjct  533  ITFIGLLFACS  543

 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 4/133 (3%)
 Frame = +3

            PD    ++VL+A A +    FG Q+H   +++G      V N L+S Y K   L   + +

            FS +++ D+ +WT L+    K G+ + +L+ +    D   R D   +  ++  C+     

Query  573  EVALNLFQKMHSL  611
            E A   F+ M ++
Sbjct  549  EEAQRYFESMRTV  561

>ref|XP_010905005.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
 ref|XP_010905006.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
 ref|XP_010905007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
 ref|XP_010905008.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]

 Score =   419 bits (1076),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 244/684 (36%), Positives = 366/684 (54%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y LS+VL+AC    +   G Q+HA  ++ G ++ + V N L++ Y++    CG  R 

               EI                           F  M   D   +N +I+G A+  + E A+
Sbjct  367   AEEI---------------------------FSDMPHHDGVTYNTLISGHAQNGNSENAI  399

              +F++M   G   D+ T AS+L+ C S+     G+Q+HS V K+G  +   +  +L+ +Y

               C ++  A   F   D E V  + +N M+     M    ++  +F  M+   + P   T

             + S++ +C+         QIH L +K GF     VS+  + MYS C  LK+ R I ERI 

             EKD+VSW AMI  YAQ  L  EA+  + EMQ  G+  D   L S +S+   +   E  L 

             +  +   +G    I V NA+++ + K G IE+AY  F  +  ++ ISWN +ISG   +G 

               ++L +F ++   G+  N++T  +V+SA A +   + GKQIH  I+K G   E  + N 

             L++LY+KCG +  +   F  M+ER+ VSWN+MI+  +QHG G EA+  FE M     ++P

             +  TF GVL+ACSH GLV +G+  F SM   +GI P  EH++C+VDIL RAG LD A E 

             ++   +  DS VW TL S+   H +   G + A  LLE E ++ A YVLLSN+YA AGKW

                  VR++M+   V K+PG SW+

 Score =   272 bits (696),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 181/602 (30%), Positives = 302/602 (50%), Gaps = 23/602 (4%)
 Frame = +3

             G+RA  +T++ + +  LS    S  L G KR+  +I       + +    L+ A    GE

                A+++FD M+ R VA WN++I G +   +    L LF +M       +   FA+ L  

             C  +   W   +Q+H+ +++ GF     V N L+ +Y     V  A  VFE+   +  D 

             +++ AM++G       EEAL +++ M    ++PT     S++S+C+         QIHA 

             V+KQGF   T V NA +T+YS C  L+    IF  +   D V++N +I+ +AQ      A

             I  + EMQ  G   D  T+ SLL++  S+ +    + + S V K+GL  +  +  +++  

             + K   IE A+ +F      N++ WN ++      G   +S +LF E+  EG+ PN +T 

              ++L  C  + +   G+QIH   +K G  L   + + LI +YSKCG L  +  + + +TE

             +DVVSW +MI+ YAQH    EA+  FE M   G ++PD       +SAC+    +E G+Q

             I   + ++ Y     V   + ++++ ++ G ++EA    +T  ++ D   W  L S  A 

Query  2070  HG  2075
Sbjct  695   SG  696

 Score =   269 bits (687),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 178/628 (28%), Positives = 309/628 (49%), Gaps = 44/628 (7%)
 Frame = +3

             P+    +  L AC  + ++  F  Q+HA  +R G      V N L+  YAK+        

                                    G V+ A  VF+++  +D   W A+++G ++    E A
Sbjct  261   -----------------------GYVDLARLVFEELYSKDNVSWVAMVSGFSQNGLGEEA  297

             L+L+ +MH  G+    Y  +SVLS C+  + +  G+Q+H+ V+K GF + T V NALVT+

             Y  C S+  A  +F D      D +TYN +I+G      +E A+ +F  M+     P  +

             T  SL+++C+   D     Q+H+ V K G      +  + + +Y  C  ++     F   

               +++V WN M+ +Y Q    G++   + EMQ EGV  ++FT  S+L +   V      E

              I +L IK G  L + VS+ ++  + K G+++ A      +  ++++SW A+I+G   + 

               +++L  F E+   G+ P+   L++ +SACAGI + + G QIH      G   + S+GN

              LI LY+KCG +  +   F+ +  +D +SWN +IS +AQ G   EA+  F  M D   V+

              +  TF  V+SA ++   ++ G QI   ++   G    +E  + +V + ++ G +++A+ 

                  + E +   W  + +  + HG  R

 Score =   235 bits (600),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 172/593 (29%), Positives = 288/593 (49%), Gaps = 69/593 (12%)
 Frame = +3

             +PD  T++++LTACASI     G QLH++  ++GL++   +   LL  Y K    C    

                                      +E A + F+   R +V +WN ++    ++ +   +
Sbjct  465   -------------------------IETAHEFFNTTDRENVVLWNVMLVAYGQMGNLGKS  499

              +LF +M   GV  + +T+ S+L  C+ +    LG Q+H++ +KTGF     V + L+ M

             Y  C  +  A  + E   ++  D +++ AMIAG    E   EAL  F  M+   + P  +

                S +S+C+         QIHA     G+    SV NA + +Y+ C  ++     FE +

             + KD +SWN +I+ +AQ     EA+  +++M R GV ++ FT GS++S+S ++A+    +

              I + +IK G   +IEV+NA+VS + K G IE A   F  M  RN +SWNA+I+GC  +G

                ++L LF ++  E L PN  T   VL+AC+       G+  F    + HG + +   +

                     ++ +  + G L H    + ++    D + W +++SA   H     GE  A H

               E       +EP D AT+  + +  + AG      Q+   M+ + G+K  PG

 Score =   177 bits (449),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 114/428 (27%), Positives = 204/428 (48%), Gaps = 19/428 (4%)
 Frame = +3

             C   E++ D  ++        A LV      +A  + N M    +     T+ SL+  C 

                +   A +IH  ++K GF   + + N  +  Y    +      +F+ +  + + SWN+

             MI   ++       +  +  M RE    +     + L +           + I + +I+ 

             G      V N ++  + K G ++ A   F ++++++ +SW A++SG   NG   ++L+L+

             S++   G+ P  Y LS+VLSAC    +F+HGKQIH  ++K G   ET +GN L+ LYS+C

             G L  +  +F  M   D V++N++IS +AQ+G    A+  F+ M  SG  +PD  T   +

             L+AC+  G +  G Q+ +S V   G+         ++D+  +   ++ A E   T + E 

Query  2028  DSTVWWTL  2051
              + V W +
Sbjct  479   -NVVLWNV  485

>ref|XP_010523729.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Tarenaya hassleriana]

 Score =   410 bits (1054),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 219/667 (33%), Positives = 375/667 (56%), Gaps = 15/667 (2%)
 Frame = +3

             F   +H++  RA L      SN +L+ ++KS  +   ++LF ++   D +SW T+++A +

               G +  A+Q+FD+   +    WNA+I+G      +  A  LF  M   G   + +T  S

             VL +CS + L   G ++H   +KTG      V+  L+ MY  CK + +A ++F     + 

              + +T+ +M+ G         A+  F  MR   +     TF S++++C   S      Q+

             H  ++K GFG    V +A + MY+ C+DL   R++ E ++  D+VSWN+MI    ++ L 

              EA+  +  M +  +  D+FT+ S+L    SS   +  A  +  L++K G      V+NA

             +V  + K G ++ A++ F  M  R++ISW A+++G   NG   ++L LF  +    + P+

                +++VL A A +   + G+Q+HG  +K G     S+GN+L+ +Y++CG +  + R+F 

              M  RDV++W ++I  YA++GK  +++  ++ M+ SG + PD  TF G+L ACSHAG  E

             +  + F+SM  +YGI PG EH++C++D+  R+G L +A+E++    +E D+TVW  + ++

             S  HG+   G   A  L+E E +N   Y+LLSN+Y+ AG+WEE+A VR LM+   + K+P

Query  2241  GSSWVRS  2261
             G SW+ +
Sbjct  670   GRSWLEA  676

 Score =   204 bits (520),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 157/583 (27%), Positives = 273/583 (47%), Gaps = 49/583 (8%)
 Frame = +3

             P+ +TL +VL  C+S+     G ++H + ++ GL     V  GLL  YAK          

                               C  + E EY   +F  MS  ++   W +++TG ++      A

             +  F+ M   G+  + +TF SVL+ C ++ +  +G QVH  ++K+GF     V +AL+ M

             Y  C+ +  A  + E    EV D +++N+MI G V     EEAL +F  M    +     

             T  S++    SS  +   A  +H L+VK G+G    V+NA + MY+    +     +FE 

             +  +D++SW A++T Y       EA+  +  M+   +  D+  + S+L +S  +   E  

               +    IK+GL   + V N++V+ + + G IE A R F  M  R++I+W A+I G   N

             G    SL  + +++  G+TP+  T   +L AC+     +  ++    + K +G       

                +I L+ + G L  +  +  Q+  E D   W ++++A   HG   +     +T+++  

              +EP  A    +LS   S AG  E+  ++   M + N   +PG

 Score = 62.8 bits (151),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = +3

            RPD   +++VL A A +    FG Q+H   +++GL +   V N L++ Y +   +    R

            +F+ ++  DV +WT L+    K G+ + +L+ +DQM

>ref|XP_009625829.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Nicotiana tomentosiformis]

 Score =   410 bits (1053),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 230/684 (34%), Positives = 370/684 (54%), Gaps = 41/684 (6%)
 Frame = +3

             D  T + VL AC+ ++ ++ G Q+H   ++ GL T     + ++  Y+K           

                              C +L E   ++  F++M  ++   W+A+I GC + ++    L 

             LF+KM   GV     T+AS+   C+ L    LG Q+H   +KT F +   V  A + MY 

                S+ DA  VF       +   +YNA+I G    ++  EA+++F  +   YL    ++ 

                 S+C+     +   QIH +  K  F     V+NA M MY  C+  +  R +F+ ++ 

             KD VSWNA+I +Y Q     E ++ +  M +  +  DEFT GS+L   ++ Q +    +I

              + +IK+G+ L+  + +A++  +CK  ++E+A +    M  + ++SWNAIISG       

              ++   +S++L EG+ P+ +T +TVL  CA + +   GKQIH  I+K     +  I +TL

             + +YSKCG +  S  +F+   ++D V+WN+++  YAQHG G EA+  FE M     V P+

              ATF  VL AC+H GLVE G+Q FNSM NNYG+ P +EH+SC+VDIL RAG + EA +++

             +   IE D  +W TL S    HG+  +    A  LL+ +  + + ++LLSNIYADAG W+

             E A +R++M+   + K+PG SW+ 

 Score =   271 bits (694),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 190/660 (29%), Positives = 323/660 (49%), Gaps = 15/660 (2%)
 Frame = +3

             T S +   CA       G Q HA  + +G      V+N L+  Y K  +L    R+F ++

                D  SW  ++   + + ++E A  +FD M  RDV  WN++I+G  +  + + ++  F 

             +M   G++ D  TFA VL  CS LE   LG QVH MV+K G        +A+V MY  CK

              + ++   F +  ++  + ++++A+IAG V        L +F  M+   +  +  T+ SL

               SC   SD    +Q+H   +K  FG    V+ A + MY+    L   R +F  +   ++

              S+NA+I  +A+ + G EA+L +  + +  +  DE +L    S+    +       I  +

               K      + V+NAI+  + K     +A R F +M  ++ +SWNAII+  + NG   ++

             L LF  +L   + P+ +T  +VL ACA       G  IH  I+K G  LE  IG+ +I +

             Y KC  +  + ++ + M E+ +VSWN++IS ++   +  EA   +  M++ G ++PD  T

             +  VL  C++   V  G QI   ++    ++  V   S +VD+ S+ G + ++  ++  K

               + D   W  L    A H  GD  L +I   + LE  + N A ++ +    A  G  E+

 Score =   150 bits (380),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/442 (25%), Positives = 218/442 (49%), Gaps = 54/442 (12%)
 Frame = +3

             NA +  YS   D++  +L+F+ + E+D++SWN+MI+ Y Q     ++I A++EM R+G+ 

              D  T   +L +   + ++ +   +  +VIK GL   +   +A+V  + K   + ++  +

             F +M  +N +SW+A+I+GC  N      L LF ++  EG+  +  T +++  +CAG+   

             + G Q+HG+ LK  FGS  +  +    + +Y+K   L  + +VF ++   ++ S+N++I 

              +A+  +G EAV  F+ ++ S  +  D+ + +G  SAC+      +G+QI          

Query  1899  ------NSMVNNYG----------------IKPGVEHFSCIVDILSRAGYLDEAEEI---  2003
                   N++++ YG                IK  V  ++ I+    + G+ DE   +   

             +    +E D   + ++  + AA  D  +G ++      +G+ LE    +  +     ++Y

                 K EE+  + E M+   ++

 Score =   114 bits (286),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 150/323 (46%), Gaps = 55/323 (17%)
 Frame = +3

              PD +T  +VL ACA+ Q    G  +H   +++G+     + + ++  Y K         

                                C K+ E E   ++ ++M  + +  WNAII+G +  +  E A
Sbjct  507   -------------------CEKVEEAE---KLHERMEEQTIVSWNAIISGFSLREQSEEA  544

                + KM   G+  DN+T+A+VL  C+ L   G+G+Q+H+ ++K    +   + + LV M

             Y  C ++ D+  +FE A  +  D +T+NA++ G       +EAL +F  M+   + P   

             TF++++ +C+        H  +V++G     S+SN       +  YS   D+        

             +A +LI +   E D V W  +++

>ref|XP_010473800.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Camelina sativa]

 Score =   406 bits (1044),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 219/645 (34%), Positives = 366/645 (57%), Gaps = 10/645 (2%)
 Frame = +3

             SN +L  ++KS  +   +++F ++   D ++W T++ A +K G +  A Q+F     ++ 

               WNA+I+G  +   ++ AL LF +M   G+  + YT  SV+ LC SL L   G ++H  

              +KTGF    +V+N L+ MY  CK +  A ++FE    E  + +T+ +M+ G        

             +A+  F  +          TF S++++C   S      Q+H  +VK GF     V +A +

              MY+ C+DL+  R + E ++  D+VSWN+MI    ++ L  EA+  +  M    +  D+F

             T+ S+L+    S   +  A     L++K G      V+NA+V  + K G ++ A + F  

             M  +++ISW A+++G   NG   ++L LF +++ EG+ P+    S+VLSA A +   + G

             +Q+HG  +K G     S+ N+L+ +Y+KCG L  +  +F  M  RD+++W ++I  YA++

             GK  +++  +  M+ +G + PD  TF G+L ACSHAGL+E+    F+SM   YGI+PG E

             H++C++D+  R+G   + EE++    +E D+TVW  + ++S  HG+   G   A  L+E 

             E NN   YVLLSN+YA AG+ +E+A+VR LM+   + K+PG SWV

 Score =   199 bits (505),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 162/622 (26%), Positives = 290/622 (47%), Gaps = 85/622 (14%)
 Frame = +3

             +P+ YTL +V+  C S+   + G ++H   ++ G     +V NGLL+ YA+         

                                C ++ + EY   +F+ MS  ++   W +++TG ++      
Sbjct  173   -------------------CKRISKAEY---LFETMSGEKNNVTWTSMLTGYSQNGFAFK  210

             A+  F+ +   G   + +TF SVL+ C S+    +G QVH  +VK+GF     V +AL+ 

             MY  C+ +  A  + E    E  D +++N+MI G V     EEAL  F  M    +    

              T  S+++    S ++   A+  H L+VK G+G    V+NA + MY+    + +   +FE

              + EKD++SW A++T         EA+  + +M  EG+  D+    S+LS+S  +   E 

                +    IK+G    + V+N++V+ + K G ++ A   F  M  R+LI+W  +I G   

             NG    SL L+  ++  G+TP+  T   +L AC+      H     G I +  S+ +   

               ++ A+Y  + G  H++                 MI  +   G+ G+ V   E +++  
Sbjct  556   --SMRAVYGIRPGPEHYAC----------------MIDLF---GRSGDFVK-VEELLNQM  593

              VEPD   +  +L+A    G +E+G +   +++    ++P     +  + ++ + AG  D

Query  1989  EA---EEIVKTKNIEVDSTVWW  2045
             EA     ++K++NI  +    W

>ref|XP_008802215.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g01510 [Phoenix dactylifera]
 ref|XP_008802216.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g01510 [Phoenix dactylifera]
 ref|XP_008802217.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g01510 [Phoenix dactylifera]

 Score =   407 bits (1046),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 231/655 (35%), Positives = 362/655 (55%), Gaps = 10/655 (2%)
 Frame = +3

             ++ G    ++ +N LL     + +L   ++LF E+   ++++   ++S   K G++  A 

             ++FD+   R    W  ++   A+    + A +LF  M S G+  D+ T A++L+ C   E

             L G   Q H+  VK GF AT  V N LV  Y  C  +      F++      D +TYNAM

             + G        E L +   MR + L P+  TF  ++++ +   D     QIH LV++  F

             G    V+N+ +  YS C  L+  R++F+ + E+D VS+N MI+ YA      E +  + E

             MQ  G    +F   SLLS++  + + +M   + + VI         V NA++  + K G 

             +E A   F +   RN ISW A+ISG   NG   ++L LF E+   GL+P+  T S++LSA

              AG+     G+Q+H YI++ G  L    G  L+ +Y+KCG L  +  VF+ M  R+++SW

             N+MISAYAQ+G+G +A+  FE M+  G VEPD  TF  VLSACSH+GL+++G++ FNSM 

               Y +KP  EH++C++D+L R G LDE E +V     E D  +W ++ +S   H +  L 

             R  A  L   E  + A YV++SN+YA AG+WE++A V+++M+   + K+P  SWV

 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 91/218 (42%), Gaps = 59/218 (27%)
 Frame = +3

            PD  T S++L+A A +     G QLH++ +R+G  L  FS  +  LL  YAK   L    

             +F E+   ++ SW  ++SA  + G+   A+++F+ M R     W               

                       GV  D+ TF SVLS CS          HS ++  G     S     +T 
Sbjct  540  -----------GVEPDSVTFLSVLSACS----------HSGLIDEGLRFFNS-----MTE  573

            Y+  K   +  AC +         D  + +VDQI + A

>ref|XP_007051907.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
 gb|EOX96064.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 

 Score =   406 bits (1044),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 216/644 (34%), Positives = 368/644 (57%), Gaps = 9/644 (1%)
 Frame = +3

             SN +L+  +KS  +   ++LF E+   D ++W T+++A    G++  A+++F ++  +  

               WN++I+G      +  A +LF  M   G   + YT  S+L LCS L L   G+QVH  

             V+KT F +   V+  LV MY  C  +++A  +F+   D+  + + + A++AG        

             +A+  F  M    +     TF S++ +C+         Q+H  + + GF     V +A +

              MY+ C+DL     + E ++  D+VSWN+MI    ++    EA+  + +M    +  D F

             T  S+L+   S+ +++  +S   L++K G      V+NA+V  + K G ++ A++ F  M

               +++ISW ++++G   NG   ++L LF ++   G+ P+   L+++LSACA +   + G+

             Q+H   +K G     S+ N+L+ +Y+KCG + +++RVF  M  +DV++W ++I  YAQ+G

             KG ++V  ++ M+ SG  +PD  TF G+L ACSHAGL+E G   F SM   YGIKPG EH

             ++C++D+L R+G L EAE ++   ++E D+TVW  L ++   HG+  LG   A  L E E

               N   Y++LSN+Y+ +GKWEE+A +R  M+   + K+PG SW+

 Score =   216 bits (549),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 173/647 (27%), Positives = 298/647 (46%), Gaps = 88/647 (14%)
 Frame = +3

             RP+ YT+ ++L  C+++     G Q+H + ++    +  +V  GL+  YAK   +   + 

             LF  +  PD                            +R+  +W AI+ G ++  +   A
Sbjct  190   LFKMM--PD----------------------------KRNHVMWTAIVAGYSQNGEAFKA  219

             +  F+ M   GV  + +TF SVL  C +++   +G QVH  + ++GF     V +ALV M

             Y  C+ + +A  V E+   EV D +++N+MI G V     EEAL +F  M    +     

             T+ S++   +S  D   A  +H L+VK GF  C  V+NA + MY+   +L     +F  +

               KD++SW +++T YA      EA+  + +M+  G+  D   L S+LS+   +   E   

              + +  +K+GL   + V N++V+ + K G IE A R F  M  +++I+W A+I G   NG

                 S+  + +++A G  P+  T   +L AC+           H  +L+ G     S   

             ++  +Y  K G  H++                 MI    + GK  EA    ET+++   V

             EPD   +  +L+AC   G +E G +   +  N + ++P     +  + ++ S +G  +EA

               I   +K++ I  +    W   +S      S   G  R G I + I

>ref|XP_004288861.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Fragaria vesca subsp. vesca]

 Score =   406 bits (1044),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 225/644 (35%), Positives = 356/644 (55%), Gaps = 9/644 (1%)
 Frame = +3

             SN LL   + S  +   +++F E+ S D +SW T+++A    G +  A QVFD    +  

               W+++I+G    +    A  LF +M   G     YT  S+L LCS L L   G  VH  

             +VKT F +   V+  LV MY  CK + +A  +FE   +   + + +  M+ G        

             +A+  F  M+   +     TF S++++ +  +      Q+H  +V+ GFG    V +A +

              MY  C D  + R +   ++  D+VSWN+MI    ++    EA+  + EM+   +  D++

             T  S+L+S    + V NA  I  L++K G  +   V NA+V  + KLG IE A   FR M

               +++ISW ++++G   NG   ++L LF E+   G+ P+ + ++++LSACA +   + G+

             QIH   +K G     S+ N+ + LY+KCG L  + RVF  M  ++V++W ++I  YAQ+G

             +G E++  +  M+ +G  +PD  TF G+L ACSHAGL+E G   F SM   YGIKPG EH

             ++C++D+L R+G L+EAE +V    +E D TVW  L ++   HG   LG   A  L   E

               N   YV LSN+Y+ AG+WE++A +R LM+   ++K+PG SW+

 Score =   146 bits (368),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/345 (28%), Positives = 165/345 (48%), Gaps = 37/345 (11%)
 Frame = +3

             + +T  +VLTA AS+    FGAQ+H   +++G      V + L+  Y K  D    +++ 

               ++  DV SW +++  C + G +  AL +F +M  R++ +                   

                         D+YT+ SVL S  +L+       +H ++VKTGF     V NALV MY 

                ++  A  +F    D+  D I++ +++ G      +E+AL +F  MR+  + P     

              S++S+C++        QIHA  +K G     SV N+ +T+Y+ C  L+    +F+ ++ 

             +++++W A+I  YAQ   G E++  Y +M   G   D  T   LL

 Score = 66.6 bits (161),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 76/149 (51%), Gaps = 5/149 (3%)
 Frame = +3

            PDH+ ++++L+ACA +    FG Q+HA  +++GL     V N  L+ YAK   L    R+

            F  +Q  +V +WT L+    + G  + +L+ ++QM    ++ D   +  ++  C+     

            E     F+ M+ + G+      +A ++ L

>ref|XP_010273294.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, 
chloroplastic [Nelumbo nucifera]

 Score =   408 bits (1048),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 219/612 (36%), Positives = 344/612 (56%), Gaps = 11/612 (2%)
 Frame = +3

               LLS   + G ++ A  VF +M  RD+  WN ++ G A+    + ALNL+ +M  +G+ 

              D YTF  VL  C+ +     GR+VH+ V++ G  +   V NAL+TMY  C+ ++ A  +

             F+       D+I++NAMI+G V   R  E L +F  MR++ + P  +T  S++S+C    

             D     +IH  V +  FG   SV N+ + MYS+  +L+    IF R+  KD+VSW AMI+

              Y +  L  +A+  Y  M+ EGV+ DE T+ S+LS+   +   EM   +  L  K G I 

                V N ++  + K   IE+A   FR M  +N+ISW +II G + N    ++L  F ++ 

                L PN+ TL   LS CA I +   GK+IH + L+ G   E  + N L+ +Y +CG + 

             ++   F     +DV SWN +++ YA+ G+G  AV  F  M+D+G + PD  TF  +L AC

             S +G+V +G++ FNSM   Y I P ++H++C+VD+L RAGYL++A E ++   ++ D  +

             W  L ++   H    LG + A  + E +  +   Y+LL N+Y D G+W++ A VR++M+ 

Query  2220  YRVIKQPGSSWV  2255
              R+   PG SWV
Sbjct  729   RRLTVDPGCSWV  740

 Score =   175 bits (443),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 118/415 (28%), Positives = 215/415 (52%), Gaps = 10/415 (2%)
 Frame = +3

             +D  + N+ I  L      E+++   + M    ++    T+++L+  C     A++   +

             +A V          + NA ++M+    +L     +F R++E+DI SWN M+  YA+    

              EA+  Y  M   G+  D +T   +L +   +   A    + + VI+ GL   I+V+NA+

             ++ + K  +I  A   F  M  R+ ISWNA+ISG   NG  ++ L LF  + +  + P+ 

              T+++V+SAC  +   + GK+IHGY+ +    ++ S+ N+LI +YS  G L  + ++F  

             M  +DVVSW +MIS Y ++G   +A+  +E M   G V PD+ T   VLSAC+  G +E 

             GI++ + +    G        + ++D+ S+   +++A ++   + +   + + WT

 Score =   160 bits (405),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 131/489 (27%), Positives = 211/489 (43%), Gaps = 82/489 (17%)
 Frame = +3

             +PD YT   VL  CA I     G ++HA  +R GL +   V+N L++ YAK +D+     

Query  402   LFSEIQS-----------------------------------PDVYSWTTLLSACTKLGE  476
             LF  +Q                                    PD+ + T+++SAC  LG+

Query  477   -----------------------------------VEYALQVFDQMSRRDVAVWNAIITG  551
                                                +E A ++F +M  +DV  W A+I+G

               +      AL  ++ M   GV  D  T ASVLS C+ L    +G ++H +  K GF+A 

             T V N L+ MY  C+ +  A  VF    ++ V  I++ ++I GL    R+ EAL  F  M

             +   L P  +T V+ +S+C+     M   +IHA  ++ G G    + NA + MY  C  +

             +     F   K KD+ SWN ++T YA+E  G  A+  + +M   G+  D  T  +LL   

               S       E   S+  +  +   ++    +V    + G +E A+ +   M    +   

Query  1425  WNAIISGCQ  1451
             W A+++ C+
Sbjct  669   WGALLNACR  677

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/278 (24%), Positives = 122/278 (44%), Gaps = 35/278 (13%)
 Frame = +3

             QS+     ++   +     T  T+L  C    +   G  ++ ++    S L   +GN L+

             +++ + G L  +  VF  M ERD+ SWN M+  YA+ G   EA++ +  M+  G ++PD 

              TF  VL  C+           HA ++    E  I + N+++  Y     +     + D 

             + R          +GY++    +        +++ +I  D     ++ S+    GD RLG

             + + G +  TE   + +VY  L  +Y+  G  EE+  +

>dbj|BAD67156.2| PpPPR_77 [Physcomitrella patens]

 Score =   412 bits (1059),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 216/620 (35%), Positives = 351/620 (57%), Gaps = 10/620 (2%)
 Frame = +3

              S DV     L+S   + G++  A ++F  M +RD+  WNAII G A  +D   A+ L++

             +M S GV     TF  +LS C+    +  G+ +H  ++++G  +   + NAL+ MY  C 

             S+++A  VFE    +  D I++N+MIAG       E A  +F  M+N  L P  +TF S+

             +S C +P       QIH  + + G     ++ NA + MY  C  L+  R +F  ++ +D+

             +SW AMI   A +    +AI  + +MQ EG    + T  S+L   +SS  +   + +++ 

             ++ +G  L   V NA++SA+ K G +  A   F  M +R+++SWN II+G   NG    +

             +    ++  + + PN ++  ++L+AC+   + + GK++H  I+K     +  +G  LI++

             Y+KCG    +  VF  + E++VV+WN+MI+AYAQHG   +A+  F  M   G ++PD +T

             FT +LSAC+HAGLV +G QIF+SM + YG+ P +EH+ C+V +L RA    EAE ++   

                 D+ VW TL  +   HG+  L    A   L+    NPAVY+LLSN+YA AG+W++ A

              +R +M+   + K+PG SW+

 Score =   289 bits (740),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 193/694 (28%), Positives = 325/694 (47%), Gaps = 82/694 (12%)
 Frame = +3

             P+  T  ++LTAC S      G ++H+  ++AG      V N LLS Y K  DL   +++

Query  405   FSEIQSPDVYSWTTLLSACTKLGEVEYALQVFDQMSRR----------------------  518
             F+ I   DV S+ T+L    +   V+  L +F QMS                        

Query  519   -----------------DVAVWNAIITGCAEIDDDEVALNLFQ-----------------  596
                              D+ V  A++T C    D + A   F+                 

                           +M S GV+ +  T+ S+L+ CS  +    G+ +HS + + G  +  

              + NAL++MY  C  +  A  +F        D I++NA+IAG    E   EA+ ++  M+

             +  + P  +TF+ L+S+C++         IH  +++ G      ++NA M MY  C  L 

               + +FE  + +D++SWN+MI  +AQ      A   + EMQ E +  D  T  S+LS  +

             +    E+   I   + ++GL L + + NA+++ + + G ++ A   F  +  R+++SW A

             +I GC   G  M+++ LF ++  EG  P   T S++L  C        GK++  YIL  G

               L+T +GN LI+ YSK G +  +  VF  M  RD+VSWN +I+ YAQ+G G  AV  F 

               +    V P+K +F  +L+ACS    +E+G ++   +V    ++  V   + ++ + ++

              G   EA+E+     IE +   W  + ++ A HG

 Score =   276 bits (707),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 175/583 (30%), Positives = 296/583 (51%), Gaps = 25/583 (4%)
 Frame = +3

             C  KRL  E +            PD++    L++   K   V  A QVF +M RRDV  W

             N++I+  A+    + A  LF++M + G   +  T+ S+L+ C    EL   G+++HS ++

             K G+     V N+L++MY  C  +  A  VF  A     D ++YN M+         +E 

             L +F  M +  + P  +T+++L+ + + P       +IH L V++G      V  A +TM

                C D+ + +  F+   ++D+V +NA+I + AQ     EA   Y  M+ +GV  +  T 

              S+L   S+S+++   ++I S + ++G    +++ NA++S + + G++ +A   F  M  

             R+LISWNAII+G        +++ L+ ++ +EG+ P   T   +LSACA   ++  GK I

             H  IL+ G      + N L+ +Y +CG L  +  VF+    RDV+SWNSMI+ +AQHG  

               A   F+ M +   +EPD  TF  VLS C +   +E G QI +  +   G++  V   +

              ++++  R G L +A  +  +     D   W  +    A  G+

 Score =   241 bits (616),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 136/488 (28%), Positives = 264/488 (54%), Gaps = 12/488 (2%)
 Frame = +3

             T+ ++L  C+ + L    +++H+ +V+        + N L+ MY  C+SV+DA  VF++ 

                  D I++N++I+        ++A  +F  M+N   +P  +T++S++++C  P     

               +IH+ ++K G+     V N+ ++MY  C DL   R +F  I  +D+VS+N M+  YAQ

             +    E +  + +M  EG+  D+ T  +LL   ++   +   + I  L ++ GL   I V

               A+V+   + G+++ A + F+    R+++ +NA+I+    +G  +++   +  + ++G+

               N  T  ++L+AC+   + + GK IH +I + G   +  IGN LI++Y++CG L  +  

             +F  M +RD++SWN++I+ YA+    GEA+  ++ M   G V+P + TF  +LSAC+++ 

                DG  I   ++ + GIK      + ++++  R G L EA+ + +      D   W ++

Query  2052  FSSSAAHG  2075
              +  A HG
Sbjct  504   IAGHAQHG  511

 Score =   213 bits (543),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 184/738 (25%), Positives = 326/738 (44%), Gaps = 101/738 (14%)
 Frame = +3

             LI  N ++A + R R+        +    S  ++P   T   +L+ACA+      G  +H

                LR+G+ +  H++N L++ Y +   L   + +F   Q+ DV SW ++++   + G  E

              A ++                               FQ+M +  +  DN TFASVLS C 
Sbjct  515   TAYKL-------------------------------FQEMQNEELEPDNITFASVLSGCK  543

             + E   LG+Q+H  + ++G     ++ NAL+ MY  C S+ DA  VF        D +++

              AMI G      + +A+ +F  M+N    P   TF S++  C+         ++ A ++ 

              G+   T V NA ++ YS    +   R +F+++  +DIVSWN +I  YAQ  LG  A+  

               +MQ + VV ++F+  SLL   SS  ++   + + + ++K  L   + V  A++S + K

              G   +A   F ++  +N+++WNA+I+    +G   ++L  F+ +  EG+ P+  T +++

             LSAC        G  + GY  +  S +E+  G      +  C  G+L  + R FQ     

                                EA    ET+++     PD A +  +L AC   G +      
Sbjct  889   -------------------EA----ETLINQMPFPPDAAVWETLLGACRIHGNIALAEHA  925

              N+ +      P V  +  + ++ + AG  D+  +I +               IEVD+ +

                  ++  +H +T    I A +  L  E      +    ++  D GK  +  S+    +

Query  2217  R----YRVIKQPGSSWVR  2258
             R    Y +IK P  + +R

>gb|AES80039.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]

 Score =   403 bits (1035),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 216/642 (34%), Positives = 365/642 (57%), Gaps = 6/642 (1%)
 Frame = +3

             +N LL+  +KS  +   ++LF ++   D YSW T++S+   +G +  A ++FD  S +  

               W++II+G  +      A +LF+ M   G     +T  SVL +CS L L   G  +H  

             VVK GF     V+  LV MY  CK V +A ++F+  + +  + + + AM+ G        

             +A+  F +M    +     TF +++++CS  +      Q+H  +VK GFG    V +A +

              MY+ C DLK  + + E +++ D+VSWN+++  + +  L  EA+  +  M    +  D++

             T  S+L+       N + +  L+IK G      VSNA+V  + K G+++ AY  F  M  

             +++ISW ++++G   N    +SL +F ++   G+ P+ + ++++LSACA +   + GKQ+

             H   +K G     S+ N+L+A+Y+KCG L  +  +F  M  +DV++W ++I  YAQ+GKG

               ++  ++ MV SG   PD  TF G+L ACSHAGLV++G + F  M   YGIKPG EH++

             C++D+  R+G LDEA++++   +++ D+TVW +L S+   H +  L    A  L E E  

             N   YV+LSN+Y+ + KW + A +R+LM+   ++K+PG SW+

 Score =   157 bits (396),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 116/416 (28%), Positives = 194/416 (47%), Gaps = 42/416 (10%)
 Frame = +3

             + YT  T+LTAC+S+    FG Q+H F +++G  +  +V + L+  YAK  DL   K + 

               ++  DV SW +L+     +G V + L+                          E AL 
Sbjct  295   ETMEDDDVVSWNSLM-----VGFVRHGLE--------------------------EEALR  323

             LF+ MH   +  D+YTF SVL+ C +      + VH +++KTGF     V NALV MY  

                +  A  VFE   ++  D I++ +++ G      +EE+L +F  MR   + P      

             S++S+C++        Q+H   +K G     SV N+ + MY+ C  L     IF  ++ K

             D+++W A+I  YAQ   G  ++  Y  M   G   D  T +G L + S +  V       

               + K  G+    E    ++  F + G++++A +    M  + +   W +++S C+

 Score = 62.8 bits (151),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 77/156 (49%), Gaps = 10/156 (6%)
 Frame = +3

            PD + ++++L+ACA +    FG Q+H   +++GL     V N L++ YAK   L     +

            F  +Q  DV +WT ++    + G+   +L+ +D M    +R D   +  ++  C+     

            +     FQ+M+ + G+      +A     C ++L+G

>ref|XP_008232744.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Prunus mume]

 Score =   403 bits (1035),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 220/644 (34%), Positives = 358/644 (56%), Gaps = 9/644 (1%)
 Frame = +3

             +N LL+  +KS  L   ++LF ++ S D +SW T+++A    G +  A Q+FD    +  

               W+++I+G    + +  A  LF +M   G     YT  SVL LCS L L   G  VH  

             V+KT F     V+  LV MY  CK + +A ++FE   D   + + +  M+ G        

             +A+  F  MR   +     TF S++++ +  +      Q+H  +V+ GFG    V +A +

              MY  C D  + +   + ++  D+VSWN+MI    ++    EA+  + EM+   +  D F

             T  S+L+S    + + NA  I  L++K G  +   V NA+V  + K G I+ A   F++M

               +++ISW ++++G   NG   ++L LF E+   G+ P+ + +++VL ACA +   + G+

             QIH   +K G     S+ N+ + +Y+KCG +  + RVF  M  ++V++W ++I  YAQ+G

             +G E++  ++ M+ +G  +PD  TF G+L ACSHAGL+E G   F SM   YGI+PG EH

             ++C++D+L R+G L EAE +V    +E D TVW  L ++   HG+  LG   A  L + E

               N   YV LSN+Y+ A +WE++A +R LM+   ++K+PG SW+

 Score =   147 bits (372),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/345 (28%), Positives = 165/345 (48%), Gaps = 37/345 (11%)
 Frame = +3

             + +T  ++LTA ASI    FGAQ+H   +++G      V + L+  Y K  D    K+  

               ++  DV SW +++  C + G  E AL +F +M  R++ +                   

                         D++T+ SVL SL +L+       +H ++VKTGF     V NALV MY 

                ++  A  VF++  D+  D I++ +++ G      +E+AL +F  MR   + P     

              S++ +C++        QIHA  +K G     SV N+ +TMY+ C  ++    +F+ ++ 

             +++++W A+I  YAQ   G E++  Y +M   G   D  T   LL

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 74/149 (50%), Gaps = 5/149 (3%)
 Frame = +3

            PD + +++VL ACA +    FG Q+HA  +++GL     V N  ++ YAK   +    R+

            F  +Q  +V +WT L+    + G  + +L+ +DQM    ++ D   +  ++  C+     

            E     F+ M+ + G+      +A ++ L

>ref|XP_010655542.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Vitis vinifera]

 Score =   404 bits (1038),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 219/632 (35%), Positives = 365/632 (58%), Gaps = 17/632 (3%)
 Frame = +3

             +R+ S IQS DV     L S    +    G++    ++FD+++   V +WN ++ G A+I

              +   +L+LF++M  LGV  ++YTF+ V+  C      +  G  VH+ + + GF +  +V

             +N+L+  YF  + V  A  +F++  D   D I++N+MI+G VS   +E+ L +F  M  +

              +     T VS+++ CS+    +    +H   +K  FG   +++N  + MYS   +L + 

               +FE + E+ +VSW +MI  YA+E L   ++  + EM++EG+  D FT+ ++L +    

                 N + + + + +N +   + VSNA++  + K G +  A+  F +M  ++++SWN +I

              G   N  P ++LNLF E+      PN+ T++ +L ACA + + + G++IHG+IL+ G  

             L+  + N L+ +Y KCG L  +  +F ++ E+D+VSW  MI+ Y  HG G EA+  F  M

              +SG +EPD+ +F  +L ACSH+GL+++G   FN M NN  I+P  EH++CIVD+L+RAG

              L +A + +K   IE D+T+W  L      + D +L   VA  + E E  N   YVLL+N

             IYA+A KWEE   +RE + R  + K PG SW+

 Score =   193 bits (491),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 128/491 (26%), Positives = 242/491 (49%), Gaps = 19/491 (4%)
 Frame = +3

             T+ SVL LC+ L+    GR++HS++          + + LV MY  C  + +   +F+  

              +E V    +N ++ G   +    E+L +F  MR + +     TF  +M   +   +  +

                +HA + + GFG   +V N+ +  Y   + +++ R +F+ + ++D++SWN+MI+ Y  

               L  + +  + +M   G+  D   L +++S     +N  M+L         IK     +

             + ++N ++  + K G +  A + F  M  R+++SW ++I+G    G    S+ LF E+  

             EG++P+ +T++T+L ACA     ++GK +H YI +     +  + N L+ +Y+KCG +  

             +  VF  M  +D+VSWN+MI  Y+++    EA++ F  M  + +  P+  T   +L AC+

                 +E G +I   ++ N G        + +VD+  + G L  A  +      E D   W

Query  2043  WTLFSSSAAHG  2075
               + +    HG
Sbjct  574   TVMIAGYGMHG  584

 Score =   165 bits (418),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 118/450 (26%), Positives = 212/450 (47%), Gaps = 41/450 (9%)
 Frame = +3

             + YT S V+   A+      G  +HA+  R G  +++ V N L++FY K + +   ++LF

              E+   DV SW +++S     G  E  L +F+QM                          
Sbjct  261   DELGDRDVISWNSMISGYVSNGLSEKGLDLFEQMLL------------------------  296

                    LG++ D  T  SV++ CS   +  LGR +H   +K  F    ++ N L+ MY 

                ++  A  VFE   +  V  +++ +MIAG      ++ ++ +F+ M    + P   T 

              +++ +C+          +H  + +        VSNA M MY+ C  +     +F  ++ 

             KDIVSWN MI  Y++ +L  EA+  ++EMQ      +  T+  +L +  S+A  E    I

                +++NG  L   V+NA+V  + K G +  A   F  +  ++L+SW  +I+G   +G+ 

              +++  F+E+   G+ P+  +  ++L AC+

 Score =   114 bits (286),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 162/318 (51%), Gaps = 20/318 (6%)
 Frame = +3

             L +  +S+ +   I S++  N + +   + + +V  +   G++ +  R F  +    +  

             WN +++G    G   +SL+LF  +   G+  N+YT S V+   A   S + G+ +H Y+ 

              L FGS+   ++ N+LIA Y K   +  + ++F  + +RDV+SWNSMIS Y  +G   + 

             +  FE M+  G +  D AT   V++ CS+ G++     +    ++ Y IK   G E    

             +C++D+ S++G L+ A ++ +T  +   S V WT  S  A +    L  +   +  E EK

Query  2127  N--NPAVYVLLSNIYADA  2174
                +P ++ + + ++A A

 Score = 96.7 bits (239),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 123/267 (46%), Gaps = 43/267 (16%)
 Frame = +3

             PD +T++T+L ACA       G  +H +     + +   VSN L+  YAK   +     +

             FSE+Q  D+ SW T++   +K                      N++            AL
Sbjct  462   FSEMQVKDIVSWNTMIGGYSK----------------------NSL---------PNEAL  490

             NLF +M       ++ T A +L  C SL     G+++H  +++ GF     V NALV MY

               C ++  A  +F+   ++  D +++  MIAG        EA+  FN MRN  + P  ++

             F+S++ +CS        H+ ++ +G+G
Sbjct  608   FISILYACS--------HSGLLDEGWG  626

 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 0/96 (0%)
 Frame = +3

            +P+  T++ +L ACAS+     G ++H   LR G +   HV+N L+  Y K   L   + 

            LF  I   D+ SWT +++     G    A+  F++M

>ref|XP_009340625.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009340626.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009340627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]

 Score =   402 bits (1034),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 220/646 (34%), Positives = 358/646 (55%), Gaps = 9/646 (1%)
 Frame = +3

             SN LL+  +KS  +   +++F ++ S D +SW T+++A    G +  A Q+FD    ++ 

               W+++I+G    + +  A  LF +M   G     YT  SVL LCS L L   G  VH  

             + KT F     V+  LV MY  CK + +A ++F    D   + + +  M+ G        

             +A+  F  MR   +     TF S++++ +  +      Q+H  VV+ G G    V ++ +

              MY  C DL + +     ++  D+VSWN+MI    ++    EA+  + +M+   +  D F

             T  S+L+S    + + NA  I  L+IK G  +   V NA+V  + K G I+ A   F+ M

               +++ISW ++I+G   NG   ++L LF E+   G+ P+ + +++ LSACA +   + G+

             QIH   +K G     S+ N+ +A+Y+KCG +  + RVF  M  +DV++W ++I  YAQ+G

             +G E++  ++ M+ +G  EPD  TF G++ ACSHAGL+E G   F SM   YGI+PG EH

             ++C++D+L R+G L+EAE +V    +E D TVW  L ++   HG+  LG   A  L + E

               N   YV LSN+Y+ A +WE++A +R LM+   ++K+PG SW+ +

 Score =   150 bits (378),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/345 (28%), Positives = 165/345 (48%), Gaps = 37/345 (11%)
 Frame = +3

             +H+T  +VLTA AS+    FGAQ+H   +++GL     V + L+  Y K  DL   K+  

               ++  DV SW +++  C + G  E AL +F  M  R++ +                   

                         D++T+ SVL S  +++       +H +++KTGF     V NALV MY 

                ++  A  VF+   ++  D I++ ++I G V    +E+AL +F  MR   + P     

              S +S+C++        QIHA  +K G     SV N+ + MY+ C  ++    +F+ ++ 

             +D+++W A+I  YAQ   G E++  Y +M   G   D  T   L+

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = +3

            PD + +++ L+ACA +    FG Q+HA  +++GL     V N  ++ YAK   +    R+

            F  +Q  DV +WT L+    + G  + +L+ +DQM    +  D   +  +I  C+     

Query  573  EVALNLFQKM  602
            E     F+ M
Sbjct  567  EKGRYYFESM  576

>ref|XP_006292825.1| hypothetical protein CARUB_v10019077mg [Capsella rubella]
 gb|EOA25723.1| hypothetical protein CARUB_v10019077mg [Capsella rubella]

 Score =   402 bits (1032),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 222/666 (33%), Positives = 369/666 (55%), Gaps = 17/666 (3%)
 Frame = +3

             FG  +H++  R  L      SN +L   +KS  +   ++LF ++   D ++W T++ A +

             K G +  A  +F     ++   WNA+I+G C    +DE A  LF +M   G+  + YT  

             SVL LC SL L   G ++H   +KTGF    +V+N L+ MY  CK + +A ++F     E

               + +T+ +M+ G        +A+  F  +R         TF S++++C   S      Q

             +H  +VK GF     V +A + MY  C+DL+  R + E ++  D+VSWN+MI    ++ L

               EA+  +  M    +  D+FT+ S+L+    S   +  A     L++K G      V+N

             A+V  + K G I+ A + F  M  +++ISW A+++G   NG   +++ LF  +   G++P

             +    ++VLSA A +   + G+Q+HG  +K G     S+ N+L+ +Y+KCG L  +  +F

               M  RD+++W ++I  YA++GK  +++  +  M+ SG + PD  TF G+L ACSHAGL+

             E+    F+SM   YGI+PG EH++C++D+  R+G   + EE++    +E D+TVW  + +

             +S  HG+   G   A  L++ E NN   YVLLSN+Y+  G+ +E+A++R LM+   + K+

Query  2238  PGSSWV  2255
             PG SWV
Sbjct  668   PGCSWV  673

 Score =   196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 162/622 (26%), Positives = 288/622 (46%), Gaps = 85/622 (14%)
 Frame = +3

             +P+ YTL +VL  C S+   + G ++H   L+ G     +V NGLL+ YA+         

                                C ++ E E+   +F  MS  ++   W +++TG ++      
Sbjct  173   -------------------CKRISEAEF---LFGTMSGEKNNVTWTSMLTGYSQNGFAFK  210

             A+  F+ +   G   + +TF SVL+ C S+    +G QVH  +VK+GF     V +AL+ 

             MY  C+ +  A  + E  + +  D +++N+MI G V     EEAL +F  M +  +    

              T  S+++  S   T  +I    H L+VK G+G    V+NA + MY+    + +   +FE

              + EKD++SW A++T         EA+  +  M+  G+  D+    S+LS+S  +   E 

                +    IK+G    + V+N++V+ + K G +E A   F  M  R+LI+W A+I G   

             NG    SL  +  ++  G+TP+  T   +L AC+      H     G I +  S+ +   

               ++  +Y  + G  H++                 MI  +   G+ G+ V   E +++  
Sbjct  556   --SMRTVYGIRPGPEHYAC----------------MIDLF---GRSGDFVKV-EELLNQM  593

              VEPD   +  +L+A    G +E+G +   +++    ++P     +  + ++ S  G  D

Query  1989  EA---EEIVKTKNIEVDSTVWW  2045
             EA     ++K+++I  +    W

>ref|XP_009351179.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]

 Score =   402 bits (1033),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 219/646 (34%), Positives = 357/646 (55%), Gaps = 9/646 (1%)
 Frame = +3

             SN LL+  +KS  +   +++F ++ S D +SW T+++A    G +  A Q+FD    ++ 

               W+++I+G    + +     LF +M   G     YT  SVL LCS L L   G  VH  

             + KT F     V+  LV MY  CK + +A ++F    D   + + +  M+ G        

             +A+  F  MR   +     TF S++++ +  +      Q+H  VV+ G G    V ++ +

              MY  C DL + +     ++  D+VSWN+MI    ++    EA+  + +M+   +  D F

             T  S+L+S    + + NA  I  L+IK G  +   V NA+V  + K G I+ A   F+ M

               +++ISW ++I+G   NG   ++L LF E+   G+ P+ + +++ LSACA +   + G+

             QIH   +K G     S+ N+ +A+Y+KCG +  + RVF  M  +DV++W ++I  YAQ+G

             +G E++  ++ M+ +G  EPD  TF G++ ACSHAGL+E G   F SM   YGI+PG EH

             ++C++D+L R+G L+EAE +V    +E D TVW  L ++   HG+  LG   A  L + E

               N   YV LSN+Y+ A +WE++A +R LM+   ++K+PG SW+ +

 Score =   150 bits (378),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/345 (28%), Positives = 165/345 (48%), Gaps = 37/345 (11%)
 Frame = +3

             +H+T  +VLTA AS+    FGAQ+H   +++GL     V + L+  Y K  DL   K+  

               ++  DV SW +++  C + G  E AL +F  M  R++ +                   

                         D++T+ SVL S  +++       +H +++KTGF     V NALV MY 

                ++  A  VF+   ++  D I++ ++I G V    +E+AL +F  MR   + P     

              S +S+C++        QIHA  +K G     SV N+ + MY+ C  ++    +F+ ++ 

             +D+++W A+I  YAQ   G E++  Y +M   G   D  T   L+

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = +3

            PD + +++ L+ACA +    FG Q+HA  +++GL     V N  ++ YAK   +    R+

            F  +Q  DV +WT L+    + G  + +L+ +DQM    +  D   +  +I  C+     

Query  573  EVALNLFQKM  602
            E     F+ M
Sbjct  567  EKGRYYFESM  576

>ref|XP_003623821.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]

 Score =   402 bits (1034),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 216/642 (34%), Positives = 365/642 (57%), Gaps = 6/642 (1%)
 Frame = +3

             +N LL+  +KS  +   ++LF ++   D YSW T++S+   +G +  A ++FD  S +  

               W++II+G  +      A +LF+ M   G     +T  SVL +CS L L   G  +H  

             VVK GF     V+  LV MY  CK V +A ++F+  + +  + + + AM+ G        

             +A+  F +M    +     TF +++++CS  +      Q+H  +VK GFG    V +A +

              MY+ C DLK  + + E +++ D+VSWN+++  + +  L  EA+  +  M    +  D++

             T  S+L+       N + +  L+IK G      VSNA+V  + K G+++ AY  F  M  

             +++ISW ++++G   N    +SL +F ++   G+ P+ + ++++LSACA +   + GKQ+

             H   +K G     S+ N+L+A+Y+KCG L  +  +F  M  +DV++W ++I  YAQ+GKG

               ++  ++ MV SG   PD  TF G+L ACSHAGLV++G + F  M   YGIKPG EH++

             C++D+  R+G LDEA++++   +++ D+TVW +L S+   H +  L    A  L E E  

             N   YV+LSN+Y+ + KW + A +R+LM+   ++K+PG SW+

 Score =   156 bits (395),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 116/416 (28%), Positives = 194/416 (47%), Gaps = 42/416 (10%)
 Frame = +3

             + YT  T+LTAC+S+    FG Q+H F +++G  +  +V + L+  YAK  DL   K + 

               ++  DV SW +L+     +G V + L+                          E AL 
Sbjct  324   ETMEDDDVVSWNSLM-----VGFVRHGLE--------------------------EEALR  352

             LF+ MH   +  D+YTF SVL+ C +      + VH +++KTGF     V NALV MY  

                +  A  VFE   ++  D I++ +++ G      +EE+L +F  MR   + P      

             S++S+C++        Q+H   +K G     SV N+ + MY+ C  L     IF  ++ K

             D+++W A+I  YAQ   G  ++  Y  M   G   D  T +G L + S +  V       

               + K  G+    E    ++  F + G++++A +    M  + +   W +++S C+

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 77/156 (49%), Gaps = 10/156 (6%)
 Frame = +3

            PD + ++++L+ACA +    FG Q+H   +++GL     V N L++ YAK   L     +

            F  +Q  DV +WT ++    + G+   +L+ +D M    +R D   +  ++  C+     

            +     FQ+M+ + G+      +A     C ++L+G

>gb|KGN54859.1| hypothetical protein Csa_4G554180 [Cucumis sativus]

 Score =   401 bits (1031),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 224/685 (33%), Positives = 373/685 (54%), Gaps = 18/685 (3%)
 Frame = +3

             ++  S   T C    +H +F   +H      G+  +S    SN LLS  +K+  +   ++

             LF ++   D Y+W  ++SA   LG +  A ++F++   ++   W+++++G  +   +   

             L  F +M S G     YT  SVL  CS L L   G+ +H   +K    A   V   LV M

             Y  CK +++A ++F    D   + + + AM+ G      + +A+  F  MRN  +     

             TF S++++C+         Q+H  ++  GFG    V +A + MY+ C DL + R+I + +

             +  D+V WN+MI          EA++ + +M    +  D+FT  S+L S  S  N    E

              + SL IK G      VSNA+V  + K G +  A   F  +  +++ISW ++++G   NG

             F  ++L LF ++    +  + + ++ V SACA +   + G+Q+H   +K  +    S  N

             +LI +Y+KCG L  + RVF  M  R+V+SW ++I  YAQ+G+G +++H +E M+  G ++

             PD  TF G+L ACSHAGLVE G   F SM   YGIKP  +H++C++D+L RAG ++EAE 

             ++   ++E D+T+W +L S+   HG+  LG      L++ E +N   YVLLSN+++ AG+

             WE++A +R  M+   + K+PG SW+

 Score =   216 bits (550),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 163/621 (26%), Positives = 285/621 (46%), Gaps = 84/621 (14%)
 Frame = +3

             +P  YTL +VL AC+++     G  +H + ++  L     V+ GL+  Y+K + L   + 

             LF  +     Y  WT +L+   + GE   A+Q F +M  +                    

                        G+  +++TF S+L+ C S+  +  GRQVH  ++ +GF     V +ALV 

             MY  C  +  A  + +    E+ D + +N+MI G V+    EEAL++F+ M N  +    

              T+ S+   ++SC +      +H+L +K GF  C +VSNA + MY+   +L     +F +

             I +KD++SW +++T Y       +A+  + +M+   V  D+F +  + S+   +   E  

               + +  IK+     +   N++++ + K G +E A R F  M TRN+ISW AII G   N

             G    SL+ + +++ +G+ P+  T   +L AC+           H  +++ G S+ E+  

                               +V+ I    D   +  MI    + GK  EA H    M     
Sbjct  565   ----------------MEKVYGIKPASD--HYACMIDLLGRAGKINEAEHLLNRM----D  602

             VEPD   +  +LSAC   G +E G +   +++    ++P     +  + ++ S AG  ++

Query  1992  AEEI---VKTKNIEVDSTVWW  2045
             A  I   +KT  I  +    W

>ref|XP_010244384.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Nelumbo nucifera]

 Score =   403 bits (1036),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 240/683 (35%), Positives = 383/683 (56%), Gaps = 43/683 (6%)
 Frame = +3

             D  TLS++L  C  +   + G Q+H+  +++GL                           
Sbjct  104   DGSTLSSILKVCGCLFDQILGKQIHSHCVKSGLEA-------------------------  138

                   DV   T+L+    K   VE   +VFD+M  R+V  W +++ G  +    + A+ 

              F +M + G+  + +TFASVL+  + + +   G QVH+ V+K GF +TT V N+L+ MY 

                 + DA  VFED  +   D +++N MIAG V      EAL +F  MR   +  T L F

             V+++  C++      A Q+H  V+K GFG   +++ A M  YS C ++     +F  +  

               ++VSW A+I  + Q     +A   + +M REGV  + FT  ++L++  +V+  + I +

              VIK        V  A++ A+ KLG I++A   F  +  +++++W+A+++G    G   +

             ++ LF ++  +G  PN +T S+V++ACAG   P+ Q GKQ+HG ++KFG      + ++L

             + +Y+K G +  + +VF+   ERD+VSWNSMIS YAQHG G +A+  FE M + G +E D

               T  GV+SAC+HAGLV++G + FN MV  +GI P +EH++C+VD+ SRAG L++A + +

             K       +TVW TL  +   + +  LG++ A  L+  E  + A YVLLSNIYA AG+WE

             E A VR+LM   +V K+ G SW+

 Score =   254 bits (649),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 171/594 (29%), Positives = 304/594 (51%), Gaps = 32/594 (5%)
 Frame = +3

             GL    H     L    ++Q +C    L S   +PD ++W        +   +  A + F

             D + +RDV+  N ++   +  + ++ A+NLF +MH   V  D  T +S+L +C  L    

             LG+Q+HS  VK+G  A  SV  +LV MY     V D   VF+   +  V  +++ +++AG

                    + A+  F  M+   + P   TF S++++ +         Q+H  V+K GF   

             T V N+ + MYS    ++    +FE +K +D VSWN MI  +       EA+  +  M+ 

              GV   +    T+  L ++ + +A A+ +   V+KNG    + ++ A++ A+ K GE+  

             A   F  M+   N++SW AII G   NG   Q+ +LF ++  EG+ PN +T ST+L+A  

              +  F    QIH  ++K       S+G  L+  Y+K G +  +T +F+++ ++D+V+W++

             M++ YAQ G    A+  F  M   G+ +P++ TF+ V++AC+      E G Q+  S++ 

              +G++  +   S +V + ++ G ++ A ++ + + +E D   W ++ S  A HG

 Score =   196 bits (499),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 137/497 (28%), Positives = 238/497 (48%), Gaps = 51/497 (10%)
 Frame = +3

             +P+ +T ++VL A A+      G Q+H   ++ G  + + V N L++ Y+KS        

                                    G +  A  VF+ M  RD   WN +I G      +  A
Sbjct  255   -----------------------GLIRDASAVFEDMKNRDAVSWNGMIAGFVLNGFELEA  291

             L LF +M   GV      F +V+ LC+ ++     +Q+H  V+K GF    ++  AL+  

             Y  C  ++ A  +F      V + +++ A+I G +     ++A  +F  M    + P   

             T+ +++++    ++  QIHA V+K  + +  SV  A +  Y+   +++    IFE I +K

             DIV+W+AM+  YAQ      AI  + +MQ++G   +EFT  S++++    +      + +

                +IK GL   I VS+++V+ + K G IE A + FR    R+L+SWN++ISG   +G+ 

              ++L +F E+  +GL  +  TL  V+SAC        G++        HG I K   +  

Query  1626  TSIGNTLIALYSKCGIL  1676
                   ++ LYS+ G L
Sbjct  649   -----CMVDLYSRAGKL  660

 Score =   173 bits (439),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 124/452 (27%), Positives = 214/452 (47%), Gaps = 15/452 (3%)
 Frame = +3

             N+EA+ +F  M    +   G T  S++  C    D +   QIH+  VK G     SV  +

              + MY     ++  + +F+++ E+++VSW +++  Y Q  L   A+  + +MQ EG+  +

              FT  S+L++S +    E    + + VIK G      V N++++ + K G I  A   F 

             DM  R+ +SWN +I+G   NGF +++L LF  +   G+        TV+  CA I     

              KQ+H  +LK G   + +I   L+  YSKCG +  +  +F  M    +VVSW ++I  + 

             Q+G   +A   F  M   G V P+  T++ +L+A       +   Q+  +   NY   P 

             V   + ++D  ++ G + EA  I +  N + D   W  + +  A  GD+    I     +

             + +   P  +   S + A AG    +   ++L

>ref|XP_007139957.1| hypothetical protein PHAVU_008G072900g [Phaseolus vulgaris]
 gb|ESW11951.1| hypothetical protein PHAVU_008G072900g [Phaseolus vulgaris]

 Score =   401 bits (1030),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 218/642 (34%), Positives = 359/642 (56%), Gaps = 6/642 (1%)
 Frame = +3

             SN LL+  +KS  +   +++F ++   D Y+W T++S    +G +  A ++ +  S R  

               W+++I+G      +     LF+ M   G     YT  S+L LCS L L   G+ +H  

             VVK GF +   V+  LV MY  C  + +A  +F+    +  + + +  M+ G        

             +A+  F +M    +     TF S++++CS         Q+H  +V+ GFG    V +A +

              MY+ C DL + + + E + + D+VSWN+MI    +     EA+L + +M    +  D++

             T  S+L+       +A+ +  LVIK G      VSNAIV  + K GE+  AY  F  M  

             +++ISW ++++G   NG   +SL +F ++   G+ P+ + ++++LSACA +   + GKQ+

             H   +K G     S+ N+L+ +Y+KCG L  +  +F  M  RDV++W ++I  YAQ+GKG

               ++  ++ MV SG  +PD  TF G+L ACSHAGLV++G   F  M   YGI+PG EH++

             C++D+  R+G LDEA+EI+   +++ D+TVW  L ++   HG+  LG   A  L E E  

             N   YV+LSN+Y+ A KW+++A +R LM+   ++K+PG SW+

 Score =   157 bits (398),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 112/419 (27%), Positives = 189/419 (45%), Gaps = 42/419 (10%)
 Frame = +3

             + +T  ++LTAC+++    FG Q+H   +R G     +V + L+  YAK  DL   KR+ 

               +   DV SW +++  C + G  E AL                                
Sbjct  298   ENMDDDDVVSWNSMIVGCVRHGFEEEALL-------------------------------  326

             LF+KMH+  +  D+YTF SVL+ C +      + VH +V+KTGF     V NA+V MY  

                +  A  VFE   ++  D I++ +++ G      +EE+L +F  MR   + P      

             S++S+C++        Q+H+  +K G     SV N+ +TMY+ C  L     IF  +  +

             D+++W A+I  YAQ   G  ++  Y  M   G   D  T   LL +       +   +  

              +   I  IE        ++  F + G++++A      M  + +   W A+++ C+ +G

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 79/158 (50%), Gaps = 14/158 (9%)
 Frame = +3

            PD + ++++L+ACA +    FG Q+H+  +++GL +   V N L++ YAK   L     +

            F  +   DV +WT L+    + G+  ++L+ +D M    ++ D   +  ++  C+    +

            D+        +K++ +    ++Y        C ++L+G

>gb|KEH25607.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]

 Score =   409 bits (1050),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 237/685 (35%), Positives = 372/685 (54%), Gaps = 43/685 (6%)
 Frame = +3

             P  Y  S+VL+AC  ++   FG QLH   L+ G ++ ++V N L++ Y++S         

                                   G +  A Q+F  MS+RD   +N++I+G A+      AL
Sbjct  333   ----------------------GNLSSAEQIFHCMSQRDRVSYNSLISGLAQQGYINRAL  370

              LF+KM+      D  T AS+LS C S+     G+Q HS  +K G  +   V  +L+ +Y

               C  +  A   F   + E V  + +N M+ G   ++   ++  +F  M+   ++P   T

             + S++ +C+  + AT    QIH  V+K GF     VS+  + MY+    L     IF R+

             KE D+VSW AMI  Y Q +   EA+  + EMQ +G+ +D     S +S+    Q++    

              I +    +G    + + NA+VS + + G++ +AY  F  ++ ++ +SWN+++SG   +G

             +  ++LN+F+++   GL  N++T  + +SA A I + + GKQIHG I K G   ET + N

              LI LY+KCG +  + R F  M +++ +SWNSMI+ Y+QHG G EA+  FE M     V 

             P+  TF GVLSACSH GLV++GI  F SM   + + P  EH++C+VD+L R+G L  A+ 

              V+   I+ D+ VW TL S+   H +  +G   A  LLE E  + A YVL+SN+YA +GK

             W+     R++M+   V K+PG SWV

 Score =   267 bits (683),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 175/625 (28%), Positives = 312/625 (50%), Gaps = 46/625 (7%)
 Frame = +3

             D    + VL  C+    +  F  Q+HA  + +G  + + + N L+  Y K+         

                                   G +  A +VF+ +  RD   W A+I+G ++   +E A+
Sbjct  232   ----------------------GFLSSAKKVFENLKARDSVSWVAMISGLSQNGYEEEAM  269

              LF +MH+ G+    Y F+SVLS C+ +E +  G+Q+H +V+K GF + T V NALVT+Y

                 ++  A  +F        D+++YN++I+GL        AL +F  M      P  +T

               SL+S+C+     P    Q H+  +K G      V  + + +Y  C D+K     F   

             + +++V WN M+  Y Q +   ++   + +MQ EG+V ++FT  S+L +  ++      E

              I + V+K G    + VS+ ++  + K G+++ A + FR +   +++SW A+I+G   + 

                ++LNLF E+  +G+  +    ++ +SACAGI +   G+QIH      G   + SIGN

              L++LY++CG +  +   F  +  +D VSWNS++S +AQ G   EA++ F  M  +G +E

              +  TF   +SA ++   V  G QI + M+   G     E  + ++ + ++ G +D+AE 

                 +  + +   W ++ +  + HG

 Score =   253 bits (646),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 180/618 (29%), Positives = 310/618 (50%), Gaps = 47/618 (8%)
 Frame = +3

              G++  A+ VFD+M  R ++ WN I  T  AE     V   LF++M +  V  D   FA 

             VL  CS     +    Q+H+  + +GF ++T + N L+ +YF    +  A  VFE+   +

               D +++ AMI+GL      EEA+++F  M    + PT   F S++S+C+         Q

             +H LV+KQGF   T V NA +T+YS   +L +   IF  + ++D VS+N++I+  AQ+  

                A+  + +M  +    D  T+ SLLS+  SV    N +   S  IK G+   I V  +

             ++  + K  +I+ A+ +F    T N++ WN ++ G        +S  +F+++  EG+ PN

              +T  ++L  C  + +   G+QIH  +LK G      + + LI +Y+K G L  + ++F+

              + E DVVSW +MI+ Y QH K  EA++ F+ M D G ++ D   F   +SAC+    ++

Query  1881  DGIQIF---------------NSMVNNYG----IKPGVEHFSCI-----------VDILS  1970
              G QI                N++V+ Y     ++     F  I           V   +

             ++GY +EA  I    N   +E++S  + +  S++A   + R+G+ + G++ +T  ++   

             V   L  +YA  G  +++

 Score =   180 bits (456),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 126/488 (26%), Positives = 226/488 (46%), Gaps = 81/488 (17%)
 Frame = +3

             +PD  T++++L+ACAS+     G Q H++ ++AG+T+   V   LL  Y K  D+     

Query  387   ----CGVK----------------------RLFSEIQ----SPDVYSWTTLLSACTKLG-  473
                 C  +                      ++F+++Q     P+ +++ ++L  CT LG 

Query  474   ----------------------------------EVEYALQVFDQMSRRDVAVWNAIITG  551
                                               ++++AL++F ++   DV  W A+I G

               + D    ALNLF++M   G+  DN  FAS +S C+ ++    GRQ+H+    +G+   

              S+ NALV++Y  C  V +A   F+       D +++N++++G       EEAL +F  M

                 L     TF   VS  ++ ++     QIH ++ K G+   T VSNA +T+Y+ C  +

                   F  + +K+ +SWN+MIT Y+Q   G EA+  + +M++  V+ +  T   +LS+ 

               V   +       S+   + L+ K E    +V    + G + +A R+  +M    + + 

Query  1425  WNAIISGC  1448
             W  ++S C
Sbjct  860   WRTLLSAC  867

 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/365 (29%), Positives = 178/365 (49%), Gaps = 15/365 (4%)
 Frame = +3

             M+ N   +   + M    +     TF+ L+  C +  +     ++H  ++K GF D   +

                 +  Y    DL     +F+ +  + +  WN +  ++  E L G     +  M  + V

               DE     +L     ++ S    E I +  I +G      + N ++  + K G +  A 

             + F ++  R+ +SW A+ISG   NG+  +++ LF ++   G+ P  Y  S+VLSAC  + 

              F+ GKQ+HG +LK G   ET + N L+ LYS+ G L  + ++F  M++RD VS+NS+IS

               AQ G    A+  F+ M +D  +  PD  T   +LSAC+  G + +G Q      ++Y 

Query  1923  IKPGV  1937
             IK G+
Sbjct  412   IKAGM  416

>ref|XP_006479094.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X1 [Citrus sinensis]
 ref|XP_006479095.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X2 [Citrus sinensis]
 ref|XP_006479096.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X3 [Citrus sinensis]

 Score =   407 bits (1046),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 230/685 (34%), Positives = 362/685 (53%), Gaps = 41/685 (6%)
 Frame = +3

             P  Y +S+ L+AC  I+    G Q H    + G ++ + V N L++ Y++S         

                                   G +  A Q+F +M +RD   +N++I+G A+    + AL
Sbjct  350   ----------------------GNLTSAEQIFSKMQQRDGVTYNSLISGLAQCGYSDKAL  387

              LF+KM    +  D  T AS++S C S+  +  G Q+HS  +K G      V  +++ +Y

               C  V  A   F   + E V  + +N M+     +    E+  +F  M+   L P   T

             + +++ +C+     +   QIH  V+K GF     V +  + MY+   +L   + I  R+ 

             E D+VSW AMI  + Q  + GEA+  + EM+ +G+ +D     S +S+    Q++     

             I +    +G    + + NA++S + + G I++AY  F  +  ++ ISWN +ISG   +G+

                +L +FS+++  G+  N YT  +V+SA A + + + GKQ+H  I+K G   ET   N+

             LI LY+KCG +  + R F  M E++ VSWN+MI+ ++QHG   EA++ FE M     V P

             +  TF GVLSACSH GLV +G++ F SM   YG+ P  EH++C+VD+L RAG L  A E 

              +   IE D+ VW TL S+   H +  +G   A  LLE E  + A YVLLSNIYA AGKW

             +    +R++M+   V K+PG SW+ 

 Score =   262 bits (670),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 177/628 (28%), Positives = 308/628 (49%), Gaps = 49/628 (8%)
 Frame = +3

             P+  T   VL AC    +       Q+H   +  G      +SN L+  YAK+       

                                     G ++ A +VF+ +  +D   W A+I+G ++   +  
Sbjct  249   ------------------------GFIDSAKKVFNNLCFKDSVSWVAMISGFSQNGYERE  284

             A+ LF +MH LG     Y  +S LS C+ +EL+ +G Q H ++ K GF + T V NALVT

             +Y    ++  A  +F        D +TYN++I+GL     +++AL +F  M+   L P  

             +T  SL+S+C+      T  Q+H+  +K G      V  + + +Y  C D++     F  

              + +++V WN M+ +Y Q N   E+   + +MQ EG+  +++T  ++L +  S+      

             E I + VIK G    + V + ++  + KLG +  A    R +   +++SW A+I G   +

             G   ++L LF E+  +G+  +    S+ +SACAGI +   G+QIH   YI  F    + S

             IGN LI+LY++CG +  +  VF  +  +D +SWN +IS +AQ G    A+  F  M+  G

              V+ +  TF  V+SA ++   ++ G Q+ ++M+   G     E  + ++ + ++ G +D+

             A+     +  E +   W  + +  + HG

 Score =   234 bits (598),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 161/549 (29%), Positives = 272/549 (50%), Gaps = 24/549 (4%)
 Frame = +3

             G+++ A+ +FD MS+R V  WN +I+G          L LF +M    V  +  TF  VL

               C     G G        Q+H +++  GF  +  + N L+ +Y     +  A  VF + 

               +  D +++ AMI+G        EA+++F  M  +  +PT     S +S+C+       

               Q H L+ K GF   T V NA +T+YS   +L +   IF +++++D V++N++I+  AQ

                  +A+  + +MQ + +  D  T+ SL+S+  SV      E + S  IK G+   I V

               +++  + K  ++E AY++F    T N++ WN ++          +S  +F ++  EGL

             TPN YT  T+L  C  + +   G+QIH  ++K G      + + LI +Y+K G L+ +  

             + + + E DVVSW +MI  + QHG  GEA+  FE M + G ++ D   F+  +SAC+   

              +  G QI   S ++  G    +   + ++ + +R G + EA  +V  K    D+  W  

Query  2049  LFSSSAAHG  2075
             L S  A  G
Sbjct  676   LISGFAQSG  684

 Score =   228 bits (581),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/523 (28%), Positives = 261/523 (50%), Gaps = 44/523 (8%)
 Frame = +3

             +PD  T++++++ACAS+     G QLH++ ++ G++    V   +L  Y K  D+    +

              F   ++ +V  W  +L A  +L ++  + Q+F Q                         
Sbjct  459   FFLTTETENVVLWNVMLVAYGQLNDLSESFQIFKQ-------------------------  493

                   M + G++ + YT+ ++L  C SL    LG Q+H+ V+KTGF     V + L+ M

             Y    ++  A  +     ++  D +++ AMI G V      EAL +F  M N  +    +

              F S +S+C+         QIHA     GF D  S+ NA +++Y+ C  ++   L+F +I

               KD +SWN +I+ +AQ      A+  + +M R GV A+ +T GS++S++ ++AN    +

              + +++IK G   + E SN++++ + K G I+ A R F +M  +N +SWNA+I+G   +G

             + ++++NLF ++    + PN  T   VLSAC+ +     G +       ++G   +    

               ++ L  + G L    R F  Q+  E D + W +++SA   H

 Score =   213 bits (541),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/519 (27%), Positives = 257/519 (50%), Gaps = 22/519 (4%)
 Frame = +3

             A+   C E++D E       + L + M   G+  ++ TF  +L  C L    L   +++H

               ++K GF     + + +  +Y     +  A  +F+D     V   ++N +I+G VS + 

             +   L +F  M +  ++P   TFV ++ +C            QIH L++  GFG    +S

             N  + +Y+    + + + +F  +  KD VSW AMI+ ++Q     EAIL + +M   G V

                + + S LS+   +      E    L+ K G   +  V NA+V+ + + G +  A + 

             F  M  R+ +++N++ISG    G+  ++L LF ++  + L P+  T+++++SACA + +F

             + G+Q+H Y +K G   +  +  +++ LY KC  +  + + F      +VV WN M+ AY

              Q     E+   F+ M   G + P++ T+  +L  C+  G +  G QI   ++   G + 

              V   S ++D+ ++ G L+ A+EI+  + +  D  V WT

 Score =   178 bits (451),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 125/415 (30%), Positives = 208/415 (50%), Gaps = 30/415 (7%)
 Frame = +3

             FNC S    C     A DE+ DQ T      G+  +   EE  +  N    ++L+   L+

             + SL+        A +IH  ++K GF     + +    +Y    DL +   IF+ + ++ 

             + SWN +I+ +  + L G  +  +L+M  + V+ +E T   +L     S + +V     I

               L+I +G      +SN ++  + K G I+ A + F ++  ++ +SW A+ISG   NG+ 

              +++ LF ++   G  P  Y +S+ LSAC  I  F+ G+Q HG I K+G   ET + N L

             + LYS+ G L  + ++F  M +RD V++NS+IS  AQ G   +A+  FE M +D   ++P

             D  T   ++SAC+  G    G Q+     ++Y IK G+       DI+     LD

>ref|XP_006402515.1| hypothetical protein EUTSA_v10006471mg [Eutrema salsugineum]
 gb|ESQ43968.1| hypothetical protein EUTSA_v10006471mg [Eutrema salsugineum]

 Score =   400 bits (1027),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 224/667 (34%), Positives = 373/667 (56%), Gaps = 15/667 (2%)
 Frame = +3

             T  G  +H++  +  L      SN  L   +KS  +   ++LF  +   D ++W T++ A

              +  G +  A Q+F +   ++   WNA+I+G  +   ++ A  LF +M   G + + YT 

              SVL +C SL L   G Q+H  +VK+GF    +V+N L+ MY  CK + +A ++F     

             E  D +T+ +M+ G        +A+  F  MR         TF S++++C   S      

             Q+H  +V+ GF     V +A + MY+ C+DL   R++   ++  D+VS N+MI    ++ 

             L  EA+  +  M    +  DEFT+ S+L    SS   +  A  +  L++K G      V+

             NA+V  + K G ++ A + F  M  +++ISW A+I+G   NG   ++L LF ++ A  ++

             P+   +++VLSA A +   + G+Q+HG  +K G     S+ N+L+ +Y+KCG L  +  +

             F  M  RD+++W ++I  YA++GK  +++  +  M+ SG + PD  TF G+L ACSHAGL

             +E+  + F+SM   YGI PG EH++C++D+  R+G   +AEE++    ++ D+TVW  + 

             ++S  HG+   G   A  L+E E NN   YVLLSN+Y+ AG+ +E+A+VR LM+   +IK

Query  2235  QPGSSWV  2255
             +PG SWV
Sbjct  667   EPGCSWV  673

 Score =   199 bits (507),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 168/623 (27%), Positives = 282/623 (45%), Gaps = 89/623 (14%)
 Frame = +3

             P+ YTL +VL  CAS+   + G Q+H   +++G     +V NGLL+ YA+          

                               C ++ E EY L V     R DV  W +++TG ++      A+

               F+ M   G   + +TF SVL+ C ++    +G QVH  +V++GF+    V +AL+ MY

               C+ +  A  +      EV D ++ N+MI   V     EEAL +F  M    +     T

               S++    SS  +   A+ +H L+VK G+     V+NA + MY+    + +   +FER+

              EKD++SW A+IT         EA+  + +M+   V  D+  + S+LS+S  +   E   

              +    IK+G+   + V N++V+ + K G +E A   F  M  R+LI+W A+I G   NG

                 SL  +S ++  G+TP+  T   +L AC                             
Sbjct  511   KAKDSLQSYSLMIGSGITPDYITFIGLLFAC-----------------------------  541

                   S  G++  + R F  M  R V         YA      G+ G+ V   E +++ 

               V+PD   +  +L+A +  G +E+G +   +++    ++P     +  + ++ S AG  

Query  1986  DEA---EEIVKTKNIEVDSTVWW  2045
             DEA     ++K++NI  +    W

>ref|XP_009352737.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic [Pyrus x bretschneideri]

 Score =   401 bits (1030),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 210/604 (35%), Positives = 349/604 (58%), Gaps = 11/604 (2%)
 Frame = +3

             K G++  A +VFD++S   V VWN +I   A++ +    + LF KM  LG+  ++YTF+ 

             VL    +L     G  +H  + K GF +  +V N+L+  YF  + +  AC VF++  D  

              D I++N+MI+  VS    E+ + +F  M ++ +     T ++++ +C    +      +

             HA  +K  F +     N  + MYS C DL +   +F+++ E+ +VSW +MI  + +E L 

              EAI  + EM+R+GV  D +T+ S+L   +SS S+     I + + ++G+   + V N +

             +  + K G +E A+  F  M  ++++SWN +I G   N  P ++L LFSE++ +   P++

              T++++L ACA + +   G++IHG+IL+ G F E  + N L+ +Y KCG+L  +  +F +

                +D++SW  +++ Y  HG G EA+  F  M  +G  EPD  +F  +L ACSH+GL ++

               + F++M N+YGI P +EH++C+VD+LSR G L +A + +KT  IE D+T+W +L    

               H D +L   VA  + E E  N   YVLL+NIYA+A KWEE   +RE + R  + K PG

Query  2244  SSWV  2255
Sbjct  747   CSWI  750

 Score =   199 bits (505),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 147/561 (26%), Positives = 268/561 (48%), Gaps = 22/561 (4%)
 Frame = +3

             S T +LS  + L    +  +V D +   S   VA  NA I    E+ + + A+ +     

                +  D   + SV+ LC+ +     G++VHS++   G  A   +   LV MY  C  + 

             +A  VF+   +  V    +N MI     +    E + +F  M+ + +     TF S +  

             C   +   +    IH  + K GFG   +V N+ M  Y   + +++   +F+ + ++D++S

             WN+MI++Y    L  + +  + +M   G+  D  T+ ++L +  +  N  +  +L    I

             K      +   N ++  + K G++  A + F+ M  R+++SW ++I+G    G   +++ 

             LFSE+  +G+ P+AYT++++L ACA   S + G+ IH YI + G      + NTL+ +Y+

             KCG +  +  VF  M  +D+VSWN+MI  Y+++    EA+  F  M+   +  PD  T  

              +L AC+    +  G +I   ++ N G        + +VD+  + G L  A  +     +

             + D   W  + +    HG  R

 Score =   181 bits (458),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 146/562 (26%), Positives = 257/562 (46%), Gaps = 68/562 (12%)
 Frame = +3

             + YT S VL   +++     G  +H +  + G  + + V N L++FY K++         

                                    +E A +VFD++  RDV  WN++I+        E  + 
Sbjct  255   ----------------------RIESACKVFDELCDRDVISWNSMISAYVSNGLAEKGVE  292

             +F++M SLG+  D  T  +VL  C +     LGR +H+  +K  F       N ++ MY 

              C  +  A  VF+   +  V  +++ +MIAG +    ++EA+ +F+ M    + P   T 

              S++ +C+   +  +   IH  + + G      V N  M MY+ C  ++    +F R+  

             KDIVSWN MI  Y++  L  EA+  + EM ++    D  T+ S+L +  S+A     + I

                +++NG   +  V+NA+V  + K G +  A R   DMF  ++LISW  I++G   +GF

               +++  F+E+   G  P+  +  ++L AC  +G+       F   +  +G + K   + 

                    ++ L S+ G L  + +  + M  E D   W S++     H   K  E V  H 

             FE       +EP+   +  +L+
Sbjct  703   FE-------LEPENTGYYVLLA  717

 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/249 (28%), Positives = 115/249 (46%), Gaps = 35/249 (14%)
 Frame = +3

            PD YT++++L ACAS      G  +H +    G+ +  +V N L+  YAK   +     +

            FS + + D+ SW T++   +K      AL++F +M ++                      

                         D+ T AS+L  C SL     G+++H  +++ G+ +   V NALV MY

              C  +V A  +F+     V D I++  ++AG        EA+  FN MR     P G++

Query  942  FVSLMSSCS  968
            FVS++ +CS
Sbjct  611  FVSILYACS  619

 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (47%), Gaps = 4/133 (3%)
 Frame = +3

            +PD  T++++L ACAS+     G ++H   LR G  +  HV+N L+  Y K   L   + 

            LF      D+ SWT +++     G    A+  F++M +     D   + +I+  C+    

Query  570  DEVALNLFQKMHS  608
             + A   F  M +
Sbjct  624  RDEAWRFFDTMRN  636

>ref|XP_001773953.1| predicted protein [Physcomitrella patens]
 gb|EDQ61301.1| predicted protein [Physcomitrella patens]

 Score =   401 bits (1031),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 230/684 (34%), Positives = 363/684 (53%), Gaps = 40/684 (6%)
 Frame = +3

             P+  T  ++LTAC S      G ++H+  ++AG      V N LLS Y K  DL   +++

             F+ I   DV S+ T+L          YA + +              +  C         L
Sbjct  186   FAGISPRDVVSYNTMLGL--------YAQKAY--------------VKEC---------L  214

              LF +M S G+S D  T+ ++L +  +  +   G+++H + V+ G  +   V  ALVTM 

               C  V  A   F+   D   D + YNA+IA L     N EA   +  MR+  +     T

             ++S++++CS          IH+ + + G      + NA ++MY+ C DL   R +F  + 

             ++D++SWNA+I  YA+    GEA+  Y +MQ EGV     T   LLS+   S + A+ +M

             I   ++++G+     ++NA+++ + + G + +A   F     R++ISWN++I+G   +G 

                +  LF E+  E L P+  T ++VLS C    + + GKQIHG I + G  L+ ++GN 

             LI +Y +CG L  +  VF  +  RDV+SW +MI   A  G+  +A+  F  M + G   P

             D +TFT +LSAC+HAGLV +G QIF+SM + YG+ P +EH+ C+V +L RA    EAE +

             +       D+ VW TL  +   HG+  L    A   L+    NPAVY+LLSN+YA AG+W

             ++ A +R +M+   + K+PG SW+

 Score =   279 bits (713),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 176/583 (30%), Positives = 297/583 (51%), Gaps = 25/583 (4%)
 Frame = +3

             C  KRL  E +            PD++    L++   K   V  A QVF +M RRDV  W

             N++I+  A+    + A  LF++M + G   +  T+ S+L+ C    EL   G+++HS ++

             K G+     V N+L++MY  C  +  A  VF  A     D ++YN M+         +E 

             L +F  M +  + P  +T+++L+ + + P       +IH L V++G      V  A +TM

                C D+ + +  F+ I ++D+V +NA+I + AQ     EA   Y  M+ +GV  +  T 

              S+L   S+S+++   ++I S + ++G    +++ NA++S + + G++ +A   F  M  

             R+LISWNAII+G        +++ L+ ++ +EG+ P   T   +LSACA   ++  GK I

             H  IL+ G      + N L+ +Y +CG L  +  VF+    RDV+SWNSMI+ +AQHG  

               A   F+ M +   +EPD  TF  VLS C +   +E G QI +  +   G++  V   +

              ++++  R G L +A  +  +     D   W  +    A  G+

 Score =   249 bits (635),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 267/491 (54%), Gaps = 12/491 (2%)
 Frame = +3

             D  T+ ++L  C+ + L    +++H+ +V+ G      + N L+ MY  C+SV+DA  VF

             ++      D I++N++I+        ++A  +F  M+N   +P  +T++S++++C  P  

                  +IH+ ++K G+     V N+ ++MY  C DL   R +F  I  +D+VS+N M+  

             YAQ+    E +  + +M  EG+  D+ T  +LL   ++   +   + I  L ++ GL   

             I V  A+V+   + G+++ A + F+ +  R+++ +NA+I+    +G  +++   +  + +

             +G+  N  T  ++L+AC+   + + GK IH +I + G   +  IGN LI++Y++CG L  

             +  +F  M +RD++SWN++I+ YA+    GEA+  ++ M   G V+P + TF  +LSAC+

             ++    DG  I   ++ + GIK      + ++++  R G L EA+ + +      D   W

Query  2043  WTLFSSSAAHG  2075
              ++ +  A HG
Sbjct  501   NSMIAGHAQHG  511

 Score =   112 bits (279),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 140/301 (47%), Gaps = 44/301 (15%)
 Frame = +3

             LI  N ++A + R R+        +    S  ++P   T   +L+ACA+      G  +H

                LR+G+ +  H++N L++ Y +   L   + +F   Q+ DV SW ++++   + G  E

              A ++                               FQ+M +  +  DN TFASVLS C 
Sbjct  515   TAYKL-------------------------------FQEMQNEELEPDNITFASVLSGCK  543

             + E   LG+Q+H  + ++G     ++ NAL+ MY  C S+ DA  VF        D +++

              AMI G      + +A+ +F  M+N  +  P G TF S++S+C+        HA +V +G

Query  1017  F  1019
Sbjct  654   Y  654

>ref|XP_004485865.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
[Cicer arietinum]

 Score =   405 bits (1042),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 236/681 (35%), Positives = 368/681 (54%), Gaps = 41/681 (6%)
 Frame = +3

             Y LS+VL+AC  +     G QLH   L+ G ++ ++V N L++ Y               

                             + LG +  A+QVF+ MS+RD   +N++I+G A+   ++ AL LF

             ++MH   +  D  T AS+LS CS  +   +G+Q HS  +K G  +   V  +L+ +Y  C

               +  A + F  +D E V  + +N M+     +++  E+  +F  M+   ++P   T+ S

             ++ +C+         QIH  V+K GF     VS+  + MY+    L     IF R+KE D

             +VSW AMI  Y Q +   EA+  + EMQ +G+ +D     S +S+     ++     I +

                 +G    + + NA+VS + + G++ +AY  F  +F+++ ISWN++ISG   +G+  +

             +LN+F+++   GL  N++T  + +SA A + + + GKQIH  I K G   ET + N LI 

             LYSKCG +  + R F  M  ++ VSW +MI+ Y+QHG G EA+  FE M     V P   

             TF GVLSACSH GLV++GI  F SM   + + P  EH++C+VD+L R+G L  A   V+ 

               I+ D+ VW TL S+   H +  +G   A  LLE E  + A YVLLSN+YA +GKW   

                R++M+   V K+PG SW+

 Score =   276 bits (707),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 180/626 (29%), Positives = 314/626 (50%), Gaps = 46/626 (7%)
 Frame = +3

             PD  T + VL  C+    +  F  Q+HA  +  G  T   + N L+  Y K+        

                                    G ++ A +VFD +  +D   W A+I+G ++   +E A
Sbjct  243   -----------------------GFLKSAKKVFDNLKVKDSVSWVAMISGLSQNGYEEEA  279

             + LF +MH+ G+    Y  +SVLS C+ +  + LG Q+H +V+K GF + T V NALVT+

             Y    +++ A  VF        D+++YN++I+GL     N+ AL +F  M    L P  +

             T  SL+S CS     +   Q H+  +K G      V  + + +Y  C D+K     F   

               +++V WN M+ +Y Q +   E+   + +MQ EG+V ++FT  S+L +  ++      E

              I + V+K G    + VS+ ++  + K G+++ A + FR +   +++SW A+I+G   + 

                ++L+LF E+  +G+  +    ++ +SACAG+ +   G+QI       G   + SIGN

              L++LY++CG +  +   F  +  +D +SWNS+IS +AQ G   EA++ F  M  +G +E

              +  TF   +SA ++   V  G QI ++M+   G     E  + ++ + S+ G +D+AE 

             +  +  N   +   W  + +  + HG

 Score =   249 bits (635),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 172/600 (29%), Positives = 295/600 (49%), Gaps = 60/600 (10%)
 Frame = +3

              G+++ A+++FD+MS R ++ WN I        +TGC           LFQ+M    V  

             D  TFA VL  CS     +    Q+H+  +  GF  +  + N L+ +YF    +  A  V

             F++   +V D +++ AMI+GL      EEA+++F  M    +  T     S++S+C+   

                   Q+H LV+KQGF   T V NA +T+YS   +L +   +F  + ++D VS+N++I+

               AQ+     A+  + EM  E +  D  T+ SLL   SS+QS+   +   S  IK G+  

              I V  +++  + K  +I+ A+ +F    T N++ WN ++          +S  +F+++ 

              EG+ PN +T  ++L  C  + +   G+QIH  +LK G      + + LI +Y+K G L 

              + ++F+ + E DVVSW +MI+ Y QH K  EA+  F  M D G ++ D   F   +SAC

Query  1860  ---------------SHAGLVEDGIQIFNSMVNNYGIKPGVEH---------------FS  1949
                            SH     D + I N++V+ Y     V                 ++

              ++   +++GY +EA  I    N   +E++S  + +  S++A   + RLG+ +  ++ +T

 Score =   214 bits (544),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 144/528 (27%), Positives = 260/528 (49%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++L+ C+S Q  + G Q H++ ++AG+T+   V   LL  Y K  D+     

              F    + +V  W  +L A  +L ++  + Q+F QM                +I+     

                       G+  + +T+ S+L  C +L    LG Q+H+ V+KTGF     V + L+ M

             Y     +  A  +F    +   D +++ AMIAG    ++  EAL +F  M++  +    +

              F S +S+C+  +      QI A     G+ D  S+ NA +++Y+ C  ++     F +I

               KD +SWN++I+ +AQ     EA+  + +M + G+  + FT GS +S++ +V N  +  

              I +++ K G   + EVSNA+++ + K G I+ A R F +M  +N +SW A+I+G   +G

                ++L+LF ++    + P+  T   VLSAC+       GI  F+   + H  + K   +

                     ++ L  + G+L  + R  + M  + D + W +++SA   H

 Score =   149 bits (375),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/340 (29%), Positives = 166/340 (49%), Gaps = 13/340 (4%)
 Frame = +3

             TF+ L+  C +  + +   ++H  ++K GF     +    M  Y    DL     +F+ +

               + +  WN ++  +  + L G     +  M +E V  DE T   +L      A      

             E I +  I +G      + N ++  + K G ++ A + F ++  ++ +SW A+ISG   N

             G+  +++ LF ++   G+    Y LS+VLSAC  +  F  G+Q+HG +LK G   ET + 

             N L+ LYS  G L  + +VF  M++RD VS+NS+IS  AQ G    A+  F+ M     +

             +PD  T   +LS CS    +  G Q      ++Y IK G+

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 3/198 (2%)
 Frame = +3

             F  L+ E G+  N+ T   +L  C    SF  G ++HG ILK G + E  +   L+  Y 

               G L  + ++F  M+ R +  WN ++  +      G     F+ M+    VEPD+ TF 

             GVL  CS   +    ++  ++    +G +      + ++DI  + G+L  A+++     +

             + DS  W  + S  + +G
Sbjct  258   K-DSVSWVAMISGLSQNG  274

>ref|XP_010512450.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Camelina sativa]

 Score =   399 bits (1024),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 218/646 (34%), Positives = 364/646 (56%), Gaps = 11/646 (2%)
 Frame = +3

             SN +L   +KS  +   +++F ++   D ++W T++ A +K G +  A Q+F     ++ 

               WNA+I+G  +   ++ A  LF +M   G+   N YT  SVL LC SL L   G ++H 

              ++KTGF    +V+N L+ MY  CK + +A ++F     E  + +T+ +M+ G       

              +A+  F  +          TF S++++C   S      Q+H  +VK GF     V +A 

             + MY+ C+DL+  R + E ++  D+VSWN+MI    ++ L  EA+  +  M    +  D+

             FT+ S+L+    S   +  A     L++K G      V+NA+V  + K G ++ A + F 

              M  +++ISW A+++G   NG   ++L LF  +  EG++P+    ++VLSA A +   + 

             G+Q+HG  +K G     S+ N+L+ +Y+KCG L  +  +F  +  RD+++W ++I  YA+

             +GK  +++  +  M+ SG + PD  TF G+L ACSHAGL+E+    F+SM   YGI+PG 

             EH++C++D+  R+G   + EE++    +E D+TVW  + ++S  HG+   G   A  L+E

              E NN   YVLLSN+YA AG+ +E+A+VR LM+   + K+PG SWV

 Score =   201 bits (511),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 165/622 (27%), Positives = 289/622 (46%), Gaps = 85/622 (14%)
 Frame = +3

             +P+ YTL +VL  C S+   + G ++H   ++ G     +V NGLL+ YA+         

                                C ++ E EY   +F  MS  ++   W +++TG ++      
Sbjct  174   -------------------CKRISEAEY---LFGTMSGEKNNVTWTSMLTGYSQNGFAFK  211

             A+  F+ +   G   + +TF SVL+ C S+    +G QVH  +VK+GF     V +AL+ 

             MY  C+ +  A  + E    E  D +++N+MI G V     EEAL  F  M    +    

              T  S+++    S +D   A+  H L+VK G+G    V+NA + MY+    + +   +FE

              + EKD++SW A++T         EA+  +  M+ EG+  D+    S+LS+S  +   E 

                +    IK+GL   + V+N++V+ + K G +E A   F  +  R+LI+W A+I G   

             NG    SL L+  ++  G+TP+  T   +L AC+      H     G I +  S+ +   

               ++  +Y  + G  H++                 MI  +   G+ G+     E +++  
Sbjct  557   --SMRTVYGIRPGPEHYAC----------------MIDLF---GRSGDFFKV-EELLNQM  594

              VEPD   +  +L+A    G +E+G +   +++    ++P     +  + ++ + AG  D

Query  1989  EA---EEIVKTKNIEVDSTVWW  2045
             EA     ++K++NI  +    W

>gb|AEB39778.1| pentatricopeptide repeat protein 77 [Funaria hygrometrica]

 Score =   407 bits (1046),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 211/620 (34%), Positives = 352/620 (57%), Gaps = 10/620 (2%)
 Frame = +3

              S DV    +L+S   + G++  A ++F+ M +RD+  WNAII G A  +D   A+ L++

             +M S GV     TF  +LS C+    +  G+ +H  ++++G  +   + NAL+ MY  C 

             S+++A  VFE       D I++N+MIAG       E A  +F  M+   L P  +TF S+

             +  C +P       QIH L+++ G     ++ NA + MY  C  L+    +F  ++ +++

             +SW AMI  +A +    +A   + +MQ +G    + T  S+L +  S A     + +++ 

             ++ +G  L   V NA++SA+ K G +  A + F  M  R+++SWN +I+G   NG    +

             L    ++  +G+  N ++  ++L+AC+   + + GK++H  I+K     +  +G  LI++

             Y+KCG L  +  VF   TE++VV+WN+MI+AYAQHG   +A+  F  M   G ++PD +T

             FT +LSAC+H+GLV +G +IF+S+ + +G+ P +EH+ C+V +L RAG   EAE ++   

                 D+ VW TL  +   HG+  L    A   L+    NPAVYVLLSN+YA AG+W++ A

              +R +M+   + K+PG SW+

 Score =   281 bits (720),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 179/626 (29%), Positives = 315/626 (50%), Gaps = 47/626 (8%)
 Frame = +3

             P   T  ++LTAC S     +G ++H+  + AG      V N LL+ Y K +DL   +++

             FS I   DV S+ T+L    +   VE  + +F QMS                        
Sbjct  241   FSGIYRRDVVSYNTMLGLYAQKAYVEECIGLFGQMS------------------------  276

                    S G+  D  T+ ++L +  +  +   G+++H + V  G  +   V  AL TM+

               C  V  A    E   D   D + YNA+IA L      EEA   +  MR+  ++    T

             ++S++++CS          IH+ + + G      + N+ ++MY+ C DL   R +F  + 

             ++D++SWNA+I  YA+    GEA+  Y +MQ EGV     T   LLS+   S + ++ +M

             I   ++++G+     ++NA+++ + + G I +A   F     R++ISWN++I+G   +G 

                +  LF E+  EGL P+  T ++VL  C    + + G+QIH  I++ G  L+ ++GN 

             LI +Y +CG L  +  VF  +  R+V+SW +MI  +A  G+  +A   F  M + G  +P

              K+TF+ +L AC  +  +++G ++   ++N+ Y +  GV   + ++   S++G + +A +

             +  K  N ++ S  W  + +  A +G

 Score =   273 bits (697),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 171/585 (29%), Positives = 298/585 (51%), Gaps = 22/585 (4%)
 Frame = +3

             + + L   KR+ +++      PD++    L++   K   V  A QVF +M RRDV  WN+

             +I+  A+    + A  LF++M + G      T+ S+L+  CS      G+++HS +++ G

             +     V N+L+ MY  C+ +  A  VF        D ++YN M+         EE + +

             F  M +  + P  +T+++L+ + + P       +IH L V +G      V  A  TM+  

             C D+   +   E   ++D+V +NA+I + AQ     EA   Y +M+ +GVV +  T  S+

             L   S+S+++   E+I S + + G    +++ N+++S + + G++ +A   F  M  R+L

             ISWNAII+G        +++ L+ ++ +EG+ P   T   +LSAC    ++  GK IH  

             IL+ G      + N L+ +Y +CG +  +  VF+    RD++SWNSMI+ +AQHG    A

                F  M   G +EPDK TF  VL  C +   +E G QI + ++   G++  V   + ++

             ++  R G L +A E+   ++ +N+      W  +    A  G+ R

 Score =   217 bits (552),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 148/570 (26%), Positives = 267/570 (47%), Gaps = 57/570 (10%)
 Frame = +3

             LI  N ++A + R R+        +    S  ++P   T   +L+AC +      G  +H

                LR+G+ +  H++N L++ Y +   +   + +F   ++ D+ SW ++++   + G  E

              A ++F +M +                                G+  D  TFASVL  C 
Sbjct  570   AAYKLFLEMKKE-------------------------------GLEPDKITFASVLVGCK  598

             + E   LGRQ+H +++++G     ++ NAL+ MY  C S+ DA  VF       V  +++

              AMI G      + +A  +F  M+N    P   TF S++ +C          ++ A ++ 

              G+   T V NA ++ YS    +   R +F+++  +DI+SWN MI  YAQ  LGG A+  

               +MQ +GVV ++F+  S+L   SS  ++   + + + ++K  +   + V  A++S + K

              G +E+A   F +   +N+++WNA+I+    +G   ++L+ F+ +  EG+ P+  T +++

             LSAC        G +I        S LE+  G          L+ L  + G    + T +

              Q+    D   W +++ A   HG    A H

 Score =   158 bits (399),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 187/363 (52%), Gaps = 8/363 (2%)
 Frame = +3

             +V L+ +C+   +   A +IHA +V+ G G    +SN  + MY  C+ +     +F ++ 

              +D++SWN++I+ YAQ+    +A   + EMQ  G +  + T  S+L++  S A  E    

             I S +I+ G      V N++++ + K  ++  A + F  ++ R+++S+N ++       +

               + + LF ++ +EG+ P+  T   +L A         GK+IH   +  G   +  +G  

             L  ++ +CG +  + +  +   +RDVV +N++I+A AQHG   EA   +  M   G V  

             ++ T+  VL+ACS +  +  G ++ +S ++  G    V+  + ++ + +R G L  A E+

Query  2004  VKT  2012
Sbjct  443   FNT  445

>ref|XP_004504288.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like isoform X1 [Cicer arietinum]
 ref|XP_004504289.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like isoform X2 [Cicer arietinum]

 Score =   400 bits (1028),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 213/603 (35%), Positives = 357/603 (59%), Gaps = 13/603 (2%)
 Frame = +3

             G++    ++FD++    V +WN +++  A+I +   +L LF KM  LG++ D+YTF  VL

               C   L  +   ++VH  V+K GF ++T+V+N+L+  YF    V  A  +F++  D   

             D +++N+MI G V    +   L +F  M  + +     T VS++ +C++         +H

             A  VK  F      SN  + MYS C +L     +F ++ E  IVSW ++I +Y +E L  

             +AI  + EMQ +GV  D +T+ S++ +   S S+     + S VIKN ++  + V+NA++

             + + K G +E+A   F  +  ++++SWN +I G   N  P  +L LFS+++ E L P+  

             T++ VL ACAG+ +   G++IHG+IL+ G F +  +   L+ +Y+KCG+L  +  +F ++

              ++D++SW  MI+ Y  HG G EA+  F  M  +G +EPD+++FT +L+ACSH+GL+ +G

              + FNSM N   I+P +EH++C+VD+L RAG L +A + +++  I+ ++T+W  L S   

              H D +L   VA  + E E +N   YV+L+N+YA+A KWEE+  +RE MQR    + PG 

Query  2247  SWV  2255
Sbjct  748   SWI  750

 Score =   192 bits (489),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 137/530 (26%), Positives = 259/530 (49%), Gaps = 33/530 (6%)
 Frame = +3

             NA I    E+ D   A+   +    H LG++    T+ SVL LC    SLE    G+++H

              ++V  G     ++   LV MY NC  +V    +F++  ++ V    +N M++    +  

               E+L +FN M+ + +     TF  ++   ++        ++H  V+K GFG  T+V N+

              +  Y     +++   +F+ + ++D+VSWN+MI            +  +++M   GV  D

               TL S+L +  ++ N  +   + +  +K     ++  SN ++  + K G +  A   F 

              M    ++SW +II+     G    ++ LF E+ ++G+ P+ YT+++++ ACA   S   

             G+ +H Y++K        + N L+ +Y+KCG +  +  VF  +  +D+VSWN+MI  Y++

             +     A+  F  MV+  +++PD  T   VL AC+    ++ G +I   ++   G    +

              H +C +VD+ ++ G L  A+   +++  K    D   W  + +    HG

 Score =   171 bits (434),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 131/485 (27%), Positives = 236/485 (49%), Gaps = 25/485 (5%)
 Frame = +3

              +L++A  K G VE A  +FD++S RDV  WN++I GC         L +F +M  LGV 

              D  T  SVL  C+ +    LGR +H+  VK  F       N L+ MY  C ++  A  V

             F    +  +  +++ ++IA  V     ++A+ +F+ M++  + P   T  S++ +C+   

             +      +H+ V+K        V+NA M MY+ C  ++  RL+F +I  KDIVSWN MI 

              Y++ +L   A+  + +M  E +  D+ T+  +L +   +A       I   +++ G   

              + V+ A+V  + K G +  A   F  +  ++LISW  +I+G   +GF  ++++ F+++ 

               G+ P+  + + +L+AC+       G +    +    S +E  + +   ++ L  + G 

             L  + +  + M  + +   W +++S    H   K  E V  H FE       +EPD   +

Query  1839  TGVLS  1853
Sbjct  713   YVVLA  717

 Score =   156 bits (395),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 117/417 (28%), Positives = 191/417 (46%), Gaps = 43/417 (10%)
 Frame = +3

             D  TL +VL ACA+I +   G  LHAFG++A  +     SN LL  Y+K  +L G     

                                       A +VF +M    +  W +II         + A+ 
Sbjct  360   --------------------------ATEVFVKMGETTIVSWTSIIAAYVREGLYDDAIG  393

             LF +M S GV  D YT  S++  C+       GR VHS V+K   ++   V NAL+ MY 

              C S+ +A  VF     +  D +++N MI G         AL +F+ M    L P  +T 

               ++ +C+         +IH  ++++G+     V+ A + MY+ C  L   +++F+ I +

             KD++SW  MI  Y     G EAI  + +M+  G+  DE +  ++L+  S   + N     

                ++N   +  K+E    +V    + G + +AY++   M  + N   W A++SGC+

 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 82/316 (26%), Positives = 155/316 (49%), Gaps = 16/316 (5%)
 Frame = +3

             L +  +S+ + + I  +++  G+ +K  +   +V  +   G++ +    F ++    +  

             WN ++S     G   +SL LF+++   G+  ++YT + VL     +   +  K++HGY+L

             K G    T++ N+LIA Y K G +  +  +F  +++RDVVSWNSMI+    +G     + 

              F  M+  G V  D  T   VL AC++ G +  G       ++ +G+K    G   FS  

             ++D+ S+ G L+ A E+   K  E     W ++ ++    G  D  +G       ++++ 

Query  2127  NNPAVYVLLSNIYADA  2174
               P +Y + S ++A A
Sbjct  403   VRPDIYTVTSIVHACA  418

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 116/250 (46%), Gaps = 35/250 (14%)
 Frame = +3

            RPD YT+++++ ACA       G  +H++ ++  + +   V+N L++ YAK   +   + 

            +FS+I + D+ SW T++   +K      AL++F  M  +                     

                       +  D+ T A VL  C+ L     GR++H  +++ G+ +   V  ALV M

            Y  C  +V A  +F+    +  D I++  MIAG        EA+  FN MR   + P   

Query  939  TFVSLMSSCS  968
            +F +++++CS
Sbjct  610  SFTAILNACS  619

 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 89/192 (46%), Gaps = 11/192 (6%)
 Frame = +3

             T  +VL  CA   S + GK+IH  I+  G  ++ ++G  L+ +Y  CG L     +F  +

                 V  WN M+S YA+ G   E++  F  M   G +  D  TFT VL   +  G V++ 

              +     V+ Y +K G    + +V+ L  A    G ++ A  +    + + D   W ++ 

Query  2055  SSSAAHGDTRLG  2090
             +    +G +R G
Sbjct  279   NGCVVNGFSRNG  290

>ref|XP_010266600.1| PREDICTED: pentatricopeptide repeat-containing protein At3g03580 
[Nelumbo nucifera]

 Score =   402 bits (1032),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 230/685 (34%), Positives = 365/685 (53%), Gaps = 42/685 (6%)
 Frame = +3

             RPD +T  +V+ +CA +  +  G  +H   L  G  +  ++ N L+  Y           

                                 ++ G +E A  VF+ M +RD+  WN++++G +   + E A

             L ++ K+  LG   D++T +S+L  C SL     G+ +H +V K G      V N L+ M

             YF    + DA  +F +      D +++N +I G   +  +EEA+ +F +M      P  L

             T  +++ +C    D      +H  + + G+   T+ SN  +TMY+ C DL A+  +F+ +

               +D VSWN++I SY Q     E +   L M++ G+  D  T   LLS    +A   +  

              L   +IK G    + V NA+V  + K G +E A + F DM TR++I+WN II+GC   G

                  L + S++ A+G+ P+  T   +L  C+ + + + GK+IHG ILKFG  L+  I N

              LI +YSKCGIL WS  VF     +DVV+W ++ISA   +G+G +A+  F  M  +G V 

             PD  TF  ++ ACSHAGLV++G+  FN M N+Y I+P +EH++CIVD+LSR+G L EAEE

              +       D+++W +L S+   +  T++   V   +L    ++   YVL SNIYA  GK

             W++   +R+ ++   + K PG SW+

 Score =   206 bits (524),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 150/559 (27%), Positives = 274/559 (49%), Gaps = 24/559 (4%)
 Frame = +3

             L+S   + G+   +  VF ++S+  ++ +WN+II    +      ALN + +M  L +  

             D +TF SV++ C+  L   +G+ VH  V++ GF +   + N+L+ MY     + +A  VF

             E       D +++N++++G  +    E AL ++  +R +  +P   T  S++ +C   + 

             A +   IH LV K G      V+N  + MY     +   + IF  + ++D VSWN +I  

             Y++  +  EAI  +  M       D  T+ ++L +   V + E+   +   + +NG    

                SN +++ + K G++  + + F  M +R+ +SWN++I+     GC + G  M+ L + 

              ++   GL P++ T   +LS C  I +   GK++H  I+K G      +GN L+ +Y KC

             G L  + + F  M  RDV++WN++I+   Q G     +     M   G V PD ATF G+

             L  CS       G +I   ++  +G    V   + ++++ S+ G L+ +  +     ++ 

             D   W  L S+   +G  +

 Score =   177 bits (449),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 198/367 (54%), Gaps = 8/367 (2%)
 Frame = +3

             +IH+L++  G       S   ++ Y+   D  A++ +F R+ +  +I  WN++I +  Q 

              +  EA+  Y EMQ+  +  D FT  S+++S   + ++EM   +   V++ G    + + 

             N+++  + + G +E+A   F  M  R+++SWN+++SG  +NG   ++L ++ +L   G  

             P+++T+S++L AC  + + + GK IHG + K G   +  + N LIA+Y K   +  + R+

             F  M +RD VSWN++I  Y++ G   EA++ F+ MV S   +PD  T T VL AC H G 

             +E G  +   M  N G +      + ++ + ++ G L  + ++     +  DS  W +L 

Query  2055  SSSAAHG  2075
             +S   +G
Sbjct  448   NSYIQYG  454

 Score =   127 bits (319),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/283 (28%), Positives = 151/283 (53%), Gaps = 4/283 (1%)
 Frame = +3

             F++   L  + S+   + I SL+I  GL   +  S  ++S + + G+   +   FR +  

             + N+  WN+II     N    ++LN +SE+    L P+ +T  +V+++CAG+   + GK 

             +H ++L+ G   +  IGN+LI +YS+ G L  +  VF+ M +RD+VSWNS++S Y+ +G+

                A+  +  +   G + PD  T + +L AC      E+G +I + +V+  GI+  +   

             + ++ +  +  ++ +A+ I     I+ D+  W T+    +  G

>ref|XP_007030706.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY11208.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 
[Theobroma cacao]

 Score =   404 bits (1039),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 231/685 (34%), Positives = 364/685 (53%), Gaps = 41/685 (6%)
 Frame = +3

             P  Y  S+VL+AC  I+    G QLH+   + G ++ ++V N L++ Y++S         

                                   G +  A Q+F  M  RD   +N++I+G A+    + AL
Sbjct  345   ----------------------GSLVSAEQIFSNMQLRDGVTYNSLISGLAQCGYSDRAL  382

              LF+KMH   +  D  T AS+L  C SL     G+Q+HS  +K GF     V  +L+ +Y

               C  +  A   F   + E V  + +N M+     ++   E+  +F  M+   L+P   T

             + S++ +C+         QIH+ V+K GF     V +  + MY+    L+    I  ++ 

             E+D+VSW AMI  Y Q ++  EA+  + EM   G+ +D   L S +S+    Q+++  + 

             I +    +G    + + NA+VS + +  + + AY+ F+ +  ++ ISWNA+ISG   +GF

               ++L +FS++   GL    YT  + +SA A   + + GKQIH  I+K G  LE    N 

             LI LY+KCG +  + + F  + E++ VSWN+MI+ Y+QHG G EA+  FE M   G V P

             +  T  GVLSACSH GLV++G+  F+SM   +G+ P  EH++C+VD+L RAG L  A + 

             V+   IE D+ +W TL S+ A H +  +G   A  LL+ E  + A YVLLSN+YA + KW

             +     R++M+   V K+P  SW+ 

 Score =   286 bits (733),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 187/626 (30%), Positives = 323/626 (52%), Gaps = 46/626 (7%)
 Frame = +3

             P+  T + +L AC+ S     +  Q+HA  +R G    S V N L+  Y           

                                 TK G ++ A++VFD++  +D   W A+I+G ++   +E A

             + LF +MH  G+    Y F+SVLS C+ +E + LG Q+HS+V K GF + T V NALVT+

             Y    S+V A  +F +   ++ D +TYN++I+GL     ++ AL +F  M +  L P  +

             T  SL+ +C+      T  Q+H+  +K GF     V  + + +Y  C D++     F   

             + +++V WN M+ +Y Q +   E+   + +MQ EG+V ++FT  S+L +  S+      E

              I S VIK G    + V + ++  + KLG++E A    R +   +++SW A+I+G   + 

                ++L LF E+L  G+  +   LS+ +SACAGI +   G+QIH      G   + SIGN

              L++LY++C     + + F+ +  +D +SWN++IS + Q G   EA+  F  M  +G +E

                 T    +SA ++   ++ G QI ++M+   G    +E  + ++ + ++ G +D+A +

             E ++    E +   W  + +  + HG

 Score =   230 bits (586),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 143/483 (30%), Positives = 248/483 (51%), Gaps = 11/483 (2%)
 Frame = +3

             G+++ A+ VFD M +R+V  WN +I+G          L  + +M    V+ +  TFA +L

               CS   +W     Q+H+ +++ GF  ++ V N L+ +Y     +  A  VF+     V 

             D +++ AMI+GL      E+A+++F+ M    + PT   F S++S+C+         Q+H

             +LV KQGF   T V NA +T+YS    L +   IF  ++ +D V++N++I+  AQ     

              A+  + +M  + +  D  T+ SLL +  S+      + + S  IK G  + I V  +++

               + K  +IE AY +F    T N++ WN ++          +S ++F ++  EGL PN +

             T  ++L  C  + +   G+QIH  ++K G      + + LI +Y+K G L  +  + + +

              E DVVSW +MI+ Y QH    EA+  F  M++ G ++ D    +  +SAC+    +  G

Query  1887  IQI  1895
Sbjct  619   QQI  621

 Score =   228 bits (582),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 152/528 (29%), Positives = 261/528 (49%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++L ACAS+     G QLH++ ++AG +    V   LL  Y K  D+     

              FS  ++ +V  W  +L A  +L  +  +  +F QM                +I+     

                       G+  + +T+ S+L  C SL    LG Q+HS V+KTGF     V + L+ M

             Y     +  A  +     +E  D +++ AMIAG    +   EAL +F  M N  +    +

                S +S+C+         QIHA     GF D  S+ NA +++Y+ C   +     F++I

               KD +SWNA+I+ + Q     EA+  + +M + G+ A  +T  S +S++ + AN    +

              I +++IK G  L+IE SN +++ + K G I+ A + F ++  +N +SWNA+I+G   +G

             + +++++LF ++   G+TPN  TL  VLSAC+       G+  F    + HG + K   +

                     ++ L  + G+L  + +  + M  E D + W +++SA A H

 Score =   173 bits (439),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/380 (31%), Positives = 189/380 (50%), Gaps = 18/380 (5%)
 Frame = +3

             E N + +     M N  +     TF+ L+  C +  +  Q   +H  ++K GF     +S

                M ++    DL A   +F+ + ++++ SWN MI+ +  + L  + +  Y  M  E V 

              +E T   +L +           E I + +I++G      V N ++  + K G I+ A +

              F  ++ ++ +SW A+ISG   NG+  Q++ LFSE+   G+ P  Y  S+VLSAC  I  

             F+ G+Q+H  + K G   ET + N L+ LYS+ G L  + ++F  M  RD V++NS+IS 

              AQ G    A+  FE M     ++PD  T   +L AC+  G +  G Q+     ++Y IK

              G   FS  +DI+     LD
Sbjct  426   AG---FS--MDIIVEGSLLD  440

 Score =   107 bits (266),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 114/464 (25%), Positives = 206/464 (44%), Gaps = 67/464 (14%)
 Frame = +3

             L  +P+   E ++    ++A +T+   FY AL LF  + +  + + D+  LS+ ++ACA 

             IQ    G Q+HA    +G +    + N L+S YA+        + F +I + D  SW  L

             +S  T+ G  E ALQVF QM++   A   A +  C                         
Sbjct  672   ISGFTQSGFCEEALQVFSQMNK---AGLEATLYTC-------------------------  703

                +SV +  +      G+Q+H+M++K G+       N L+T+Y  C S+ DA   F + 

              ++  +++++NAMI G        EA+ +F  M+ + + P  +T V ++S+CS       

              H  +V +G     S+S           Y+   DL        +A + + +   E D + 

             W  ++++ A  +N+  GE    +L        A    L +L + S+   + +    ++ +

              G+  +     IEV N+I + F   +L  + E+ Y +  D+  R

>ref|XP_010937493.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At2g01510 [Elaeis guineensis]

 Score =   396 bits (1018),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 229/655 (35%), Positives = 360/655 (55%), Gaps = 10/655 (2%)
 Frame = +3

             ++ G     + +N LL  +  + +L   ++LF E+   ++++   ++S   K GE++ A 

             ++FD    R+   W  ++   A+    + A  LF  M   G+  D+ T A++L+ C   E

             L     Q H+  +K G  AT  V N LV  Y  C  +      F +  +   D +TYNAM

             + G        E L +   MR + L P+  TF  ++++ +   D     QIH LV++  F

             G    V+N+ +  YS C  L+  R++F+ + E+D VS+N MI++YA      E +  + E

             +Q  G    +F   SLLS + +V N +M   I + VI+        V NA++  + K G 

             +E A   F     RN ISW A+ISG   +G   ++L LF E+  +GL+P+  TLS++L A

              AG+     GKQ+H YI++ G       G  L+ +Y+KCG L  +  +F+ M  ++++SW

             N+MISAYAQ+G+G +AV+ F+ M+  G VEPD  TF  VLSACSH+GL+++G++ FNSM 

               Y +KP  EH++C++D+L R G LDE E +V     E D  +W ++ SS   H +  L 

             R  A  L   E  + A YV+ SN+YA AG+WE++A V+++M+   V K+P  SWV

 Score =   154 bits (390),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 124/452 (27%), Positives = 208/452 (46%), Gaps = 43/452 (10%)
 Frame = +3

             L+  N ++  +++   FY  +        +  L+P  +T S VLTA   +     G Q+H

                +R        V+N LL FY+K   L   + LF E+   D  S+  ++SA        

             YA              WN            +  LNLF+++  +G     + FAS+LS+  
Sbjct  318   YA--------------WNG---------QTKELLNLFRELQFIGFDQSQFPFASLLSVAG  354

             ++    +GRQ+H+ V++T   +   V NAL+ MY  C  +  A  +F    D   + I++

              AMI+G +   R EEAL +F+ M+   L P   T  S++ + +         Q+H+ +++

              G+        A + MY+ C  L  T  IFE +  ++I+SWNAMI++YAQ   G +A+  

             +  M R GV  D  T  S+LS+       +  L    S+     L  K E    ++    

             ++G +++  R    + F  + I WN+I+S C+

>ref|XP_007025334.1| Pentatricopeptide, putative [Theobroma cacao]
 gb|EOY27956.1| Pentatricopeptide, putative [Theobroma cacao]

 Score =   399 bits (1026),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 216/613 (35%), Positives = 351/613 (57%), Gaps = 13/613 (2%)
 Frame = +3

             + L+S     G+++    +FD+M ++ V +WN ++   A+  D + ++ LF+ M   G+ 

              D+YTF+ +L  C     GL  G +VH  ++K GF +  SV+N+L+T YF  K V  A  

             +F++  D   D I++N+MI+G VS    E+ L +F  M  + +     T V+++  C++ 

              T      +HAL +K  F    + +N  + MYS C DL     +FE++ E+++VSW +MI

               Y ++     AI    +M+REGV  D   + S+L   + S S+ N + +   +  N + 

               + V NA++  + K G +E A   F  M  +++ISWN +I G   N  P ++L + + +

             L E L P++ TL+ +L ACA + + + GK+IHG+IL+ G F +  + N L+ LY KCG+L

               +  +F +++ +D+VSW  MI+ Y  HG   EA+  F  M D+G +EPD+ +F  +L A

             CSH+GL+E+G + F  M N+Y I+P +EH++C+VD+LSR G L +A   ++   I  D+T

             +W  +      + D +L   VA  + E E  N   YVLL+NIYA+A KWEE   VRE + 

Query  2217  RYRVIKQPGSSWV  2255
             R  + K PG SW+
Sbjct  733   RKGLRKNPGCSWI  745

 Score =   144 bits (363),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 114/420 (27%), Positives = 180/420 (43%), Gaps = 49/420 (12%)
 Frame = +3

             D  T+ TVL  CA+      G  +HA  ++A      + +N LL  Y+K  DL G  R+F

              ++   +V SWT++++  T+ G+ + A+++  QM R                        
Sbjct  360   EKMGERNVVSWTSMIAGYTRDGQSDGAIRLLQQMERE-----------------------  396

                     GV  D     SVL  C    SLE    G+ VH  +      +   V NAL+ 

             MY  C S+ DA  +F      V D I++N MI G        EAL M   M    L P  

              T   ++ +C+         +IH  +++ G+     V+NA + +Y  C  L   RL+F+ 

             I  KD+VSW  MI  Y       EAI  + EM+  G+  DE +  S+L   S   +    

                  +++N   +  K+E    +V    + G + +A+ +   M    +   W A++ GC+

 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/207 (26%), Positives = 105/207 (51%), Gaps = 15/207 (7%)
 Frame = +3

             NL + +    ++PN+     T  ++L  CA + S + GK++H  I   G  ++  +G+ L

             ++ Y  CG L     +F  M ++ V  WN M++ YA+ G   E+++ F+ M+  G +E D

               TF+ +L   + +G +++G       V+ Y +K G   ++ +V+ L     +   ++ A

              E+   + I+ D   W ++ S   ++G

 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 2/103 (2%)
 Frame = +3

            +PD  TL+ +L ACAS+     G ++H   LR G  +  HV+N L+  Y K   L   + 

            LF  I S D+ SWT +++     G    A+  F++M  RD  +

>ref|XP_008386813.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Malus domestica]
 ref|XP_008386814.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Malus domestica]

 Score =   404 bits (1039),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 228/685 (33%), Positives = 364/685 (53%), Gaps = 43/685 (6%)
 Frame = +3

             P  Y  S+VL+ACA I+    G QLH    + G +  ++V N L++ Y++S         

                                   G    A Q+F  M  RD   +N++I+G A+    + AL
Sbjct  357   ----------------------GNFISAEQIFKTMWHRDAVSYNSLISGLAQCGFSDRAL  394

              LF++M    +  D  T AS+LS C+ E+  L  G+Q+HS+ +K G  +   +  +L+ +

             Y  C  V  A   F   + E V  + +N M+     ++  +++  +F  M    ++P   

             T+ S++ +C+         QIH  V+K GF     V +  + MY+   +L     I  R+

                D+VSW AMI  YAQ +L  E+++ + EMQR G+ +D     S +S+    Q++    

              I +     G    + V NA+V+ + + G I++AYR F    +++ +SWN +ISG   +G

                ++L +F+ +   G+  N +T  + +SA A + + + G+QIH  I+K GS  ET + N

              LI LYSKCG +  + R F  M E++ +SWN+MI+ Y+QHG+G E++H FE M   G + 

             P   TF GVL+ACSH GLV +G+  F SM   +G+ P  EH++C+VD+L RAG L  A +

              ++   ++ D+ +W TL S+     +T +G   A  LLE E  + A YVLLSN+YA +G 

             W+     R+LM+   V K+PG SW+

 Score =   280 bits (717),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 181/625 (29%), Positives = 316/625 (51%), Gaps = 44/625 (7%)
 Frame = +3

             PD  T S VL AC  S  H  +  Q+HA  +  G  T   V N L+  YAK+        

                                    G V+ A +VFD++  RD   W A+I+G ++   ++ A
Sbjct  256   -----------------------GSVDAAKKVFDKLYIRDSVSWVAMISGLSQNGREKEA  292

             + LF +M +  +    Y F+SVLS C+ +EL+ +G Q+H ++ K GF   T V NALVT+

             Y    + + A  +F+       D ++YN++I+GL     ++ AL +F  M+   L P  +

             T  SL+S+C++        Q+H+L +K G      +  + + +Y  C D++     F   

             + +++V WN M+ +Y Q +   ++   + +M  EG++ +++T  S+L +  SV      E

              I + VIK G    + V + ++  + K GE++ A R  R +   +++SW A+I+G   + 

                +SL LF E+   G+  +    S+ +SACAGI + + G+QIH     FG   + S+GN

              L+ LY++CG +  + R F+    +D +SWN +IS +AQ G   EA+  F  M  +G +E

              +  TF   +SA ++   ++ G QI  +++   G     E  + ++ + S+ G +D+A+ 

                ++  E +   W  + +  + HG

 Score =   220 bits (560),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 150/526 (29%), Positives = 259/526 (49%), Gaps = 58/526 (11%)
 Frame = +3

             RPD  T++++L+ACA I     G QLH+  ++AG+++   +   LL  Y K  D+     

              F   ++ +V  W  +L A  +L +++ + ++F Q                         
Sbjct  466   FFLTTETENVVLWNVMLVAYGQLDDLDQSFRIFRQ-------------------------  500

                   MH  G+  + YT+ S+L  C S+    LG Q+H+ V+KTGF     V + L+ M

             Y     +  A  +     ADD V    ++ AMIAG    +   E+L++F  M+   +   

              + F S +S+C+         QIHA     G+ D  SV NA +T+Y+ C  ++     FE

                 KD +SWN +I+ +AQ     EA+  +  M + G+ A+ FT GS +S++ ++ N   

              + I + +IK G   + EVSNA+++ + K G I+ A R F +M  +N ISWNA+I+G   

             +G  ++S++LF ++   G+ P+  T   VL+AC+       G+  F+  ++ HG + K  

              +        ++ L  + G L  + +  + M  + D + W +++SA

 Score =   201 bits (510),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/472 (28%), Positives = 230/472 (49%), Gaps = 13/472 (3%)
 Frame = +3

             +++HS ++K GF A   + + L+  Y     +  A  VF+D     +   ++N +I   +

             + +   + L  F+ M    + P   TF  ++ +C           QIHA V+  GFG   

              V N  + +Y+    + A + +F+++  +D VSW AMI+  +Q     EAIL ++EMQ  

              ++   +   S+LS+   +      E +  L+ K G   +  V NA+V+ + + G    A

              + F+ M+ R+ +S+N++ISG    GF  ++L LF  +  + L P+  T++++LSACA I

              + Q GKQ+H   +K G   +  +  +L+ LY KC  +  +   F      +VV WN M+

              AY Q     ++   F  M   G + P++ T+  +L  C+  G +  G QI   ++   G

                 V   S ++D+ ++ G LD A  I+  + +  D  V WT   +  A  D

 Score =   165 bits (418),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 110/400 (28%), Positives = 196/400 (49%), Gaps = 13/400 (3%)
 Frame = +3

             N + +   + M    +     T++ L+  CS+    + + ++H+ ++K GF     + + 

              +  Y    DL     +F+ +  + + SWN +I  +    L  + +  +  M  + V  D

             E T   +L     S+  +   + I + VI +G    + V N ++  + K G ++ A + F

               ++ R+ +SW A+ISG   NG   +++ LF E+    + P  Y  S+VLSACA I  F+

              G+Q+HG I K G   ET + N L+ LYS+ G    + ++F+ M  RD VS+NS+IS  A

             Q G    A+  F+ M +D  R  PD  T   +LSAC+  G ++ G Q+ +S+    G+  

              +     ++D+  +   +  A +   T   E ++ V W +

>ref|XP_011089782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X2 [Sesamum indicum]

 Score =   403 bits (1036),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 243/720 (34%), Positives = 385/720 (53%), Gaps = 52/720 (7%)
 Frame = +3

             +S +L AC+       F  Q+HA  +R G +    V N L+  Y K++          ++

Query  387   C------------GVKR---------LFSEIQS----PDVYSWTTLLSACTK-----LGE  476
             C            G+ +         L+SE++     P  Y +++++SACTK     LGE

               +AL +F++M  +D   +N +I+G A    +E AL LF+KMHS  +  D+ T A +L  

             CS + +   G Q+HS  +K G  +   +  +L+ +Y  C  +  A   F     + V  +

              +N M+     +   +E+  +++ M+ + L P   T+ S++ +C+         Q+H  V

             +K GF     V +  + MY+   +L+    IF R+ E DIVSW AMI  YAQ ++  EA+

               + EMQ  G+++D   L S +S+    Q++     I S  I +G    I + NA+V  +

              + G   +A+  F  M+ R+ +SWNA+ISG   +G   ++L +FS+++  G   N +T  

             + +SA A + +   GKQIH   +K G   E  + N LI LY+KCG L+ + RVF  M E+

             + VSWN+MI+ Y+QHG G +A+  FE M    +++P+  T+ GVL+ACSH GLVE+G+  

             F SM   + + P  EH++C+VD+L RAG +  A   V++  I  D+ VW TL SS   H 

             +T +G   A  LLE E  + A YVL+SN+YA  GKW+     R LM+   V K+PG SW+

 Score =   209 bits (532),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 128/460 (28%), Positives = 228/460 (50%), Gaps = 40/460 (9%)
 Frame = +3

             +PD  T++ +L  C+SI     G QLH++ ++AG+ +   +   LL  Y K  D+    +

              F   Q+ +V  W  +L A  ++G ++                                +
Sbjct  405   FFVATQTDNVVLWNVMLVAYGQIGNLQE-------------------------------S  433

              N++ +M  LG+  + YT+ S+L  C S+    LG QVH+ V+KTGF     V + L+ M

             Y     +  A  +F   +++  D +++ AMIAG    +  +EAL +F  M+   ++   +

                S +S+C+         QIH+  +  G+    S+ NA + +Y+ C       L F+++

               +D VSWNA+I+ +AQ     EA+  + +M + G   + FT GS +S++ ++ N  +  

              I +  IK G   +IEV N +++ + K G +  A R F +M  +N +SWNA+I+G   +G

             +  Q++ LF ++    + PN  T   VL+AC+ +   + G

 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 79/160 (49%), Gaps = 14/160 (9%)
 Frame = +3

            +T  + ++A A++ +   G Q+HA  ++ G      V N L++ YAK   L G +R+F+E

            +   +  SW  +++  ++ G    A+++F+ M+    + +   +  ++  C+ +   E  

            LN F+ M   HSL    ++Y        C +++ G   QV

>ref|XP_010413449.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Camelina sativa]

 Score =   397 bits (1021),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 216/645 (33%), Positives = 360/645 (56%), Gaps = 10/645 (2%)
 Frame = +3

             SN +L   +KS  +   +++F ++   D ++W T++ A +K G +  A Q+F     ++ 

               WNA+I+G  +   ++ A  LF +M   G+  + YT  SVL LC+ L L   G +VH  

              +KTGF    +V+N L+ MY  CK + +A ++F     E  + +T+ +M+ G        

              A+  F  +          TF S++++C   S      Q+H  +VK GF     V +A +

              MY+ C+DL+  R + E ++  D+VSWN+MI    ++ L  E +  +  M    +  D+F

             T+ S+L+    S   +  A     L++K G      V+NA+V  + K G ++ A + F  

             M  +++ISW A+++G   N    ++L LF  +  EG++P+    ++VLSA A +   + G

             +Q+HG  +K G     S+ N+L+ +Y+KCG L  +  +F  M  RD+++W ++I  YA++

             GK  +++  +  M+ SG + PD  TF G+L ACSHAGL+E+    F+SM   YGI+PG E

             H++C++D+  R+G   + EE++    +E D+TVW  + ++S  HG+   G   A  L+E 

             E NN   YVLLSN+YA AG+ +E+A+VR LM+   + K+PG SWV

 Score =   195 bits (495),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 162/622 (26%), Positives = 286/622 (46%), Gaps = 85/622 (14%)
 Frame = +3

             +P+ YTL +VL  C  +   + G ++H   ++ G     +V NGLL+ YA+         

                                C ++ E EY   +F  MS  ++   W +++TG ++      
Sbjct  173   -------------------CKRISEAEY---LFGSMSGEKNNVTWTSMLTGYSQNGFAFR  210

             A+  F+ +   G   + +TF SVL+ C S+    +G QVH  +VK+GF     V +AL+ 

             MY  C+ +  A  + E    E  D +++N+MI G V     EE L  F  M    +    

              T  S+++    S ++   A+  H L+VK G+G    V+NA + MY+    + +   +FE

              + EKD++SW A++T         EA+  +  M+ EG+  D+    S+LS+S  +   E 

                +    IK+G    + V+N++V+ + K G ++ A   F  M  R+LI+W A+I G   

             NG    SL L+  ++  G+TP+  T   +L AC+      H     G I +  S+ +   

               ++  +Y  + G  H++                 MI  +   G+ G+ V   E ++   
Sbjct  556   --SMRTVYGIRPGPEHYAC----------------MIDLF---GRSGDFVKV-EELLSQM  593

              VEPD   +  +L+A    G +E+G +   +++    ++P     +  + ++ + AG  D

Query  1989  EA---EEIVKTKNIEVDSTVWW  2045
             EA     ++K++NI  +    W

>ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, 
chloroplastic [Vitis vinifera]

 Score =   399 bits (1026),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 218/612 (36%), Positives = 349/612 (57%), Gaps = 12/612 (2%)
 Frame = +3

               LLS   + G++  A  VF +M+ RD+  WN ++ G A+    + ALNL+ +M  +G+ 

              D YTF  VL  C  L     GR+VH  V++ GF +   V+NAL+TMY  C  +  A  V

             F+       D+I++NAMI+G    +   E L +F  MR  ++ P  +T  S++S+C    

             D     ++H  V+K GF    SV+N+ + M+S+        ++F +++ KD+VSW AMI+

              Y +  L  +A+  Y  M+ EGVV DE T+ S+LS+   +       M+     + GL  

              + V+N+++  + K   I++A   F  +  +N+ISW +II G + N    ++L  F +++

                L PN+ TL +VLSACA I +   GK+IH + L+ G   +  + N L+ +Y +CG + 

              +   F    E+DV SWN +++ YAQ GKGG AV  F  M++S  V PD+ TFT +L AC

             S +G+V DG++ F SM + + I P ++H++ +VD+L RAG L++A E +K   I+ D  +

             W  L ++   + +  LG + A  + E +  +   Y+LL N+YAD+GKW+E A VR++M+ 

Query  2220  YRVIKQPGSSWV  2255
              R+   PG SWV
Sbjct  728   NRLTVDPGCSWV  739

 Score =   224 bits (571),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 151/541 (28%), Positives = 277/541 (51%), Gaps = 18/541 (3%)
 Frame = +3

             N++I       D E AL     M  L VS +  T+ ++L LC  +     G +VHS V K

             T       + NAL++M+     +V+A +VF    +   D  ++N ++ G       +EAL

              +++ M  + + P   TF  ++ +C    D     ++H  V++ GF     V NA +TMY

               C D+ + RL+F+R+  +D +SWNAMI+ Y + ++  E +  +  M+   V  D  T+ 

             S++S+ +++ +  +   +   VIK G + ++ V+N+++     +G  ++A   F  M  +

             +L+SW A+ISG + NG P +++  ++ +  EG+ P+  T+++VLSACAG+     G  +H

              +  + G      + N+LI +YSKC  +  +  VF  +  ++V+SW S+I     + +  

             EA+  F+ M+ S  ++P+  T   VLSAC+  G +  G +I    +   G+  G + F  

             + ++D+  R G ++ A    +  + E D   W  L +  A  G   L   +   ++E++ 

Query  2127  N  2129
Sbjct  594   N  594

 Score =   166 bits (419),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 125/452 (28%), Positives = 211/452 (47%), Gaps = 42/452 (9%)
 Frame = +3

             RPD YT   VL  C  +     G ++H   +R G  +   V N L++ Y K    CG   

                     D++S                A  VFD+M RRD   WNA+I+G  E D     
Sbjct  245   --------DIFS----------------ARLVFDRMPRRDRISWNAMISGYFENDVCLEG  280

             L LF  M    V  D  T  SV+S C +L    LGR+VH  V+KTGF+A  SV N+L+ M

             + +     +A  VF     E  D +++ AMI+G       E+A+  +  M +  ++P  +

             T  S++S+C+          +H    + G      V+N+ + MYS C+ +     +F RI

               K+++SW ++I          EA+  + +M    +  +  TL S+LS+   +      +

              I +  ++ GL     + NA++  + + G +E A+  F     +++ SWN +++G    G

                 ++ LF +++   + P+  T +++L AC+

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 6/150 (4%)
 Frame = +3

            +P+  TL +VL+ACA I     G ++HA  LR GL     + N LL  Y +   +     

             F+  +  DV SW  LL+   + G+   A+++F +M   DV      + +++  C+    

                L  F+ M H   ++ +   +ASV+ L

>gb|ABR17838.1| unknown [Picea sitchensis]

 Score =   397 bits (1020),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 212/588 (36%), Positives = 333/588 (57%), Gaps = 10/588 (2%)
 Frame = +3

             R +  VW   I G  +      AL L+ +M   G++ D   F SV+  C S      GR+

             VH  ++  GF +   V  AL +MY  C S+ +A  VF+       D +++NA+IAG    

              +  EAL +F+ M+   + P   T VS+M  C+  +      QIH   ++ G      V 

             N  + MY+ C ++     +FER+  +D+ SWNA+I  Y+  +   EA+  +  MQ  G+ 

              +  T+ S+L +     ++   + I    I++G      V NA+V+ + K G +  AY+ 

             F  M  +N+++WNAIISG   +G P ++L LF E+ A+G+ P+++ + +VL ACA   + 

             + GKQIHGY ++ G      +G  L+ +Y+KCG ++ + ++F+ M E+DVVSW +MI AY

               HG G +A+  F  M ++G  + D   FT +L+ACSHAGLV+ G+Q F  M ++YG+ P

              +EH++C+VD+L RAG+LDEA  I+K  ++E D+ VW  L  +   H +  LG   A  L

              E + +N   YVLLSNIYA+A +WE+ A +R++M+   V KQPG S V

 Score =   219 bits (557),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 153/525 (29%), Positives = 256/525 (49%), Gaps = 38/525 (7%)
 Frame = +3

             DV   T L S  TK G +E A QVFD+M +RDV  WNAII G ++      AL LF +M 

               G+  ++ T  SV+ +C+  L  L  G+Q+H   +++G  +   V+N LV MY  C +V

               A  +FE     + D  ++NA+I G     ++ EAL  FN M+   + P  +T VS++ 

             +C+         QIH   ++ GF     V NA + MY+ C ++ +   +FER+ +K++V+

             WNA+I+ Y+Q     EA+  ++EMQ +G+  D F + S+L +     ++   + I    I

             ++G    + V   +V  + K G +  A + F  M  ++++SW  +I     +G    +L 

             LFS++   G   +    + +L+AC+       G+  FQ  K  +G   K   +       

              L+ L  + G L  +  + + M+ E D   W +++ A   H   + GE  A H FE    

                ++PD A +  +LS         + +     M+   G+K  PG

 Score =   160 bits (404),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 190/420 (45%), Gaps = 44/420 (10%)
 Frame = +3

             +P+  TL +V+  CA +     G Q+H + +R+G+ +   V NGL++ YAK  ++    +

             LF  +   DV SW                               NAII G +       A
Sbjct  278   LFERMPIRDVASW-------------------------------NAIIGGYSLNSQHHEA  306

             L  F +M   G+  ++ T  SVL  C+  L+ L  G+Q+H   +++GF +   V NALV 

             MY  C +V  A  +FE    + V  + +NA+I+G        EAL +F  M+   + P  

                VS++ +C+  +      QIH   ++ GF     V    + +Y+ C ++   + +FER

             + E+D+VSW  MI +Y     G +A+  + +MQ  G   D     ++L++       +  

             L     +    GL  K+E    +V    + G +++A    ++M    +   W A++  C+

>ref|XP_004242544.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Solanum lycopersicum]

 Score =   398 bits (1023),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 227/683 (33%), Positives = 365/683 (53%), Gaps = 41/683 (6%)
 Frame = +3

             D  T + +L AC+ I+ +  G Q+H   +R GL T     + ++  Y+K           

                              C +L E   ++  F++M  ++   W+A+I GC + +     L+

             LF+ M   GV     T+ASV   C+ L    LG Q+H   +KT F     V  A + MY 

              C S+ DA  VF    +  +   +YNA+I G    ++  EA+++F  +   YL    ++ 

               + S+C+     +   Q+H +  K  F     V+NA M MY  C+  +    +F+ ++ 

             +D VSWNA+I +Y Q     E ++ +  M +  +  DEFT GS+L   ++ Q      +I

              + +IK+G+ L+  + +A++  +CK  ++E+A +    M  + ++SWNAIISG       

              ++   FS +L EG+ P+ +T +TVL  CA + +   GKQIH  I+K     +  I +TL

             + +YSKCG +  S  +F+   ++D V+WN+++  YAQHG G EA+  FE M     V P+

              ATF  VL AC+H GLVE G+Q FNSM NNYG+ P +EH+SC+VDIL RAG + +A +++

             +   IE D  +W TL S    H +  +    A  LLE +  + + ++LLSNIYA AG W+

             E + +R++M+   + K+PG SW+

 Score =   271 bits (693),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 186/654 (28%), Positives = 327/654 (50%), Gaps = 21/654 (3%)
 Frame = +3

             P++Y  T S +   CA       G Q HA  + +G      V+N L+  Y K  +L    

             ++F ++   D  SW  ++   + + E++ A  +FD    RD   WN++I+G  +  +   

             ++  F +M   G++ D  TFA +L  CS +E   LG QVH +VV+ G        +A+V 

             MY  CK + ++   F +  ++  + ++++A+IAG V   +  + L +F +M+   +  + 

              T+ S+  SC   SD    +Q+H   +K  FG    V+ A + MY+ C  L   R +F  

             +   ++ S+NA+I  +A+ + G EA++ +  + +  +  DE +L  + S+    +     

               +  +  K   +  + V+NAI+  + K    ++A R F +M  R+ +SWNAII+  + N

             G   ++L LF  +L   + P+ +T  +VL ACA    F  G  IH  I+K G  LE  IG

             + +I +Y KC  +  + ++ + M E+ +VSWN++IS ++   +  EA   F  M++ G V

             +PD  TF  VL  C++   V  G QI   ++    ++  V   S +VD+ S+ G + ++ 

              ++  K  + D   W  L    A HG   LG    +I   + LE  + N A ++

 Score =   146 bits (368),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 116/509 (23%), Positives = 229/509 (45%), Gaps = 86/509 (17%)
 Frame = +3

             TF  +   C+   T     Q HA ++  GF     V+N  + MY  C             

                                +L   +L+F+   E+D +SWN++I+ Y Q    G++I  +L

             EM R+G+  D  T   +L +   + ++ +   +  LV++ GL   +   +A+V  + K  

              ++++  +F +M  +N +SW+A+I+GC  N      L+LF  +   G+  +  T ++V  

             +CAG+   + G Q+HG+ LK     +  +    + +Y+KC  L  + +VF  +   ++ S

             +N++I  +A+  +G EAV  F  ++ S  +  D+ + +GV SAC+      +G+Q+    

Query  1899  ------------NSMVNNYG----------------IKPGVEHFSCIVDILSRAGYLDEA  1994
                         N++++ YG                I+  V  ++ I+    + G+ DE 

                   ++K++ +E D   + ++  + AA  D   G ++      +G+ LE    +  + 

                 ++Y    K EE+  + E M+   ++

 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 79/164 (48%), Gaps = 5/164 (3%)
 Frame = +3

            ++  N +++ F+ C Q       F        ++PD++T +TVL  CA++     G Q+H

            A  ++  L +   +++ L+  Y+K  ++   + +F +    D  +W  L+    + G  E

             ALQ+F++M   DV    A + A++  CA I   E  L  F  M

>ref|XP_010277283.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nelumbo nucifera]

 Score =   404 bits (1037),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 239/683 (35%), Positives = 365/683 (53%), Gaps = 41/683 (6%)
 Frame = +3

             Y  S+VL+AC  ++    G QLHA  L+ G ++   V N LL+ Y    DL   +RLF+E

                                            M  RD   +N++I+G  +  + + A+ LF
Sbjct  369   -------------------------------MDCRDKVTYNSVISGFVKCGNSDRAIQLF  397

             + M       D  T AS+LS CS +     G+Q+HS  +K G      +  +L+  Y  C

               +  A   F     E V  + +N M+     +    E+L +F+ M+   + P   T+ S

             ++ +C+   T     QIH L++K GF     V +  + MY+    L+  R I E + E+D

             +VSW AMI  YAQ +L  EA+  + EMQ  G+ +D   L S LS+    Q++   + I +

                 +G  + + + N++++ + + G I+ AY  F  +  ++ ISWN +ISG   +G   +

             SL +F ++   G+  N +T  +V+SACA I   + GKQIH  I+K G   +T  GN LI 

             LY+KCG ++ + + F+ M +R+ +SWN+MI+ Y+QHG G EA++ F+ M   G V P+  

             TF GVLSACSH GLV  G+  FNSM   + I P  EH++C+VDIL RAG LD A E ++ 

               I  D+ VW TL S+   H + ++G + A  LLE E  + A YVLLSNIYA A KW+  

               +R++M+   V K+PG SW+ +

 Score =   271 bits (693),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 179/628 (29%), Positives = 316/628 (50%), Gaps = 48/628 (8%)
 Frame = +3

             +PDH+T S+VL AC       H V   Q+HA  +R G  T   V N L++ Y+K+     

                                       G ++ A  +F+++  RD   W A+I+G ++   +
Sbjct  256   --------------------------GYIDSACLIFEELCSRDSKSWVAMISGFSQNCHE  289

             E AL LF +M   G++   Y F+SVLS C+ +E +  G Q+H+ V+K GF +   V NAL

             +T+Y     +V    +F + D    D++TYN++I+G V    ++ A+ +F +M+      

               +T  SL+S+CS         Q+H+  +K G      +  + +  Y  C D++     F

                K +++V WN M+ +Y Q     E++  + +MQ  G+  +E+T  S+L +  S+    

             +   I +L+IK G  L   V + ++  + K G +E A +   ++   +++SW A+I+G  

              N   +++L LF E+   G+  +   LS+ LSACAG+ +   G+QIH      G  ++ S

             IGN+LI LY++CG +  +  VF ++  +D +SWN +IS +AQ G   E++  F  M   G

              V  +  TF  V+SAC++   ++ G QI   ++   G     E  + ++ + ++ G + +

             A +  +    + +   W  + +  + HG

 Score =   235 bits (599),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 162/557 (29%), Positives = 279/557 (50%), Gaps = 15/557 (3%)
 Frame = +3

             + L+S  +  G ++ A  + D +S++ ++ WN I++G          L LF +M +  V 

              D++TF+SVL  C     G     Q+H+M+++ GF     V N L+ +Y     +  AC 

             +FE+      D  ++ AMI+G       EEAL++FN M+   +  T   F S++S+C+  

                    Q+HA V+K+GF     V NA +T+Y    DL +T  +F  +  +D V++N++I

             + + +      AI  +  MQ      D  T+ SLLS+  SV      + + S  IK G+ 

               I +  +++  + K  +IE A+ +F      N++ WN ++      G   +SL++FS++

                G+ PN YT  ++L  C  + +   G QIH  I+K G  L   + + LI +Y+K G+L

               + ++ + +TE DVVSW +MI+ YAQ+    EA+  FE M   G +  D    +  LSA

             C+    +  G QI   S V+ Y +   +   + ++++ +R G + +A  +    + + D 

Query  2034  TVWWTLFSSSAAHGDTR  2084
               W  L S  A  G + 

 Score =   174 bits (440),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/418 (27%), Positives = 203/418 (49%), Gaps = 42/418 (10%)
 Frame = +3

             RP+ YT  ++L  C S+     G Q+H   ++ G    ++V + L+  YAK+  L   ++

             +   +   DV SWT                               A+I G A+ D    A
Sbjct  567   ILENLTEEDVVSWT-------------------------------AMIAGYAQNDLCIEA  595

             L LF++M   G+  DN   +S LS C+ ++   LG+Q+H+    +G+    S+ N+L+ +

             Y  C  + DA  VF+  D +  DQI++N +I+G      +EE+L +F  M  + +     

             TF S++S+C   +D     QIHA ++K G+   T   N  +T+Y+ C ++      F  +

              +++ +SWNAMIT Y+Q   G EA+  + EM+++G+V +  T   +LS+   V      L

                 S+  ++ +I + E    +V    + G +++A  +  +M    + + W  ++S C

 Score =   147 bits (372),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/326 (30%), Positives = 165/326 (51%), Gaps = 12/326 (4%)
 Frame = +3

             + A  +H  ++K GF DC  V  +  +++YS C  L     + + + ++ + SWN +++ 

                +      +  + +M  + V  D FT  S+L +    +      E I +++I+ G   

                V N +++ + K G I+ A   F ++ +R+  SW A+ISG   N    ++L LF+++ 

               G+T   Y  S+VLSAC  + +F+ G+Q+H  +LK G   E  + N L+ LY   G L 

              + R+F  M  RD V++NS+IS + + G    A+  FE M      + D  T   +LSAC

             S  G +  G Q+     ++Y IK GV
Sbjct  420   SSVGALHKGKQL-----HSYAIKLGV  440

 Score =   108 bits (269),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 131/260 (50%), Gaps = 14/260 (5%)
 Frame = +3

             + E LGG  +        L +L +  E  +  +F T   LL     S S+ NA+ +   +

             +K G      + + ++S +   G ++ A     ++  ++L SWN I+SG  +       L

              LFS+++A+ + P+ +T S+VL AC  G   F + +QIH  I+++G   +  + N LI L

             YSK G +  +  +F+ +  RD  SW +MIS ++Q+    EA+  F  M  SG +      

             F+ VLSAC+     E G Q+

>ref|XP_009762759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, 
chloroplastic [Nicotiana sylvestris]

 Score =   399 bits (1024),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 219/610 (36%), Positives = 346/610 (57%), Gaps = 12/610 (2%)
 Frame = +3

             LLS   +LG +  A  VF +M  RDV  WN +I G A+    + AL+L+Q+M  +G   D

              YTF  VL  C  L  W +GR++H+ V+  G+ +   V+NAL+TMY  C  + +A  +F+

                    D+I++NAMIAG    +   E L +F+ MR     P  +T  S++S+C    D 

                  +H  V +  F    SV N+ + +YS     +    IF+RI+ KD+VSW AMI+ Y

                    +A+  Y  M+ EGV+ DE T+ S+LS+  S+   EM   +  L  + GL   +

              VSN +V  + K   I++A   F  +  +N+ISW +II G + N   +++L LF ++   

                PN  TL +VLSAC+ I +   GK+IH Y+L+ G      + N L+  Y +CG +  +

               +F  M ++DV +WN +++ YAQ G+G  AV  F+ M+ S +V+PD+ TF  +L ACS 

             +GLV +G+   N+M NNY + P ++H++C+VD+L RAG +++A + + T  ++ DS +W 

              L ++   H    LG + A  +LET++     YVLL N Y+D G+W+E A++R++M    

Query  2226  VIKQPGSSWV  2255
             +   PG SW+
Sbjct  734   LTVDPGCSWI  743

 Score =   164 bits (414),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 122/452 (27%), Positives = 206/452 (46%), Gaps = 42/452 (9%)
 Frame = +3

             RPD YT   VL  C  +     G ++HA  +  G  +   V N L++ Y K  DL   + 

             LF                               D M RRD   WNA+I G  E D+    
Sbjct  256   LF-------------------------------DGMPRRDRISWNAMIAGYFENDEFSEG  284

             L LF  M   G   D  T  SV+S C +L    LG+ +H  V +  F +  SV N+L+ +

             Y    S  +A  +F+    +  D +++ AMI+G  S    E+A+  +  M    ++P  +

             T  S++S+C+         ++H L  ++G      VSN  +  YS C  +     IF RI

              +K+++SW ++I      N   EA++ + +M+R     +  TL S+LS+   +      +

              I + V++NG+     + NA++  + + G I  A   F +M  +++ +WN +++G    G

                 ++ LF  +L   + P+  T  ++L AC+

 Score =   145 bits (367),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 157/309 (51%), Gaps = 9/309 (3%)
 Frame = +3

             N+ +     +NL  +AI+ +L+  +E  G + +E   +L  L    ++   A  + S ++

                  L + + NA++S F +LG +  A+  F  M  R++ SWN +I G   NG+  ++L+

             L+  +L  G  P+ YT   VL  C G+P ++ G++IH +++ FG   E  + N LI +Y 

             KCG L  +  +F  M  RD +SWN+MI+ Y ++ +  E +  F +M   G   PD  T T

              V+SAC   G    G +  +  V+       V   + ++ + S  G  +EAE+I     I

Query  2022  EVDSTVWWT  2048
             +    V WT
Sbjct  362   QCKDVVSWT  370

 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 112/256 (44%), Gaps = 36/256 (14%)
 Frame = +3

            PD  T+++VL+AC S+     G +LH    R GLT +  VSN L+ FY+K   +     +

            F  I   +V SWT+++           AL +F QM R                       
Sbjct  459  FHRIPDKNVISWTSIILGLRINNRSLEALILFGQMKR-----------------------  495

              +Q  +++       T  SVLS CS +     G+++H+ V++ G      + NAL+  Y

              C  +  A  +F     +V     +N ++ G     +   A+ +F+ M    + P  +T

            F+SL+ +CS     T+

>ref|XP_009610200.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, 
chloroplastic [Nicotiana tomentosiformis]

 Score =   398 bits (1023),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 223/610 (37%), Positives = 346/610 (57%), Gaps = 12/610 (2%)
 Frame = +3

             LLS   +LG +  A  VF +M  RDV  WN +I G A+    + AL+L+Q+M  +GV  D

              YTF  VL  C  L  W +GR++H+ V + G+ +   V+NALVTMY  C  V  A  VF+

                    D+I++NAMIAG        E L +F+ MR     P  +T  S++S+C    D 

                  +H  V +  F    SV N+ + +YS     +    IF+RI+ KD+VSW AMI+ Y

                    +A+  Y  M+ EGV+ DE T+ S+LS+  S+   EM   +  L  + GL   +

              VSN ++  + K   I++A   F  +  +N+ISW +II G + N   +++L LFS++   

                PN  TL +VLSAC+ I +   GK+IH Y+L+ G      + N L+  Y +CG +  +

               +F  M ++DV +WN +++ YAQ G+G  AV  F+ M+ S +V+PD+ TF  +L ACS 

             +GLV  G+   NSM + Y I P ++H++C+VD+L RAG +++A + + T  ++ DS +W 

              L ++   H    LG + A  +LET++ +   YVLL N Y+D+G+W+E A++R++M    

Query  2226  VIKQPGSSWV  2255
             +   PG SW+
Sbjct  734   LTVDPGCSWI  743

 Score =   174 bits (440),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 121/405 (30%), Positives = 208/405 (51%), Gaps = 15/405 (4%)
 Frame = +3

             N+ +  L S  + E+A++    ++ ++      TFV L   C     + +  A  V    

              +C S     + NA ++M+    +L     +F +++E+D+ SWN +I  YA+     EA+

               Y  M   GV  D +T   +L +   + + +M   I + V + G   +I+V NA+V+ +

              K G++  A   F  M  R+ ISWNA+I+G   N    + L LFS +   G  P+  T++

             +V+SAC  +     GK +HGY+ +   + + S+ N+LI LYS  G    + ++F  +  +

             DVVSW +MIS Y  +G   +AV  ++ M   G V PD+ T   VLSAC+  GL+E G+++

              + +    G+   V   + ++D  S+   +D+A EI   +  KN+

 Score =   165 bits (417),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 126/452 (28%), Positives = 208/452 (46%), Gaps = 42/452 (9%)
 Frame = +3

             RPD YT   VL  C  +     G ++HA   R G  +   V N L++ Y K    CG   

                     DV+                 A  VFD M RRD   WNA+I G  E  +    
Sbjct  249   --------DVF----------------IARMVFDGMPRRDRISWNAMIAGYFENVEFSEG  284

             L LF  M   G   D  T  SV+S C +L    LG+ +H  V +  F +  SV N+L+ +

             Y    S  +A  +F+    +  D +++ AMI+G  S    E+A+  +  M    +MP  +

             T  S++S+C+         ++H L  ++G      VSN  +  YS C  +     IF RI

              +K+++SW ++I      N   EA++ + +M+R     +  TL S+LS+   +      +

              I + V++NG+     + NA++  + + G I  A   F +M  +++ +WN +++G    G

                 ++ LF  +L   + P+  T  ++L AC+

 Score =   145 bits (365),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/295 (31%), Positives = 153/295 (52%), Gaps = 8/295 (3%)
 Frame = +3

             E  + +L+  +E  G + +E F L + L   +  +N A  + S ++     L + + NA+

             +S F +LG +  A+  F  M  R++ SWN +I G   NG+  ++L+L+  +L  G+ P+ 

             YT   VL  C G+P ++ G++IH ++ +FG   E  + N L+ +Y KCG +  +  VF  

             M  RD +SWN+MI+ Y ++ +  E +  F +M + G   PD  T T V+SAC   G    

             G +  +  V+       V   + ++ + S  G  +EAE+I     I+    V WT

>gb|KDO86035.1| hypothetical protein CISIN_1g003584mg [Citrus sinensis]

 Score =   396 bits (1018),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 221/645 (34%), Positives = 359/645 (56%), Gaps = 9/645 (1%)
 Frame = +3

             N  L  ++ S ++    +LF ++   D ++W T+++A    G +  A ++F++   ++  

              W+++I G +    D  A  LF +M   G     YT  +VL LCSL+ L   G Q H   

             +KT F     V+  LV MY  CK + +A ++F+   D   + + +  MI G        +

             A+  F  MR   +     TF S++++C   S      Q+H  ++  GF     V +A + 

             MY+ C DL + R + E  +  + VSWN+MI  +A++    EA+  + +M    +  D+FT

               S+L   +S+  + NA+ + SL++K G      V+NA++  + K G ++ A+  F  M 

              +++ISW ++I+GC  +G   ++L  FS++   G+ P+   +S++LSACA +   + G+Q

             +H   LK G     S+ N+L+ +Y+KCG ++ + RVF  M  RDV++W ++I   AQ+GK

             G EA+  ++ M+  G  +PD  TF G+L ACSHAGL E+    F SM   YGIKPG +H+

             +C++D+L R+G L EA+ ++     E D+TVW  L S+   HGD  LG   A  L E E 

              N   YV LSN+Y+ AGKWE++A VR+LM+   + K+PG SWV +

 Score =   141 bits (355),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 108/420 (26%), Positives = 189/420 (45%), Gaps = 42/420 (10%)
 Frame = +3

             + +T  ++LTACA++    FGAQ+H   L +G     +V + L+  YAK  DL   +RL 

                +  +  SW +++    + G  + AL +F +M  RD+ +                   

                         D++T+ SVL+  +  +     + VHS++VKTGF     V NAL+ MY 

                ++  A  VF    D+  D I++ ++I G       EEAL  F+ MR   + P  +  

              S++S+C++        Q+HA+ +K G     SV N+ + +Y+ C  +     +F+ +  

             +D+++W A+I   AQ   G EA+  Y +M   G   D  T   LL +      AE     

               S+    G+    +    ++    + G++ +A      M    +   W A++S C+ +G

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (52%), Gaps = 5/149 (3%)
 Frame = +3

            PDH  +S++L+ACA +    FG Q+HA  L++G  +   V N L+  YAK   +    R+

            F  + + DV +WT L+  C + G+ + ALQ +DQM    ++ D   +  ++  C+     

            E A   F+ M  + G+      +A ++ L

>ref|XP_009366439.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X1 [Pyrus x bretschneideri]

 Score =   403 bits (1036),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 226/682 (33%), Positives = 364/682 (53%), Gaps = 43/682 (6%)
 Frame = +3

             Y  S+VL+AC  I+    G QLH    + G +  ++V N L++ Y++S            

                                G    A Q+F  M +RD   +N++I+G A+    + AL LF

             ++M    +  D  T AS+LS C+ E+  L  G+Q+HS+ +K G  +   +  +L+ +Y  

             C  V  A   F   + E V  + +N M+     ++  +++  +F  M    ++P   T+ 

             S++ +C+         QIH  V+K GF     V +  + MY+   +L     I  R+   

             D+VSW AMI  YAQ +L  E+++ + EMQR G+ +D     S +S+    Q+++    I 

             +     G    + V NA+V  + + G I +AYR F    +++ +SWN +ISG   +G+  

             ++L +F+ +   G+  N +T  + +SA A + + + G+QIH  I+K GS  ET + N LI

              LYSKCG ++ + R F  M E++ +SWN+MI+ Y+QHG+G E++H FE M   G + P  

              TF GVL+ACSH GLV +G+  F SM   +G+ P  EH++C+VD+L RAG L  A + ++

                ++ D+ +W TL S+     +T +G   A  LLE E  + A YVLLSN+YA +G W+ 

                 R+LM+   V K+PG SW+

 Score =   279 bits (714),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 182/625 (29%), Positives = 315/625 (50%), Gaps = 44/625 (7%)
 Frame = +3

             PD  T S VL AC  S  H  +  Q+HA  +  G  T   V N L+  YAK+        

                                    G V+ A +VFD++  RD   W A+I+G ++   +E A
Sbjct  259   -----------------------GSVDAAKKVFDKLYIRDSVSWVAMISGLSQNGREEEA  295

             + LF +M +  +    Y F+SVLS C+ +EL+ +G Q+H ++ K GF   T V NALVT+

             Y    + + A  +F+       D ++YN++I+GL     ++ AL +F  M+   L P  +

             T  SL+S+C++        Q+H+L +K G      +  + + +Y  C D++     F   

             + +++V WN M+ +Y Q +   ++   + +M  EG++ +++T  S+L +  SV      E

              I + VIK G    + V + ++  + K GE++ A R  R +   +++SW A+I+G   + 

                +SL LF E+   G+  +    S+ +SACAGI +   G+QIH     FG   + S+GN

              L+ LY++CG +  + R F+    +D +SWN +IS +AQ G   EA+  F  M  +G +E

              +  TF   +SA ++   ++ G QI  ++V   G     E  + ++ + S+ G +++A+ 

                ++  E +   W  + +  + HG

 Score =   218 bits (555),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 146/524 (28%), Positives = 256/524 (49%), Gaps = 54/524 (10%)
 Frame = +3

             RPD  T++++L+ACA I     G QLH+  ++AG+++   +   LL  Y K  D+     

              F   ++ +V  W  +L A  +L +++ + ++F Q                         
Sbjct  469   FFLTTETENVVLWNVMLVAYGQLDDLDQSFRIFRQ-------------------------  503

                   MH  G+  + YT+ S+L  C S+    LG Q+H+ V+KTGF     V + L+ M

             Y     +  A  +      +  D +++ AMIAG    +   E+L++F  M+   +    +

              F S +S+C+         QIHA     G+ D  SV NA + +Y+ C  ++     FE  

               KD +SWN +I+ +AQ     EA+  +  M + G+ A+ FT GS +S++ ++AN    +

              I + ++K G   + EVSNA+++ + K G I  A R F +M  +N ISWNA+I+G   +G

               ++S++LF  +   G+ P+  T   VL+AC+       G+  F+  ++ HG + K   +

                     ++ L  + G L  + +  + M  + D + W +++SA

 Score =   202 bits (515),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 132/472 (28%), Positives = 232/472 (49%), Gaps = 13/472 (3%)
 Frame = +3

             +++HS ++K GF A   + + L+  Y     +  A  VF+D     +  I++N +I   +

             + +   + L  F+ M    + P   TF  ++ +C           QIHA V+  GFG   

              V N  + +Y+    + A + +F+++  +D VSW AMI+  +Q     EAIL ++EMQ  

              +++  +   S+LS+   +      E +  L+ K G   +  V NA+V+ + + G    A

              + F+ M+ R+ +S+N++ISG    GF  ++L LF  +  + L P+  T++++LSACA I

              + Q GKQ+H   +K G   +  +  +L+ LY KC  +  +   F      +VV WN M+

              AY Q     ++   F  M   G + P++ T+  +L  C+  G +  G QI   ++   G

                 V   S ++D+ ++ G LD A  I+  + +  D  V WT   +  A  D

 Score =   166 bits (420),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 111/400 (28%), Positives = 197/400 (49%), Gaps = 13/400 (3%)
 Frame = +3

             N + +   + M    +     T+V L+  CS+    + + ++H+ ++K GF     + + 

              +  Y    DL     +F+ +  + ++SWN +I  +    L G+ +  +  M  + V  D

             E T   +L     S+  +   + I + VI +G    + V N ++  + K G ++ A + F

               ++ R+ +SW A+ISG   NG   +++ LF E+    +    Y  S+VLSAC  I  F+

              G+Q+HG I K G   ET + N L+ LYS+ G    + ++F+ M +RD VS+NS+IS  A

             Q G    A+  F+ M +D  R  PD  T   +LSAC+  G ++ G Q+ +S+    G+  

              +     ++D+  +   +  A E   T   E ++ V W +

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 103/225 (46%), Gaps = 7/225 (3%)
 Frame = +3

             Q+ G   + +     +    +  N  T   +L  C+   S    K++H  ILK G   E 

              I + LI  Y   G L  + RVF  +  R ++SWN++I  +  +   G+ +  F  M+ +

               V PD+ TF+ VL AC  + +    ++  ++ V  +G    +   + ++D+ ++ G +D

              A+++     I  DS  W  + S     G ++ GR    ILL  E

>emb|CBI36234.3| unnamed protein product [Vitis vinifera]

 Score =   399 bits (1025),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 218/612 (36%), Positives = 349/612 (57%), Gaps = 12/612 (2%)
 Frame = +3

               LLS   + G++  A  VF +M+ RD+  WN ++ G A+    + ALNL+ +M  +G+ 

              D YTF  VL  C  L     GR+VH  V++ GF +   V+NAL+TMY  C  +  A  V

             F+       D+I++NAMI+G    +   E L +F  MR  ++ P  +T  S++S+C    

             D     ++H  V+K GF    SV+N+ + M+S+        ++F +++ KD+VSW AMI+

              Y +  L  +A+  Y  M+ EGVV DE T+ S+LS+   +       M+     + GL  

              + V+N+++  + K   I++A   F  +  +N+ISW +II G + N    ++L  F +++

                L PN+ TL +VLSACA I +   GK+IH + L+ G   +  + N L+ +Y +CG + 

              +   F    E+DV SWN +++ YAQ GKGG AV  F  M++S  V PD+ TFT +L AC

             S +G+V DG++ F SM + + I P ++H++ +VD+L RAG L++A E +K   I+ D  +

             W  L ++   + +  LG + A  + E +  +   Y+LL N+YAD+GKW+E A VR++M+ 

Query  2220  YRVIKQPGSSWV  2255
              R+   PG SWV
Sbjct  728   NRLTVDPGCSWV  739

 Score =   224 bits (570),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 151/541 (28%), Positives = 277/541 (51%), Gaps = 18/541 (3%)
 Frame = +3

             N++I       D E AL     M  L VS +  T+ ++L LC  +     G +VHS V K

             T       + NAL++M+     +V+A +VF    +   D  ++N ++ G       +EAL

              +++ M  + + P   TF  ++ +C    D     ++H  V++ GF     V NA +TMY

               C D+ + RL+F+R+  +D +SWNAMI+ Y + ++  E +  +  M+   V  D  T+ 

             S++S+ +++ +  +   +   VIK G + ++ V+N+++     +G  ++A   F  M  +

             +L+SW A+ISG + NG P +++  ++ +  EG+ P+  T+++VLSACAG+     G  +H

              +  + G      + N+LI +YSKC  +  +  VF  +  ++V+SW S+I     + +  

             EA+  F+ M+ S  ++P+  T   VLSAC+  G +  G +I    +   G+  G + F  

             + ++D+  R G ++ A    +  + E D   W  L +  A  G   L   +   ++E++ 

Query  2127  N  2129
Sbjct  594   N  594

 Score =   165 bits (417),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 125/452 (28%), Positives = 211/452 (47%), Gaps = 42/452 (9%)
 Frame = +3

             RPD YT   VL  C  +     G ++H   +R G  +   V N L++ Y K    CG   

                     D++S                A  VFD+M RRD   WNA+I+G  E D     
Sbjct  245   --------DIFS----------------ARLVFDRMPRRDRISWNAMISGYFENDVCLEG  280

             L LF  M    V  D  T  SV+S C +L    LGR+VH  V+KTGF+A  SV N+L+ M

             + +     +A  VF     E  D +++ AMI+G       E+A+  +  M +  ++P  +

             T  S++S+C+          +H    + G      V+N+ + MYS C+ +     +F RI

               K+++SW ++I          EA+  + +M    +  +  TL S+LS+   +      +

              I +  ++ GL     + NA++  + + G +E A+  F     +++ SWN +++G    G

                 ++ LF +++   + P+  T +++L AC+

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 6/150 (4%)
 Frame = +3

            +P+  TL +VL+ACA I     G ++HA  LR GL     + N LL  Y +   +     

             F+  +  DV SW  LL+   + G+   A+++F +M   DV      + +++  C+    

                L  F+ M H   ++ +   +ASV+ L

>ref|XP_002282164.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g13650 [Vitis vinifera]

 Score =   409 bits (1050),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 239/684 (35%), Positives = 367/684 (54%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y  S+VL+AC  I+    G QLH F ++ GL++ + V N L++ Y++          

                        W  L++A           Q+F +M RRD   +N++I+G A+    + AL

              LF+KM    +  D  T AS+LS C+    G  G+Q+HS V+K G  +   +  +L+ +Y

               C  +  A   F   + E V  + +N M+     +    E+  +F  M+   LMP   T

             + S++ +C+         QIH  V+K GF     V +  + MY+   +L   R I +R++

             E+D+VSW AMI  Y Q +L  EA+  + EM+ +G+ +D     S +S+    Q++   + 

             I +    +G    + + NA+VS + + G  + AY  F  +  ++ ISWNA+ISG   +G 

               ++L +FS++   G+  N +T  + +SA A   + + GKQIH  ++K G   ET   N 

             LI LYSKCG +  + R F  M E++VVSWN+MI+ Y+QHG G EAV  FE M   G + P

             +  TF GVLSACSH GLV +G+  F SM   +G+ P  EH+ C+VD+L RA  L  A E 

             ++   IE D+ +W TL S+   H +  +G   A  LLE E  + A YVLLSN+YA +GKW

             +     R++M+   V K+PG SW+

 Score =   267 bits (682),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 181/629 (29%), Positives = 316/629 (50%), Gaps = 52/629 (8%)
 Frame = +3

             PD  T ++VL AC    A  Q T    Q+HA  +  G  +   V N L+  Y+K+     

                                       G V+ A  VF+++  +D   W A+I+G ++   +
Sbjct  245   --------------------------GHVDLAKLVFERLFLKDSVSWVAMISGLSQNGRE  278

             + A+ LF +MH   V    Y F+SVLS C+ +EL+ LG Q+H  +VK G  + T V NAL

             VT+Y    +++ A  +F        D+I+YN++I+GL     ++ AL +F  M+   + P

               +T  SL+S+C+         Q+H+ V+K G      +  + + +Y  C D++     F

                + +++V WN M+ +Y Q     E+   +L+MQ EG++ +++T  S+L +  S+    

               E I + VIK+G    + V + ++  + K GE++ A    + +   +++SW A+I+G  

              +    ++L LF E+  +G+  +    S+ +SACAGI +   G+QIH      G   + S

             IGN L++LY++CG    +   F+ +  +D +SWN++IS +AQ G   EA+  F  M  +G

              VE +  TF   +SA ++   ++ G QI   M+   G     E  + ++ + S+ G +++

             A+ E  +     V S  W  + +  + HG

 Score =   243 bits (621),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 180/607 (30%), Positives = 297/607 (49%), Gaps = 33/607 (5%)
 Frame = +3

             G+RA + T+  +  G  +    S  L   K+L + I        DV   + L+      G

             EV+ A+++FD +   +V+ WN +I+G          L LF  M +  V+ D  TFASVL 

              CS     + +  Q+H+ ++  GF ++  V N L+ +Y     V  A  VFE     + D

              +++ AMI+GL    R +EA+++F  M    ++PT   F S++S+C+         Q+H 

              +VK G    T V NA +T+YS   +L A   IF ++  +D +S+N++I+  AQ      

             A+  + +MQ + +  D  T+ SLLS+  SV      + + S VIK G+   + +  +++ 

              + K  +IE A+ YF    T N++ WN ++      G   +S  +F ++  EGL PN YT

               ++L  C  + +   G+QIH  ++K G      + + LI +Y+K G L  +  + Q + 

             E DVVSW +MI+ Y QH    EA+  F+ M + G +  D   F+  +SAC+    +  G 

             QI   S ++ Y     + +   +V + +R G   +A    E+I    NI      W  L 

Query  2055  SSSAAHG  2075
             S  A  G
Sbjct  674   SGFAQSG  680

 Score =   227 bits (579),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 153/528 (29%), Positives = 264/528 (50%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++L+ACAS+     G QLH++ ++ G+++   +   LL  Y K  D+     

              F   ++ +V  W  +L A  +LG +  +  +F QM                +I+     

                       G+  + YT+ S+L  C SL    LG Q+H+ V+K+GF     V + L+ M

             Y     +  A  + +   +E  D +++ AMIAG    +   EAL +F  M N  +    +

              F S +S+C+         QIHA     G+ +  S+ NA +++Y+ C   +   L FE+I

               KD +SWNA+I+ +AQ     EA+  + +M + GV A+ FT GS +S++ + AN    +

              I +++IK G   + E SN +++ + K G IE A R F +M  +N++SWNA+I+G   +G

             +  ++++LF E+   GL PN  T   VLSAC+       G+  F+   + HG + K   +

             +       ++ L  +  +L  +    + M  E D + W +++SA   H

 Score =   212 bits (539),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 148/526 (28%), Positives = 263/526 (50%), Gaps = 16/526 (3%)
 Frame = +3

             A+W+A+  +   E + +   ++    M   G+  +  T+  +   C  S  L    +++H

             + + K+GF     + + L+ +Y     V +A  +F+D     V    +N +I+GL++ + 

               + L +F+ M    + P   TF S++ +CS    P   T QIHA ++  GFG    V N

               + +YS    +   +L+FER+  KD VSW AMI+  +Q     EAIL + +M +  V+ 

               +   S+LS+   +      E +   ++K GL  +  V NA+V+ + + G +  A + F

               M  R+ IS+N++ISG    GF  ++L LF ++  + + P+  T++++LSACA + +  

              GKQ+H Y++K G   +  I  +L+ LY KC  +  +   F      +VV WN M+ AY 

             Q G   E+   F  M   G + P++ T+  +L  C+  G ++ G QI   ++ + G +  

             V   S ++D+ ++ G LD A  I++    E D   W  + +    H

 Score =   119 bits (298),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 214/518 (41%), Gaps = 80/518 (15%)
 Frame = +3

             GI Q L E  ++    ++A +T+    ++          +  +R D+   S+ ++ACA I

             Q    G Q+HA    +G +    + N L+S YA+          F +I + D  SW  L+

             S   + G  E ALQVF QM++                                GV  + +
Sbjct  674   SGFAQSGHCEEALQVFSQMNQ-------------------------------AGVEANLF  702

             TF S +S   +      G+Q+H+M++KTG+ + T   N L+T+Y  C S+ DA   F + 

              ++ V  +++NAMI G        EA+ +F  M+ + LMP  +TFV ++S+CS       

              H  +V +G     S+S           Y    DL         A   I E   E D + 

             W  ++   T +    +G  A    LE++ E   A    L ++ + S      +    ++ 

               G+  +     IEV N+I + F   +L  + EQ Y Y  D+  R               

             G+     NL +++  E   P AY  S  L+   G+ S 

>ref|XP_006366808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Solanum tuberosum]

 Score =   399 bits (1024),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 226/684 (33%), Positives = 364/684 (53%), Gaps = 41/684 (6%)
 Frame = +3

             D  T + +L AC+ I+ +  G Q+H   ++ GL T     + ++  Y+K           

                              C +L E   ++  F++M  ++   W+A+I GC + +     L+

             LF+ M   GV     T+ASV   C+ L    LG Q+H   +KT F +   V  A + MY 

              C S+ DA  VF    +  +   +YNA+I G    ++  EA+++F  +   YL    ++ 

                 S+C+     +   Q+H +  K  F     V+NA M MY  C+  +    +F+ ++ 

             +D VSWNA+I +Y Q     E ++ +  M +  +  DEFT GS+L   ++ Q      +I

              + +IK+G+ L+  + +A++  +CK  ++E+A +    M  + ++SWNAIISG       

              ++   FS +L EG+ P+ +T +TVL  CA + +   GKQIH  I+K     +  I +TL

             + +YSKCG +  S  +F+   ++D V+WN+++  YAQHG G EA+  FE M     V P+

              A F  VL AC+H GLVE G+Q FNSM NNYG+ P +EH+SC+VDIL RAG + +A +++

             +   +E D  +W TL S    H +  +    A  LLE +  + + ++LLSNIYADAG W+

             E A +R+ M+   + K+PG SW+ 

 Score =   273 bits (699),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 188/654 (29%), Positives = 326/654 (50%), Gaps = 21/654 (3%)
 Frame = +3

             P++Y  T S +   CA       G Q HA  + +G      V+N L+  Y K  +L    

             ++F ++   D  SW  ++   + + E+E A  +FD M  RD   WN++I+G  +  +   

             ++  F +M   G++ D  TFA +L  CS +E   LG QVH +VVK G        +A+V 

             MY  CK + ++   F +  ++  + ++++A+IAG V   +    L +F +M+   +  + 

              T+ S+  SC   SD    +Q+H   +K  FG    V+ A + MY+ C  L   R +F  

             +   ++ S+NA+I  +A+ + G EA++ +  + +  +  DE +L    S+    +     

               +  +  K   +  + V+NAI+  + K    ++A R F +M  R+ +SWNAII+  + N

             G   ++L LF  +L   + P+ +T  +VL ACA    F  G  IH  I+K G  LE  IG

             + +I +Y KC  +  + ++ + M E+ +VSWN++IS ++   +  EA   F  M++ G +

             +PD  TF  VL  C++   V  G QI   ++    ++  V   S +VD+ S+ G + ++ 

              ++  K  + D   W  L    A HG   LG    +I   + LE  + N A ++

 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 109/443 (25%), Positives = 218/443 (49%), Gaps = 56/443 (13%)
 Frame = +3

             NA +  YS   +L+  +L+F+ + E+D +SWN++I+ Y Q    G++I  +LEM R+G+ 

              D  T   +L +   + ++ +   +  LV+K GL   +   +A+V  + K   + ++  +

             F +M  +N +SW+A+I+GC  N      L+LF  +   G+  +  T ++V  +CAG+   

             + G Q+HG+ LK  FGS  +  +    + +Y+KC  L  + +VF ++   ++ S+N++I 

              +A+  +G EAV  F  ++ S  +  D+ + +G  SAC+      +G+Q+          

Query  1899  ------NSMVNNYG----------------IKPGVEHFSCIVDILSRAGYLDEAE----E  2000
                   N++++ YG                I+  V  ++ I+    + G+ DE       

             ++K++ +E D   + ++  + AA  D   G ++      +G+ LE    +  +     ++

             Y    K EE+  + E M+   ++

 Score = 69.3 bits (168),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = +3

            +PD++T +TVL  CA++     G Q+HA  ++  L +   +++ L+  Y+K  ++   + 

            +F +    D  +W  L+    + G  E ALQ+F++M   DV    A + A++  CA I  

Query  570  DEVALNLFQKM  602
             E+ L  F  M
Sbjct  701  VEIGLQHFNSM  711

>ref|XP_009366440.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X2 [Pyrus x bretschneideri]

 Score =   403 bits (1036),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 226/682 (33%), Positives = 364/682 (53%), Gaps = 43/682 (6%)
 Frame = +3

             Y  S+VL+AC  I+    G QLH    + G +  ++V N L++ Y++S            

                                G    A Q+F  M +RD   +N++I+G A+    + AL LF

             ++M    +  D  T AS+LS C+ E+  L  G+Q+HS+ +K G  +   +  +L+ +Y  

             C  V  A   F   + E V  + +N M+     ++  +++  +F  M    ++P   T+ 

             S++ +C+         QIH  V+K GF     V +  + MY+   +L     I  R+   

             D+VSW AMI  YAQ +L  E+++ + EMQR G+ +D     S +S+    Q+++    I 

             +     G    + V NA+V  + + G I +AYR F    +++ +SWN +ISG   +G+  

             ++L +F+ +   G+  N +T  + +SA A + + + G+QIH  I+K GS  ET + N LI

              LYSKCG ++ + R F  M E++ +SWN+MI+ Y+QHG+G E++H FE M   G + P  

              TF GVL+ACSH GLV +G+  F SM   +G+ P  EH++C+VD+L RAG L  A + ++

                ++ D+ +W TL S+     +T +G   A  LLE E  + A YVLLSN+YA +G W+ 

                 R+LM+   V K+PG SW+

 Score =   279 bits (714),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 182/625 (29%), Positives = 315/625 (50%), Gaps = 44/625 (7%)
 Frame = +3

             PD  T S VL AC  S  H  +  Q+HA  +  G  T   V N L+  YAK+        

                                    G V+ A +VFD++  RD   W A+I+G ++   +E A
Sbjct  258   -----------------------GSVDAAKKVFDKLYIRDSVSWVAMISGLSQNGREEEA  294

             + LF +M +  +    Y F+SVLS C+ +EL+ +G Q+H ++ K GF   T V NALVT+

             Y    + + A  +F+       D ++YN++I+GL     ++ AL +F  M+   L P  +

             T  SL+S+C++        Q+H+L +K G      +  + + +Y  C D++     F   

             + +++V WN M+ +Y Q +   ++   + +M  EG++ +++T  S+L +  SV      E

              I + VIK G    + V + ++  + K GE++ A R  R +   +++SW A+I+G   + 

                +SL LF E+   G+  +    S+ +SACAGI +   G+QIH     FG   + S+GN

              L+ LY++CG +  + R F+    +D +SWN +IS +AQ G   EA+  F  M  +G +E

              +  TF   +SA ++   ++ G QI  ++V   G     E  + ++ + S+ G +++A+ 

                ++  E +   W  + +  + HG

 Score =   218 bits (555),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 146/524 (28%), Positives = 256/524 (49%), Gaps = 54/524 (10%)
 Frame = +3

             RPD  T++++L+ACA I     G QLH+  ++AG+++   +   LL  Y K  D+     

              F   ++ +V  W  +L A  +L +++ + ++F Q                         
Sbjct  468   FFLTTETENVVLWNVMLVAYGQLDDLDQSFRIFRQ-------------------------  502

                   MH  G+  + YT+ S+L  C S+    LG Q+H+ V+KTGF     V + L+ M

             Y     +  A  +      +  D +++ AMIAG    +   E+L++F  M+   +    +

              F S +S+C+         QIHA     G+ D  SV NA + +Y+ C  ++     FE  

               KD +SWN +I+ +AQ     EA+  +  M + G+ A+ FT GS +S++ ++AN    +

              I + ++K G   + EVSNA+++ + K G I  A R F +M  +N ISWNA+I+G   +G

               ++S++LF  +   G+ P+  T   VL+AC+       G+  F+  ++ HG + K   +

                     ++ L  + G L  + +  + M  + D + W +++SA

 Score =   202 bits (515),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 132/472 (28%), Positives = 232/472 (49%), Gaps = 13/472 (3%)
 Frame = +3

             +++HS ++K GF A   + + L+  Y     +  A  VF+D     +  I++N +I   +

             + +   + L  F+ M    + P   TF  ++ +C           QIHA V+  GFG   

              V N  + +Y+    + A + +F+++  +D VSW AMI+  +Q     EAIL ++EMQ  

              +++  +   S+LS+   +      E +  L+ K G   +  V NA+V+ + + G    A

              + F+ M+ R+ +S+N++ISG    GF  ++L LF  +  + L P+  T++++LSACA I

              + Q GKQ+H   +K G   +  +  +L+ LY KC  +  +   F      +VV WN M+

              AY Q     ++   F  M   G + P++ T+  +L  C+  G +  G QI   ++   G

                 V   S ++D+ ++ G LD A  I+  + +  D  V WT   +  A  D

 Score =   166 bits (420),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/400 (28%), Positives = 197/400 (49%), Gaps = 13/400 (3%)
 Frame = +3

             N + +   + M    +     T+V L+  CS+    + + ++H+ ++K GF     + + 

              +  Y    DL     +F+ +  + ++SWN +I  +    L G+ +  +  M  + V  D

             E T   +L     S+  +   + I + VI +G    + V N ++  + K G ++ A + F

               ++ R+ +SW A+ISG   NG   +++ LF E+    +    Y  S+VLSAC  I  F+

              G+Q+HG I K G   ET + N L+ LYS+ G    + ++F+ M +RD VS+NS+IS  A

             Q G    A+  F+ M +D  R  PD  T   +LSAC+  G ++ G Q+ +S+    G+  

              +     ++D+  +   +  A E   T   E ++ V W +

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 103/225 (46%), Gaps = 7/225 (3%)
 Frame = +3

             Q+ G   + +     +    +  N  T   +L  C+   S    K++H  ILK G   E 

              I + LI  Y   G L  + RVF  +  R ++SWN++I  +  +   G+ +  F  M+ +

               V PD+ TF+ VL AC  + +    ++  ++ V  +G    +   + ++D+ ++ G +D

              A+++     I  DS  W  + S     G ++ GR    ILL  E

>ref|XP_006339454.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006339455.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
isoform X2 [Solanum tuberosum]

 Score =   395 bits (1016),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 214/628 (34%), Positives = 349/628 (56%), Gaps = 9/628 (1%)
 Frame = +3

             +++F ++   D ++WTT+++A    G +  A QVF+++  +    W+++I G  +   + 

                  F +M S G     +T AS+L +C+++ L   G Q+H   +KT F     V+  L+

              MY   K V++A  +F+       + +T+ AMI G         A+  F+ MR   +   

               TF  ++SSC   SD     Q+H  +V  GF     V ++ + MYS C DL + +   E

              ++    VSWN MI  Y +     EA+  + +M    +  DEFT  S+L+S    Q   N

              + +  LV+K G      VSNA++  + K G++  A   F  M  +++ISW ++++GC  

             NGF  ++L LF E+    + P+   +++VLS+C+ +   + G+Q+H   +K G     S+

              N+L+ +Y+ CG L  + ++F  M   +V+SW ++I AYAQ+GKG E++  F+ M+ SG 

             +EPD  TF G+L ACSH GLV+DG + F SM  +YGIKP  +H++C++D+L RAG + EA

             E++V   +IE D+TVW  L ++   HG+T L    +  L + E  +   YV+LSNIY+ A

             GKWE +A +R  M    + K+PG SW+ 

 Score =   197 bits (500),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 164/583 (28%), Positives = 262/583 (45%), Gaps = 48/583 (8%)
 Frame = +3

             RP  +TL+++L  CA       G Q+H + ++        V  GL+  YAKS      KR

             +                       E E   Q+      ++   W A+I G ++  D   A
Sbjct  172   VL----------------------EAECIFQIMSH--GKNHVTWTAMINGYSQNGDALRA  207

             +  F  M + G+  + YTF  VLS C +L     G QVH  +V  GF A   V ++L+ M

             Y  C  +  A    E    EV   +++N MI G V     EEAL +F  M    +     

             T+ S+++S +   DP     +H LVVK G+     VSNA + MY+   DL     +F  +

              EKD++SW +++T  A      EA+  + EM+   +  D   + S+LSS   +A  E+  

              + +  IK+GL   + V N++++ +   G +E A + F  M   N+ISW A+I     NG

                +SL  F E++A G+ P+  T   +L AC+       GK+    + K +G        

               +I L  + G +  + ++   M  E D   W ++++A   HG    A      +    +

             +EP  A    +LS   S AG  E+  ++   M N+ G+  +PG

 Score =   117 bits (292),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 139/270 (51%), Gaps = 36/270 (13%)
 Frame = +3

Query  1335  NAIVSAFCKLGEIEQAYRYF-----RDMFT--------------------------RNLI  1421
             N  ++   KLG+ ++A + F     +D FT                          ++ I

             +W+++I G   +GF ++    F ++ +EG  P+ +TL+++L  CA       G+QIHGY 

             +K    +   +   LI +Y+K   +  +  +FQIM+  ++ V+W +MI+ Y+Q+G    A

             + CF +M   G +E ++ TF GVLS+C+    +  G+Q+   +VN  G +  V   S ++

             D+ S+ G LD A++ ++   +EV+  V W 

>ref|XP_006838936.1| hypothetical protein AMTR_s00002p00270380 [Amborella trichopoda]
 gb|ERN01505.1| hypothetical protein AMTR_s00002p00270380 [Amborella trichopoda]

 Score =   399 bits (1025),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 224/685 (33%), Positives = 376/685 (55%), Gaps = 44/685 (6%)
 Frame = +3

             D +T   VL AC  ++    G ++H   +++G  +F+ + N L++ YAK  +LC   ++F

              E+ +  DV SW T++S+ ++ G    AL++F +M+R  V +                  

                          +++T  S+L  CS E    LG ++H +M+ K G        N+L+ M

             Y     +  A  VF    +   D++++N+M+   V      EAL  F  +++    P  +

             + +++ S+ S   +     +IH   +K GF       N+ + MYS C  +     +FE++

               KD++SW AMI+ YAQ ++  +A+  + E Q EG+  D   +GSLL S    +S++  +

              + S VI++ L+ ++ + N+IV A+ + G ++ A   F+    ++L++W + ISG   N 

              P + L LF  ++  GL P++  L ++LSA A +   +HGK+ HGY+++    L+ S+ +

             +LI +YS+CG +  S +VF+ + E+D+VSW SMI+A   HG+G EA+  FE M   G   

             PD   F  +L ACSH+GLV++G      M ++YG+ P  +H +CIVD+L R+  L+EA E

              V    IE +S VW +L  +   H DT+LG  +A  LL++E  NP  YVL+SNI+A +GK

             W +   VRE+M++  + K PG SW+

 Score =   254 bits (649),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 167/628 (27%), Positives = 310/628 (49%), Gaps = 49/628 (8%)
 Frame = +3

             + ST++  CA  +    G Q+HA  + +   + +H                         
Sbjct  65    SYSTIIEFCADAKSITLGKQIHARLISSHGLSHAH-------------------------  99

                D +  T +L    K G +  A ++FD M  +   +WNA+I G A +     A+ LF 

                 +G S D++TF  VL  C  L+   +G ++H +++K+G+L+ TS++NAL+ MY  C 

              +  A  VF +   E  D +++N +I+       + EAL +F  M    +     T VS+

             + +CS         +IHA ++K+     GF +    +N+ + MY+    +K    +F R+

             K +D VSWN+M+ +Y Q     EA+  + E+Q      D     T+GS  S   ++   +

              I    +KNG    +E  N+++  + K G+++ A R F  M T+++ISW A+ISG   N 

               +++L  F E  +EG+  ++  + ++L +C G+ S  + KQ+H Y+++    L+  + N

             +++  Y +CG + ++  VF++   +D+V+W S IS Y ++    + +  F  MV +G +E

             PD      +LSA +   ++  G +    ++  + I  G    S ++D+ SR G +  + +

             + +    E D   W ++ +++  HG  +

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 103/220 (47%), Gaps = 26/220 (12%)
 Frame = +3

              P+  L L   +    +GL P  + + ST++  CA   S   GKQIH  ++         

               FL T I    + +Y+KCG +  + ++F +M E+    WN++I  YA  G+G EAV  F

              +  V  G +  D  TF  VL AC +   ++ G +I   +     IK G   F+ I++ L

                 ++ G L  A+++ +      D   W T+ SS +  G

>ref|XP_006445136.1| hypothetical protein CICLE_v10018890mg [Citrus clementina]
 ref|XP_006491023.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
[Citrus sinensis]
 gb|ESR58376.1| hypothetical protein CICLE_v10018890mg [Citrus clementina]

 Score =   395 bits (1014),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 220/645 (34%), Positives = 358/645 (56%), Gaps = 9/645 (1%)
 Frame = +3

             N  L  ++ S ++    +LF ++   D ++W T+++A    G +  A ++F++   ++  

              W+++I G +    D  A  LF +M   G     YT  +VL LCSL+ L   G Q H   

             +KT F     V+  LV MY  CK + +A ++F+   D   + + +  MI G        +

             A+  F  MR   +     TF S++++C   S      Q+H  ++  GF     V +A + 

             MY+ C DL + R + E  +  + VSWN+MI  + ++    EA+  + +M    +  D+FT

               S+L   +S+  + NA+ + SL++K G      V+NA++  + K G ++ A+  F  M 

              +++ISW ++I+GC  +G   ++L  FS++   G+ P+   +S++LSACA +   + G+Q

             +H   LK G     S+ N+L+ +Y+KCG ++ + RVF  M  RDV++W ++I   AQ+GK

             G EA+  ++ M+  G  +PD  TF G+L ACSHAGL E+    F SM   YGIKPG +H+

             +C++D+L R+G L EA+ ++     E D+TVW  L S+   HGD  LG   A  L E E 

              N   YV LSN+Y+ AGKWE++A VR+LM+   + K+PG SWV +

 Score =   141 bits (355),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 108/420 (26%), Positives = 189/420 (45%), Gaps = 42/420 (10%)
 Frame = +3

             + +T  ++LTACA++    FGAQ+H   L +G     +V + L+  YAK  DL   +RL 

                +  +  SW +++    + G  + AL +F +M  RD+ +                   

                         D++T+ SVL+  +  +     + VHS++VKTGF     V NAL+ MY 

                ++  A  VF    D+  D I++ ++I G       EEAL  F+ MR   + P  +  

              S++S+C++        Q+HA+ +K G     SV N+ + +Y+ C  +     +F+ +  

             +D+++W A+I   AQ   G EA+  Y +M   G   D  T   LL +      AE     

               S+    G+    +    ++    + G++ +A      M    +   W A++S C+ +G

 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (52%), Gaps = 5/149 (3%)
 Frame = +3

            PDH  +S++L+ACA +    FG Q+HA  L++G  +   V N L+  YAK   +    R+

            F  + + DV +WT L+  C + G+ + ALQ +DQM    ++ D   +  ++  C+     

            E A   F+ M  + G+      +A ++ L

>gb|KDP34853.1| hypothetical protein JCGZ_09141 [Jatropha curcas]

 Score =   395 bits (1015),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 224/684 (33%), Positives = 356/684 (52%), Gaps = 41/684 (6%)
 Frame = +3

             PD YT   V+ AC+ + +   G  +    L  G +    V + L+  YA++         

                                   G +E A  +FD+M  +D  +WN ++ G  +  +   A+
Sbjct  172   ----------------------GRIEDARFLFDKMPHKDCVLWNVMLNGFLKCGESITAI  209

              +F++M S     D+ TFA VLS+C+ E +   G Q+H +VV  GF     V N LV MY

               C    DAC +F+   +  V  +T+N MIAG V     +EA  +F+ M    + P  +T

             F S + S  +  +  Q   IH  +++        + +A M +Y  C+D+K  R IF +  

               DIV   AMI+ Y    L  +A+  +  +  E +  +  TL S+L +   +AN ++   

             + + ++KNG   K  V +AIV  + K G +E A++ F+ +  ++ I WN II+    NG 

             P ++++ F ++  EG+  N  ++S  LSACA +P+ ++GK+IH +++K     +    + 

             LI +Y KCG L ++  VF +M E++ VSWNS+I AY  HG   +++  F  M++ G ++P

             D  TF  +LS C HAG V+ GIQ F  M   YGI    EH++C+VD+  RAG L EA E 

             +K+     D+ VW TL  +   HG+  L  + +  LL+ +  N   Y+LLSNI+ADAG+W

               +  +R LM+   V K PG SW+

 Score =   233 bits (594),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 155/537 (29%), Positives = 274/537 (51%), Gaps = 12/537 (2%)
 Frame = +3

             A ++F Q+       WN +I G  ++   + AL  + KM   GV  D YTF  V+  CS 

             L    LG+ +   ++  GF     V ++L+ +Y     + DA ++F+    +  D + +N

              M+ G +    +  A+ +F  MR+    P   TF  ++S C S+ M    TQ+H LVV  

             GF     V+N  + MYS C        +F+ + E  +V+WN MI  Y Q     EA   +

              EM   GV  D  T  S L S   S S+   + I   ++++ + L + + +A++  + K 

              +++ A   F      +++   A+ISG   NG    +L +F  LL E ++PNA TL++VL

              ACAG+ + + GK++H YILK G   +  +G+ ++ +Y+KCG L  + ++F+ ++E+D +

              WN++I++++Q+GK  EA+H F  M   G ++ +  + +  LSAC++   +  G +I + 

             M+ +      +   S ++D+  + G L  A  +      E +   W ++  +  +HG

 Score =   182 bits (461),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 147/553 (27%), Positives = 257/553 (46%), Gaps = 45/553 (8%)
 Frame = +3

             +PD  T + VL+ CAS     FG QLH   +  G      V+N L++ Y+K    CG   

                  Q PD                   A ++F  M    V  WN +I G  +    + A
Sbjct  274   -----QFPD-------------------ACKLFKTMPETSVVTWNGMIAGYVQNGFMKEA  309

              +LF +M   GV  D+ TFAS L S+        G+++H  +++        + +AL+ +

             YF C+ V  A  +F  +   ++D +   AMI+G V    N +AL +F  +    + P  +

             T  S++ +C   ++     ++HA ++K GF     V +A + MY+ C  L+    IF+ I

              EKD + WN +ITS++Q     EAI  + +M  EG+  +  ++ + LS+  ++      +

              I S +IK+     +   +A++  + K G +  A   F  M  +N +SWN+II    S+G

                 SL+LF+++L +G+ P+  T  ++LS C        G Q    +  ++G   +    

               ++ L+ + G L  +    + M    D   W +++ A   HG    A    + ++D   

Query  1815  VEPDKATFTGVLS  1853
             ++P+ + F  +LS
Sbjct  725   LDPENSGFYILLS  737

 Score =   144 bits (364),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 107/410 (26%), Positives = 195/410 (48%), Gaps = 7/410 (2%)
 Frame = +3

             S+ SD + A QIHA  +     +   +    +  Y  C ++   + +F +++    + WN

              MI  + +      A+L Y +M   GV  D++T   ++ +   + N    ++I   ++  

             G  +   V ++++  + + G IE A   F  M  ++ + WN +++G    G  + ++ +F

              E+ +    P++ T + VLS CA     + G Q+HG ++  G   +  + NTL+A+YSKC

             G    + ++F+ M E  VV+WN MI+ Y Q+G   EA   F  M+ +G V+PD  TF   

             L +   +  ++ G +I +  +  + +   +   S ++DI  +   +  A  I     I +

             D  V   + S    +G       V  +LLE EK +P    L S + A AG

>ref|XP_010686415.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Beta vulgaris subsp. vulgaris]

 Score =   398 bits (1022),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 226/683 (33%), Positives = 372/683 (54%), Gaps = 41/683 (6%)
 Frame = +3

             + +  S+VL ACA+     +G Q+H   L AG  +   V+N L+  YAK ++    +RLF

                                            D++  R V  WNA+ +   + +  E A+ 
Sbjct  224   -------------------------------DEIPERSVVSWNALFSCYVQGNFFEEAIC  252

             LF +M S     + ++ +S+L+ C+ +  G LGR++H  ++K G        NALV MY 

               + + DA  VF++  +   D +++NA+IAG V  E +  AL +F  M ++ + P   T 

              S +  C+         Q+H+ ++K             + MYS C+ ++  + +F  I E

             KD+++WNAMI+ Y+      EA+  Y+EM +EGV  ++ TL ++L S  S+ N E+   I

              ++ +K+GL     V N++V ++ K G I+ A + FR+    +L S+ ++I+     G  

              ++L LF E+ +  + P+ +  S +L+AC+ + +++ GKQIH +ILK G   +T  GN+L

             + +Y+KCG +  +TR F  ++E+ +VSW+++I   AQHG G EA+  F+ M+  G V P+

               T   VL ACSHAGLVE+  + F SM   YG++P  EH++C++DIL RAG LDEA E+V

                  E +  VW  L  ++  H +  LG+  A  L   E      ++LL+N+YA AG WE

               + +R++M+  +V K+PG SWV

 Score =   237 bits (604),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 173/623 (28%), Positives = 305/623 (49%), Gaps = 43/623 (7%)
 Frame = +3

               S  L+ C   +    G Q+HA   ++GL   + + N L+S Y+K              

                           C   G   YA ++ D+    D+  W+AII+G  +    + AL  FQ

             +MHSLG+  + + F+SVL  C+  +    G+Q+H + +  GF +   V N LV +Y  C+

                D+  +F++  +  V  +++NA+ +  V     EEA+ +FN M +    P   +  S+

             +++C+   D     +IH  ++K G  +    +NA + MY+  +++K   L+F+ I E DI

             VSWNA+I     +     A+  + +M   G+  + FTL S L     +   E+   + S 

             +IK      +     ++  + K   +E+A   F  +  ++LI+WNA+ISG  SNG   ++

             L+++ E+  EG++ N  TLS VL +   + + +  +QIH   +K G   +  + N+L+  

             Y K G +  + ++F+     D+ S+ SMI+AY+Q+G+G EA+  F+ M  S RV PD   

              + +L+ACS+    E G QI   ++   G        + +V++ ++ G +D+A     +K

               E     W  +    A HG  +

 Score =   190 bits (482),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 135/452 (30%), Positives = 224/452 (50%), Gaps = 40/452 (9%)
 Frame = +3

             RP+ ++LS++L ACA       G ++H + ++ G       +N L+  YAK +++     

             +F  I  PD+ SW                               NAII G    ++  +A
Sbjct  323   VFDNILEPDIVSW-------------------------------NAIIAGSVLQEEHVLA  351

             L LF +M+ LG+  + +T +S L +C+ L L  LGRQ+HS ++K    A       L+ M

             Y  CKS+ +A  VF    ++  D I +NAMI+G  S   ++EAL ++   H   +    T

              L+ V   ++S  +     QIHA+ VK G      V N+ +  Y    ++K    IF   

             +  D+ S+ +MIT+Y+Q   G EA+  + EMQ   V  D F   +LL++  +++  E   

              I   ++K G +      N++V+ + K G I+ A R F  +  + ++SW+AII G   +G

                ++L LF +++ +G+ PN  TL +VL AC+

 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 84/184 (46%), Gaps = 13/184 (7%)
 Frame = +3

            PD +  S +L AC+++     G Q+H   L+ G  + +   N L++ YAK   +    R 

            FS++    + SW+ ++    + G  + AL++FDQM +  V        +++  C+     

            E A   FQ M  L GV      +A     C +++ G   ++     +V K  + A  +V 

Query  741  NALV  752
Sbjct  742  GALL  745

>ref|XP_002533783.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
 gb|EEF28596.1| pentatricopeptide repeat-containing protein, putative [Ricinus 

 Score =   390 bits (1003),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 214/618 (35%), Positives = 342/618 (55%), Gaps = 10/618 (2%)
 Frame = +3

             D +  ++L+    + G +E A ++FD+M  +D  +WN ++ G  +  +   A+ +F+ M 

             +     ++ TFASVLS+C+ E L   G Q+H +V+  GF     V NALV MY     + 

             DA  +F    D  V  +T+N MIAG V     +EA ++F+ M +  + P  +TF S + S

              ++  +  Q   IH  +++ G      + +A + +Y  C+D+     IF++    DIV  

              A+I+ Y    L  +A+  +  +  E +  +  TL S+L +   +A   +   L   ++K

             +GL  +  V +AI+  + K G ++ AY+ FR M  ++ + WNAII+ C  NG P ++++L

             F ++  EGL+ +  ++S  LSACA +P+  HGK IH +++K     E    + LI +Y K

             CG L  +  VF +M E++ VSWNS+I+AY  HG    ++  F  M++ G ++PD  TF  

             +LSAC HAG V+ GIQ F  M   YGI   +EH++CIVD+  RAG L+EA E +K     

              D  VW TL  +   HG+  L  + +  LL+ +  N   YVLLSN++ADAG+W     +R

              LM++  V K PG SW+ 

 Score =   197 bits (501),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 145/523 (28%), Positives = 251/523 (48%), Gaps = 42/523 (8%)
 Frame = +3

             +P+  T ++VL+ CAS   + FG QLH   +  G      V+N L++ Y+K   L    +

             LF+ +   +V +W  +++   + G +                              DE +
Sbjct  130   LFNTMPDTNVVTWNGMIAGFVQNGFM------------------------------DEAS  159

             L LF +M S GVS D+ TFAS L S+        G+++H  +++ G      + +AL+ +

             YF C+ V  AC +F+ + +  VD +   A+I+G V    N +AL +F  +    + P  +

             T  S++ +C+   T     ++HA ++K G  +   V +A M MY+ C  L     IF R+

              EKD V WNA+IT+ +Q     EAI  + +M REG+  D  ++ + LS+  ++    + +

              I S +IK     ++   +A++  + K G +  A   F  M  +N +SWN+II+   S+G

                 SL LF ++L +G+ P+  T  T+LSAC        G Q    +  ++G        

               ++ L+ + G L+ +    + M    D   W +++ A   HG

 Score =   157 bits (397),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/360 (27%), Positives = 189/360 (53%), Gaps = 6/360 (2%)
 Frame = +3

             GF     V ++ + +Y+    ++  R +F+++  KD V WN M+  + +      A+  +

              +M+      +  T  S+LS   S A +E    +  LVI  G      V+NA+V+ + K 

             G++  A + F  M   N+++WN +I+G   NGF  ++  LFSE+++ G++P++ T ++ L

              +     S + GK+IHGYIL+ G  L+  + + LI +Y KC  +  + ++F+  T  D+V

                ++IS Y  +G   +A+  F  +++  ++ P+  T   VL AC+    +  G ++  +

             ++  +G+       S I+D+ ++ G LD A +I + +  E D+  W  + ++ + +G  +

>ref|XP_008385706.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Malus domestica]
 ref|XP_008385707.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Malus domestica]
 ref|XP_008385708.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Malus domestica]

 Score =   395 bits (1014),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 217/646 (34%), Positives = 357/646 (55%), Gaps = 9/646 (1%)
 Frame = +3

             SN LL+  +KS  +   +++F ++ S D +SW T+++A    G +  A Q+FD    ++ 

               W+++I+G    + +  A  LF +M   G     YT  SVL LCS L L   G  VH  

             + KT F     V+  LV MY  CK + +A ++FE   D   + + +  M+ G        

             +A+  F  MR   +     TF S++++ +  +      Q+H  VV+ G G    V ++ +

              MY  C DL + +     ++  ++VSWN+MI    ++    EA+  + +M+   +  D F

             T  S+L+S    + + NA  I  L+IK G  +   V NA+V  + K G I+ A   F+ M

               +++ISW ++I+G   NG   ++L LF E+   G+ P+ + +++ LSA A +   + G+

             QIH   +K G     S+ N+ +A+Y+KCG +  + +VF  M  +DV++W ++I  YAQ+G

             +G E++  ++ M+ +G  EPD  TF G++ ACSHAGL+E G   F  M   YGI+PG EH

             ++C++D+L R+G L+EAE +V    +E D TVW  L ++   HG+  LG   A  L + E

               N   YV LSN+Y+ A +WE++A +R LM+   ++K+PG SW+ +

 Score =   141 bits (355),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/345 (28%), Positives = 162/345 (47%), Gaps = 37/345 (11%)
 Frame = +3

             + +T  +VLTA AS+    FGAQ+H   +++GL     V + L+  Y K  DL   K+  

               ++  +V SW +++  C + G  E AL +F  M  R++ +                   

                         D++T+ SVL S   ++       +H +++KTGF     V NALV MY 

                ++  A  VF+   D+  D I++ ++I G V    +E+AL +F  MR   + P     

              S +S+ ++        QIHA  +K G     SV N+ + MY+ C  ++    +F+ ++ 

             +D+++W A+I  YAQ   G E++  Y +M   G   D  T   L+

 Score = 60.1 bits (144),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = +3

            PD + +++ L+A A +    FG Q+HA  +++GL     V N  ++ YAK   +    ++

            F  +Q  DV +WT L+    + G  + +L+ +DQM    +  D   +  +I  C+

>ref|XP_009764400.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nicotiana sylvestris]
 ref|XP_009764401.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nicotiana sylvestris]
 ref|XP_009764402.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nicotiana sylvestris]
 ref|XP_009764403.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nicotiana sylvestris]
 ref|XP_009764404.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nicotiana sylvestris]
 ref|XP_009764405.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nicotiana sylvestris]

 Score =   400 bits (1029),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 240/684 (35%), Positives = 364/684 (53%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y  S+V++A   I+    G QLHA   + G  T   V N L++ Y++    CG    

                        + TL            A QVF +M ++D   +N++I+G +     + AL
Sbjct  333   -----------YLTL------------AEQVFIEMPQKDGVTYNSLISGLSLKGFSDKAL  369

              LF+KM    +  D  T AS+L  C SL     GRQ+HS   K G  + + +  +L+ +Y

               C  +  A   F  +  E +  + +N M+ G   M   +E+  +F+ M+   L P   T

             + S++ +C+         QIH+ V+K GF     V +  + MY+  + L A   IF R+ 

             E+D+VSW +MI  YAQ +L  EA+  + +MQ  G+ +D     S  S+    Q++     

             I +  + +G  L   + NA++  + + G I+ AY  F  + TR++ISWN ++SG   +GF

               ++L +FS L  +G+  N +T  + +SA A   + + GKQIH  I+K G   ET   N 

             LI LY+KCG L  + + F  M  ++ VSWN+MI+ Y+QHG G EA+  FE M   G V+P

             +  T+ GVLSACSH GLV+ G+  FNSM  +YG+ P +EH++ +VDIL RAG+L  A + 

             V+T  IE D+ VW TL S+     +  +G      LLE E  + A YVLLSN+YA  G+W

             +     R LM+   V K+PG SW+

 Score =   253 bits (645),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 184/659 (28%), Positives = 319/659 (48%), Gaps = 51/659 (8%)
 Frame = +3

             N LL+ FTR ++   A+           + PD  T S VL AC S     F      Q+H

             A  +R GL     V N L+  Y+K+                               G V+
Sbjct  206   ALIMRCGLGLKLIVCNRLIDLYSKN-------------------------------GLVD  234

              A QVF+ M  RD + W A+++G  + +  E A+ L++ M   GV    Y F+SV+S  +

              ++ + LG Q+H+ + K GFL    V NALVT+Y  C  +  A  VF +   +  D +TY

             N++I+GL     +++ALM+F  M+   L P  +T  SL+ +C+         Q+H+   K

              G    + +  + + +Y  C D++     F   + ++IV WN M+  Y Q     E+   

             + +MQ +G+  +++T  S+L +  SV      E I S V+K G    + V + ++  + K

               +++ A + F  +   +++SW ++I+G   +   +++L LF ++   G+  +    ++ 

              SACAGI +   G+QIH   +  G  L+ SIGN LI LY++CG +  +   F  +  RD+

             +SWN ++S +AQ G   EA+  F  +   G VE +  T+   +SA ++   ++ G QI  

              ++   G     E  + ++ + ++ G L D  +E  + +N   +   W  + +  + HG

 Score =   237 bits (604),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 153/522 (29%), Positives = 265/522 (51%), Gaps = 20/522 (4%)
 Frame = +3

             G++  ALQ+FD +    R+V+ WN +++G      ++  LNLF +M    V+ D  TF+ 

             VL  CS         G+  Q+H+++++ G      V N L+ +Y     V  A  VFED 

                V D  ++ AM++G    ER E+A++++  MR   ++PT   F S++S+ +       

               Q+HA + K GF     V NA +T+YS C  L     +F  + +KD V++N++I+  + 

             +    +A++ + +MQ   +  D  T+ SLL +  S+        + S   K GL     +

               +++  + K  +IE A+++F      N++ WN ++ G    G   +S  +FS++  +GL

              PN YT  ++L  C  + +   G+QIH  +LK G +    + + LI +Y+K   L  + +

             +F  + E DVVSW SMI+ YAQH    EA+  F  M   G +  D   F    SAC+   

              ++ G QI   S+V+ Y +   +   + ++ + +R G + +A

 Score =   188 bits (478),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/438 (28%), Positives = 223/438 (51%), Gaps = 12/438 (3%)
 Frame = +3

             A  +F++    + +   +N +++G    +RN+  L +F+ M    + P   TF  ++ +C

             S    A       QIHAL+++ G G    V N  + +YS    + + + +FE +  +D  

             SW AM++ + +   G +AIL Y +M++ GV+   +   S++S+S  +   E+   L   +

              K G +  + V NA+V+ + + G +  A + F +M  ++ +++N++ISG    GF  ++L

              LF ++    L P+  T++++L ACA + +   G+Q+H Y  K G   ++ I  +L+ LY

              KC  +  + + F      ++V WN M+  Y Q G   E+   F  M   G ++P++ T+

               +L  C+  G +  G QI +S V   G    V   S ++D+ ++   LD AE+I    N

              E D   W ++ +  A H
Sbjct  548   -EEDVVSWTSMIAGYAQH  564

 Score =   177 bits (450),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 121/418 (29%), Positives = 199/418 (48%), Gaps = 42/418 (10%)
 Frame = +3

             +P+ YT  ++L  C S+     G Q+H+  L+ G     +V + L+  YAK + L   ++

             +F  +   DV SWT++                               I G A+ D    A
Sbjct  542   IFWRLNEEDVVSWTSM-------------------------------IAGYAQHDLFVEA  570

             L LF+KM   G+  DN  FAS  S C+ ++    GRQ+H+  V +G+    S+ NAL+ +

             Y  C  + DA   F+  D    D I++N +++G       EEAL +F+ +    +     

             T+ S +S+ ++        QIHA ++K G+   T  SN  +T+Y+ C  L   R  F  +

             + K+ VSWNAMIT Y+Q   G EAI  + EM+R GV  +  T   +LS+   V   +  L

                 S+    GL+ K+E   ++V    + G +++A ++   M    + + W  ++S C

 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/343 (30%), Positives = 177/343 (52%), Gaps = 17/343 (5%)
 Frame = +3

             ++SL+ SC      + A ++H  ++K GFG    +S   + +Y    DL +   IF+ + 

                +++  WN +++ + +       +  +  M RE V  DE T   +L   S   VA   

                E I +L+++ GL LK+ V N ++  + K G ++ A + F DM  R+  SW A++SG 

               N     ++ L+ ++   G+ P  Y  S+V+SA   I +F+ G+Q+H  I K+G     

              +GN L+ LYS+CG L  + +VF  M ++D V++NS+IS  +  G   +A+  F+ M   

             G ++PD  T   +L AC+  G +  G Q+     ++Y  K G+

>ref|XP_004306236.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Fragaria vesca subsp. vesca]

 Score =   393 bits (1009),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 230/622 (37%), Positives = 344/622 (55%), Gaps = 16/622 (3%)
 Frame = +3

             D+     +L+   K G    A +VFD+M  R+V  W ++I G ++   ++ A+ L+ +M 

               G   D +TF SV+  CS    +W LGRQVH+ VVK+   +     NAL +MY     +

              DA  VF     +  D I++ ++IAG   ++   EAL  F  M  +  Y+ P    F S 

              S+CS    P    QIH + +K G G       +   MY+NC  L++ R +F  I   D+

             VSWNAMIT ++       AI  +  MQ   ++ DE ++ S+LS   SS +++    + S 

             +IK  L   + V NA+++ + K   ++ A+  F+DM  R   +SWNAII+ C  +    +

                L   +L   + P+  T+S V+ ACA I S + G QIH + +K G     ++ N LI 

             +Y+KCG L  + ++F +M   DVVSW+S+I  YAQ G G EA+  F+TM   G V+P++ 

             T  GVL+ACSH GLVE G Q++ +M + +GI P  EH SC+VD+L+RAG L EAEE +K 

                E D  VW TL ++    G+T +G+  A  +LE + +N A  VLL NI A +G+W+E 

             A +R LM+   V K PG SW+ 

 Score =   199 bits (507),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 140/490 (29%), Positives = 244/490 (50%), Gaps = 14/490 (3%)
 Frame = +3

             T+A+++S CS L     GR++H  ++ +       + N ++ MY  C S  DA  VF++ 

              +  V  +++ ++IAG     + ++A+ ++  M      P   TF S++ +CS   +   

               Q+HA VVK   G      NA  +MY+    +     +F R+  KD++SW ++I  ++Q

              + G EA+  + EM  +G  + +EF  GS  S+   +   E    I  + IK GL     

                ++   +   G +E A   F  +   +L+SWNA+I+G  + G    +++ FS +    

             L P+  ++ +VLSAC   P+   G+Q+H YI+K       S+ N L+ +Y+KC  L  + 

              VF+ M  R   VSWN++I+A  QH + GE     + M+ S  + PD  T + V+ AC+ 

                +E G QI    V + G+  GV   + ++D+ ++ G L+ A+++    +   D   W 

Query  2046  TLFSSSAAHG  2075
             +L    A  G
Sbjct  542   SLIMGYAQSG  551

 Score =   172 bits (436),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/493 (25%), Positives = 219/493 (44%), Gaps = 81/493 (16%)
 Frame = +3

             +PD +T  +V+ AC+ + +   G Q+HA+ +++   +     N L S Y K   +     

Query  402   LFSEIQSPDVYSWTTLL------------------------------------SACTKLG  473
             +F+ + + D+ SW +++                                    SAC+ L 

Query  474   EVEYALQ-----------------------------------VFDQMSRRDVAVWNAIIT  548
             + EY  Q                                   VF  + R D+  WNA+IT

             G +   D   A++ F +M  + +  D  +  SVLS C S      GRQVHS ++KT    

             T SV NAL+TMY  C ++ DA  VF+D  +     +++NA+I   +   +  E   +   

             M    + P  +T  +++ +C+D  +     QIH   VK G     +VSN  + MY+ C  

             L++ + +F  +   D+VSW+++I  YAQ   G EA+  +  M+  GV  +E TL  +L++

                +   E    +  ++  ++G+    E  + +V    + G + +A  + + + F  +++

Query  1422  SWNAIISGCQSNG  1460
              W  +++ C++ G
Sbjct  642   VWKTLLAACKTRG  654

 Score = 89.0 bits (219),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 92/166 (55%), Gaps = 5/166 (3%)
 Frame = +3

             F   L   + I S C+   +   +Q+ +   +  +  + P+ Y  + ++SAC+ + S +H

             G++IH +IL      +  + N ++ +Y KCG    + +VF  M ER+VVSW S+I+ Y+Q

             + +  +AV  +  M+ SG  +PD+ TF  V+ ACS  G V  G Q+

>ref|XP_002441797.1| hypothetical protein SORBIDRAFT_08g002505 [Sorghum bicolor]
 gb|EES15635.1| hypothetical protein SORBIDRAFT_08g002505 [Sorghum bicolor]

 Score =   395 bits (1014),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 233/685 (34%), Positives = 358/685 (52%), Gaps = 43/685 (6%)
 Frame = +3

             PD  TL+ +L AC  ++    G Q+HA  ++ GL       + L+  Y K + L      

                                      E AL+ F  M  R+   W A I GC + +     L
Sbjct  188   -------------------------EDALRFFHGMGERNSVSWGAAIAGCVQNEQYTRGL  222

              LF +M  LG+      +ASV   C+ +      RQ+H+  +K  F A   V  A+V +Y

                 S+VDA   F    +  V     NAM+ GLV      EAL +F  M    +    ++

                + S+C++    +   Q+H L +K GF     V NA + +Y  C+ L    L+F+ ++

             ++D VSWNA+I +  Q N   E  +AYL EM R G+  D+FT GS+L +    QS+    

             ++    IK+GL L   VS+ +V  +CK G I +A +    +  + L+SWN+IISG   N 

                ++   FSE+L  G+ P+ +T +TVL  CA + + + GKQIHG I+K     +  I +

             TL+ +Y+KCG +  S  +F+   + D VSWN+MI  YA HG+G EA+  FE M     V 

             P+ ATF  VL ACSH GL++DG + F  M + Y ++P +EHF+C+VDIL R+    EA +

              +++  +E D+ +W TL S      D  +    A  +L  + ++ +VY+LLSN+YA++GK

             W + +  R LM++ R+ K+PG SW+

 Score =   265 bits (677),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 182/623 (29%), Positives = 307/623 (49%), Gaps = 16/623 (3%)
 Frame = +3

             T S +   CA    +    G   HA  L +G    + VSN LL  YA+       + +F 

              +   D  SW T+L+A    G+   A  +F  M   DV  WNA+++G  +      ++ L

               +M   GV+ D  T A +L  C  LE   LG Q+H++ VKTG        +ALV MY  

             C+S+ DA   F    +   + +++ A IAG V  E+    L +F  M+ + L  +   + 

             S+  SC+      TA Q+HA  +K  F     V  A + +Y+    L   R  F  +   

              + + NAM+    +  LG EA+  +  M R G+  D  +L  + S+   V        + 

              L IK+G  + + V NAI+  + K   + +AY  F++M  R+ +SWNAII+  + N    

              ++   +E+L  G+ P+ +T  +VL ACAG+ S ++G  +HG  +K G  L+  + +T++

              +Y KCG++  + ++   +  +++VSWNS+IS ++ + +  EA   F  M+D G V+PD 

              T+  VL  C++   +E G QI   ++    +  G E+  S +VD+ ++ G + ++  ++

               K  ++D   W  +    A HG

 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 66/147 (45%), Gaps = 31/147 (21%)
 Frame = +3

            +PDH+T +TVL  CA++     G Q+H   ++  +    ++S+ L+  YAK    CG   

                   PD                   +L +F++  + D   WNA+I G A       A
Sbjct  590  -----NMPD-------------------SLLMFEKAQKLDFVSWNAMICGYALHGQGFEA  625

            L +F++M    V  ++ TF +VL  CS

>ref|XP_007217281.1| hypothetical protein PRUPE_ppa017680mg [Prunus persica]
 gb|EMJ18480.1| hypothetical protein PRUPE_ppa017680mg [Prunus persica]

 Score =   393 bits (1010),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 218/612 (36%), Positives = 341/612 (56%), Gaps = 12/612 (2%)
 Frame = +3

               LLS   + G +  A  VF +M  RDV  WN ++ G A+    + ALNL+ +M  +G+ 

              D YTF  VL  C  +     GR++H  V++ GF +   V+NAL+TMY  C +V  A  +

             F+       D+I++NAMI+G        E L +F  M    + P  +T  SL+S+C   S

             D     +IH  V++  F +  SV NA + MYS     +    +F R + KD+VSW +MI+

              Y    L  +A+ +Y  M+REG++ DE T+ S+LS+   + N +M   +  L  + G I 

              + V+N ++  +CK   +++A   F  +  +N+ISW +II G + N    ++L  F ++ 

                L PN+ TL +VLSACA I +   GK+IH + L+ G   +  + N L+ +Y +CG + 

              +   F    ++DV +WN +++ YAQ G+G  AV  F  MV+S  V+PD+ TF  +L AC

             S +G+V +G++ F SM  NY I P ++H++CIVD+L  AG LD+A E ++   I  D  +

             W  L ++   H    LG + A  +L+ +      YVL+ N+YA  GKWEE A VR++M++

Query  2220  YRVIKQPGSSWV  2255
               +   PG SWV
Sbjct  644   RGLTVDPGCSWV  655

 Score =   191 bits (486),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 132/509 (26%), Positives = 249/509 (49%), Gaps = 28/509 (6%)
 Frame = +3

             M  L +  +   + +++ LC    W      G +V+S V  +  L +  + NAL++M+  

               ++VDA +VF    +   D  ++N ++ G       +EAL +++ M  + ++P   TF 

              ++ +C    D     +IH  V++ GF     V NA +TMY  C  + + R++F+R+  +

             D +SWNAMI+ Y +     E +  +L M    V  D  T+ SL+S+ + +++ ++   I 

               V++      + V NA++  +  +G  E+A + F     ++++SW ++IS   +N  P 

             +++  +  +  EG+ P+  T+++VLSACA + +   G ++H    + G      + NTLI

              +Y KC  +  +  VF  +  ++V+SW S+I     + +  EA+  F  M  S  ++P+ 

              T   VLSAC+  G +  G +I     + + ++ GV       + ++D+  R G +  A 

                     + D   W  L +  A  G  R

 Score =   138 bits (348),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 127/487 (26%), Positives = 199/487 (41%), Gaps = 83/487 (17%)
 Frame = +3

             PD YT   VL  C  +     G ++H   +R G  +   V N L++ Y K   +   + L

Query  405   FSEIQSPDVYSW-----------------------------------TTLLSACTKLGEV  479
             F  +   D  SW                                   T+L+SAC  L + 

             +   ++   + R     DV+V NA+I   + I   E A  +F +                

                            M   G+  D  T ASVLS C+ L    +G ++H +  +TGF++  

              V N L+ MY  CK V  A  VF     + V  I++ ++I GL    R  EAL+ F  M+

              + L P  +T VS++S+C+     M   +IHA  ++ G      + NA + MY  C  + 

             +    F   K KD+ +WN ++T YAQ   G  A+  +  M    V  DE T  SLL   S

              S  V    E   S+ +   +   ++    IV      G+++ A+ + R M    +   W

Query  1428  NAIISGC  1448
              A+++ C
Sbjct  585   GALLNAC  591

 Score = 69.7 bits (169),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 114/251 (45%), Gaps = 35/251 (14%)
 Frame = +3

             C    + + G +++ Y+    + L   +GN L++++ + G L  +  VF  M ERDV SW

             N ++  YA+ G   EA++ +  M+  G V PD  TF  VL  C            H  ++

                 E  + + N+++  Y     V     + D + R          +GY +  E  E ++

                + ++S+V+       +L S+     D +LGR + G ++ TE   + +V   L  +Y+

Query  2169  DAGKWEESASV  2201
               G +EE+  V
Sbjct  259   IIGHFEEAEKV  269

 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +3

            +P+  TL +VL+ACA I   + G ++HA  LR G+    ++ N LL  Y +   +     

             F+     DV +W  LL+   + G+  +A+++F++M

>ref|XP_008366040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, 
chloroplastic-like [Malus domestica]

 Score =   395 bits (1016),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 210/604 (35%), Positives = 348/604 (58%), Gaps = 11/604 (2%)
 Frame = +3

             K G++  A +VFD++S   V VWN +I   A++ +    + LF KM  LG+  ++YTF+ 

             VL    +L     G  +H  + K GF +  +V N+L+  YF  + +  A  VF++  D  

              D I++N+MI+  VS    E+ + +F  M ++ +     T ++++ +C    +      +

             HA  +K  F +     N  + MYS C DL +   +F+++ E+ +VSW +MI  + +E L 

              EAI  + EM+R+GV  D +T+ S+L   +SS S+     I + + ++G+   + V N +

             +  + K G +E A+  F  M  ++++SWN +I G   N  P ++L LFSE++ +   P++

              T+++VL ACA + +   G++IHG+IL+ G F E  + N L+ +Y KCG+L  +  +F  

             +  +D++SW  + + Y  HG G EA+  F  M  +G +EPD  +F  +L ACSH+GL ++

               + F++M N+YGI P +EH++C+VD+LSR G L +A + +KT  IE D+T+W +L    

               H D +L   VA  + E E  N   YVLL+NIYA+A KWEE   +RE + R  + K PG

Query  2244  SSWV  2255
Sbjct  745   CSWI  748

 Score =   204 bits (519),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 143/525 (27%), Positives = 251/525 (48%), Gaps = 20/525 (4%)
 Frame = +3

             D   + SV+ LC+ +     G+ VHS++   G  A   +   LV MY  C  + +A  VF

             +   +  V    +N MI     +    E + +F  M+ + +     TF S +  C   + 

               +    IH  + K GFG   +V N+ M  Y   + ++  R +F+ + ++D++SWN+MI+

             +Y    L  + +  + +M   G+  D  T+ ++L +  +  N  +  +L    IK     

              +   N ++  + K G++  A + F+ M  R+++SW ++I+G    G   +++ LFSE+ 

              +G+ P+AYT++++L ACA   S + G+ IH YI + G      + NTL+ +Y+KCG + 

              +  VF  M  +D+VSWN+MI  Y+++    EA+  F  M+   +  PD  T   VL AC

             +    +  G +I   ++ N G        + +VD+  + G L  A  +     I V   +

              WT+    A +G    GR       E  K    P     +S +YA

 Score =   181 bits (459),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 147/590 (25%), Positives = 266/590 (45%), Gaps = 68/590 (12%)
 Frame = +3

             + YT S VL   +++     G  +H +  + G  + + V N L++FY K++         

                                    +E A +VFD++  RDV  WN++I+        E  + 
Sbjct  253   ----------------------RIEXARKVFDELCDRDVISWNSMISAYVSNGLAEKGVE  290

             +F++M SLG+  D  T  +VL  C +     LGR +H+  +K  F       N ++ MY 

              C  +  A  VF+   +  V  +++ +MIAG +    ++EA+ +F+ M    + P   T 

              S++ +C+   +  +   IH  + + G      V N  M MY+ C  ++    +F R+  

             KDIVSWN MI  Y++  L  EA+  + EM ++    D  T+ S+L +  S+A     + I

                +++NG   +  V+NA+V  + K G +  A   F  +  ++LISW  I +G   +GF 

              +++  F+E+   G+ P++ +  ++L AC  +G+       F   +  +G + K   +  

                   ++ L S+ G L  + +  + M  E D   W S++     H   K  E V  H F

             E       +EP+   +  +L+         + +++    +   G+K  PG

 Score =   102 bits (253),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 114/249 (46%), Gaps = 35/249 (14%)
 Frame = +3

            PD YT++++L ACAS      G  +H +    G+ +  +V N L+  YAK   +     +

            FS + + D+ SW T++   +K      AL++F +M ++                      

                         D+ T ASVL  C SL     G+++H  +++ G+ +   V NALV MY

              C  +V A  +F+     V D I++  + AG        EA+  FN MR   + P  ++

Query  942  FVSLMSSCS  968
            F+S++ +CS
Sbjct  609  FISILYACS  617

 Score = 73.6 bits (179),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 96/214 (45%), Gaps = 34/214 (16%)
 Frame = +3

             +LS +  ++ A   +S  +    I  +   NA ++ +C++G               NL S

                ++SG Q            SEL  E     AY   +V+  CAG+ S Q GK +H  I 

               G   +  +G  L+ +Y KCG L  + RVF  ++   V  WN MI+ YA+     E V+

              F  M + G ++ +  TF+ VL   S  G V +G

 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 62/133 (47%), Gaps = 4/133 (3%)
 Frame = +3

            +PD  T+++VL ACAS+     G ++H   LR G  +  HV+N L+  Y K   L   + 

            LF  I   D+ SWT + +     G    A+  F++M +     D   + +I+  C+    

Query  570  DEVALNLFQKMHS  608
             + A   F  M +
Sbjct  622  XDEAWRFFDTMRN  634

>ref|XP_011089777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X1 [Sesamum indicum]
 ref|XP_011089778.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X1 [Sesamum indicum]
 ref|XP_011089779.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X1 [Sesamum indicum]
 ref|XP_011089780.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
isoform X1 [Sesamum indicum]

 Score =   400 bits (1027),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 232/684 (34%), Positives = 360/684 (53%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y  S+V++AC  I     G QLHA   + G ++   V N L++ Y++  +L   + +

             FSE+   D  S+ TL+S     G  E ALQ                              
Sbjct  336   FSEMLCKDKVSYNTLISGFAMQGSNEKALQ------------------------------  365

              LF+KMHS  +  D+ T A +L  C S+ +   G Q+HS  +K G  +   +  +L+ +Y

               C  +  A   F     + V  + +N M+     +   +E+  +++ M+ + L P   T

             + S++ +C+         Q+H  V+K GF     V +  + MY+   +L+    IF R+ 

             E DIVSW AMI  YAQ ++  EA+  + EMQ  G+++D   L S +S+    Q++     

             I S  I +G    I + NA+V  + + G   +A+  F  M+ R+ +SWNA+ISG   +G 

               ++L +FS+++  G   N +T  + +SA A + +   GKQIH   +K G   E  + N 

             LI LY+KCG L+ + RVF  M E++ VSWN+MI+ Y+QHG G +A+  FE M    +++P

             +  T+ GVL+ACSH GLVE+G+  F SM   + + P  EH++C+VD+L RAG +  A   

             V++  I  D+ VW TL SS   H +T +G   A  LLE E  + A YVL+SN+YA  GKW

             +     R LM+   V K+PG SW+

 Score =   272 bits (695),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 177/623 (28%), Positives = 306/623 (49%), Gaps = 44/623 (7%)
 Frame = +3

             +S +L AC+       F  Q+HA  +R G +    V N L+  Y K++ L          

                                  + A+Q+F  M  RD   W A+I+G ++   +  A++L+ 

             +M  LGV    Y F+SV+S C+ + L+ LG Q+H+++ K GF +   V N+L+ +Y  C 

             ++  A  +F +      D+++YN +I+G      NE+AL +F  M +  L P  +T   L

             + +CS         Q+H+  +K G      +  + + +Y  C D+K     F   +  ++

             V WN M+ +Y Q     E+   Y +MQ  G+  +++T  S+L +  SV      E + + 

             VIK G    + V + ++  + K GE+E A + FR +   +++SW A+I+G   +    ++

             L LF E+   G+  +   L++ +SACAGI + + G+QIH   +  G   + SIGN L+ L

             Y++CG    +   F  M  RD VSWN++IS +AQ GK  EA+  F  M+ +G  E +  T

             +   +SA ++   V  G QI    +   G    +E  + ++ + ++ G L+ A  +  T+

               E +   W  + +  + HG  R

 Score =   209 bits (531),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 128/460 (28%), Positives = 228/460 (50%), Gaps = 40/460 (9%)
 Frame = +3

             +PD  T++ +L  C+SI     G QLH++ ++AG+ +   +   LL  Y K  D+    +

              F   Q+ +V  W  +L A  ++G ++                                +
Sbjct  436   FFVATQTDNVVLWNVMLVAYGQIGNLQE-------------------------------S  464

              N++ +M  LG+  + YT+ S+L  C S+    LG QVH+ V+KTGF     V + L+ M

             Y     +  A  +F   +++  D +++ AMIAG    +  +EAL +F  M+   ++   +

                S +S+C+         QIH+  +  G+    S+ NA + +Y+ C       L F+++

               +D VSWNA+I+ +AQ     EA+  + +M + G   + FT GS +S++ ++ N  +  

              I +  IK G   +IEV N +++ + K G +  A R F +M  +N +SWNA+I+G   +G

             +  Q++ LF ++    + PN  T   VL+AC+ +   + G

>ref|XP_009602859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nicotiana tomentosiformis]
 ref|XP_009602860.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nicotiana tomentosiformis]
 ref|XP_009602861.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nicotiana tomentosiformis]
 ref|XP_009602862.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nicotiana tomentosiformis]
 ref|XP_009602863.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nicotiana tomentosiformis]
 ref|XP_009602864.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nicotiana tomentosiformis]

 Score =   393 bits (1010),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 216/644 (34%), Positives = 357/644 (55%), Gaps = 9/644 (1%)
 Frame = +3

             N  LS  +K       +++F ++   D ++W T+++A   +G +  A QVF ++  +   

              W+++I G  +   +     LF +M S G     +T  S+L +C+++ L   G Q+H   

             +KT F     V+  L+ MY   K + +A  +F+       + +T+ AMI G         

             A+  F++M +  +     TF  +++SC+   D     Q+H+ +VK GF     V ++ + 

             MYS C DL + +   E ++    VSWN+MI    +  + GEA+  +  M    +  DEFT

               S+L+S    Q V N + +  +V+K G      VSNA++  + K GE+  A   F  M 

              +++ISW ++++GC  NG   ++L  F E+    + P+   +++VLS+C+ +   + G+Q

             +H   LK G     SI N+L+ +Y+ CG L  + +VF  M  R+V+SW ++I AYAQ+GK

             G E+V  ++ M+ SG +EPD  TF G+L ACSH GLVE G + F+SM  +YGI+P  +H+

             +C++D+L RAG + EAE++V   +I  D+TVW  L ++   HG T L    +  L + E 

              + A YV+LSNIY+ AGKW+++A +R  M+   V K+PG SW+ 

 Score =   159 bits (403),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 114/420 (27%), Positives = 202/420 (48%), Gaps = 42/420 (10%)
 Frame = +3

             + YT   VLT+CA++    FG Q+H+  ++ G      V + L+  Y+K  DL   K+  

               ++     SW +++  C + G                       + G A        L+
Sbjct  282   ELMEVDHAVSWNSMILGCVRHG-----------------------VPGEA--------LS  310

             LF++MH+  +  D +T+ SVL SL  ++    G+ +H MVVKTG+ +   V NAL+ MY 

                 +  A  VF    ++  D I++ +++ G       EEAL  F  MR   + P  +  

              S++SSCS+        Q+HA  +K G     S+ N+ MTMY+NC  L+  + +F  ++ 

             ++++SW A+I +YAQ   G E++  Y EM   G+  D  T +G L + S +  V + +  

                + K+ G+    +    ++    + G+I++A +   +M    +   W A+++ C+ +G

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +3

             PDH  +++VL++C+ +     G Q+HA  L++GL     + N L++ YA    L   K+

            +F+ +Q  +V SWT L+ A  + G+ + +++ +D+M

>gb|EPS63127.1| hypothetical protein M569_11659 [Genlisea aurea]

 Score =   395 bits (1014),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 239/686 (35%), Positives = 354/686 (52%), Gaps = 43/686 (6%)
 Frame = +3

             R D  T + VL  C+S+++ + G QLH    + G       S+ LL  YAK         

                                C  L E   +++ FD M  ++   W+A+I GC + DD    
Sbjct  228   -------------------CNSLDE---SIRFFDAMPVKNWVSWSAMIAGCVQKDDPFRG  265

             L  F++M   G+     T+ASV  S   L    LGRQ+H   +K  FL    V  A++ M

             Y  C  +  A  VF    D  +D  +YNA+I G        E + +F  +        G+

             +     SSCS        +Q+H LV+K  F     V+NA + MY  C  L+  R +F+ +

             +++D VSWNA+I +  ++N  GE + A +L M R G   D FT GS+L +     V N  

               I   VIK+G+     V   +V  +CK G + +A +  R M   +L+SWNAIISG  SN

                  + N FS +L  G  P+A+T + +L  C+ + +   G+QIHG I+K     +  I 

             +TL+ +YSKCG +  +  VF   ++RD V+WN+MI AYA HG+G EA+  FETM    +V

              P++ TF  VL AC+H G  ++  + F+ M   YGI+P +EH+S +VD L + G L +A 

              +++    E D  +W TL S   A+G+       A  LLE + N+P+ YVLLSN+YADAG

              W E A +R  M+ + + K+PG SW+

 Score =   276 bits (705),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 194/675 (29%), Positives = 325/675 (48%), Gaps = 15/675 (2%)
 Frame = +3

             RP  Y  T S +   C        G Q H+    +G      V N L+  Y K   L   

             +++F ++   D  SW  ++   +  G+VE A   FD M  +DV  WN++I+G  +  D  

              +L++F  M   G+ +D  TFA VL +C SLE + LG Q+H +V KTGF       +AL+

              MY  C S+ ++   F+     V + ++++AMIAG V  +     L  F  M+   +  +

               T+ S+  S    S      Q+H   +K+ F     V  A + MYS C DL + R +F 

              + + D+ S+NA+IT  ++  LG E +  +  + R     D  +L    SS   +     

                +  LVIK      + V+NA +  + K G + +A R F +M  R+ +SWNA+I+ C+ 

             N        LF  +L  G  P+A+T  +VL ACAG      G++IHG ++K G   ++ +

             G  L+ +Y K G +  + ++ ++M E  +VSWN++IS ++ +     A + F  M+++G 

               PD  T+  +L  CS+      G QI   +V    +       S +VD+ S+ G +D+A

               +V  ++ + D   W  +  + A HG      R+   + L     N   ++ +    A 

Query  2172  AGKWEESASVRELMQ  2216
              G+ +E++   +LM+
Sbjct  698   VGRADEASRYFDLMR  712

>ref|XP_007030705.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
 gb|EOY11207.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 

 Score =   405 bits (1042),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 231/685 (34%), Positives = 364/685 (53%), Gaps = 41/685 (6%)
 Frame = +3

             P  Y  S+VL+AC  I+    G QLH+   + G ++ ++V N L++ Y++S         

                                   G +  A Q+F  M  RD   +N++I+G A+    + AL
Sbjct  345   ----------------------GSLVSAEQIFSNMQLRDGVTYNSLISGLAQCGYSDRAL  382

              LF+KMH   +  D  T AS+L  C SL     G+Q+HS  +K GF     V  +L+ +Y

               C  +  A   F   + E V  + +N M+     ++   E+  +F  M+   L+P   T

             + S++ +C+         QIH+ V+K GF     V +  + MY+    L+    I  ++ 

             E+D+VSW AMI  Y Q ++  EA+  + EM   G+ +D   L S +S+    Q+++  + 

             I +    +G    + + NA+VS + +  + + AY+ F+ +  ++ ISWNA+ISG   +GF

               ++L +FS++   GL    YT  + +SA A   + + GKQIH  I+K G  LE    N 

             LI LY+KCG +  + + F  + E++ VSWN+MI+ Y+QHG G EA+  FE M   G V P

             +  T  GVLSACSH GLV++G+  F+SM   +G+ P  EH++C+VD+L RAG L  A + 

             V+   IE D+ +W TL S+ A H +  +G   A  LL+ E  + A YVLLSN+YA + KW

             +     R++M+   V K+P  SW+ 

 Score =   287 bits (734),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 187/626 (30%), Positives = 323/626 (52%), Gaps = 46/626 (7%)
 Frame = +3

             P+  T + +L AC+ S     +  Q+HA  +R G    S V N L+  Y           

                                 TK G ++ A++VFD++  +D   W A+I+G ++   +E A

             + LF +MH  G+    Y F+SVLS C+ +E + LG Q+HS+V K GF + T V NALVT+

             Y    S+V A  +F +   ++ D +TYN++I+GL     ++ AL +F  M +  L P  +

             T  SL+ +C+      T  Q+H+  +K GF     V  + + +Y  C D++     F   

             + +++V WN M+ +Y Q +   E+   + +MQ EG+V ++FT  S+L +  S+      E

              I S VIK G    + V + ++  + KLG++E A    R +   +++SW A+I+G   + 

                ++L LF E+L  G+  +   LS+ +SACAGI +   G+QIH      G   + SIGN

              L++LY++C     + + F+ +  +D +SWN++IS + Q G   EA+  F  M  +G +E

                 T    +SA ++   ++ G QI ++M+   G    +E  + ++ + ++ G +D+A +

             E ++    E +   W  + +  + HG

 Score =   230 bits (586),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 143/483 (30%), Positives = 248/483 (51%), Gaps = 11/483 (2%)
 Frame = +3

             G+++ A+ VFD M +R+V  WN +I+G          L  + +M    V+ +  TFA +L

               CS   +W     Q+H+ +++ GF  ++ V N L+ +Y     +  A  VF+     V 

             D +++ AMI+GL      E+A+++F+ M    + PT   F S++S+C+         Q+H

             +LV KQGF   T V NA +T+YS    L +   IF  ++ +D V++N++I+  AQ     

              A+  + +M  + +  D  T+ SLL +  S+      + + S  IK G  + I V  +++

               + K  +IE AY +F    T N++ WN ++          +S ++F ++  EGL PN +

             T  ++L  C  + +   G+QIH  ++K G      + + LI +Y+K G L  +  + + +

              E DVVSW +MI+ Y QH    EA+  F  M++ G ++ D    +  +SAC+    +  G

Query  1887  IQI  1895
Sbjct  619   QQI  621

 Score =   230 bits (586),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 152/528 (29%), Positives = 261/528 (49%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++L ACAS+     G QLH++ ++AG +    V   LL  Y K  D+     

              FS  ++ +V  W  +L A  +L  +  +  +F QM                +I+     

                       G+  + +T+ S+L  C SL    LG Q+HS V+KTGF     V + L+ M

             Y     +  A  +     +E  D +++ AMIAG    +   EAL +F  M N  +    +

                S +S+C+         QIHA     GF D  S+ NA +++Y+ C   +     F++I

               KD +SWNA+I+ + Q     EA+  + +M + G+ A  +T  S +S++ + AN    +

              I +++IK G  L+IE SN +++ + K G I+ A + F ++  +N +SWNA+I+G   +G

             + +++++LF ++   G+TPN  TL  VLSAC+       G+  F    + HG + K   +

                     ++ L  + G+L  + +  + M  E D + W +++SA A H

 Score =   173 bits (438),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 116/380 (31%), Positives = 189/380 (50%), Gaps = 18/380 (5%)
 Frame = +3

             E N + +     M N  +     TF+ L+  C +  +  Q   +H  ++K GF     +S

                M ++    DL A   +F+ + ++++ SWN MI+ +  + L  + +  Y  M  E V 

              +E T   +L +           E I + +I++G      V N ++  + K G I+ A +

              F  ++ ++ +SW A+ISG   NG+  Q++ LFSE+   G+ P  Y  S+VLSAC  I  

             F+ G+Q+H  + K G   ET + N L+ LYS+ G L  + ++F  M  RD V++NS+IS 

              AQ G    A+  FE M     ++PD  T   +L AC+  G +  G Q+     ++Y IK

              G   FS  +DI+     LD
Sbjct  426   AG---FS--MDIIVEGSLLD  440

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 114/464 (25%), Positives = 206/464 (44%), Gaps = 67/464 (14%)
 Frame = +3

             L  +P+   E ++    ++A +T+   FY AL LF  + +  + + D+  LS+ ++ACA 

             IQ    G Q+HA    +G +    + N L+S YA+        + F +I + D  SW  L

             +S  T+ G  E ALQVF QM++   A   A +  C                         
Sbjct  672   ISGFTQSGFCEEALQVFSQMNK---AGLEATLYTC-------------------------  703

                +SV +  +      G+Q+H+M++K G+       N L+T+Y  C S+ DA   F + 

              ++  +++++NAMI G        EA+ +F  M+ + + P  +T V ++S+CS       

              H  +V +G     S+S           Y+   DL        +A + + +   E D + 

             W  ++++ A  +N+  GE    +L        A    L +L + S+   + +    ++ +

              G+  +     IEV N+I + F   +L  + E+ Y +  D+  R

>ref|XP_004492675.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
[Cicer arietinum]

 Score =   392 bits (1007),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/642 (33%), Positives = 352/642 (55%), Gaps = 32/642 (5%)
 Frame = +3

             SN LL+  +KS  +   ++LF ++   D YSW T++S    +G++  A ++FD  S R  

               W+++I+G  +      A +LF+ M   G     YT  SVL +CS L L   G  +H  

             VVK GF +   V+  LV MY  CK +++A ++F+    +  + + + AM+ G        

             +A+  F +M    ++    TF +++++CS         Q+H  +V+ GFG    V +A +

              MY+ C DL + + + E +++ DIVSWN+MI  + +     EA+L +  M    +  D++

             T  S+L+       +   +  L+IK G      VSNA+V  + K  ++  AY  F  M  

             +++ISW ++++G   NG   +SL  F ++   G+ P+ + ++++LSACA +   + GKQ+

             H   +K G     S+ N+L+A+Y+KCG L  +  +F  M   DV++W ++I  YAQ+   

                                     G+L ACSHAGLV++G + F  M N YGIKPG EH++
Sbjct  519   ------------------------GLLFACSHAGLVDEGRRYFQQMNNVYGIKPGPEHYA  554

             C++D+  R+G +DEA+E++   +++ D+TVW +L ++   HG+  LG   A  L E E  

             N   YV+LSN+Y+ A KW+++A +R+LM+   ++K+PG SW+

 Score =   144 bits (363),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/320 (30%), Positives = 153/320 (48%), Gaps = 43/320 (13%)
 Frame = +3

             + YT  T+LTAC+S+    FG Q+H   +R+G     +V + L+  YAK  DL   KR+ 

               ++  D+ SW +++     +G V +  +                          E AL 
Sbjct  298   ETMEDDDIVSWNSMI-----VGFVRHGFE--------------------------EEALL  326

             LF+ MH   +  D+YTF S+L+ C   S++     R VH +++KTGF     V NALV M

             Y     +  A  VFE   ++  D I++ +++ G      +EE+L  F  MR   + P   

                S++S+C++        Q+H+  +K G     SV N+ + MY+ C  L     IF  +

             +  D+++W A+I  YAQ  L

 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/281 (28%), Positives = 133/281 (47%), Gaps = 37/281 (13%)
 Frame = +3

             +G    I  SN +++   K G ++ A + F  M  ++  SWN +ISG             

                  C+S+             G  +++ +LF  +  EG  P  YTL +VL  C+ +   

             Q G+ IHGY++K G      +   L+ +Y+KC  +  +  +F+ +    ++ V W +M++

              YAQ+G G +AV  F  M   G V  ++ TF  +L+ACS       G Q+   +V + G 

                V   S +VD+ ++ G L  A+ +++T  +E D  V W 

 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 9/105 (9%)
 Frame = +3

            PD + ++++L+ACA +    FG Q+H+  +++GL     V N L++ YAK   L     +

            F  +Q PDV +WT          LL AC+  G V+   + F QM+

>ref|XP_002319164.2| pentatricopeptide repeat-containing family protein, partial [Populus 
 gb|EEE95087.2| pentatricopeptide repeat-containing family protein, partial [Populus 

 Score =   396 bits (1017),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 229/684 (33%), Positives = 358/684 (52%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y  S+VL+ C  I+    G QLHA   + G +  ++V N L++ Y++  +    +++

             FS                               +M  +D   +N++I+G A+    + AL
Sbjct  201   FS-------------------------------KMQSKDEVSFNSLISGLAQQGFSDGAL  229

              LF KM    +  D  T AS+LS C S      G Q+HS V+K G  +   V  AL+ +Y

              NC  +  A  +F  A  E V  + +N M+     ++   E+  +F  M+   L+P   T

             + S++ +C+         QIH  V+K GF     V +  + MY+    L    +I   + 

             E D+VSW A+I+ YAQ NL  EA+  + EM   G+ +D     S +S+    Q++     

             I +    +G    + + NA+VS + + G I++AY  F  +  ++ ISWN +ISG   +G+

                +L +F+++    L  + +T  + +SA A I + + GKQIH  I+K G   +  + N 

             LI  Y+KCG +  + R F  M E++ VSWN+MI+ Y+QHG G EAV+ FE M   G + P

             +  TF GVLSACSH GLV  G+  F SM   +G+ P   H++C+VD++SRAG+L  A + 

             ++   IE D+T+W TL S+   H +  +G   A  LLE E  + A YVLLSN+YA +GKW

             +     R++M+   V K+PG SW+

 Score =   276 bits (705),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 176/625 (28%), Positives = 320/625 (51%), Gaps = 44/625 (7%)
 Frame = +3

             P   + ++VL AC+  +  + +  Q+HA  +  GL     +SN L+  YAK+        

                                    G +  A +VFD +  +D   W A+I+G ++   +E A
Sbjct  91    -----------------------GLIISARKVFDNLCTKDSVSWVAMISGFSQNGYEEEA  127

             ++LF +MH+ G+    Y F+SVLS C+ ++L+ +G Q+H++V K G    T V NALVT+

             Y    + V A  VF     +  D++++N++I+GL     ++ AL +F  M+  YL P  +

             T  SL+S+C+         Q+H+ V+K G      V  A + +Y NC D+K    +F   

             + +++V WN M+ ++ + +   E+   + +MQ +G++ ++FT  S+L +  SV      E

              I + VIK G    + V + ++  + K G+++ A+   R +   +++SW A+ISG   + 

                ++L  F E+L  G+  +    S+ +SACAGI +   G+QIH      G   + SIGN

              L++LY++CG +  +   F+ +  +D +SWN +IS +AQ G   +A+  F  M +  ++E

                 TF   +SA ++   ++ G QI ++M+   G    +E  + ++   ++ G +++A  

                 +  E +   W  + +  + HG

 Score =   228 bits (582),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 152/528 (29%), Positives = 258/528 (49%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++L+ACAS      G QLH++ ++AG+++   V   LL  Y    D+     

             +F   Q+ +V  W  +L A  KL  +  + ++F QM  +                     

                       G+  + +T+ S+L  C S+    LG Q+H+ V+KTGF     V + L+ M

             Y     +  A  +     ++  D +++ A+I+G        EAL  F  M N  +    +

              F S +S+C+         QIHA     G+ +  S+ NA +++Y+ C  +K   L FE+I

               KD +SWN +I+ +AQ     +A+  + +M R  + A  FT GS +S++ ++AN    +

              I +++IK G    IEVSNA+++ + K G IE A R F +M  +N +SWNA+I+G   +G

             +  +++NLF ++   G  PN  T   VLSAC+       G+  F+   + HG + K   +

                     ++ L S+ G L  + +  + M  E D   W +++SA   H

 Score =   228 bits (582),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 159/533 (30%), Positives = 268/533 (50%), Gaps = 17/533 (3%)
 Frame = +3

             M  R V  W+ II+G  E       L+LF  M    VS    +FASVL  CS    G+  

               Q+H+ ++  G L +  + N L+ +Y     ++ A  VF++   +  D +++ AMI+G 

                   EEA+ +F  M    + PT   F S++S C+         Q+HALV K G    T

              V NA +T+YS   +  +   +F +++ KD VS+N++I+  AQ+     A+  + +M+R+

              +  D  T+ SLLS   S+ ++   E + S VIK G+   + V  A++  +    +I+ A

             +  F    T N++ WN ++          +S  +F ++  +GL PN +T  ++L  C  +

              +   G+QIH  ++K G      + + LI +Y+K G L  +  + + +TE DVVSW ++I

             S YAQH    EA+  F+ M++ G ++ D   F+  +SAC+    +  G QI   S V+ Y

                  + +   +V + +R G + EA   ++ + I+  DS  W  L S  A  G

>ref|XP_006855406.1| hypothetical protein AMTR_s00057p00151990 [Amborella trichopoda]
 gb|ERN16873.1| hypothetical protein AMTR_s00057p00151990 [Amborella trichopoda]

 Score =   394 bits (1013),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 237/683 (35%), Positives = 360/683 (53%), Gaps = 44/683 (6%)
 Frame = +3

             P+ +T +  L ACA       G ++HA  +++ L   + + +GL++ Y K       KR 

                                      E A ++F++M  RDV  WN I+  C     +E  L
Sbjct  236   ------------------------KECAYKIFNKMHERDVVSWNTIMAACMGECIEESGL  271

               F+ M   G   ++ TF ++L  CS     +G Q+H+  +K G    + V N+L+  Y 

                 +  A  VFE   +   +++ +  M+   VSM  + EAL +F+ M    + P  +  

              +++SSC+ P +    TQIH   +K GF   T V+NA MTMY+ C+ L    LIF  I E

              D VSWNA+IT +       E    + +M R G+  +  TL   L +  ++ + ++   +

              +LV+K G      V NA+V+ +   G +E A   F  +  R+++SWN++I+G   NG  

               SL LF E+L +GL PN  T   VLSA A + S   G QI   I K G      I N+L

             I +Y+KCG + ++ + F+ + + D+VSWNS+I+ YA HG G  AV  FE M  +G V+ D

               TF GVLSACSH GL+ +G   F +M   +G++P +EH++C+VD+L R GYL+EA E++

             +   I     +W TL  +   +G+T++G + A  LLE E  + A Y LLSNIYA  GKWE

             E   VR+ M+   V K+ G SW+

 Score =   247 bits (630),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 168/556 (30%), Positives = 275/556 (49%), Gaps = 13/556 (2%)
 Frame = +3

             PD++    L++   K G +  A++VFD+M   DV  W+ +I G A    ++ A   F+ M

              S G   + +T+ + L  C+L  +   G +VH+ +VK+  L  T + + L+ MY   K  

               A  +F    +   D +++N ++A  +     E  L  F  M     MP  +TF++L+ 

             SCS      QIHA  +K G G  + V N+ +  YS    L   R +FE IKE++ V W  

             M+  Y       EA+  +  M RE +  D   + ++LSS  S  + E    I    IK+G

                   V+NA+++ + K   + +A   F  +   + +SWNAII+G        +   LFS

             ++   GL  N  TL+  L AC  I   + G+ +H  ++K G      +GN L+ +Y+  G

              L  +  VF  +T RD+VSWNSMI+ Y ++G   +++  F  M+  G + P+  TF GVL

             SA +    ++ G QI  + +   G KP V   + ++++ ++ G +D A  +   + IE  

Query  2028  DSTVWWTLFSSSAAHG  2075
             D   W +L +  A HG
Sbjct  649   DIVSWNSLITRYAHHG  664

 Score =   182 bits (461),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/444 (28%), Positives = 220/444 (50%), Gaps = 9/444 (2%)
 Frame = +3

             G  VH+ + +TGF+    + N L+ MY  C S+  A  VF++      D I+++ MI G 

                 R ++A M F  M +   MP   T+ + + +C   S      ++HA +VK      T

              + +  + MY   +  +    IF ++ E+D+VSWN ++ +   E +    +  +  M R+

             G + ++ T  +LL S  S++    I +  IK+G  L   V N++++ + K+G++  A R 

             F  +  RN + W  ++    S G   ++L+LFS +L E + P+   +ST+LS+C    S 

             + G QIH + +K G    T + N L+ +Y+KC  L  +  +F ++ E D VSWN++I+ +

                    E    F  M   G +  +  T TG L AC +    + G Q  +++V   G + 

                  + +V + +  G L+ AE +

 Score =   155 bits (393),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 177/367 (48%), Gaps = 31/367 (8%)
 Frame = +3

              + +H  + + GF     + N  + MY  C  +     +F+ +   D++SW+ MI  YA+

              +   +A + + +M  +G + ++FT         LGS++     V +A ++ SL++ +  

             I      + +++ + K    E AY+ F  M  R+++SWN I++ C   G  ++   LF  

             +L +G  PN  T   +L +C+   S   G QIH + +K G  L + + N+LI  YSK G 

             L  + RVF+ + ER+ V W  M+  Y   G   EA+  F  M+   R+ PD    + +LS

             +C+    +E G QI     + + IK G    + + + L    ++   L EA+ I    + 

Query  2022  EVDSTVW  2042
             E D   W
Sbjct  445   EPDGVSW  451

 Score =   108 bits (271),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 154/303 (51%), Gaps = 12/303 (4%)
 Frame = +3

             S+S+    M+ + + + G +  I + N +++ + K G I  A + F +M   ++ISW+ +

             I G         +   F +++++G  PN +T +  L ACA     + G ++H  I+K   

               +T I + LIA+Y K      + ++F  M ERDVVSWN++++A    G+  E    F++

             M+  G + P+  TF  +L +CS   +   G+QI  +++ + +G+   V   + +++  S+

              G L  A  + ++   E +  VW  +     + G +     +  ++L  E+ NP  Y+L+

Query  2154  SNI  2162
             S I
Sbjct  386   STI  388

 Score = 89.4 bits (220),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = +3

             LT NAY  S +LS      S ++G  +H ++ + G   +  I N LI +Y KCG +H + 

             +VF  M   DV+SW++MI  YA+  +  +A  CF  MV  G + P++ T+T  L AC+  

Query  1869  GLVEDGIQIFNSMVNN  1916
              +V +G+++  S+V +
Sbjct  199   SMVREGMEVHASIVKS  214

>ref|XP_010325860.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010325865.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010325867.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010325873.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010325875.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010325880.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]
 ref|XP_010325884.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Solanum lycopersicum]

 Score =   392 bits (1007),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 214/628 (34%), Positives = 350/628 (56%), Gaps = 9/628 (1%)
 Frame = +3

             ++LF ++   D ++WTT+++A    G +  A QVF ++  +    W+++I G  +   + 

                 LF +M S G     +T  S+L +C+++ L   G Q+H   +KT F     V+  L+

              MY   K V++A  +F+       + +T+ AMI G         A+  F++MR   +   

               TF  ++SSC   SD     Q+H  +V  GF     V ++ + MY  C+DL + +   +

             +++    VSWN+MI  Y +  L  EA+  + +M    +  DEFT  S+L+S    Q   N

                +  LV+K G      VSNA++  + K  ++  A   F  M  +++ISW ++++GC  

             NGF  ++L LF E+      P+   +++VLS+C+ +   + G+Q+HG  +K G     S+

              N+L+ +Y+ CG L  + +VF  M   +V+SW ++I AYAQ+GKG E++  +E M+ SG 

             +EPD  TF G+L ACSH GLV+DG + F SM  +YGI+P  +H++C++D+L RAG + EA

             E++V   +IE D+TVW  L ++   HG+T L    +  L + E  +   YV+LSNIY+ A

             GKWE +A +R  M    + K+PG SW+ 

 Score =   189 bits (479),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 145/522 (28%), Positives = 235/522 (45%), Gaps = 41/522 (8%)
 Frame = +3

             P  +TL ++L  CA       G Q+H + ++        V  GL+  YAKS      KR+

                                    E E   Q+      ++   W A+I G +   D   A+
Sbjct  173   L----------------------EAECIFQIMSH--GKNHVTWTAMINGYSLNGDALRAI  208

               F  M + G+  + YTF  VLS C +L     G QVH  +V  GF A   V ++L+ MY

               C+ +  A    +    EV   +++N+MI G V     EEAL +F  M    +     T

             + S+++S +   D      +H LVVK G+     VSNA + MY+  +DL     +F  + 

             EKD++SW +++T  A      EA+  + EM+      D+  + S+LSS   +A  E+   

             +    IK+GL   + V N++++ +   G +E A + F  M   N+ISW A+I     NG 

               +SL  + E++A G+ P+  T   +L AC+       GK+    + K +G         

              +I L  + G +  + ++   M  E D   W ++++A   HG

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/271 (28%), Positives = 134/271 (49%), Gaps = 36/271 (13%)
 Frame = +3

Query  1332  SNAIVSAFCKLGEIEQAYRYF-----RDMF--------------------------TRNL  1418
              N  ++   KLG+ ++A + F     RD F                          T++ 

             I+W+++I G   +GF ++   LF ++ +EG  P+ +TL ++L  CA       G+QIHGY

              +K    +   +   LI +Y+K   +  +  +FQIM+  ++ V+W +MI+ Y+ +G    

             A+ CF  M   G +E ++ TF GVLS+C+    +  G+Q+   +VN  G +  V   S +

             +D+  +   L  A++ +  K +EV+  V W 

 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 81/165 (49%), Gaps = 14/165 (8%)
 Frame = +3

            +PD   +++VL++C+ +     G Q+H   +++GL     V N L++ YA    L   K+

            +F+ +Q  +V SWT L+ A  + G+ + +L+ +++M       D   +  ++  C+    

            +DD +      +K + +  S D+Y        C ++L G   ++ 

>ref|XP_010518772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Tarenaya hassleriana]

 Score =   396 bits (1017),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 225/686 (33%), Positives = 379/686 (55%), Gaps = 42/686 (6%)
 Frame = +3

             R + +T  +VL +CA+ +    G Q+H   +  G  +   V N L+  YAK         

                                C   GE+E + +VF+++  + V  WNA+++   + D     
Sbjct  211   -------------------C---GELEASRRVFNELPEKGVVSWNALLSSYMQNDSCAEG  248

             ++LF  M + GV  + ++ +S++  C+ L   G GR++H  ++K G+ +     NALV M

             Y    S+VDA  VF++   E  D +++N ++AG V  E  E +L +F  M      P  +

             T  S + + +         Q HA ++K    +  S +    + MYS C      R +FE 

             + EK +V+WNAMI+ Y+Q+    EA+L + EM +EG+  ++ TL ++L S    Q+   +

             E I +L +K+GL+    + N+++ A+ K G++E A + F +  + +L+S+ ++I+     

                 +++ L+ ++   GL P+A+  S++L+ACA + +++ GKQIH ++LKFG   +   G

             N+L+ +Y+KCG +  + R F  + ER ++SW++MI   AQHG G +A+  FE M++ G V

              P+  T   VLSAC+H GLV +  + F SM   +GI+P  EH++C++D+L RAG L EA 

             E+V+    E D++VW  L  ++  H +  LG+  A  LL  E      +VLL+NIYA AG

              WE  A +R+LM+ ++V K+PG SW+

 Score =   215 bits (548),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 164/625 (26%), Positives = 294/625 (47%), Gaps = 44/625 (7%)
 Frame = +3

             P   T   +L+  ++ +  + G Q+H   +  GL+  S   N L+  Y K    CG    

                                       YA ++ D+    D   W+A+I+G ++    + AL
Sbjct  113   ------------------------FGYARKLLDESPEPDFVSWSALISGYSQNGFSQEAL  148

               FQ+MH LG+  + +TF SVL  C+  +   LG QVH + + TG+ +   V N+LV MY

               C  +  +  VF +  ++ V  +++NA+++  +  +   E + +F+ M N  + P   +

               S++ +C+   D     ++H  ++K G+      SNA + MY+    L    L+F+ ++

               DIVSWN ++           ++  +++M R     +  TL S L +   +   E+   

                 L+  N +     +   I+  + K    + A + F  M  + +++WNA+ISG    G

                +++ LF E+  EG+  N  TLSTVL + A + +    +QIH   LK G   +  I N

             +LI  Y K G +  +T+VF+     D+VS+ S+I+AY+Q+ +G EA+  +  M   G + 

             PD    + +L+AC++    E G QI   ++    I  G    S +V++ ++ G +++A+ 

                ++  E     W  +    A HG

 Score =   176 bits (445),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/398 (28%), Positives = 199/398 (50%), Gaps = 24/398 (6%)
 Frame = +3

             PT +T++ L+S  S     +   QIH  ++  G    +   N+ + +Y  C      R +

              +   E D VSW+A+I+ Y+Q     EA+ A+ EM   G+ ++EFT  S+L S    AN 

             ++ L      + I  G      V N++V  + K GE+E + R F ++  + ++SWNA++S

                 N    + ++LF +++  G+ PN ++LS+++ ACAG+     G+++HGY++K G   

             +    N L+ +Y+K G L  +  VFQ +   D+VSWN++++    H     ++H F  M 

              S +  P+  T +  L A +  G  E G Q        N+M ++  I  G      I+D+

              S+    D+A ++ +   +E     W  + S  +  G+

 Score = 80.1 bits (196),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 93/191 (49%), Gaps = 6/191 (3%)
 Frame = +3

              P   T   +LS  +   S   G+QIHG ++  G   ++   N+LI LY KCG   ++ +

             +     E D VSW+++IS Y+Q+G   EA+  F+ M   G +  ++ TF  VL +C+   

              ++ G+Q+   ++V  Y     V   + +VD+ ++ G L+ +  +     +     V W 

Query  2049  LFSSSAAHGDT  2081
                SS    D+
Sbjct  234   ALLSSYMQNDS  244

>ref|XP_004233816.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316659.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316660.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316661.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316662.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316664.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316665.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316666.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316667.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]
 ref|XP_010316668.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Solanum lycopersicum]

 Score =   399 bits (1024),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 238/684 (35%), Positives = 364/684 (53%), Gaps = 41/684 (6%)
 Frame = +3

             P  Y  S+V++A   I+    G QLHA   + G  +   VSN L++ Y++    CG    

                        + TL            A QVF +M ++D   +N++I+G +     + AL
Sbjct  331   -----------YLTL------------AEQVFVEMPQKDGVTYNSLISGLSLKGFSDKAL  367

              LF+KM    +  D  T AS+L  C SL     GRQ+HS   K G  + + +  +L+ +Y

               C  +  A   F  +  E +  + +N M+ G   M   +E+  +F+ M+   L P   T

             + S++ +C+         QIH+ V+K  F     V +  + MY+  + L A   IF R+ 

             E+D+VSW +MI  YAQ +   EA+  + EMQ  G+ +D     S +S+    Q++     

             I +  + +G  L   + NA++  + + G+I+ AY  F  + T+++ISWN ++SG   +GF

               ++L +FS L  +G+  N +T  + +SA A   + + GKQIH  I K G   ET   N 

             LI LY+KCG L  + + F  M  ++ VSWN+MI+ Y+QHG G EA+  FE M   G V+P

             +  T+ GVLSACSH GLV+ G+  FNSM  +YG+ P +EH++ +VDIL RAG+L  A   

             V+T  +E D+ VW TL S+   H +  +G      LLE E  + A YVLLSN+YA  G+W

             +     R LM+   V K+PG SW+

 Score =   253 bits (646),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 177/628 (28%), Positives = 312/628 (50%), Gaps = 48/628 (8%)
 Frame = +3

             PD  T S VL AC+  +    + G  Q+HA   R GL     VSN L+  Y+K+      

                                      G V+ A QVF+ M  RD + W A+++G  + + +E
Sbjct  229   -------------------------GFVDSAKQVFEDMVVRDSSSWVAMLSGFCKNNREE  263

              A+ L++ M   GV    Y F+SV+S  + +E + LG Q+H+ + K GFL+   V NALV

             T+Y  C  +  A  VF +   +  D +TYN++I+GL     +++AL +F  M+   L P 

              +T  SL+ +C+         Q+H+   K G    + +  + + +Y  C D++     F 

               + ++IV WN M+  Y Q     E+   +  MQ +G+  +++T  S+L +  SV     

              E I S V+K      + V + ++  + K  +++ A + F  +   +++SW ++I+G   

             + F +++L LF E+   G+  +    ++ +SACAGI +   G+QIH   +  G  L+ SI

             GN LI LY++CG +  +   F  +  +D++SWN ++S +AQ G   EA+  F  +   G 

             VE +  T+   +SA ++   ++ G QI ++ +   G     E  + ++ + ++ G L D 

              +E ++ +N   +   W  + +  + HG

 Score =   227 bits (578),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 154/534 (29%), Positives = 269/534 (50%), Gaps = 23/534 (4%)
 Frame = +3

             G++  A Q+FD +    R+V+ WN +++G + I  ++   NLF +M    V+ D  TF+ 

             VL  CS       + G+  Q+H+++ + G      V N L+ +Y     V  A  VFED 

                V D  ++ AM++G     R E+A++++  MR   ++PT   F S++S+ +       

               Q+HA + K GF     VSNA +T+YS C  L     +F  + +KD V++N++I+  + 

             +    +A+  + +MQ   +  D  T+ SLL +  S+        + S   K GL     +

               +++  + K  +IE A+++F      N++ WN ++ G    G   +S  +FS +  +GL

              PN YT  ++L  C  + +   G+QIH  +LK   +    + + LI +Y+K   L  + +

             +F  + E DVVSW SMI+ YAQH    EA+  F  M D G +  D   F   +SAC+   

              +  G QI   S+++ Y +   +   + ++ + +R G + +A    + + TK+I

 Score =   208 bits (529),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 141/528 (27%), Positives = 254/528 (48%), Gaps = 54/528 (10%)
 Frame = +3

             +PD  T++++L ACAS+     G QLH++  +AGL + S +   LL  Y K  D+    +

              F   Q  ++  W  +L    ++G+++ + ++F  M  +                     

                       G+  + YT+ S+L  C S+    LG Q+HS V+KT F     V + L+ M

             Y   + +  A  +F   ++E  D +++ +MIAG    +   EAL +F  M++  +    +

              F S +S+C+         QIHA  V  G+    S+ NA + +Y+ C  ++     F++I

               KDI+SWN +++ +AQ     EA+  +  +  +GV A+ FT GS +S++ +  N    +

              I + + K G   + E SN +++ + K G +  A + F +M  +N +SWNA+I+G   +G

                +++ LF E+   G+ PN  T   VLSAC+       G+  F    + +G + K   +

                    +++ +  + G L  +    + M  E D + W +++SA   H

 Score =   197 bits (501),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 127/472 (27%), Positives = 239/472 (51%), Gaps = 12/472 (3%)
 Frame = +3

             +++H  ++  GF A   +    + +Y     +  A  +F++    + +   +N +++G  

              ++RN+E   +F+ M    + P   TF  ++ +CS    A       QIHAL+ + G G 

                VSN  + +YS    + + + +FE +  +D  SW AM++ + + N   +AIL Y +M+

             + GV+   +   S++S+S  +      E + + + K G +  + VSNA+V+ + + G + 

              A + F +M  ++ +++N++ISG    GF  ++L LF ++    L P+  T++++L ACA

              + + Q G+Q+H Y  K G   ++ I  +L+ LY KC  +  + + F      ++V WN 

             M+  Y Q G   E+   F  M   G ++P++ T+  +L  C+  G +  G QI +S V  

                   V   S ++D+ ++   LD AE+I    N E D   W ++ +  A H

 Score =   153 bits (386),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 98/343 (29%), Positives = 173/343 (50%), Gaps = 17/343 (5%)
 Frame = +3

             ++SL+ SC      + A ++H  ++  GFG    +    + +Y    DL +   IF+   

             I  +++  WN +++ +++     E    +  M  E V  DE T   +L +         +

                E I +L+ + GL L++ VSN ++  + K G ++ A + F DM  R+  SW A++SG 

               N     ++ L+ ++   G+ P  Y  S+V+SA   I +F  G+Q+H  I K+G     

              + N L+ LYS+CG L  + +VF  M ++D V++NS+IS  +  G   +A+  FE M  S

               ++PD  T   +L AC+  G ++ G Q+     ++Y  K G+

>ref|XP_011046269.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Populus euphratica]
 ref|XP_011046270.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Populus euphratica]

 Score =   394 bits (1012),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 226/683 (33%), Positives = 371/683 (54%), Gaps = 42/683 (6%)
 Frame = +3

             D  TLS VL AC+ +    FG Q+H + L++G      V   LL  Y K++++   +R  

                                           FD+M  R+V  W +++TG A+   +   L 
Sbjct  158   -----------------------------AFDEMGARNVVSWTSLLTGYAQNGLNLETLK  188

             LF +M   G+  + +TF++V+   + E +   G QVH+MV+K GF   T   N+L+ MYF

                 + DA  VF    D   + +++N+M+AGLV+   + E L +F HMR   +  T + F

               ++  C +      + Q+H  V+K GF    ++    M  YS C ++     IF  + +

               +++VSW AMI+ Y Q  +  +A+  + +M REG+  ++FT  ++L++   V+  EM  

             +  IK   +    V  A++ A+ K G I++A + F+ +  +++++W+A+I G    G   

              ++ +F ++  EG+ PN YT S +++ACA      + GKQ+H + +K        + + L

             + +YSK G +  +  VF+   ERD+VSWNS+IS YAQHG G +A+  FE M     +E D

               TF GV+SAC+HAGL ++G + F+ MV ++ I+P +EH+SC+VD+  RAG L +A EI+

                     + VW TL ++S  H +  +G++ A  L+  +  NPA YVLL+N+YA  G W+

             E A VR+LM+  +V K  G SW+

 Score =   234 bits (597),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 160/564 (28%), Positives = 282/564 (50%), Gaps = 32/564 (6%)
 Frame = +3

             A  VF +  ++++  +N ++  C+  + +   ++LF  +H  G   D  T + VL  CS 

                   G QVH+  +K+GFL   SV  AL+ MY   ++V D    F++     V  +++ 

             +++ G      N E L +F  M    + P   TF +++ + +D        Q+H +V+K 

             GFG  T  SN+ + MY     +   R +F  + +++ VSWN+M+       L  E +  +

               M+  GV   +     ++    + + +  +  +   V+K+G      +   ++ A+ K 

             GE++ A++ F  M    RN++SW A+ISG   NG   Q++NLF ++  EG+ PN +T ST

             +L+A  G+  F    ++H   +K       S+G  L+  Y K G +  +++VFQ + E+D

             +V+W++MI  YAQ G+   AV  F  M   G ++P++ TF+G+++AC+   AG VE G Q

             +     + + IK    +  C+   L    S+ G ++ A E+ K +  E D   W ++ S 

              A HG    GR    +  E ++ N

 Score =   182 bits (463),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 124/452 (27%), Positives = 220/452 (49%), Gaps = 24/452 (5%)
 Frame = +3

             + YN ++       RN   + +F  +        G T   ++ +CS   D    TQ+H  

              +K GF +  SV  A + MY   +++K  R  F+ +  +++VSW +++T YAQ  L  E 

             +  +L M  EG+  + FT  ++   L+    V     + ++VIKNG  +    SN++++ 

             + K G I  A   F  M  RN +SWN++++G  +NG  +++L +F  +   G+       

             + V+  C  I      +Q+H  +LK G   + +I  TL+  YSKCG +  + ++F +M++

               R+VVSW +MIS Y Q+G   +AV+ F  M   G ++P+  T++ +L+A       + G

             +  F     ++  NY   P V   + ++D   + G +DEA ++ +    E D   W  + 

                A  G+T  G +   + +  E   P  Y  

 Score = 96.7 bits (239),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 109/211 (52%), Gaps = 6/211 (3%)
 Frame = +3

             +A+  F     +NL+ +N ++  C         ++LF  +   G   +  TLS VL AC+

              +     G Q+H Y LK G   + S+G  L+ +Y K   +    R F  M  R+VVSW S

             +++ YAQ+G   E +  F  M+  G ++P+  TF+ V+ A +  G+VE GIQ+   ++ N

              G   GV  F+   ++++  ++G + +A  +

 Score = 95.9 bits (237),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 125/267 (47%), Gaps = 47/267 (18%)
 Frame = +3

             +P+ +T ST+LTA    Q  V   ++HA  ++        V   LL  Y K  ++    +

             +F  I+  D+ +W+ ++    ++GE E A+++F QM++                      

                       G+  + YTF+ +++ C+    G+  G+Q+H+  +K+ F     V +AL+T

             MY     +  A  VF+   +   D +++N++I+G        +AL +F  M+   L   G

             +TF+ ++S+C+        HA + K+G
Sbjct  606   VTFIGVISACT--------HAGLAKEG  624

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 79/160 (49%), Gaps = 15/160 (9%)
 Frame = +3

            +P+ YT S ++ ACA+    V  G QLHA+ +++       VS+ LL+ Y+K  D+    

             +F   +  D+ SW +++S   + G    AL+VF++M R+    D   +  +I+ C    

               + +   ++  K H +    ++Y+       C ++L+G

>ref|XP_006465408.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, 
chloroplastic-like [Citrus sinensis]

 Score =   394 bits (1011),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 217/613 (35%), Positives = 347/613 (57%), Gaps = 13/613 (2%)
 Frame = +3

                LS   K G++ +A  VF +M  RD+  WN +I G A+    + AL+L+Q+M  +G V

               D YTF  VL  C  +     G++VH  V++ G+ A   V+NAL+TMY  C  +V A  

             VF+       D+I++NAMI+G        + LM+F  MR + + P  +T  S++S+    

              D     ++H  V+K GF D  SV N  + MY +  + +    +F R++ KD+VSW  MI

             + Y    L  +A+  Y  M+ EG + DE T+ S+LS+   + N ++   +  L ++ GLI

               + ++N ++  + K   I++A   F  +  +N+ISW +II G + N    ++L  F ++

             +   L PN+ TL ++LSACA I +   GK+IH + L+ G   +  + N L+ +Y +CG +

               +   F    ERDV +WN +++ YA+ G+G  A   F  M+DS +V PD+ TF  +L A

             CS +G+V +G+++FNSM   Y + P + H++CIVD+L RAG L+EA E ++   ++ D+ 

             +W  L ++   H    LG + AG + ET+  +   YVLL N+YA +GKW+E A VR LM+

Query  2217  RYRVIKQPGSSWV  2255
                +   PG SWV
Sbjct  729   EKGLTIDPGCSWV  741

 Score =   195 bits (495),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 141/533 (26%), Positives = 262/533 (49%), Gaps = 24/533 (5%)
 Frame = +3

             E AL     M  L +  D     +++ LC  +  +  G  +HS+V KT    +  + NA 

             ++M+     +  A +VF    D   D  ++N +I G       +EAL ++  M  +  + 

             P   TF  ++ +C    D     ++H  V++ G+     V NA +TMY  C DL   RL+

             F+ + ++D +SWNAMI+ Y +     + ++ ++ M+   V  D  TL S++S+S+ V + 

             ++   +   VIK G    + V N ++  +   G  E+  + F  M +++++SW  +IS  

             + +  P +++  +  + AEG  P+  T+++VLSACA + +   G ++H   ++ G     

              I NTLI +YSKC  +  +  VF  + +++V+SW S+I     + +  EA+  F  M+ +

               ++P+  T   +LSAC+  G +  G +I     + + ++ GV  + F  + ++D+  R 

             G +  A     +   E D + W  L +  A  G   L       ++++ K NP

 Score =   141 bits (355),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 128/546 (23%), Positives = 235/546 (43%), Gaps = 64/546 (12%)
 Frame = +3

             +PD YT   VL  C  +     G ++H   +R G      V N L++ Y K  DL   + 

             +F  +   D  SW                               NA+I+G  E  +    
Sbjct  254   VFDGMPKRDRISW-------------------------------NAMISGYFENGEYMKG  282

             L LF  M  + V  D  T +SV+S  + EL G   LGR+VH  V+K GF    SV N L+

              MY +  +  +   +F   + +  D +++  MI+        ++A+  +  M     MP 

              +T  S++S+C+   +     ++H L ++ G      ++N  + MYS C+ +     +F 

             +I +K+++SW ++I      N   EA++ + +M    +  +  TL S+LS+   +     

              + I +  ++ G+     + NA++  + + G ++ A+  F     R++ +WN +++G   

              G    +   F +++   + P+  T   +L AC+       G+  F   KQ++       

              +        ++ L  + G L  +    Q M  + D   W ++++A   H   + GE  A

Query  1779  VHCFET  1796
              H FET
Sbjct  691   GHIFET  696

 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 78/357 (22%), Positives = 142/357 (40%), Gaps = 65/357 (18%)
 Frame = +3

             S  NA+ +  L  +N   +  +  N+ ++  C  G +EQA +Y   M             

                      Q LN+  +  A         L  ++  C     +  G  +H  + K  + L

                +GN  ++++ K G L  +  VF  M +RD+ SWN +I  YA+ G   EA+  ++ M 

               G V+PD  TF  VL  C            H  ++  G    + + N+++  Y     +

                  + D + +          +GY +  E         +++   ++ D     ++ S+S

                GD +LGR V G +++    ++ +V   L  +Y   G  EE   +   M+   V+

>ref|XP_008442211.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial isoform X1 [Cucumis melo]
 ref|XP_008442212.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial isoform X1 [Cucumis melo]
 ref|XP_008442213.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial isoform X1 [Cucumis melo]
 ref|XP_008442215.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial isoform X1 [Cucumis melo]

 Score =   392 bits (1006),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 218/647 (34%), Positives = 359/647 (55%), Gaps = 13/647 (2%)
 Frame = +3

             VSN LLS  +K+  +   ++LF ++   D Y+W  ++SA   LG +  A ++F +   ++

                W+ +++G  +   +   L LF +M S G     YT  SVL  CS L L   G+ +H 

               +K        V   LV MY  CK +++A ++F    D   + + + AM+ G      +

              +A+  F  MR   +     TF S++++C+         Q+H  ++  GFG    V +A 

             + MY+ C DL + R+I   ++  D+V WN+MI          EA++ + +M    +  D+

             FT  S L S  S  N ++   + SL+IK G      VSNA+V  + K G +  A   F  

             +  +++ISW ++++G   NGF  ++L LF ++    +  + + ++ V SACA +   + G

             +Q+H   +K   GS L  S  N+LI +Y+KCG L  + RVF  M  R+V+SW ++I  YA

             Q+G+G +++H ++ M+ +G ++PD  TF G+L ACSHAGLVE G   F SM   YGIKP 

              +H++C++D+L RAG L+EAE ++   ++E D+T+W +L S+   HG+  LG      L+

             + E +N   YVLLSN+++ AG+WE++A +R  M+   + K+PG SW+

 Score =   208 bits (529),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 162/621 (26%), Positives = 281/621 (45%), Gaps = 84/621 (14%)
 Frame = +3

             +P  YTL +VL AC+++     G  +H + ++  L     V+ GL+  Y+K + L   + 

             LF  +     Y  WT +L+   + GE   A+Q F +M  +                    

                        G+  +++TF S+L+ C S+  +  GRQVH  ++ +GF     V +ALV 

             MY  C  +  A  +      E+ D + +N+MI G V+    EEAL++F+ M N  +    

              T+ S + S +          +H+L++K GF  C +VSNA + MY+   +L     +F R

             I +KD++SW +++T Y       +A+  + +M+   V  D+F +  + S+   +   E  

               + +  IK+ +   +   N++++ + K G +E A R F  M  RN+ISW AII G   N

             G    SL+ + +++  G+ P+  T   +L AC+           H  +++ G S+ E+  

                               +V+ I    D   +  MI    + GK  EA H    M     
Sbjct  562   ----------------MEKVYGIKPASD--HYACMIDLLGRAGKLNEAEHLLNRM----D  599

             VEPD   +  +LSAC   G +E G +   +++    ++P     +  + ++ S AG  ++

Query  1992  AEEI---VKTKNIEVDSTVWW  2045
             A  I   +KT  I  +    W

>ref|XP_010916743.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, 
chloroplastic [Elaeis guineensis]

 Score =   392 bits (1008),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 229/682 (34%), Positives = 374/682 (55%), Gaps = 45/682 (7%)
 Frame = +3

             T  +VL  CA +     G ++HA    +G+   + +++ L+  Y K              

                           C  LGE     +VFD+ + +D +  WN ++   A++ D E +++LF

             ++M    V  D+YTF+ +L  C   + G+  G QVH  ++K GF A  +V NAL+  Y  

             C  +  A  +F++  D+  D I++N++I G VS     + + +F  M    +     T V

             S++ +C++    T    +H   +K  +    +V+N+ + MYS C  L+    IFER+ ++

              +VSW +MI +Y +  L  EAI  + EM+  GV  D F + S L   S   S+   + I 

               +++N L   + V+NA++  + K G +E+A   F +  ++N+ISWN +I G   N FP 

             ++L+LFS++    + PN+ T++ VL A A + S + G++IHG+IL+ G F +  + N L+

              +Y+KCG L  +  +F  M ++D++SW  MI+ Y  HG    A+  F+ M  SG VEPD+

              +FT +L ACSH+GL+ +G + +N M N Y I+P +EH++C+VD+LSRAG L +A E +K

             +  IE DSTVW  L      H + +L   VA  + E E  N   YVLL+NIYA+A +WE 

                +R+ +  + + K PG SW+

 Score =   181 bits (460),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 146/587 (25%), Positives = 264/587 (45%), Gaps = 58/587 (10%)
 Frame = +3

             +PD YT S +L   A++     G Q+H   ++ G   ++ V N L++FY+K   +     

             +F E+   DV SW +L++ C           V + + R+ V                   
Sbjct  256   MFDEMPDKDVISWNSLINGC-----------VSNSLPRKGV-------------------  285

               LF  M   G+  D+ T  SVL  C+ L +  LG+ VH   +K  +    +V N+LV M

             Y  C S+  A  +FE      V  +++ +MI         +EA+ +F  M ++ + P   

                S + +CS   +  Q   IH  +V+        V+NA M MYS C  ++  R IF+  

               K+I+SWN +I  Y++     EA+  + +MQ   +  +  T+  +L ++ S+++ E   

              I   +++ G      V+NA+V  + K G +  A   F  MF ++LISW  +I+G   +G

                 ++ +F E+   G+ P+  + + +L AC+       G + +  I++    +E  + +

                ++ L S+ G L  +    + M  E D   W +++     H   K  E V  H FE  

                  +EP+   +  +L+         + ++     ++ +G++  PG

 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 77/149 (52%), Gaps = 2/149 (1%)
 Frame = +3

             + + L S+  +E    N+ T  +VL  CA + S   G+++H  +   G  ++T + + L+

              +Y KCG L    RVF     +D +  WN +++ YAQ G   E++  F+ M  S  V+PD

               TF+ +L   +  G V +G Q+   ++ 

>ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citrus clementina]
 gb|ESR44233.1| hypothetical protein CICLE_v10011041mg [Citrus clementina]

 Score =   392 bits (1008),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 226/683 (33%), Positives = 358/683 (52%), Gaps = 41/683 (6%)
 Frame = +3

             D+ + +  L  C+ ++   FG QLH F ++ G        + L+  YAK           

                              C KL +   ++ +F++MS R+   WN +I GC +      AL 

             LF+ M  +GV     T+AS+L  C+ L    LG Q+H+  +KT F     V  A + MY 

              C ++ DA  VF    +  +   +YNA+I G     +  EAL +F  ++   L    +T 

                 S+C+     +   Q+H L +K        V+N+ + MY  CQD+     +F+ ++ 

             +D VSWNA+I   AQ     E +  ++ M    +  DEFT GS+L +    Q++     I

              S +IK+G+   + V +A++  +CK G +E+A +       R+++SWNAIISG       

               +   FS +L  G+ P+ +T +T+L  C  + +   G Q+H  I+K     +  I +TL

             + +YSKCG +  S  +F+   +RD V+WN+MI  YA HG G EA+  FE M +   V+P+

              ATF  VL AC+H GLVE G+  FN M+++Y + P +EH+SC+VDIL R+G LD+A +++

             +    E D  +W TL S    HG+  +    A  LL+ +  + + Y+LLSNIYADAG W+

             + +  R LM++ +V K+PG SW+

 Score =   288 bits (738),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 196/653 (30%), Positives = 326/653 (50%), Gaps = 19/653 (3%)
 Frame = +3

             +P   T S +       Q    G Q HA  + +G      VSN L+  Y K  +L    +

             +F ++   DV SW  L+      GE+  A  +F+ M  RDV  WN++++G   + D   A

             +++F +M  L    DN +FA  L +CS LE    G Q+H   +K GF       +ALV M

             Y  CK + D+  +F    +   + +++N +IAG V   +  EAL +F  M+ I +  +  

             T+ S++ SC   S+    TQ+HA  +K  F     V  A + MY+ C ++   + +F  +

               + + S+NA+I  YAQ   G EA+  +  +Q+ G+  +E TL    S+   +A      

              +  L IK+ L   I V+N+I+  + K  ++ +A   F +M  R+ +SWNAII+    NG

                ++L  F  +L   + P+ +T  +VL ACAG  +  +G QIH  I+K G      +G+

              LI +Y KCG++  + ++     ERDVVSWN++IS ++   +  +A   F  M+  G V+

             PD  T+  +L  C +   V  G+Q+   ++    ++  V   S +VD+ S+ G + ++  

             I+  K+ + D   W  +    A HG   LG    ++   + LE  K N A ++

>gb|EEE51385.1| hypothetical protein OsJ_32436 [Oryza sativa Japonica Group]

 Score =   392 bits (1006),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 227/684 (33%), Positives = 360/684 (53%), Gaps = 41/684 (6%)
 Frame = +3

             PD  T + +L +C++++    G Q+HA  ++ GL       + L+  Y K + L      

                                      + AL  F  M  R+   W A I GC + +     L
Sbjct  201   -------------------------DDALCFFYGMPERNWVSWGAAIAGCVQNEQYVRGL  235

              LF +M  LG+     ++AS    C+ +     GRQ+H+  +K  F +   V  A+V +Y

                 S+ DA   F    +  V+  T NAM+ GLV      EA+ +F  M    +    ++

                + S+C++        Q+H L +K GF     V+NA + +Y  C+ L    LIF+ +K

             +KD VSWNA+I +  Q     + IL + EM R G+  D+FT GS+L +  ++ + E   M

             +   VIK+GL     V++ +V  +CK G I++A +    +  + ++SWNAI+SG   N  

               ++   FSE+L  GL P+ +T +TVL  CA + + + GKQIHG I+K     +  I +T

             L+ +Y+KCG +  S  VF+ + +RD VSWN+MI  YA HG G EA+  FE M     V P

             + ATF  VL ACSH GL +DG + F+ M  +Y ++P +EHF+C+VDIL R+    EA + 

             + +   + D+ +W TL S      D  +  + A  +L  + ++ +VY+LLSN+YA++GKW

              + +  R L+++ R+ K+PG SW+

 Score =   258 bits (659),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 186/628 (30%), Positives = 316/628 (50%), Gaps = 18/628 (3%)
 Frame = +3

             P   T S V  +CA    +    G   HA  + +G    + VSN LL  YA+       +

             R+F  +   D  SW T+L+A +  G++  A+ +FD M   DV  WNA+++G  +    + 

             +++LF +M   GVS D  TFA +L  CS LE   LG QVH++ VKTG        +ALV 

             MY  C+S+ DA   F    +   + +++ A IAG V  E+    L +F  M+ + L  + 

              ++ S   SC   S   T  Q+HA  +K  F     V  A + +Y+    L   R  F  

             +    + + NAM+    +  LG EA+  +  M R  +  D  +L  + S+   ++     

             + +  L IK+G  + I V+NA++  + K   + +AY  F+ M  ++ +SWNAII+  + N

             G    ++  F+E+L  G+ P+ +T  +VL ACA + S ++G  +H  ++K G   +  + 

             +T++ +Y KCGI+  + ++   +  + VVSWN+++S ++ + +  EA   F  M+D G +

             +PD  TF  VL  C++   +E G QI   ++    +    E+  S +VD+ ++ G  D  

             + ++  + +E  D   W  +    A HG

 Score =   112 bits (281),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/320 (26%), Positives = 135/320 (42%), Gaps = 73/320 (23%)
 Frame = +3

            R D  +LS V +ACA  +    G Q+H   +++G      V+N +L  Y K + L     

Query  402  LFSEIQ-----------------------------------SPDVYSWTTLLSACTKLGE  476
            +F  ++                                    PD +++ ++L AC  L  

Query  477  VEYALQVFDQMSR-----------------------------------RDVAVWNAIITG  551
            +EY L V D++ +                                   + V  WNAI++G

             +   + E A   F +M  +G+  D++TFA+VL  C+ L    LG+Q+H  ++K   L  

              + + LV MY  C  + D+  VFE  +    D +++NAMI G        EAL MF  M

            +   ++P   TFV+++ +CS

>ref|NP_001065364.2| Os10g0558600 [Oryza sativa Japonica Group]
 dbj|BAF27201.2| Os10g0558600 [Oryza sativa Japonica Group]

 Score =   392 bits (1006),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 227/684 (33%), Positives = 360/684 (53%), Gaps = 41/684 (6%)
 Frame = +3

             PD  T + +L +C++++    G Q+HA  ++ GL       + L+  Y K + L      

                                      + AL  F  M  R+   W A I GC + +     L
Sbjct  201   -------------------------DDALCFFYGMPERNWVSWGAAIAGCVQNEQYVRGL  235

              LF +M  LG+     ++AS    C+ +     GRQ+H+  +K  F +   V  A+V +Y

                 S+ DA   F    +  V+  T NAM+ GLV      EA+ +F  M    +    ++

                + S+C++        Q+H L +K GF     V+NA + +Y  C+ L    LIF+ +K

             +KD VSWNA+I +  Q     + IL + EM R G+  D+FT GS+L +  ++ + E   M

             +   VIK+GL     V++ +V  +CK G I++A +    +  + ++SWNAI+SG   N  

               ++   FSE+L  GL P+ +T +TVL  CA + + + GKQIHG I+K     +  I +T

             L+ +Y+KCG +  S  VF+ + +RD VSWN+MI  YA HG G EA+  FE M     V P

             + ATF  VL ACSH GL +DG + F+ M  +Y ++P +EHF+C+VDIL R+    EA + 

             + +   + D+ +W TL S      D  +  + A  +L  + ++ +VY+LLSN+YA++GKW

              + +  R L+++ R+ K+PG SW+

 Score =   258 bits (660),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 186/628 (30%), Positives = 316/628 (50%), Gaps = 18/628 (3%)
 Frame = +3

             P   T S V  +CA    +    G   HA  + +G    + VSN LL  YA+       +

             R+F  +   D  SW T+L+A +  G++  A+ +FD M   DV  WNA+++G  +    + 

             +++LF +M   GVS D  TFA +L  CS LE   LG QVH++ VKTG        +ALV 

             MY  C+S+ DA   F    +   + +++ A IAG V  E+    L +F  M+ + L  + 

              ++ S   SC   S   T  Q+HA  +K  F     V  A + +Y+    L   R  F  

             +    + + NAM+    +  LG EA+  +  M R  +  D  +L  + S+   ++     

             + +  L IK+G  + I V+NA++  + K   + +AY  F+ M  ++ +SWNAII+  + N

             G    ++  F+E+L  G+ P+ +T  +VL ACA + S ++G  +H  ++K G   +  + 

             +T++ +Y KCGI+  + ++   +  + VVSWN+++S ++ + +  EA   F  M+D G +

             +PD  TF  VL  C++   +E G QI   ++    +    E+  S +VD+ ++ G  D  

             + ++  + +E  D   W  +    A HG

 Score =   112 bits (281),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/320 (26%), Positives = 135/320 (42%), Gaps = 73/320 (23%)
 Frame = +3

            R D  +LS V +ACA  +    G Q+H   +++G      V+N +L  Y K + L     

Query  402  LFSEIQ-----------------------------------SPDVYSWTTLLSACTKLGE  476
            +F  ++                                    PD +++ ++L AC  L  

Query  477  VEYALQVFDQMSR-----------------------------------RDVAVWNAIITG  551
            +EY L V D++ +                                   + V  WNAI++G

             +   + E A   F +M  +G+  D++TFA+VL  C+ L    LG+Q+H  ++K   L  

              + + LV MY  C  + D+  VFE  +    D +++NAMI G        EAL MF  M

            +   ++P   TFV+++ +CS
