BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24761_g11_i2 len=1031 path=[13571:0-306 12002:307-550 12246:551-597
22599:598-1030]

Length=1031
                                                                      Score     E

gb|EPS70693.1|  germin-like protein                                     308   4e-101   
gb|EYU28339.1|  hypothetical protein MIMGU_mgv1a013656mg                307   2e-100   
ref|XP_011093822.1|  PREDICTED: auxin-binding protein ABP19a-like       303   6e-99    
gb|EYU25861.1|  hypothetical protein MIMGU_mgv1a013719mg                300   1e-97    
ref|XP_010666273.1|  PREDICTED: auxin-binding protein ABP19a            293   3e-95    
gb|ABV03161.1|  germin-like protein                                     291   5e-94    Chimonanthus praecox [wintersweet]
gb|AEN02469.1|  germin-like protein                                     290   8e-94    
gb|KDP33908.1|  hypothetical protein JCGZ_07479                         290   1e-93    
ref|XP_004287628.1|  PREDICTED: auxin-binding protein ABP19a-like       289   2e-93    
ref|XP_008450917.1|  PREDICTED: auxin-binding protein ABP19a-like       288   5e-93    
gb|AFK44812.1|  unknown                                                 288   5e-93    
ref|XP_004287629.1|  PREDICTED: auxin-binding protein ABP19a-like       288   6e-93    
gb|AFK39466.1|  unknown                                                 286   2e-92    
gb|AFK43419.1|  unknown                                                 286   2e-92    
ref|XP_004243715.1|  PREDICTED: auxin-binding protein ABP19a-like       286   2e-92    
ref|XP_004513480.1|  PREDICTED: auxin-binding protein ABP19a-like       285   8e-92    
ref|XP_008337871.1|  PREDICTED: auxin-binding protein ABP20             285   1e-91    
emb|CDP03095.1|  unnamed protein product                                284   2e-91    
ref|XP_010049430.1|  PREDICTED: auxin-binding protein ABP19a-like       282   1e-90    
ref|XP_010049517.1|  PREDICTED: auxin-binding protein ABP19a-like       282   1e-90    
ref|XP_006342367.1|  PREDICTED: auxin-binding protein ABP19a-like       282   1e-90    
emb|CAN67380.1|  hypothetical protein VITISV_017918                     280   3e-90    Vitis vinifera
ref|NP_001268059.1|  germin-like protein 6 precursor                    281   3e-90    
ref|XP_009361697.1|  PREDICTED: auxin-binding protein ABP19a            280   5e-90    
sp|O04011.1|ABP20_PRUPE  RecName: Full=Auxin-binding protein ABP2...    280   9e-90    Prunus persica
ref|XP_007202571.1|  hypothetical protein PRUPE_ppa011460mg             280   1e-89    
gb|ADD71879.1|  germin-like protein subfamily 3 member 4 precursor      279   1e-89    Arachis hypogaea [goober]
ref|XP_004144029.1|  PREDICTED: auxin-binding protein ABP20-like        280   1e-89    
ref|XP_007012661.1|  Germin protein subfamily 3 member 3                281   3e-89    
ref|XP_008337872.1|  PREDICTED: auxin-binding protein ABP19a            278   4e-89    
ref|XP_007138665.1|  hypothetical protein PHAVU_009G227800g             277   8e-89    
ref|NP_001241062.1|  auxin-binding protein ABP19a-like precursor        277   1e-88    
ref|XP_008242222.1|  PREDICTED: auxin-binding protein ABP19a            276   2e-88    
ref|XP_007202573.1|  hypothetical protein PRUPE_ppa011467mg             275   4e-88    
gb|ACA03785.1|  putative auxin-binding protein 2                        274   1e-87    Prunus salicina [Japanese plum]
emb|CAC34417.1|  Germin-like protein                                    274   2e-87    Pisum sativum [garden pea]
ref|XP_009784907.1|  PREDICTED: auxin-binding protein ABP19a-like       274   2e-87    
ref|XP_009596795.1|  PREDICTED: auxin-binding protein ABP19a-like       273   5e-87    
ref|XP_010049513.1|  PREDICTED: auxin-binding protein ABP19a-like       273   5e-87    
gb|ACA03784.1|  putative auxin-binding protein 3                        273   5e-87    Prunus salicina [Japanese plum]
ref|XP_008242223.1|  PREDICTED: auxin-binding protein ABP20             272   1e-86    
ref|XP_010454369.1|  PREDICTED: germin-like protein subfamily 3 m...    271   2e-86    
ref|XP_010420905.1|  PREDICTED: germin-like protein subfamily 3 m...    270   4e-86    
ref|XP_011045993.1|  PREDICTED: auxin-binding protein ABP20             270   8e-86    
ref|XP_010049516.1|  PREDICTED: auxin-binding protein ABP19a-like       269   1e-85    
ref|XP_006381632.1|  hypothetical protein POPTR_0006s14510g             270   2e-85    
ref|XP_008362990.1|  PREDICTED: auxin-binding protein ABP19a-like       268   2e-85    
ref|XP_009389677.1|  PREDICTED: germin-like protein 8-14                268   2e-85    
ref|XP_009417703.1|  PREDICTED: germin-like protein 8-14                268   4e-85    
gb|ABL86677.1|  GLP3                                                    268   4e-85    Gossypium barbadense [Egyptian cotton]
ref|XP_009131804.1|  PREDICTED: germin-like protein subfamily 3 m...    267   1e-84    
ref|XP_007204735.1|  hypothetical protein PRUPE_ppa011385mg             266   1e-84    
ref|XP_006289376.1|  hypothetical protein CARUB_v10002870mg             266   1e-84    
sp|O04012.1|AB19B_PRUPE  RecName: Full=Auxin-binding protein ABP1...    266   1e-84    Prunus persica
ref|XP_002516286.1|  Auxin-binding protein ABP19a precursor, puta...    266   1e-84    Ricinus communis
emb|CDY51841.1|  BnaA03g56080D                                          266   2e-84    
ref|XP_007154588.1|  hypothetical protein PHAVU_003G131400g             266   2e-84    
ref|XP_010235197.1|  PREDICTED: germin-like protein 8-14                265   4e-84    
ref|XP_009594759.1|  PREDICTED: auxin-binding protein ABP19a-like       265   6e-84    
ref|XP_003574592.1|  PREDICTED: germin-like protein 8-14                265   6e-84    
ref|XP_006342915.1|  PREDICTED: auxin-binding protein ABP19a-like       263   2e-83    
ref|XP_008391398.1|  PREDICTED: auxin-binding protein ABP19a-like       263   3e-83    
ref|XP_004235542.1|  PREDICTED: auxin-binding protein ABP19a            263   4e-83    
ref|XP_009784603.1|  PREDICTED: auxin-binding protein ABP19a-like       262   5e-83    
ref|XP_003551125.1|  PREDICTED: auxin-binding protein ABP19a-like       262   5e-83    
gb|ACU18952.1|  unknown                                                 262   7e-83    Glycine max [soybeans]
ref|XP_009375459.1|  PREDICTED: auxin-binding protein ABP19a            262   9e-83    
ref|XP_004303688.1|  PREDICTED: auxin-binding protein ABP19a-like       262   1e-82    
ref|XP_010261909.1|  PREDICTED: auxin-binding protein ABP20-like        261   1e-82    
ref|NP_197563.1|  germin-like protein subfamily 3 member 3              261   1e-82    Arabidopsis thaliana [mouse-ear cress]
gb|AAB51566.1|  germin-like protein                                     261   1e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KFK26288.1|  hypothetical protein AALP_AA8G228400                    261   2e-82    
gb|AAB51583.1|  germin-like protein                                     260   2e-82    Arabidopsis thaliana [mouse-ear cress]
emb|CDX70935.1|  BnaC03g10190D                                          261   2e-82    
gb|KCW82144.1|  hypothetical protein EUGRSUZ_C03535                     260   3e-82    
gb|KEH37575.1|  auxin-binding protein ABP19a                            260   3e-82    
emb|CAC32847.1|  adenosine diphosphate glucose pyrophosphatase          260   3e-82    Hordeum vulgare [barley]
ref|XP_011072583.1|  PREDICTED: auxin-binding protein ABP19a            261   3e-82    
ref|XP_010261910.1|  PREDICTED: auxin-binding protein ABP19a-like       260   4e-82    
ref|XP_002874007.1|  hypothetical protein ARALYDRAFT_910104             260   4e-82    
gb|ABG46233.1|  germin-like protein 2a                                  260   4e-82    Hordeum vulgare subsp. vulgare [barley]
dbj|BAK03467.1|  predicted protein                                      260   4e-82    
ref|NP_001061976.1|  Os08g0460000                                       260   6e-82    Oryza sativa Japonica Group [Japonica rice]
gb|ABL86676.1|  GLP2                                                    259   7e-82    Gossypium barbadense [Egyptian cotton]
ref|XP_006400624.1|  hypothetical protein EUTSA_v10014670mg             259   7e-82    
dbj|BAJ98277.1|  predicted protein                                      259   7e-82    
gb|KEH37574.1|  auxin-binding protein ABP19a                            259   1e-81    
ref|XP_006361339.1|  PREDICTED: auxin-binding protein ABP19a-like       259   1e-81    
gb|AAO92740.1|  auxin binding protein                                   259   1e-81    Gossypium hirsutum [American cotton]
gb|AAF21988.2|AF116537_1  fiber protein GLP1                            259   1e-81    Gossypium hirsutum [American cotton]
ref|XP_009126456.1|  PREDICTED: germin-like protein 1                   259   1e-81    
emb|CAC85479.1|  adenosine diphosphate glucose pyrophosphatase          259   1e-81    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008784308.1|  PREDICTED: germin-like protein 8-14                259   1e-81    
ref|XP_009600028.1|  PREDICTED: auxin-binding protein ABP19a            258   2e-81    
emb|CAA75907.1|  Germin-like protein 1                                  258   2e-81    Hordeum vulgare [barley]
ref|XP_009760539.1|  PREDICTED: auxin-binding protein ABP19a-like       258   3e-81    
gb|AAC05682.1|  germin-like protein                                     258   3e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006426654.1|  hypothetical protein CICLE_v10026481mg             258   3e-81    
gb|EMS51159.1|  Germin-like protein 8-14                                258   4e-81    
dbj|BAA74702.1|  germin-like protein 1                                  257   9e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008786632.1|  PREDICTED: germin-like protein 8-14                256   1e-80    
gb|ABK95684.1|  unknown                                                 256   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_002304136.2|  germin-like family protein                         256   2e-80    Populus trichocarpa [western balsam poplar]
ref|XP_010910722.1|  PREDICTED: auxin-binding protein ABP20-like        256   2e-80    
ref|XP_006465923.1|  PREDICTED: auxin-binding protein ABP19a-like       256   2e-80    
ref|XP_008362989.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-bindin...    255   2e-80    
ref|XP_011078074.1|  PREDICTED: auxin-binding protein ABP19a-like       255   3e-80    
sp|P45854.1|GLP1_SINAL  RecName: Full=Germin-like protein 1; Flag...    255   3e-80    Sinapis alba [bai jie]
ref|XP_011035719.1|  PREDICTED: auxin-binding protein ABP19a-like       255   3e-80    
ref|XP_002299591.2|  germin-like family protein                         255   3e-80    Populus trichocarpa [western balsam poplar]
ref|XP_004973627.1|  PREDICTED: germin-like protein 8-14-like           255   4e-80    
gb|AEQ39055.1|  putative germin-like protein                            255   4e-80    
ref|XP_004141699.1|  PREDICTED: auxin-binding protein ABP19a-like       254   5e-80    
ref|XP_009120792.1|  PREDICTED: germin-like protein 1                   254   1e-79    
ref|XP_008462312.1|  PREDICTED: auxin-binding protein ABP19a            254   1e-79    
gb|AFY10819.1|  germin-like protein                                     254   1e-79    
gb|EYU45887.1|  hypothetical protein MIMGU_mgv1a022096mg                253   3e-79    
ref|NP_001140857.1|  uncharacterized protein LOC100272933 precursor     253   3e-79    Zea mays [maize]
ref|XP_010428148.1|  PREDICTED: germin-like protein subfamily 3 m...    252   5e-79    
ref|XP_002439350.1|  hypothetical protein SORBIDRAFT_09g004970          252   1e-78    Sorghum bicolor [broomcorn]
ref|XP_010064035.1|  PREDICTED: auxin-binding protein ABP19a            251   1e-78    
ref|XP_008228197.1|  PREDICTED: auxin-binding protein ABP19a            251   1e-78    
ref|XP_010932415.1|  PREDICTED: germin-like protein 8-14                251   2e-78    
ref|XP_011036430.1|  PREDICTED: auxin-binding protein ABP19a-like       251   2e-78    
ref|XP_006849665.1|  hypothetical protein AMTR_s00024p00231430          250   3e-78    
ref|XP_010537615.1|  PREDICTED: germin-like protein subfamily 3 m...    249   5e-78    
ref|XP_010051414.1|  PREDICTED: auxin-binding protein ABP19a-like       250   6e-78    
ref|XP_004287630.1|  PREDICTED: auxin-binding protein ABP19a-like       248   1e-77    
gb|ABG76199.2|  germin-like protein                                     248   2e-77    Capsicum chinense [Scotch bonnet]
ref|XP_010090139.1|  Auxin-binding protein ABP19a                       248   2e-77    
gb|KCW81975.1|  hypothetical protein EUGRSUZ_C033371                    248   2e-77    
sp|L8BRS3.1|GLP1_MORAL  RecName: Full=Germin-like protein; Short=...    248   3e-77    
ref|XP_010471285.1|  PREDICTED: germin-like protein subfamily 3 m...    247   4e-77    
ref|NP_177405.1|  germin-like protein subfamily 3 member 1              247   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659477.1|  PREDICTED: germin-like protein 8-14-like           247   7e-77    
ref|XP_002888885.1|  hypothetical protein ARALYDRAFT_476393             246   8e-77    
gb|AAB51750.1|  germin-like protein                                     246   8e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416015.1|  PREDICTED: germin-like protein subfamily 3 m...    246   1e-76    
dbj|BAH15357.1|  germin like protein                                    245   3e-76    Nicotiana tabacum [American tobacco]
gb|AAL38307.1|  germin-like protein                                     245   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471286.1|  PREDICTED: germin-like protein subfamily 3 m...    244   4e-76    
ref|XP_006302822.1|  hypothetical protein CARUB_v10020953mg             243   1e-75    
ref|XP_004296080.1|  PREDICTED: auxin-binding protein ABP19b-like       243   2e-75    
ref|XP_007024622.1|  Germin-like protein 1                              243   3e-75    
ref|XP_006390643.1|  hypothetical protein EUTSA_v10019138mg             242   3e-75    
ref|XP_010086822.1|  Auxin-binding protein ABP19a                       242   4e-75    
emb|CDY11164.1|  BnaC06g24160D                                          242   4e-75    
ref|XP_010086820.1|  Auxin-binding protein ABP19a                       242   4e-75    
emb|CAA63014.1|  germin1                                                242   5e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521328.1|  Auxin-binding protein ABP19a precursor, puta...    242   5e-75    Ricinus communis
gb|KCW82145.1|  hypothetical protein EUGRSUZ_C03536                     241   9e-75    
ref|XP_004510467.1|  PREDICTED: germin-like protein subfamily 3 m...    242   1e-74    
emb|CDX68260.1|  BnaA07g23000D                                          240   3e-74    
gb|KFK41682.1|  hypothetical protein AALP_AA2G159300                    239   3e-74    
gb|KCW82126.1|  hypothetical protein EUGRSUZ_C03507                     238   6e-74    
ref|XP_009104850.1|  PREDICTED: germin-like protein 1                   238   9e-74    
gb|AFK42476.1|  unknown                                                 238   1e-73    
ref|XP_011078075.1|  PREDICTED: auxin-binding protein ABP20-like        238   2e-73    
ref|XP_002274625.1|  PREDICTED: auxin-binding protein ABP19a-like       236   6e-73    Vitis vinifera
gb|ABK25578.1|  unknown                                                 236   1e-72    Picea sitchensis
ref|XP_003627273.1|  Germin-like protein                                236   1e-72    
ref|XP_002273384.1|  PREDICTED: auxin-binding protein ABP19a-like       234   5e-72    Vitis vinifera
emb|CAN67670.1|  hypothetical protein VITISV_008896                     234   6e-72    Vitis vinifera
gb|ACG69484.1|  germin-like protein 8                                   233   1e-71    Glycine max [soybeans]
gb|KDP40703.1|  hypothetical protein JCGZ_24702                         233   1e-71    
ref|NP_001236394.1|  uncharacterized protein LOC100500326 precursor     233   1e-71    
gb|ABK22930.1|  unknown                                                 233   2e-71    Picea sitchensis
ref|XP_009105920.1|  PREDICTED: germin-like protein 1                   231   5e-71    
ref|XP_002274457.1|  PREDICTED: germin-like protein                     230   2e-70    Vitis vinifera
gb|KCW81978.1|  hypothetical protein EUGRSUZ_C03347                     229   3e-70    
sp|P46271.1|GLP1_BRANA  RecName: Full=Germin-like protein 1; Flag...    229   4e-70    Brassica napus [oilseed rape]
ref|XP_010666274.1|  PREDICTED: auxin-binding protein ABP19a-like       229   6e-70    
ref|XP_003547722.1|  PREDICTED: auxin-binding protein ABP19a-like       228   9e-70    
ref|XP_007135442.1|  hypothetical protein PHAVU_010G129900g             227   3e-69    
gb|EMT30411.1|  Germin-like protein 8-14                                228   4e-69    
gb|ACG30276.1|  auxin-binding protein ABP20 precursor                   225   9e-69    Zea mays [maize]
emb|CDX72929.1|  BnaC06g33770D                                          226   1e-68    
ref|XP_009126460.1|  PREDICTED: germin-like protein 1                   225   2e-68    
emb|CDX96421.1|  BnaA07g30320D                                          224   7e-68    
ref|XP_010666275.1|  PREDICTED: auxin-binding protein ABP19a-like       223   7e-68    
ref|XP_010666280.1|  PREDICTED: auxin-binding protein ABP19a-like       223   8e-68    
ref|XP_003528524.1|  PREDICTED: auxin-binding protein ABP19a-like       223   1e-67    
ref|XP_010666307.1|  PREDICTED: auxin-binding protein ABP19a-like       223   1e-67    
gb|KHN01407.1|  Auxin-binding protein ABP19a                            223   2e-67    
ref|XP_006595343.1|  PREDICTED: auxin-binding protein ABP19a-like       219   1e-66    
ref|XP_008786633.1|  PREDICTED: germin-like protein 8-14                220   1e-66    
ref|XP_009126458.1|  PREDICTED: germin-like protein subfamily 3 m...    220   2e-66    
ref|XP_004288274.1|  PREDICTED: auxin-binding protein ABP19a-like       219   5e-66    
ref|XP_010666277.1|  PREDICTED: auxin-binding protein ABP19a-like       218   1e-65    
ref|XP_004510469.1|  PREDICTED: auxin-binding protein ABP19a-like       218   1e-65    
ref|XP_010917183.1|  PREDICTED: germin-like protein 8-14                218   1e-65    
ref|XP_003627279.1|  Germin-like protein                                217   2e-65    
ref|XP_007135441.1|  hypothetical protein PHAVU_010G129800g             216   4e-65    
ref|XP_004973626.1|  PREDICTED: germin-like protein 8-14-like           216   5e-65    
ref|XP_004510468.1|  PREDICTED: germin-like protein 8-14-like           216   6e-65    
emb|CAN74028.1|  hypothetical protein VITISV_013539                     216   6e-65    Vitis vinifera
emb|CAI56441.1|  germin-like protein                                    214   1e-64    Cicer arietinum [garbanzo]
ref|XP_003627277.1|  Germin-like protein                                214   2e-64    
ref|XP_003627275.1|  Germin-like protein                                214   2e-64    
ref|NP_001240182.1|  auxin-binding protein ABP19a-like precursor        214   2e-64    
ref|NP_001236898.1|  uncharacterized protein LOC100527498 precursor     214   2e-64    
ref|XP_010495333.1|  PREDICTED: germin-like protein subfamily 3 m...    213   3e-64    
ref|XP_003528531.2|  PREDICTED: auxin-binding protein ABP19a-like       215   3e-64    
gb|KHN01412.1|  Auxin-binding protein ABP19a                            214   3e-64    
gb|ADD71875.1|  germin-like protein subfamily 3 member 3 precursor      214   5e-64    Arachis hypogaea [goober]
ref|XP_010688043.1|  PREDICTED: auxin-binding protein ABP19a-like       213   6e-64    
gb|ABS86850.1|  oxalate oxidase                                         214   6e-64    Arachis hypogaea [goober]
ref|XP_003627280.1|  Germin-like protein                                213   9e-64    
gb|KHN01409.1|  Auxin-binding protein ABP19a                            213   1e-63    
ref|XP_007135440.1|  hypothetical protein PHAVU_010G129700g             213   1e-63    
ref|XP_010687709.1|  PREDICTED: auxin-binding protein ABP19a-like       212   2e-63    
gb|AFK35921.1|  unknown                                                 212   2e-63    
ref|XP_003632366.1|  PREDICTED: auxin-binding protein ABP19a-like       212   2e-63    
ref|XP_002274739.1|  PREDICTED: auxin-binding protein ABP19a            212   3e-63    Vitis vinifera
ref|XP_010672291.1|  PREDICTED: auxin-binding protein ABP19a-like       211   4e-63    
ref|XP_002445609.1|  hypothetical protein SORBIDRAFT_07g022520          211   6e-63    Sorghum bicolor [broomcorn]
ref|XP_010688042.1|  PREDICTED: auxin-binding protein ABP19a-like       209   2e-62    
ref|XP_010672290.1|  PREDICTED: auxin-binding protein ABP19a-like       210   2e-62    
ref|XP_002264949.1|  PREDICTED: auxin-binding protein ABP19a            209   3e-62    Vitis vinifera
ref|XP_010666278.1|  PREDICTED: auxin-binding protein ABP19a-like       208   5e-62    
gb|AAG36666.1|  oxalate oxidase-like germin 171                         206   3e-61    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010666282.1|  PREDICTED: auxin-binding protein ABP19b-like       206   3e-61    
ref|XP_010670849.1|  PREDICTED: auxin-binding protein ABP19a-like       206   4e-61    
ref|XP_004303796.1|  PREDICTED: auxin-binding protein ABP19a-like...    206   6e-61    
ref|XP_010666281.1|  PREDICTED: auxin-binding protein ABP19b-like       204   2e-60    
ref|XP_004288296.1|  PREDICTED: auxin-binding protein ABP19a-like       203   5e-60    
ref|XP_006652155.1|  PREDICTED: germin-like protein 8-14-like           203   1e-59    
gb|EMS64736.1|  Germin-like protein 8-14                                202   1e-59    
ref|XP_010687789.1|  PREDICTED: auxin-binding protein ABP19a-like       202   1e-59    
gb|EAZ30088.1|  hypothetical protein OsJ_14150                          202   1e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010670843.1|  PREDICTED: auxin-binding protein ABP19a-like       202   1e-59    
gb|EMT28865.1|  Germin-like protein 8-14                                202   3e-59    
dbj|BAJ98352.1|  predicted protein                                      201   3e-59    
ref|XP_010670845.1|  PREDICTED: auxin-binding protein ABP19a-like       200   6e-59    
ref|XP_004973625.1|  PREDICTED: germin-like protein 8-14-like           197   2e-57    
ref|XP_010687565.1|  PREDICTED: auxin-binding protein ABP19a-like       197   2e-57    
ref|XP_006837025.1|  hypothetical protein AMTR_s00110p00020470          196   3e-57    
gb|AFK33656.1|  unknown                                                 196   5e-57    
ref|XP_010666317.1|  PREDICTED: auxin-binding protein ABP19b-like       194   2e-56    
gb|EAZ07239.1|  hypothetical protein OsI_29483                          194   3e-56    Oryza sativa Indica Group [Indian rice]
gb|KCW82113.1|  hypothetical protein EUGRSUZ_C03488                     192   3e-56    
ref|NP_001175609.1|  Os08g0459700                                       194   3e-56    
ref|XP_010666313.1|  PREDICTED: auxin-binding protein ABP19b-like       193   3e-56    
ref|XP_010666297.1|  PREDICTED: auxin-binding protein ABP19b-like       192   7e-56    
ref|NP_001266709.1|  auxin-binding protein ABP20 precursor              193   7e-56    
ref|XP_010666316.1|  PREDICTED: auxin-binding protein ABP19b-like       192   9e-56    
gb|AFW78895.1|  auxin-binding protein ABP20                             192   9e-56    
ref|NP_001130872.1|  uncharacterized protein LOC100191976 precursor     192   1e-55    Zea mays [maize]
ref|XP_010666311.1|  PREDICTED: auxin-binding protein ABP19b-like       191   3e-55    
emb|CAN81765.1|  hypothetical protein VITISV_038014                     190   5e-55    Vitis vinifera
ref|XP_010689545.1|  PREDICTED: auxin-binding protein ABP19a-like       190   7e-55    
ref|XP_010683942.1|  PREDICTED: auxin-binding protein ABP19a-like       190   7e-55    
ref|XP_010683952.1|  PREDICTED: auxin-binding protein ABP19a-like       189   1e-54    
ref|XP_010683953.1|  PREDICTED: auxin-binding protein ABP19a-like       189   1e-54    
ref|XP_010683943.1|  PREDICTED: auxin-binding protein ABP19a-like       189   1e-54    
ref|XP_010670840.1|  PREDICTED: auxin-binding protein ABP19a-like       189   2e-54    
ref|XP_010670847.1|  PREDICTED: auxin-binding protein ABP19a-like       189   2e-54    
gb|AAO85278.1|  germin-like protein Wageningen 1                        188   2e-54    Beta vulgaris [beet]
ref|XP_004288941.1|  PREDICTED: auxin-binding protein ABP19a-like       189   2e-54    
sp|P45853.1|GLP1_IPONI  RecName: Full=Germin-like protein; Flags:...    188   4e-54    Ipomoea nil [qian niu]
gb|AAG36665.1|  oxalate oxidase-like germin 165                         188   4e-54    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010665051.1|  PREDICTED: uncharacterized protein LOC100266509    195   4e-54    
ref|XP_010689601.1|  PREDICTED: auxin-binding protein ABP19b-like       187   5e-54    
ref|XP_010683950.1|  PREDICTED: auxin-binding protein ABP19a-like       187   6e-54    
ref|XP_010683929.1|  PREDICTED: auxin-binding protein ABP19a-like       187   6e-54    
ref|XP_010670841.1|  PREDICTED: auxin-binding protein ABP19a-like       187   7e-54    
gb|AAG36667.1|  oxalate oxidase-like germin 172                         187   9e-54    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010670848.1|  PREDICTED: auxin-binding protein ABP19a-like       187   1e-53    
ref|XP_010670844.1|  PREDICTED: auxin-binding protein ABP19a-like       187   1e-53    
gb|ADD71881.1|  germin-like protein subfamily 3 member 2 precursor      186   2e-53    Arachis hypogaea [goober]
ref|XP_010683951.1|  PREDICTED: auxin-binding protein ABP19a-like       186   2e-53    
ref|XP_010684017.1|  PREDICTED: auxin-binding protein ABP19a-like       187   3e-53    
gb|AHM10392.1|  GLP                                                     185   3e-53    
ref|XP_003627287.1|  Germin-like protein                                186   4e-53    
ref|XP_003594910.1|  Germin-like protein subfamily 3 member             185   4e-53    
ref|XP_003604394.1|  Germin-like protein                                185   4e-53    
gb|AFK44522.1|  unknown                                                 185   5e-53    
ref|XP_003627289.1|  Germin-like protein                                185   7e-53    
ref|XP_006659476.1|  PREDICTED: germin-like protein 8-13-like           184   9e-53    
ref|XP_010683949.1|  PREDICTED: auxin-binding protein ABP19a-like       184   1e-52    
ref|XP_003595410.1|  Germin-like protein                                184   1e-52    
ref|XP_010675440.1|  PREDICTED: auxin-binding protein ABP19a-like       184   2e-52    
gb|ADD71878.1|  germin-like protein subfamily 3 member 1 precursor      182   6e-52    
ref|XP_002445608.1|  hypothetical protein SORBIDRAFT_07g022510          182   1e-51    
ref|XP_010670839.1|  PREDICTED: auxin-binding protein ABP19a-like       182   1e-51    
gb|AES68967.2|  germin family 3 protein                                 181   1e-51    
gb|KEH37655.1|  auxin-binding protein ABP19a                            181   2e-51    
ref|XP_010670838.1|  PREDICTED: auxin-binding protein ABP19a-like       180   3e-51    
gb|AAK28807.1|AF310960_3  germin-like protein                           180   3e-51    
ref|XP_004510470.1|  PREDICTED: uncharacterized protein LOC101508818    186   4e-51    
ref|XP_010683946.1|  PREDICTED: auxin-binding protein ABP19a-like       179   1e-50    
ref|XP_004288978.1|  PREDICTED: auxin-binding protein ABP19a-like       178   2e-50    
ref|XP_003601113.1|  Germin-like protein 8-13                           177   4e-50    
ref|XP_004287631.1|  PREDICTED: auxin-binding protein ABP19b-like       177   4e-50    
ref|XP_003598716.1|  Germin-like protein 8-14                           181   4e-50    
gb|KHN01411.1|  Germin-like protein subfamily 3 member 3                177   8e-50    
ref|XP_006604971.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    175   2e-49    
ref|XP_008664608.1|  PREDICTED: germin-like protein 8-13                175   4e-49    
ref|XP_008664607.1|  PREDICTED: germin-like protein 8-13                175   4e-49    
ref|NP_001148746.1|  germin-like protein 1 precursor                    175   7e-49    
ref|NP_001236424.1|  uncharacterized protein LOC100305768 precursor     174   9e-49    
ref|XP_003598711.1|  Germin-like protein                                174   1e-48    
ref|XP_003621280.1|  Germin-like protein 8-14                           173   2e-48    
gb|KEH16191.1|  germin family 3 protein                                 173   2e-48    
ref|XP_003598714.1|  Germin-like protein                                174   3e-48    
gb|AES68965.2|  auxin-binding protein ABP19a                            172   3e-48    
gb|ABC86741.1|  auxin-binding protein                                   170   3e-48    
gb|KHN39629.1|  Auxin-binding protein ABP19a                            171   5e-48    
ref|XP_002263714.1|  PREDICTED: auxin-binding protein ABP19a-like       171   6e-48    
ref|XP_003593959.1|  Auxin-binding protein ABP19a                       170   3e-47    
tpg|DAA48780.1|  TPA: hypothetical protein ZEAMMB73_768604              169   1e-46    
ref|XP_003612996.1|  Auxin-binding protein ABP19a                       168   1e-46    
ref|XP_003547711.1|  PREDICTED: auxin-binding protein ABP19a-like       168   2e-46    
gb|KHN27553.1|  Germin-like protein 1                                   168   2e-46    
ref|XP_003627288.1|  Germin-like protein                                173   4e-46    
gb|KHN27554.1|  Germin-like protein 1                                   167   5e-46    
ref|XP_006599799.1|  PREDICTED: auxin-binding protein ABP19a-like       166   1e-45    
ref|XP_003547730.1|  PREDICTED: germin-like protein-like                166   1e-45    
ref|XP_002985836.1|  hypothetical protein SELMODRAFT_271813             166   2e-45    
gb|KEH18478.1|  germin family 3 protein                                 164   2e-45    
ref|XP_002984776.1|  hypothetical protein SELMODRAFT_271729             165   3e-45    
tpg|DAA48779.1|  TPA: hypothetical protein ZEAMMB73_510963              166   8e-45    
ref|XP_002961897.1|  hypothetical protein SELMODRAFT_227249             164   9e-45    
gb|AET01764.2|  auxin-binding protein ABP19b                            163   1e-44    
ref|XP_002971188.1|  hypothetical protein SELMODRAFT_228015             163   2e-44    
ref|XP_002988491.1|  hypothetical protein SELMODRAFT_229376             162   2e-44    
emb|CAA11031.1|  germin-like protein                                    158   5e-44    
ref|XP_002985837.1|  hypothetical protein SELMODRAFT_446428             164   6e-44    
ref|XP_002964838.1|  hypothetical protein SELMODRAFT_227520             161   7e-44    
ref|XP_004303797.1|  PREDICTED: auxin-binding protein ABP19a-like...    159   7e-44    
emb|CAN80715.1|  hypothetical protein VITISV_042933                     171   1e-43    
ref|XP_002981347.1|  hypothetical protein SELMODRAFT_114518             160   2e-43    
ref|XP_002969738.1|  hypothetical protein SELMODRAFT_92738              160   2e-43    
ref|XP_002986338.1|  hypothetical protein SELMODRAFT_123774             160   2e-43    
ref|XP_002961768.1|  hypothetical protein SELMODRAFT_227294             160   2e-43    
ref|XP_002979113.1|  hypothetical protein SELMODRAFT_109813             160   2e-43    
ref|XP_002986337.1|  hypothetical protein SELMODRAFT_123769             160   3e-43    
ref|XP_002986434.1|  hypothetical protein SELMODRAFT_123878             160   3e-43    
ref|XP_002979115.1|  hypothetical protein SELMODRAFT_109970             159   5e-43    
ref|XP_002986439.1|  hypothetical protein SELMODRAFT_123791             159   6e-43    
ref|XP_002964624.1|  hypothetical protein SELMODRAFT_81894              159   7e-43    
ref|XP_002989518.1|  hypothetical protein SELMODRAFT_235813             159   8e-43    
ref|NP_001052383.1|  Os04g0288100                                       159   9e-43    
ref|XP_002986433.1|  hypothetical protein SELMODRAFT_123956             158   1e-42    
ref|XP_002986335.1|  hypothetical protein SELMODRAFT_123975             158   1e-42    
ref|XP_002978995.1|  hypothetical protein SELMODRAFT_109968             158   1e-42    
gb|ABK23834.1|  unknown                                                 157   1e-42    
ref|XP_002978861.1|  hypothetical protein SELMODRAFT_228582             157   1e-42    
ref|XP_003547710.1|  PREDICTED: auxin-binding protein ABP19a-like       157   2e-42    
ref|XP_002979117.1|  hypothetical protein SELMODRAFT_109767             157   2e-42    
ref|XP_002979114.1|  hypothetical protein SELMODRAFT_109995             157   3e-42    
ref|XP_002962817.1|  hypothetical protein SELMODRAFT_78485              156   5e-42    
emb|CAD40409.3|  OSJNBa0065J03.5                                        162   6e-42    
ref|XP_002981345.1|  hypothetical protein SELMODRAFT_114208             154   3e-41    
ref|XP_002969737.1|  hypothetical protein SELMODRAFT_92705              153   9e-41    
ref|XP_002981346.1|  hypothetical protein SELMODRAFT_114245             153   1e-40    
ref|XP_010688041.1|  PREDICTED: auxin-binding protein ABP19a-like       151   2e-40    
gb|EMT24696.1|  hypothetical protein F775_52705                         150   7e-40    
ref|XP_004158659.1|  PREDICTED: putative germin-like protein 2-1-...    149   4e-39    
ref|XP_007099749.1|  Germin-like protein subfamily T member 2           149   9e-39    
emb|CDP12575.1|  unnamed protein product                                153   2e-38    
ref|XP_004134617.1|  PREDICTED: putative germin-like protein 2-1-...    147   2e-38    
ref|XP_002523176.1|  Rhicadhesin receptor precursor, putative           146   3e-38    
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     147   3e-38    
gb|KHN07905.1|  Auxin-binding protein ABP19a                            144   5e-38    
ref|XP_010086816.1|  Germin-like protein subfamily 3 member 1           144   6e-38    
ref|XP_006597668.1|  PREDICTED: putative germin-like protein 2-1-...    145   6e-38    
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    145   9e-38    
emb|CAN74027.1|  hypothetical protein VITISV_013538                     148   2e-37    
gb|ADW66150.1|  auxin-binding protein                                   140   2e-37    
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     144   2e-37    
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    144   2e-37    
ref|XP_010051456.1|  PREDICTED: germin-like protein                     143   3e-37    
ref|XP_011037744.1|  PREDICTED: putative germin-like protein 2-1        144   3e-37    
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     144   3e-37    
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    144   4e-37    
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    144   4e-37    
ref|XP_004134614.1|  PREDICTED: putative germin-like protein 2-3-...    143   4e-37    
ref|XP_002266412.1|  PREDICTED: putative germin-like protein 2-1        143   4e-37    
emb|CDP10146.1|  unnamed protein product                                143   4e-37    
ref|XP_004134615.1|  PREDICTED: putative germin-like protein 2-1-...    143   5e-37    
gb|KCW64213.1|  hypothetical protein EUGRSUZ_G01863                     142   5e-37    
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     143   6e-37    
gb|EYU42507.1|  hypothetical protein MIMGU_mgv1a019482mg                143   6e-37    
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    143   6e-37    
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     143   6e-37    
ref|XP_003598719.1|  Germin-like protein                                145   7e-37    
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     143   7e-37    
gb|AAM28275.1|  germin-like protein                                     143   7e-37    
ref|XP_002983755.1|  hypothetical protein SELMODRAFT_118954             142   7e-37    
gb|KDP34915.1|  hypothetical protein JCGZ_09203                         143   8e-37    
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    143   8e-37    
ref|XP_002990500.1|  hypothetical protein SELMODRAFT_131700             142   8e-37    
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    143   9e-37    
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    142   1e-36    
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    142   1e-36    
ref|XP_004134624.1|  PREDICTED: putative germin-like protein 2-1-...    142   1e-36    
ref|XP_007147457.1|  hypothetical protein PHAVU_006G126200g             142   1e-36    
ref|XP_008439540.1|  PREDICTED: putative germin-like protein 2-1        142   1e-36    
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    142   1e-36    
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    142   1e-36    
ref|XP_008439537.1|  PREDICTED: putative germin-like protein 2-1        142   1e-36    
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     142   1e-36    
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    142   1e-36    
ref|XP_009604370.1|  PREDICTED: putative germin-like protein 2-3        142   1e-36    
ref|XP_008439539.1|  PREDICTED: putative germin-like protein 2-1        142   1e-36    
ref|XP_010053014.1|  PREDICTED: putative germin-like protein 2-3        142   2e-36    
ref|XP_002968588.1|  hypothetical protein SELMODRAFT_89841              142   2e-36    
ref|XP_004952510.1|  PREDICTED: putative germin-like protein 2-2-...    142   2e-36    
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    142   2e-36    
ref|XP_002975893.1|  hypothetical protein SELMODRAFT_104757             141   2e-36    
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     141   2e-36    
ref|XP_011037778.1|  PREDICTED: putative germin-like protein 2-1        141   3e-36    
ref|XP_002523177.1|  Rhicadhesin receptor precursor, putative           141   3e-36    
ref|XP_009362202.1|  PREDICTED: putative germin-like protein 2-1        141   3e-36    
ref|XP_009362201.1|  PREDICTED: putative germin-like protein 2-1        141   3e-36    
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    141   3e-36    
ref|XP_007210029.1|  hypothetical protein PRUPE_ppa018980mg             140   3e-36    
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          141   4e-36    
gb|KHN06080.1|  Auxin-binding protein ABP20                             140   4e-36    
ref|XP_001756112.1|  predicted protein                                  141   4e-36    
ref|XP_001764390.1|  predicted protein                                  141   4e-36    
ref|XP_006647292.1|  PREDICTED: putative germin-like protein 2-2-...    141   4e-36    
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     141   4e-36    
ref|XP_006377938.1|  germin-like protein 1                              140   5e-36    
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    140   5e-36    
ref|XP_006362217.1|  PREDICTED: putative germin-like protein 2-3-...    140   5e-36    
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    140   5e-36    
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    140   6e-36    
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    140   6e-36    
ref|NP_001046876.1|  Os02g0491800                                       140   6e-36    
ref|XP_003546275.1|  PREDICTED: putative germin-like protein 2-1-...    140   6e-36    
ref|XP_002452097.1|  hypothetical protein SORBIDRAFT_04g019640          140   7e-36    
gb|KDP23867.1|  hypothetical protein JCGZ_27136                         140   7e-36    
gb|EMT02678.1|  Putative germin-like protein 2-1                        140   7e-36    
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    140   8e-36    
gb|EAY85909.1|  hypothetical protein OsI_07272                          140   8e-36    
ref|XP_008439536.1|  PREDICTED: germin-like protein 8-2                 140   9e-36    
gb|AAL05886.1|AF417204_1  germin-like protein                           140   1e-35    
ref|XP_006377955.1|  germin-like protein 1                              139   1e-35    
ref|XP_002452096.1|  hypothetical protein SORBIDRAFT_04g019630          139   1e-35    
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    139   1e-35    
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    144   2e-35    
ref|XP_010053013.1|  PREDICTED: putative germin-like protein 2-1        139   2e-35    
ref|NP_001050793.1|  Os03g0651800                                       139   2e-35    
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    139   2e-35    
ref|XP_002267172.1|  PREDICTED: putative germin-like protein 2-2        139   2e-35    
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     139   2e-35    
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...    139   2e-35    
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...    139   2e-35    
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     139   2e-35    
ref|XP_004249175.1|  PREDICTED: putative germin-like protein 2-3        139   2e-35    
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    144   2e-35    
ref|XP_002523178.1|  Rhicadhesin receptor precursor, putative           139   2e-35    
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    139   2e-35    
ref|XP_010678642.1|  PREDICTED: germin-like protein subfamily T m...    140   2e-35    
ref|XP_008225645.1|  PREDICTED: putative germin-like protein 2-1        139   3e-35    
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    140   3e-35    
ref|XP_001782709.1|  predicted protein                                  139   3e-35    
ref|XP_004952511.1|  PREDICTED: putative germin-like protein 2-2-...    139   3e-35    
gb|KEH37070.1|  rhicadhesin receptor                                    138   3e-35    
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        138   3e-35    
gb|EAY85910.1|  hypothetical protein OsI_07273                          139   4e-35    
ref|XP_008383377.1|  PREDICTED: putative germin-like protein 2-1        138   4e-35    
ref|XP_006448875.1|  hypothetical protein CICLE_v10016638mg             138   4e-35    
ref|XP_009762345.1|  PREDICTED: putative germin-like protein 2-3        138   4e-35    
ref|XP_008383378.1|  PREDICTED: putative germin-like protein 2-1        138   5e-35    
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...    138   5e-35    
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...    138   5e-35    
ref|XP_011037723.1|  PREDICTED: putative germin-like protein 2-3        138   5e-35    
ref|XP_006377949.1|  germin-like protein 1                              138   5e-35    
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    138   6e-35    
emb|CDP15405.1|  unnamed protein product                                138   6e-35    
ref|XP_003594592.1|  Germin-like protein subfamily 1 member             137   6e-35    
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    137   6e-35    
ref|XP_008225641.1|  PREDICTED: putative germin-like protein 2-1 ...    137   6e-35    
ref|XP_007213411.1|  hypothetical protein PRUPE_ppa026076mg             137   7e-35    
ref|XP_006597667.1|  PREDICTED: putative germin-like protein 2-1-...    137   7e-35    
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          137   7e-35    
ref|XP_011075127.1|  PREDICTED: putative germin-like protein 2-1 ...    137   8e-35    
gb|AFK37121.1|  unknown                                                 137   8e-35    
ref|XP_008239296.1|  PREDICTED: germin-like protein subfamily 3 m...    138   8e-35    
gb|EMT29286.1|  Germin-like protein 1-3                                 137   9e-35    
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...    137   9e-35    
ref|XP_004299636.1|  PREDICTED: germin-like protein subfamily T m...    137   1e-34    
ref|XP_010054737.1|  PREDICTED: putative germin-like protein 2-1        137   1e-34    
ref|XP_002269347.1|  PREDICTED: putative germin-like protein 2-1        137   1e-34    
gb|EMS54839.1|  Germin-like protein 1-1                                 137   1e-34    
ref|XP_002989582.1|  hypothetical protein SELMODRAFT_428138             137   1e-34    
gb|KDP34914.1|  hypothetical protein JCGZ_09202                         137   1e-34    
emb|CDP10107.1|  unnamed protein product                                137   1e-34    
ref|XP_008441074.1|  PREDICTED: putative germin-like protein 2-1        136   1e-34    
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...    137   1e-34    
ref|XP_002964232.1|  hypothetical protein SELMODRAFT_81725              137   1e-34    
gb|EYU42510.1|  hypothetical protein MIMGU_mgv1a013236mg                137   1e-34    
ref|XP_002964051.1|  hypothetical protein SELMODRAFT_405674             137   1e-34    
ref|NP_001055081.1|  Os05g0277500                                       137   1e-34    
ref|XP_009761605.1|  PREDICTED: putative germin-like protein 2-3        135   1e-34    
ref|XP_006586855.1|  PREDICTED: putative germin-like protein 2-1-...    137   2e-34    
ref|XP_008656864.1|  PREDICTED: putative germin-like protein 3-2        137   2e-34    



>gb|EPS70693.1| germin-like protein, partial [Genlisea aurea]
Length=204

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKK++ VT +DF Y GLAAAGNTTNII+AAVTPAFD QFP VN
Sbjct  17   DFCVADLSLPAGPAGYPCKKTSEVTADDFAYGGLAAAGNTTNIIRAAVTPAFDGQFPAVN  76

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GL +S+ARLDLAV GVIPLHTHP  SE+LVV QGTICAGFISSFEN VY K LNKGDVMV
Sbjct  77   GLEISIARLDLAVGGVIPLHTHPAASEVLVVIQGTICAGFISSFENVVYLKTLNKGDVMV  136

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG+  + AFV+FSS NPGLQIT FALFKND PTD+V   TFLDV QIKK
Sbjct  137  FPQGLLHFQINSGNHPSIAFVSFSSQNPGLQITDFALFKNDFPTDLVAKTTFLDVQQIKK  196

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  197  LKGVLGGT  204



>gb|EYU28339.1| hypothetical protein MIMGU_mgv1a013656mg [Erythranthe guttata]
Length=214

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS P GPAGYPCKKS+SVTENDF + GLAAAGNT NII AAVTPAFD QFPGVN
Sbjct  25   DFCIADLSHPAGPAGYPCKKSSSVTENDFFFHGLAAAGNTKNIISAAVTPAFDGQFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIPLHTHP GSEILVV QGTI AG ISSFEN VY K LNKGDVMV
Sbjct  85   GLGLSIARLDLAPGGVIPLHTHPAGSEILVVIQGTITAGLISSFENKVYIKTLNKGDVMV  144

Query  465  FPQGLLHFQINSGDGE-ATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            FPQGLLHFQINSG G  A AFV+FSS NPGLQIT FALF+ND PT++V   TFLDVAQIK
Sbjct  145  FPQGLLHFQINSGKGTPAQAFVSFSSQNPGLQITDFALFQNDFPTELVAKTTFLDVAQIK  204

Query  642  KLKGVLGGTN  671
            KLKGVLGGTN
Sbjct  205  KLKGVLGGTN  214



>ref|XP_011093822.1| PREDICTED: auxin-binding protein ABP19a-like [Sesamum indicum]
Length=211

 Score =   303 bits (776),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKK+ SVT +DF Y GLA AGNT+NII A VTPAFDAQFPGVN
Sbjct  23   DFCVADLSLPAGPAGYPCKKAASVTADDFAYHGLATAGNTSNIISAFVTPAFDAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDL V GVIPLHTHP  SEILVV +GTICAG ISSF+N VY K LNKGDVMV
Sbjct  83   GLGVSIARLDLGVGGVIPLHTHPAASEILVVIEGTICAGLISSFDNVVYLKTLNKGDVMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A AFV+FS PNPGLQI  FALFKND PT++V   TFLDVAQIKK
Sbjct  143  FPQGLLHFQINSGKTPALAFVSFSGPNPGLQILDFALFKNDFPTELVAKTTFLDVAQIKK  202

Query  645  LKGVLGGTN  671
            LK VLGGTN
Sbjct  203  LKAVLGGTN  211



>gb|EYU25861.1| hypothetical protein MIMGU_mgv1a013719mg [Erythranthe guttata]
Length=212

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 169/210 (80%), Gaps = 2/210 (1%)
 Frame = +3

Query  48   MFLQ--TLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M+L    LF L   ++++   DFCV +LSLP GPAGYPCKKS+SVT +DF + GLAAAGN
Sbjct  3    MYLHYFILFSLLAAASTALVQDFCVADLSLPAGPAGYPCKKSSSVTADDFAFHGLAAAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            TTNII AAVTPAFD QFPGVNGLG+S+ARLDLA  GVIP+HTHP  SEILVV +GTICAG
Sbjct  63   TTNIISAAVTPAFDGQFPGVNGLGVSIARLDLAAGGVIPIHTHPAASEILVVIEGTICAG  122

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
             ISSF+N VY K L KGDVMVFPQGLLHFQINSG   A A+V+FS  NPGLQIT FALF 
Sbjct  123  LISSFDNVVYLKTLFKGDVMVFPQGLLHFQINSGKTPALAYVSFSGQNPGLQITDFALFA  182

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ND PT++V   TFLDVAQIKKLKGVLGGT 
Sbjct  183  NDFPTELVAKTTFLDVAQIKKLKGVLGGTK  212



>ref|XP_010666273.1| PREDICTED: auxin-binding protein ABP19a [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+LP GPAGY CK    VT +DFVY GLAAAGNT+N+IKAAVTPAF AQFPGVN
Sbjct  21   DFCVADLNLPDGPAGYSCKSPAKVTADDFVYHGLAAAGNTSNLIKAAVTPAFSAQFPGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+AV GVIP+HTHPGGSEILVV QG ICAGF+SS  N+VY K LN+GDVMV
Sbjct  81   GLGISIARLDIAVGGVIPMHTHPGGSEILVVIQGQICAGFVSS-ANSVYIKTLNRGDVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A AFV+FS P+PGLQIT FALF N LPT+IV T TFLD A +KK
Sbjct  140  FPQGLLHFQINSGKSPAIAFVSFSDPSPGLQITDFALFANSLPTEIVTTTTFLDKATVKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>gb|ABV03161.1| germin-like protein [Chimonanthus praecox]
Length=214

 Score =   291 bits (744),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK   VT +DFV+SGL  AGNT+NII+AAVTPAF AQFPG+N
Sbjct  26   DFCVGDLTGPEGPAGYSCKKPAIVTVDDFVFSGLGKAGNTSNIIRAAVTPAFSAQFPGLN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLAV+GVIPLHTHPGGSE+LVV QGTICAGFISS  NTVYFK L KGD+MV
Sbjct  86   GLGLSIARLDLAVEGVIPLHTHPGGSELLVVVQGTICAGFISSSANTVYFKTLKKGDIMV  145

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A  FV+FSSP+PGLQIT FALF N+LP+++V   TFLD AQ+KK
Sbjct  146  FPQGLLHFQINGGGIPAIGFVSFSSPSPGLQITAFALFANNLPSELVEKTTFLDDAQVKK  205

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  206  LKAVLGGT  213



>gb|AEN02469.1| germin-like protein [Camellia sinensis]
Length=212

 Score =   290 bits (742),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 169/209 (81%), Gaps = 2/209 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsass--halDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M+L  LF++SLL + S    LDFCV + SLP GPAGY CKK   VT NDFVYS L  AG+
Sbjct  3    MYLPILFVVSLLFSYSHGSVLDFCVADFSLPDGPAGYSCKKPAKVTVNDFVYSALGIAGD  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            T N+IKA VTPAF AQFPGVNGLGLSMARLDLAVDGV+P+HTHPGGSEIL V +GTICAG
Sbjct  63   TNNLIKAKVTPAFAAQFPGVNGLGLSMARLDLAVDGVVPIHTHPGGSEILFVVEGTICAG  122

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  NTVYFK L KGDVMVFPQGLLHFQ NSG+  A A V+FSSP+PGLQIT FALF 
Sbjct  123  FISSSANTVYFKTLYKGDVMVFPQGLLHFQFNSGNKPALAIVSFSSPSPGLQITDFALFA  182

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            N+LP+ +V  VTFLD AQ+KKLK VLGGT
Sbjct  183  NNLPSALVEKVTFLDDAQVKKLKAVLGGT  211



>gb|KDP33908.1| hypothetical protein JCGZ_07479 [Jatropha curcas]
Length=208

 Score =   290 bits (741),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LS P GPAG+ CKK+ SVT  DFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  21   DFCVGDLSGPEGPAGFSCKKAASVTVKDFVYSGLGVAGNTTNIIKAAVTPAFAAQFPGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLA  GVIP HTHPG SE+LVV QGTICAGF+SS  N V+F+ L KGD+MV
Sbjct  81   GLGISMARLDLAPGGVIPFHTHPGASEVLVVIQGTICAGFVSS-ANKVFFQTLKKGDIMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A AFV+FSSP PGLQI  +ALF NDLP+DI+   TFLD AQ+KK
Sbjct  140  FPQGLLHFQINGGGSPALAFVSFSSPFPGLQILDYALFGNDLPSDIIEMTTFLDAAQVKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>ref|XP_004287628.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK+ +VT +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPEGPAGYSCKKAATVTVDDFVFSGLGVAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIP HTHPG SE+LVVTQG I AGFISS  NTVY K L KGD+MV
Sbjct  82   GLGISLARLDLAPGGVIPFHTHPGASEVLVVTQGAIVAGFISS-ANTVYLKTLKKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A AFV+FSSP+PGLQI  FALFKNDLPT +V + TFLDVAQIKK
Sbjct  141  FPQGLLHFQVNGGGSSAVAFVSFSSPSPGLQILDFALFKNDLPTSLVASTTFLDVAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>ref|XP_008450917.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis melo]
Length=215

 Score =   288 bits (737),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+G+PCKK++ VTE DFVYSGL  AGNT+N+IKAAVTPAF AQFPGVN
Sbjct  28   DFCVADLKSPDTPSGFPCKKASLVTEKDFVYSGLGVAGNTSNLIKAAVTPAFTAQFPGVN  87

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+AV GVIP+HTHP GSEIL+V +GTICAGF+SS  NTVYFK LNKGD+MV
Sbjct  88   GLGISLARLDIAVGGVIPMHTHPAGSEILLVVEGTICAGFVSS-ANTVYFKTLNKGDIMV  146

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A  FV+FSSPNPGLQI  FALF N+LPTDIV   TFLD   IKK
Sbjct  147  FPQGLLHFQINSGKNTALGFVSFSSPNPGLQILDFALFGNELPTDIVAKTTFLDAVTIKK  206

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  207  LKGVLGGS  214



>gb|AFK44812.1| unknown [Lotus japonicus]
Length=210

 Score =   288 bits (737),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAF AQFPGVN
Sbjct  23   DFCVGDLTFPNGPAGYACKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFGAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE LVV QGTICAGF++S +NTVY K L KGDVMV
Sbjct  83   GLGISLARLDLASGGVIPLHTHPGASEALVVVQGTICAGFVAS-DNTVYLKTLKKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A AFV+FSS NPGLQI  FALFK+D PTD++   TFLD AQIKK
Sbjct  142  FPQGLLHFQINDGGSSALAFVSFSSANPGLQILDFALFKSDFPTDLIAATTFLDAAQIKK  201

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  202  LKGVLGGS  209



>ref|XP_004287629.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   288 bits (736),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CKK   VT +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADLTAPEGPAGYSCKKPAKVTVDDFVFSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAVDGVIP HTHPG SE+L+V +GTICAGF+SS +NTVY + L  GD MV
Sbjct  82   GLGISLARLDLAVDGVIPFHTHPGASEVLIVVEGTICAGFVSS-DNTVYLQTLETGDSMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N GD  A AFV+FSS +PGLQI  FALFKNDLPT ++   TFLDVAQIKK
Sbjct  141  FPQGLLHFQVNGGDTPALAFVSFSSASPGLQILDFALFKNDLPTSLIAQTTFLDVAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>gb|AFK39466.1| unknown [Medicago truncatula]
Length=210

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + +LP GPAGY CK  + VTENDF Y GLAAAGNT+NIIKAAVTPAFDAQF G+N
Sbjct  23   DFCVADYNLPNGPAGYSCKTPSKVTENDFAYHGLAAAGNTSNIIKAAVTPAFDAQFAGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGF+SS  NTVY K L KGDVMV
Sbjct  83   GLGISLARLDLAAGGVIPLHTHPGASEVLVVIQGTICAGFVSS-ANTVYIKTLYKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +KK
Sbjct  142  FPQGLLHFQINSGGSNALAFVSFSSANPGLQILDFALFKSDFPTELITATTFIDAAVVKK  201

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  202  LKGVLGGS  209



>gb|AFK43419.1| unknown [Medicago truncatula]
 gb|KEH37573.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + +LP GPAGY CK  + VTENDF Y GLAAAGNT+NIIKAAVTPAFDAQF G+N
Sbjct  23   DFCVADYNLPNGPAGYSCKTPSKVTENDFAYHGLAAAGNTSNIIKAAVTPAFDAQFAGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGF+SS  NTVY K L KGDVMV
Sbjct  83   GLGISLARLDLAAGGVIPLHTHPGASEVLVVIQGTICAGFVSS-ANTVYIKTLYKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +KK
Sbjct  142  FPQGLLHFQINSGGSNALAFVSFSSANPGLQILDFALFKSDFPTELITATTFIDAAVVKK  201

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  202  LKGVLGGS  209



>ref|XP_004243715.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum lycopersicum]
Length=211

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 166/211 (79%), Gaps = 3/211 (1%)
 Frame = +3

Query  48   MFLQTLFI---lsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAG  218
            M+ Q LF+   + + S+ +  LDFCVG+LSLP GP GY CKK + VT +DFV+SGLAA G
Sbjct  1    MYFQALFLFSLVIISSSQAAVLDFCVGDLSLPDGPGGYACKKPSKVTADDFVFSGLAATG  60

Query  219  NTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICA  398
                +IKAAVTPAF  QFPGVNGLG+SMARLDLA+ GVIP+HTHPG SE+L V QG ICA
Sbjct  61   KIIPLIKAAVTPAFAPQFPGVNGLGISMARLDLAISGVIPMHTHPGASEVLYVVQGEICA  120

Query  399  GFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALF  578
            GFISS +N V+FK L +GD+MVFPQGLLHFQINSG   A A ++FSSP PGLQIT FALF
Sbjct  121  GFISSSDNKVFFKTLKQGDIMVFPQGLLHFQINSGKTSALAIISFSSPTPGLQITDFALF  180

Query  579  KNDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
             NDLPT++V   TFLD A IKKLKGVLGGTN
Sbjct  181  ANDLPTELVAATTFLDAALIKKLKGVLGGTN  211



>ref|XP_004513480.1| PREDICTED: auxin-binding protein ABP19a-like [Cicer arietinum]
Length=210

 Score =   285 bits (729),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DFVY GL+A GNTTNIIKAAVTPAFDAQFPGVN
Sbjct  23   DFCVADYTFPNGPAGYSCKKPSKVTADDFVYHGLSAGGNTTNIIKAAVTPAFDAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QG ICAGF+SS +NTVY K L KGDVMV
Sbjct  83   GLGISIARLDLAAGGVIPLHTHPGASEVLVVVQGKICAGFVSS-DNTVYLKTLYKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A AFV+FSSPNPGLQI  FALFK+D PT+++   TF+D A +KK
Sbjct  142  FPQGLLHFQINGGGSNALAFVSFSSPNPGLQILDFALFKSDFPTELITATTFIDAAVVKK  201

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  202  LKGVLGGS  209



>ref|XP_008337871.1| PREDICTED: auxin-binding protein ABP20 [Malus domestica]
Length=233

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK   +V  +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  46   DFCVADLTAPDGPAGYSCKSPANVKVDDFVFSGLGVAGNTTNIIKAAVTPAFAAQFPGVN  105

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GVIP HTHPGGSE+L+V +GTICAGF+SS  NTVY + L KGD+MV
Sbjct  106  GLGISLARLDLAVGGVIPFHTHPGGSEVLIVIEGTICAGFVSS-ANTVYLQTLEKGDIMV  164

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G+  A AFV+FSSP+PGLQI  +ALFKNDLPT+++   TFLDVAQIKK
Sbjct  165  FPQGLLHFQVNGGETMALAFVSFSSPSPGLQILDYALFKNDLPTELIAQTTFLDVAQIKK  224

Query  645  LKGVLGGTN  671
            LK  LGGTN
Sbjct  225  LKAALGGTN  233



>emb|CDP03095.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 166/208 (80%), Gaps = 1/208 (0%)
 Frame = +3

Query  48   MFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTT  227
            M +Q LF  SLL AS+ A DFCV + SLP GPAGY CKK+  VT +DF++S LAA+GNT+
Sbjct  1    MLIQALFFFSLLVASTQAFDFCVADPSLPVGPAGYSCKKTADVTVDDFIFS-LAASGNTS  59

Query  228  NIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFI  407
            NII AAVTPAF   F GVNGLG+S+ARLD AV GVIP HTHPGGSEILVV QG +CAGFI
Sbjct  60   NIISAAVTPAFPPTFAGVNGLGISIARLDFAVGGVIPFHTHPGGSEILVVIQGQLCAGFI  119

Query  408  SSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKND  587
            SS EN VYFK L KGDVM FP+GLLHFQ NSG   A AFV+FSSPNPGLQ+T FA FKND
Sbjct  120  SSLENQVYFKTLVKGDVMAFPRGLLHFQFNSGKSPALAFVSFSSPNPGLQVTDFAFFKND  179

Query  588  LPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            LPT+IV   TFLD+ QIKKLK +LGGTN
Sbjct  180  LPTEIVAKTTFLDIPQIKKLKAILGGTN  207



>ref|XP_010049430.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW81986.1| hypothetical protein EUGRSUZ_C03354 [Eucalyptus grandis]
Length=211

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTTAFVNQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+A  GVIPLHTHPGGSE+L+V QGTICAGFISS  NTVY K LNKGD M+
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGTICAGFISSSANTVYLKTLNKGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A A V+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ+KK
Sbjct  143  FPQGLLHFQLNSGKGPALAIVSFSSPSPGLQIVDFALFANNFPSELVEATTFLDDAQVKK  202

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  203  LKGVLGGT  210



>ref|XP_010049517.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW82146.1| hypothetical protein EUGRSUZ_C03537 [Eucalyptus grandis]
Length=211

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTTAFVNQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+A  GVIPLHTHPGGSE+L+V QGTICAGFISS  NTVY K LNKGD M+
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGTICAGFISSSANTVYLKTLNKGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A A V+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ+KK
Sbjct  143  FPQGLLHFQLNSGKGPALAIVSFSSPSPGLQIVDFALFANNFPSELVEATTFLDDAQVKK  202

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  203  LKGVLGGT  210



>ref|XP_006342367.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=211

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 165/211 (78%), Gaps = 3/211 (1%)
 Frame = +3

Query  48   MFLQTLFI---lsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAG  218
            M+ Q LFI   L + S+ +  LDFCVG+LSLP GP GY CKK + VT +DFV+SGLAA  
Sbjct  1    MYFQGLFIFSLLIISSSEAAVLDFCVGDLSLPDGPGGYACKKPSKVTSDDFVFSGLAAPV  60

Query  219  NTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICA  398
                +IKAAVTPAF  QFPG+NGLG+SMARLDLA+ GVIP+HTHPG SE+L V QG ICA
Sbjct  61   KLIPLIKAAVTPAFAPQFPGLNGLGISMARLDLAIGGVIPMHTHPGASEVLYVVQGEICA  120

Query  399  GFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALF  578
            GFISS +N V+FK L +GD+MVFPQGLLHFQINSG   A A V+FSSP PGLQIT FALF
Sbjct  121  GFISSSDNKVFFKTLKQGDIMVFPQGLLHFQINSGKTSALAIVSFSSPTPGLQITDFALF  180

Query  579  KNDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
             NDLPT++V   TFLD A IKKLKGVLGGTN
Sbjct  181  ANDLPTELVAATTFLDAALIKKLKGVLGGTN  211



>emb|CAN67380.1| hypothetical protein VITISV_017918 [Vitis vinifera]
Length=193

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK   VT +DFV+SGL  AGNT+N+IKAAVTPAF  QFPG+N
Sbjct  6    DFCVGDLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVTPAFAPQFPGLN  65

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLAV GV+P+HTHPGGSE+L+VTQG ICAGFISS  NTVYFK L KGD+M+
Sbjct  66   GLGLSIARLDLAVGGVVPMHTHPGGSEVLLVTQGAICAGFISS-ANTVYFKTLKKGDIMI  124

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N     +TAFV+FSSP PGLQI  +ALF NDLPT++V   TFLD A +KK
Sbjct  125  FPQGLLHFQVNGAGIPSTAFVSFSSPQPGLQILDYALFANDLPTELVVQTTFLDAAVVKK  184

Query  645  LKGVLGGTN  671
            LK VLGGTN
Sbjct  185  LKAVLGGTN  193



>ref|NP_001268059.1| germin-like protein 6 precursor [Vitis vinifera]
 gb|ABL60875.1| germin-like protein 6 [Vitis vinifera]
Length=208

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK   VT +DFV+SGL  AGNT+N+IKAAVTPAF  QFPG+N
Sbjct  21   DFCVGDLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVTPAFAPQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLAV GV+P+HTHPGGSE+L+VTQG ICAGFISS  NTVYFK L KGD+M+
Sbjct  81   GLGLSIARLDLAVGGVVPMHTHPGGSEVLLVTQGAICAGFISS-ANTVYFKTLKKGDIMI  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N     +TAFV+FSSP PGLQI  +ALF NDLPT++V   TFLD A +KK
Sbjct  140  FPQGLLHFQVNGAGIPSTAFVSFSSPQPGLQILDYALFANDLPTELVVQTTFLDAAVVKK  199

Query  645  LKGVLGGTN  671
            LK VLGGTN
Sbjct  200  LKAVLGGTN  208



>ref|XP_009361697.1| PREDICTED: auxin-binding protein ABP19a [Pyrus x bretschneideri]
Length=209

 Score =   280 bits (717),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV N   P GPAGY CKK   VT +DFVYSGL   GNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVANYKAPEGPAGYSCKKPAKVTVDDFVYSGLGIPGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GVIP HTHPG SE+L+V QGTI AGF+SS  NTVY K L KGD+MV
Sbjct  82   GLGISLARLDLAVGGVIPFHTHPGASEVLLVAQGTIIAGFVSS-ANTVYLKTLKKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N     A AFV+FSSP+PGLQI  FALF+NDLPT+++   TFLD AQIKK
Sbjct  141  FPQGLLHFQVNGDKTPALAFVSFSSPSPGLQILDFALFQNDLPTELIAQTTFLDAAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>sp|O04011.1|ABP20_PRUPE RecName: Full=Auxin-binding protein ABP20; Flags: Precursor [Prunus 
persica]
 gb|AAB51240.1| auxin-binding protein [Prunus persica]
Length=214

 Score =   280 bits (716),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAG+ CKK  SV  NDFV+SGL  AGNT+NIIKAAVTPAF AQFPGVN
Sbjct  27   DFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVTPAFVAQFPGVN  86

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GV+P HTHPG SE+L+V QGTICAGF++S +NT Y + L KGD+MV
Sbjct  87   GLGISIARLDLAVGGVVPFHTHPGASEVLIVAQGTICAGFVAS-DNTPYLQTLEKGDIMV  145

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G+  A AF +F S +PGLQI  FALFKNDLPT+++   TFLD AQIKK
Sbjct  146  FPQGLLHFQVNGGEAPALAFASFGSASPGLQILDFALFKNDLPTEVIAQTTFLDAAQIKK  205

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  206  LKGVLGGTN  214



>ref|XP_007202571.1| hypothetical protein PRUPE_ppa011460mg [Prunus persica]
 gb|EMJ03770.1| hypothetical protein PRUPE_ppa011460mg [Prunus persica]
Length=209

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAG+ CKK  SV  NDFV+SGL  AGNT+NIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVTPAFVAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GV+P HTHPG SE+L+V QGTICAGF++S +NT Y + L KGD+MV
Sbjct  82   GLGISIARLDLAVGGVVPFHTHPGASEVLIVAQGTICAGFVAS-DNTPYLQTLEKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G+  A AF +F S +PGLQI  FALFKNDLPT+++   TFLD AQIKK
Sbjct  141  FPQGLLHFQVNGGEAPALAFASFGSASPGLQILDFALFKNDLPTEVIAQTTFLDAAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>gb|ADD71879.1| germin-like protein subfamily 3 member 4 precursor [Arachis hypogaea]
Length=211

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFVYSGL A GNT+NIIKAAVTPAFDAQF GVN
Sbjct  24   DFCVADYTAPNGPAGYSCKSPAKVTVDDFVYSGLGAVGNTSNIIKAAVTPAFDAQFAGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS +NTVYFK L KGDVMV
Sbjct  84   GLGISTARLDLAPGGVIPLHTHPGASELLVVVQGTICAGFISS-DNTVYFKTLKKGDVMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            +PQGLLHFQ+N G  +A AFV+FSS NPGLQI  FALFK+D PT+++   TFLD A +KK
Sbjct  143  YPQGLLHFQLNGGGTQALAFVSFSSANPGLQILDFALFKSDFPTELITQTTFLDAAXVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGG++
Sbjct  203  LKGVLGGSS  211



>ref|XP_004144029.1| PREDICTED: auxin-binding protein ABP20-like [Cucumis sativus]
 ref|XP_004161110.1| PREDICTED: auxin-binding protein ABP20-like [Cucumis sativus]
 gb|KGN66292.1| hypothetical protein Csa_1G596420 [Cucumis sativus]
Length=215

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     P+G+PCKK++ VTE DFV+SGL  AGNT+N+IKAAVTPAF AQFPGVN
Sbjct  28   DFCVADLMSADTPSGFPCKKASLVTEKDFVFSGLGVAGNTSNLIKAAVTPAFTAQFPGVN  87

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+AV GVIP+HTHP GSEIL+V +G ICAGF+SS  NTVYFK LNKGD+M+
Sbjct  88   GLGVSLARLDIAVGGVIPMHTHPAGSEILLVVEGVICAGFVSS-ANTVYFKTLNKGDIMI  146

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A  FV+FSSPNPGLQI  FALF N+LPTDIV   TFLD   IKK
Sbjct  147  FPQGLLHFQINSGKTAALGFVSFSSPNPGLQILDFALFGNELPTDIVAKTTFLDPVTIKK  206

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  207  LKGVLGGS  214



>ref|XP_007012661.1| Germin protein subfamily 3 member 3 [Theobroma cacao]
 gb|EOY30280.1| Germin protein subfamily 3 member 3 [Theobroma cacao]
Length=275

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 158/189 (84%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     PAGY CK  T+VT +DFV+SGL AAGNT+N+IKAAVTPAFDAQFPGVN
Sbjct  90   DFCVADLKGLQSPAGYSCK--TAVTVDDFVFSGLGAAGNTSNLIKAAVTPAFDAQFPGVN  147

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GV+P+HTHPGGSEIL+V QG+ICAGFISS  N VYFK L +GD+MV
Sbjct  148  GLGVSIARLDLAVGGVVPMHTHPGGSEILLVVQGSICAGFISS-ANKVYFKSLKRGDIMV  206

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AF +FSSPNPGLQI  FALF NDLPT+I+  VTFLD AQ+KK
Sbjct  207  FPQGLLHFQINAGKTLALAFASFSSPNPGLQILDFALFGNDLPTEIIKQVTFLDDAQVKK  266

Query  645  LKGVLGGTN  671
            LK VLGG N
Sbjct  267  LKRVLGGIN  275



>ref|XP_008337872.1| PREDICTED: auxin-binding protein ABP19a [Malus domestica]
Length=209

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV N   P GPAGY CKK   VT +DFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVANYKAPEGPAGYACKKPAKVTVDDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDL   GVIP HTHPG SE+L+V QGTI AGF+SS  NTVY K L KGD+MV
Sbjct  82   GLGISLARLDLDAGGVIPFHTHPGASEVLLVAQGTIIAGFVSS-ANTVYLKTLKKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N     + A+V+FSSP+PGLQI  FALF+NDLPT+++   TFLDVAQIKK
Sbjct  141  FPQGLLHFQVNGDKTPSLAYVSFSSPSPGLQILDFALFQNDLPTELIAQTTFLDVAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>ref|XP_007138665.1| hypothetical protein PHAVU_009G227800g [Phaseolus vulgaris]
 gb|ESW10659.1| hypothetical protein PHAVU_009G227800g [Phaseolus vulgaris]
Length=210

 Score =   277 bits (709),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT NDFVYSGLA AGNT+NIIKAAV+PAFDAQFPGVN
Sbjct  23   DFCVADYTAPNGPAGYSCKNPAKVTVNDFVYSGLATAGNTSNIIKAAVSPAFDAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV +G ICAGF+ S  N VY K L KGD+MV
Sbjct  83   GLGISVARLDLASGGVIPLHTHPGASELLVVVEGQICAGFVDS-GNNVYLKTLEKGDIMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSGD +  AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +KK
Sbjct  142  FPQGLLHFQINSGDSQGLAFVSFSSANPGLQILDFALFKSDFPTELITETTFIDAAVVKK  201

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  202  LKGVLGGS  209



>ref|NP_001241062.1| auxin-binding protein ABP19a-like precursor [Glycine max]
 gb|ACG69486.1| germin-like protein 10 [Glycine max]
Length=213

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFVYSGL  AGNT+NIIKAAVTPAFDAQFPGVN
Sbjct  26   DFCVADYTGPNGPAGYSCKSPAKVTVDDFVYSGLGTAGNTSNIIKAAVTPAFDAQFPGVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTIC GF++S +NTVY K L KGDVMV
Sbjct  86   GLGISIARLDLAAGGVIPLHTHPGASELLVVVQGTICTGFVAS-DNTVYLKTLKKGDVMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            +PQGLLHFQIN G+ +A AFV+FSS NPGLQI  F+LFK+D PT+++   TF+D A +KK
Sbjct  145  YPQGLLHFQINDGESQALAFVSFSSANPGLQILDFSLFKSDFPTELITQTTFIDAAVVKK  204

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  205  LKGVLGGS  212



>ref|XP_008242222.1| PREDICTED: auxin-binding protein ABP19a [Prunus mume]
Length=209

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIP HTHPG SE+L+V QGTI AGF++S +NT Y K LNKGD+MV
Sbjct  82   GLGISLARLDLAPGGVIPFHTHPGASELLLVVQGTIIAGFVAS-DNTPYLKTLNKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A AF +FSSP+PGLQI  FALFKNDLPT+++   TFLD +QIKK
Sbjct  141  FPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLPTELIAQTTFLDASQIKK  200

Query  645  LKGVLGGTN  671
            LKG LGGTN
Sbjct  201  LKGALGGTN  209



>ref|XP_007202573.1| hypothetical protein PRUPE_ppa011467mg [Prunus persica]
 sp|Q9ZRA4.1|AB19A_PRUPE RecName: Full=Auxin-binding protein ABP19a; Flags: Precursor 
[Prunus persica]
 gb|AAD00295.1| auxin-binding protein ABP19 [Prunus persica]
 gb|EMJ03772.1| hypothetical protein PRUPE_ppa011467mg [Prunus persica]
Length=209

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAKVTINDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDL   GVIP HTHPG SE+L+V QGTI AGF++S +NT Y K L KGD+MV
Sbjct  82   GLGISLARLDLGPGGVIPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYLKTLKKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A AF +FSSP+PGLQI  FALFKNDLPT+++   TFLD AQIKK
Sbjct  141  FPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLPTELIAQTTFLDAAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>gb|ACA03785.1| putative auxin-binding protein 2 [Prunus salicina]
Length=209

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIP HTHPG SE+L+V QGTI AGF++S +NT Y K L KGD+MV
Sbjct  82   GLGISLARLDLAPGGVIPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYLKTLKKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A AF +FSSP+PGLQI  FALFKNDL T+++   TFLD AQIKK
Sbjct  141  FPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLATELIAQTTFLDAAQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>emb|CAC34417.1| Germin-like protein [Pisum sativum]
Length=211

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFV+ GLA  GNTTNIIKAAVTPAFDAQFPGVN
Sbjct  24   DFCVADYNAPNGPAGYSCKTPKKVTVDDFVFHGLATGGNTTNIIKAAVTPAFDAQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTI AGF+SS  N VY K LNKGDVMV
Sbjct  84   GLGISIARLDLAPGGVIPLHTHPGASEVLVVIQGTILAGFVSS-ANVVYLKTLNKGDVMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A AFV+FSS NPGLQI  FALFK+D PT+++   TFLD   +KK
Sbjct  143  FPQGLLHFQINSGRSNALAFVSFSSANPGLQILDFALFKSDFPTELITATTFLDAGLVKK  202

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  203  LKGVLGGS  210



>ref|XP_009784907.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=210

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 163/210 (78%), Gaps = 2/210 (1%)
 Frame = +3

Query  48   MFLQTLFIlsll--sasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M  Q+ FI SLL  S+ +  LDFCVG+LS+P GP GY CKK ++VT NDFV+SGLA    
Sbjct  1    MLFQSFFIFSLLFLSSEAAVLDFCVGDLSVPDGPGGYACKKPSAVTANDFVFSGLATPVK  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
               +IKAAVTPAF  QFPG+NGLG+SMARLDLA+ GVIP+HTHPG SE+L V  G ICAG
Sbjct  61   LNPLIKAAVTPAFAPQFPGLNGLGISMARLDLAIGGVIPMHTHPGASEVLYVVTGQICAG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS +N V+FK L +GD+MVFPQGLLHFQINSG   + A V+FSSP PGLQIT FALF 
Sbjct  121  FISSSDNKVFFKNLKQGDIMVFPQGLLHFQINSGKTASLAIVSFSSPTPGLQITDFALFA  180

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            NDL T+IV   TFLD A IKKLKGVLGGTN
Sbjct  181  NDLATEIVQATTFLDAATIKKLKGVLGGTN  210



>ref|XP_009596795.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana tomentosiformis]
 dbj|BAC77634.1| 24K germin like protein [Nicotiana tabacum]
Length=210

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 162/210 (77%), Gaps = 2/210 (1%)
 Frame = +3

Query  48   MFLQTLFIlsll--sasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MF Q  FI SLL  S+ +  LDFCVG+LS+P GP GY CKK ++VT NDFV+SGLA    
Sbjct  1    MFFQAFFIFSLLFLSSDAAVLDFCVGDLSVPDGPGGYACKKPSAVTANDFVFSGLATPVK  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
               +IKAAVTPAF  QFPG+NGLG+SMARLDLA+ GVIP+HTHPG SE+L V  G ICAG
Sbjct  61   LNPLIKAAVTPAFAPQFPGLNGLGISMARLDLAIGGVIPMHTHPGASEVLYVVTGEICAG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS +N V+FK L +GD+MVFPQGLLHFQINSG     A V+FSSP PGLQIT FALF 
Sbjct  121  FISSSDNKVFFKNLKQGDIMVFPQGLLHFQINSGKTTGLAIVSFSSPTPGLQITDFALFA  180

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            NDL T++V   TFLD A IKKLKGVLGGTN
Sbjct  181  NDLATELVQATTFLDAATIKKLKGVLGGTN  210



>ref|XP_010049513.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW82133.1| hypothetical protein EUGRSUZ_C03521 [Eucalyptus grandis]
Length=211

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVTPA   QFPG+N
Sbjct  23   DFCVGDLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTPALINQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            G G+S+ARLD+A  GVIPLHTHPGGSE+L+V QG+ICAGFISS  NT+Y K LNKGD M+
Sbjct  83   GFGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGSICAGFISSSVNTIYLKTLNKGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+  G   A V+FSSP+PGLQI  FAL  N+ P+++V   TFLD AQ+KK
Sbjct  143  FPQGLLHFQMNAVKGPGLAIVSFSSPSPGLQILDFALLANNFPSELVEATTFLDDAQVKK  202

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  203  LKGVLGGT  210



>gb|ACA03784.1| putative auxin-binding protein 3 [Prunus salicina]
Length=214

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            ++ T+I  +   F L L S+++   DFCV +L+ P GPAG+ CKK  SV  NDFV+SGL 
Sbjct  2    RQATMIFPILFTFFLLLSSSNAAVQDFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLG  61

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT  389
             AGNT+NIIKAAVTPAF AQFPGVNGLG+S+ARLDLAV GV+P HTHPG SE+LVV +GT
Sbjct  62   IAGNTSNIIKAAVTPAFAAQFPGVNGLGISIARLDLAVGGVVPFHTHPGASEVLVVVEGT  121

Query  390  ICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTF  569
            ICAGF++S +N  Y + L KGD+MV PQGLLHFQ+N G   A AF +F S +PGLQI  F
Sbjct  122  ICAGFVAS-DNAPYLQTLEKGDIMVSPQGLLHFQVNGGKASALAFASFGSASPGLQILDF  180

Query  570  ALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ALFKNDL T+++   TFLD AQIKKLKGVLGGTN
Sbjct  181  ALFKNDLATELIAQTTFLDAAQIKKLKGVLGGTN  214



>ref|XP_008242223.1| PREDICTED: auxin-binding protein ABP20 [Prunus mume]
Length=237

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 166/214 (78%), Gaps = 1/214 (0%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            ++ T+I  +   F L L S+++   DFCV +L+ P GPAG+ CKK   V  NDFV+SGL 
Sbjct  25   RQATMIFPILFTFFLLLSSSNAAVQDFCVADLAAPEGPAGFSCKKPAVVKVNDFVFSGLG  84

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT  389
             AGNT+NIIKAAVTPAF AQFPGVNGLG+S+ARLDLAV GV+P HTHPG SE+L+V +GT
Sbjct  85   IAGNTSNIIKAAVTPAFVAQFPGVNGLGISIARLDLAVGGVVPFHTHPGASEVLIVAEGT  144

Query  390  ICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTF  569
            ICAGF++S +NT Y + L KGD+MVFPQGLLHFQ+N G+  A AF +F S +PGLQI  F
Sbjct  145  ICAGFVAS-DNTPYLQTLEKGDIMVFPQGLLHFQVNGGEAPALAFASFGSASPGLQILDF  203

Query  570  ALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ALFKNDL T ++   TFLD AQIKKLKGVLGGTN
Sbjct  204  ALFKNDLATKLIAQTTFLDPAQIKKLKGVLGGTN  237



>ref|XP_010454369.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=211

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 160/214 (75%), Gaps = 4/214 (2%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            K I  + F+ +LF+    ++     DFCV +   P  P+GY CK    V ENDFV+SGL 
Sbjct  2    KMIIHVFFIISLFLSIAFASVQ---DFCVADPKGPQSPSGYSCKNPDQVNENDFVFSGLG  58

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT  389
             AGNT+NIIKAAVTPAF   F G+NGLG+SMARLDLA  GVIPLHTHPG SE+LVV QGT
Sbjct  59   KAGNTSNIIKAAVTPAFAPAFAGINGLGISMARLDLAGGGVIPLHTHPGASEVLVVIQGT  118

Query  390  ICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTF  569
            ICAGFISS  N VY K LN+GD MVFPQGLLHFQ+NSG G A AFV F SP+PGLQIT+F
Sbjct  119  ICAGFISS-ANKVYLKTLNRGDTMVFPQGLLHFQLNSGKGPALAFVAFGSPSPGLQITSF  177

Query  570  ALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ALF NDLP+++V   TFL   ++KKLKGVLGGTN
Sbjct  178  ALFANDLPSELVEATTFLSDEEVKKLKGVLGGTN  211



>ref|XP_010420905.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
 ref|XP_010493167.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=211

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 159/214 (74%), Gaps = 4/214 (2%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            K I  + F+ +LF      A +   DFCV +   P  P+GY CK    V ENDFV+SGL 
Sbjct  2    KMIIHVFFIISLF---SSIAFASVQDFCVADPKGPQSPSGYSCKNPDQVNENDFVFSGLG  58

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT  389
             AGNT+NIIKAAVTPAF   F G+NGLG+SMARLDLA  GVIPLHTHPG SE+LVV QGT
Sbjct  59   KAGNTSNIIKAAVTPAFAPAFAGINGLGISMARLDLAGGGVIPLHTHPGASEVLVVIQGT  118

Query  390  ICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTF  569
            ICAGFISS  N VY K LN+GD MVFPQGLLHFQ+NSG G A AFV F SP+PGLQIT+F
Sbjct  119  ICAGFISS-ANKVYLKTLNRGDTMVFPQGLLHFQLNSGKGPALAFVAFGSPSPGLQITSF  177

Query  570  ALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ALF NDLP+++V   TFL   ++KKLKGVLGGTN
Sbjct  178  ALFANDLPSELVEATTFLSDEEVKKLKGVLGGTN  211



>ref|XP_011045993.1| PREDICTED: auxin-binding protein ABP20 [Populus euphratica]
Length=209

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P G+ CKK  +VT +DFV+SGL A GNT+NIIKAAVTPAF  +F GVN
Sbjct  22   DFCVADLTGPDTPTGFVCKKPAAVTVDDFVFSGLGAGGNTSNIIKAAVTPAFADKFAGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLAV GV+P+HTHPGGSE+L+V  G+ICAGFISS +N VYFK L KGD+MV
Sbjct  82   GLGISMARLDLAVGGVVPMHTHPGGSEVLIVVSGSICAGFISS-DNKVYFKSLKKGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN+G   A AFV+FSS  PGLQI  FALF NDLP++I+   TFLD AQ+KK
Sbjct  141  FPRGLLHFQINAGGTSALAFVSFSSERPGLQILDFALFANDLPSEIIEKTTFLDDAQVKK  200

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  201  LKGVLGGT  208



>ref|XP_010049516.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
Length=210

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GP GY CKK ++VT NDFV+SGL  AGNT+N+IKAA TPAF  QFPG+N
Sbjct  23   DFCVADLSAPEGPTGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAATPAFVTQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ RLD+A  GVIPLHTHPGGSE+++V +G+ICAGFISS  NTVY K LNKGD M+
Sbjct  83   GLGLSLVRLDMAPGGVIPLHTHPGGSEVILVLEGSICAGFISS-ANTVYLKTLNKGDSMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQ+N+    A AFV+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ+KK
Sbjct  142  FPRGLLHFQLNAAKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVKK  201

Query  645  LKGVLGGT  668
            LKG+LGGT
Sbjct  202  LKGILGGT  209



>ref|XP_006381632.1| hypothetical protein POPTR_0006s14510g [Populus trichocarpa]
 gb|ERP59429.1| hypothetical protein POPTR_0006s14510g [Populus trichocarpa]
Length=250

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 168/213 (79%), Gaps = 3/213 (1%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            +K+ L +FL  +F L   ++++   DFCV +L+ P  P G+ CKK  +VT +DFV+SGL 
Sbjct  40   EKMILPIFL--IFSLLSSTSNAAVQDFCVADLTGPDTPTGFVCKKPAAVTVDDFVFSGLG  97

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT  389
            A GNT+NIIKAAVTPAF  +F GVNGLG+SMARLDLAV GVIP+HTHPGGSE+L+V  G+
Sbjct  98   AGGNTSNIIKAAVTPAFADKFGGVNGLGISMARLDLAVGGVIPMHTHPGGSEVLIVVSGS  157

Query  390  ICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTF  569
            ICAGFISS +N VYFK L KGD+M FP+GLLHFQIN+G   A AFV+FSS  PGLQI  F
Sbjct  158  ICAGFISS-DNKVYFKSLKKGDIMAFPRGLLHFQINAGGTPALAFVSFSSERPGLQILDF  216

Query  570  ALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            ALF NDLP++I+ T TFLD AQ+KKLKGVLGGT
Sbjct  217  ALFANDLPSEIIETTTFLDDAQVKKLKGVLGGT  249



>ref|XP_008362990.1| PREDICTED: auxin-binding protein ABP19a-like [Malus domestica]
Length=210

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ N     GPAGY CKK   VT +DFVYSGL   GNTTNI K+AVTPAF AQFPGVN
Sbjct  22   DFCIANYKAXEGPAGYSCKKPAKVTVDDFVYSGLGIPGNTTNIFKSAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLAV GV+PLHTHP GSEIL+V QGTI AGF+SS  NTVY K L KGD+M 
Sbjct  82   GLGISFARLDLAVGGVMPLHTHPRGSEILLVAQGTIIAGFVSSANNTVYRKTLKKGDIMA  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQGLLHFQ+N     A AFV+FSSP+PGLQI  +ALF+NDLPT+++   T LD AQIKK
Sbjct  142  IPQGLLHFQVNGDKTPALAFVSFSSPSPGLQILDYALFQNDLPTELIAQTTVLDAAQIKK  201

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  202  LKGVLGGTN  210



>ref|XP_009389677.1| PREDICTED: germin-like protein 8-14 [Musa acuminata subsp. malaccensis]
Length=215

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG LS    PAGYPCK+ ++VT +DFV++GL   G+T+N+IKAAVTPAF +QFPGVN
Sbjct  28   DFCVGELSSSDTPAGYPCKEVSTVTCDDFVFTGLGVPGDTSNLIKAAVTPAFVSQFPGVN  87

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A DGV+PLHTHPGGSE+L V +GTICAGFISS  N VYF  LNKGD MV
Sbjct  88   GLGMSAARLDIAPDGVVPLHTHPGGSELLFVIEGTICAGFISS-ANDVYFTTLNKGDTMV  146

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG LHFQIN+GD  A AFV+FSSPNPGLQIT FALF N LP+ +V  VTFLD  Q+KK
Sbjct  147  FPQGQLHFQINAGDVNAVAFVSFSSPNPGLQITAFALFANSLPSPLVEKVTFLDDEQVKK  206

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  207  LKKVLGGS  214



>ref|XP_009417703.1| PREDICTED: germin-like protein 8-14 [Musa acuminata subsp. malaccensis]
Length=209

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG++S    PAGYPCK  + VT NDFV+ GL  AGNT+NIIKAAVTPAF  QFPGVN
Sbjct  22   DFCVGDISASDTPAGYPCKDVSHVTTNDFVFKGLGKAGNTSNIIKAAVTPAFVGQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GV+PLHTHPGGSE+LVVTQG I AGFISS  N VY+  L+KGD MV
Sbjct  82   GLGISAARLDLAPGGVVPLHTHPGGSELLVVTQGMILAGFISS-ANGVYYTTLHKGDTMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+G   A A VTFSSPNPGLQIT FALF N LP+ +V  VTFLD AQ+KK
Sbjct  141  FPQGLLHFQVNAGGVTAVAIVTFSSPNPGLQITAFALFANSLPSALVEKVTFLDDAQVKK  200

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  201  LKKVLGGS  208



>gb|ABL86677.1| GLP3 [Gossypium barbadense]
Length=205

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK+  VT NDFVYSGLAA GNT+N+IKAAVTPAF AQFPGVN
Sbjct  19   DFCVGDLNGPVGPAGYSCKKT--VTVNDFVYSGLAATGNTSNLIKAAVTPAFSAQFPGVN  76

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GVIP+HTHPG SE+++V  GT+ AGF+SS   +VY K LN+GD+MV
Sbjct  77   GLGISIARLDLAVGGVIPMHTHPGASELILVMHGTLLAGFMSSDSKSVYSKTLNEGDIMV  136

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN+G  ++ AFV+F+S +PG+QI   ++F NDLPT ++   TFLD AQIKK
Sbjct  137  FPRGLLHFQINAGKTQSVAFVSFNSADPGIQIFHLSMFANDLPTGVIAKTTFLDTAQIKK  196

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  197  LKGVLGGT  204



>ref|XP_009131804.1| PREDICTED: germin-like protein subfamily 3 member 3 [Brassica 
rapa]
Length=211

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+NIIKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVTPAFSPTFAGIN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K L KGD MV
Sbjct  84   GLGVSLARLDLASGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLEKGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI +FALF NDLP+++V   TFL  A++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>ref|XP_007204735.1| hypothetical protein PRUPE_ppa011385mg [Prunus persica]
 gb|EMJ05934.1| hypothetical protein PRUPE_ppa011385mg [Prunus persica]
Length=212

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNI KAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDL   GV+P HTHPG SE+L+V QGTI AGF++S +NT Y K L KGD++V
Sbjct  82   GLGISLARLDLGPGGVVPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYLKTLKKGDIIV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N GD  A AF +FSSP+PGLQI  FALFKNDL T+++   T LD  QIKK
Sbjct  141  FPQGLLHFQVNGGDTPAIAFPSFSSPSPGLQIVDFALFKNDLATELIAQTTLLDAPQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>ref|XP_006289376.1| hypothetical protein CARUB_v10002870mg [Capsella rubella]
 gb|EOA22274.1| hypothetical protein CARUB_v10002870mg [Capsella rubella]
Length=212

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  PAGY CK    VTENDFV+SGL   GNT+NIIKAAVTPAF   F G N
Sbjct  25   DFCVADPKGPQSPAGYSCKNPDQVTENDFVFSGLGKTGNTSNIIKAAVTPAFAPAFAGTN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K LN+GD MV
Sbjct  85   GLGVSMARLDLAAGGVIPLHTHPGASEVLVVVQGTICAGFISS-ANKVYLKTLNRGDSMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI +FALF NDLP+++V   TFL  A++KK
Sbjct  144  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVKK  203

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  204  LKGVLGGTN  212



>sp|O04012.1|AB19B_PRUPE RecName: Full=Auxin-binding protein ABP19b; Flags: Precursor 
[Prunus persica]
 gb|AAB51241.1| auxin-binding protein [Prunus persica]
Length=209

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNI KAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDL   GV+P HTHPG SE+L+V QGTI AGF++S +NT Y K L KGD++V
Sbjct  82   GLGISLARLDLGPGGVVPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYLKTLKKGDIIV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N GD  A AF +FSSP+PGLQI  FALFKNDL T+++   T LD  QIKK
Sbjct  141  FPQGLLHFQVNGGDTPAIAFPSFSSPSPGLQIVDFALFKNDLATELIAQTTLLDAPQIKK  200

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  201  LKGVLGGTN  209



>ref|XP_002516286.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
 gb|EEF46288.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
Length=208

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 160/210 (76%), Gaps = 2/210 (1%)
 Frame = +3

Query  42   LIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            +I+ +  +F L   S+ +   D+CVG+LS P GPAGY CKK+  VT NDFVYSGLAA G 
Sbjct  1    MILHIFLIFALLSSSSYALVQDYCVGDLSGPDGPAGYGCKKT--VTVNDFVYSGLAAPGK  58

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
               +IKA VTPAF  QFPG+NGLG+SMARLDL   GVIP+HTHP  SE+L V  G+ICAG
Sbjct  59   ILPLIKAGVTPAFVDQFPGLNGLGISMARLDLQPGGVIPMHTHPAASEVLTVISGSICAG  118

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS +N V+FK L+KGD+M+FPQGLLHFQINSG   A AFV+FSSP PGLQIT FALF 
Sbjct  119  FISSSDNKVFFKNLDKGDIMIFPQGLLHFQINSGGSSALAFVSFSSPRPGLQITDFALFA  178

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            NDLP+++V   TFLD A +KKLK VLGG N
Sbjct  179  NDLPSELVEKTTFLDDATVKKLKAVLGGKN  208



>emb|CDY51841.1| BnaA03g56080D [Brassica napus]
Length=211

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+NIIKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVTPAFAPTFAGIN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K L KGD MV
Sbjct  84   GLGVSLARLDLASGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLEKGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI +FALF NDLP+++V   TFL  A++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>ref|XP_007154588.1| hypothetical protein PHAVU_003G131400g [Phaseolus vulgaris]
 gb|ESW26582.1| hypothetical protein PHAVU_003G131400g [Phaseolus vulgaris]
Length=208

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF GVN
Sbjct  21   DFCVADHAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLHTHPG SE+LVV QG+I AGFISS +NTVY K L KGDVMV
Sbjct  81   GLGISAARLDLAAGGVIPLHTHPGASELLVVIQGSILAGFISS-DNTVYLKTLKKGDVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A V+FSS NPGLQI  FALFK++ PT ++   TFLD A +KK
Sbjct  140  FPQGLLHFQINAGGSSALAIVSFSSSNPGLQILDFALFKSNFPTPLIVETTFLDAALVKK  199

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  200  LKAVLGGS  207



>ref|XP_010235197.1| PREDICTED: germin-like protein 8-14 [Brachypodium distachyon]
Length=214

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK + SV+  DF Y GLAAAGNTTN+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCKAAGSVSSGDFYYHGLAAAGNTTNLIKAAVTPAFVGQFPGVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP  SE+L V +GT+ AGFI+S  NTVY K L KGD+MV
Sbjct  86   GLGISGARLDIAVGGVVPLHTHPAASELLFVVEGTVLAGFITSSSNTVYTKTLYKGDIMV  145

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V TVTFLD AQ+KK
Sbjct  146  FPQGLLHYQYNGGASAAVALVAFSGPNPGLQITDYALFANNLPSAVVETVTFLDDAQVKK  205

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  206  LKAVLGGS  213



>ref|XP_009594759.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana tomentosiformis]
Length=208

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK +T VT NDFV+SGL+AAGNT+NIIKA+VTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKTATKVTVNDFVFSGLSAAGNTSNIIKASVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GV+P HTHPG SE+L+V QG+I A F+SS  NTVY K L KG++MV
Sbjct  81   GLGLSAARLDLASGGVVPFHTHPGASEVLLVVQGSITAAFVSS-ANTVYLKTLKKGELMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+    + A+V FSS +PGLQIT FALF NDL T +V   TFLD AQIKK
Sbjct  140  FPQGLLHFQVNAAGYTSVAYVFFSSSSPGLQITDFALFANDLSTKLVEATTFLDEAQIKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_003574592.1| PREDICTED: germin-like protein 8-14 [Brachypodium distachyon]
Length=214

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK + SV+  DF Y GLAAAGNTTN+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCKAAGSVSSGDFYYHGLAAAGNTTNLIKAAVTPAFVGQFPGVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP  SE+L V +GTI AGFI+S  NTVY K L KGD MV
Sbjct  86   GLGISGARLDIAVGGVVPLHTHPAASELLFVVEGTILAGFITSSSNTVYTKTLYKGDAMV  145

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A AFV FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KK
Sbjct  146  FPQGLLHYQYNGGASTAVAFVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKK  205

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  206  LKAVLGGS  213



>ref|XP_006342915.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=208

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK  T+VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPGVN
Sbjct  21   DFCVADLKAPESPSGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIP HTHPG SEIL+V QG+I AGF+SS  N+VY K L KGD+MV
Sbjct  81   GLGISAARLDLAAGGVIPFHTHPGASEILLVVQGSITAGFVSS-ANSVYLKTLKKGDLMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ++     +  +V FSS NPGLQIT FALF NDLPT +V   TFLD A IKK
Sbjct  140  FPQGLLHFQVSDAGYTSVGYVFFSSSNPGLQITDFALFANDLPTKLVGATTFLDEATIKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>ref|XP_008391398.1| PREDICTED: auxin-binding protein ABP19a-like [Malus domestica]
Length=213

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL +L  LS  ++++   DFCV +L  P  P+GY CK +  VT +DFV+SGLA  GNT
Sbjct  6    ILFLFSLIFLSSSTSNASVNDFCVADLKGPDSPSGYTCKTAAMVTVSDFVFSGLAKGGNT  65

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
            TNII AAVTPAF AQFPGVNGLG+S+ARLDLA  GVIP HTHPG SEILVVT+G I AGF
Sbjct  66   TNIISAAVTPAFVAQFPGVNGLGISIARLDLAPGGVIPFHTHPGASEILVVTRGIIKAGF  125

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            +SS  NTVY K L+KG+VMVFPQGLLHFQ+N     + AFV+FSS +PGLQI  FALF N
Sbjct  126  VSS-ANTVYLKTLHKGEVMVFPQGLLHFQVNVAKIHSNAFVSFSSASPGLQILDFALFAN  184

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            DLP+++V   TFLD+A IKKLKGVLGGT
Sbjct  185  DLPSELVAQTTFLDLATIKKLKGVLGGT  212



>ref|XP_004235542.1| PREDICTED: auxin-binding protein ABP19a [Solanum lycopersicum]
Length=208

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK  T+VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKAPESPSGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP HTHPG SEIL+V QG+I AGF+SS  N+VY K L KGD+MV
Sbjct  81   GLGLSAARLDLAPSGVIPFHTHPGASEILLVVQGSITAGFVSS-ANSVYLKTLKKGDLMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ++     +  +V FSS NPGLQIT FALF NDLPT +V   TFLD A IKK
Sbjct  140  FPQGLLHFQVSDAGYTSVGYVFFSSSNPGLQITDFALFANDLPTKLVAATTFLDEATIKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>ref|XP_009784603.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=208

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK +T VT NDFV+SGL+AAGNT+NIIKA+VTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKNATKVTVNDFVFSGLSAAGNTSNIIKASVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GV+P HTHPG SE+L+V QG+I A F+SS  NTVY K L KG++MV
Sbjct  81   GLGLSAARLDLAPGGVVPFHTHPGASEVLLVVQGSITAAFVSS-ANTVYLKTLKKGELMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+    + A+V FSS +PGLQIT FALF NDL T +V   TF+D AQIKK
Sbjct  140  FPQGLLHFQVNAAGYTSVAYVFFSSSSPGLQITDFALFANDLSTKLVEATTFVDEAQIKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_003551125.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
 gb|KHN17718.1| Auxin-binding protein ABP19a [Glycine soja]
Length=208

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF G+N
Sbjct  21   DFCVADYAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLHTHPG SE+LVV +G+I AGFISS  N VY K L KGDVM 
Sbjct  81   GLGISAARLDLAAGGVIPLHTHPGASELLVVIEGSILAGFISS-ANIVYLKTLKKGDVMA  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A V+FSS NPGLQI  FALFK+  PT ++   TFLD A +KK
Sbjct  140  FPQGLLHFQINAGKSSALAIVSFSSSNPGLQILDFALFKSSFPTPLIVQTTFLDAALVKK  199

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  200  LKGVLGGS  207



>gb|ACU18952.1| unknown [Glycine max]
Length=208

 Score =   262 bits (669),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF G+N
Sbjct  21   DFCVADYAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLHTHPG SE+LVV +G+I AGFISS  N VY K L KGDVM 
Sbjct  81   GLGISAARLDLAAGGVIPLHTHPGASELLVVIEGSILAGFISS-ANIVYLKTLKKGDVMA  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A V+FSS NPGLQI  FALFK+  PT ++   TFLD A +KK
Sbjct  140  FPQGLLHFQINAGKSSALAIVSFSSSNPGLQIQDFALFKSGFPTPLIVQTTFLDAALVKK  199

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  200  LKGVLGGS  207



>ref|XP_009375459.1| PREDICTED: auxin-binding protein ABP19a [Pyrus x bretschneideri]
Length=213

 Score =   262 bits (669),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 161/208 (77%), Gaps = 1/208 (0%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL +L  LS  ++++   DFCV +L  P  P+GY CK    VT +DFV+SGLA  GNT
Sbjct  6    ILFLFSLIFLSSSTSNASVNDFCVADLKGPDSPSGYTCKIPAKVTVSDFVFSGLAKGGNT  65

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
            TNII AAVTPAF AQFPGVNGLG+S+ARLDLA  GVIP HTHPG SEILVVT+G I AGF
Sbjct  66   TNIISAAVTPAFVAQFPGVNGLGISIARLDLAPGGVIPFHTHPGASEILVVTRGIIKAGF  125

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            +SS  NTVY K L+KG+VMVFPQGLLHFQ+N     + AFV+FSS +PGLQI  FALF N
Sbjct  126  VSS-ANTVYLKTLHKGEVMVFPQGLLHFQVNVAKIHSNAFVSFSSASPGLQILDFALFAN  184

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            DLP+++V   TFLD+A IKKLKGVLGGT
Sbjct  185  DLPSELVAQTTFLDLATIKKLKGVLGGT  212



>ref|XP_004303688.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGY CK   +VT +DFVYSGLA AGNT+NII+AAVTPAF AQFPGVN
Sbjct  36   DFCVADLTGPDSPAGYFCKNPANVTVSDFVYSGLAKAGNTSNIIQAAVTPAFVAQFPGVN  95

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP HTHPG SE+L+V +G I AGF+SS  NTVY K L KGDVMV
Sbjct  96   GLGLSLARLDLAPGGVIPFHTHPGASEVLIVLRGYITAGFVSS-ANTVYVKTLKKGDVMV  154

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+    A A V+FSS +PGLQI  FALF NDLPT +V   TFLD AQI K
Sbjct  155  FPQGLLHFQVNAAKIHAKAIVSFSSASPGLQILDFALFANDLPTSLVGKTTFLDPAQIMK  214

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  215  LKGVLGGT  222



>ref|XP_010261909.1| PREDICTED: auxin-binding protein ABP20-like [Nelumbo nucifera]
Length=207

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CKK   VT +DFV+S L   GNT+NIIKAAVTPAF  QFPGVN
Sbjct  21   DFCVADLTAPEGPAGYSCKKPAKVTVDDFVFS-LGTVGNTSNIIKAAVTPAFATQFPGVN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLA DGV+P+HTHPG +E+L+V QGTIC GFISS  N+VY   L +GD+MV
Sbjct  80   GLGISMARLDLAPDGVVPMHTHPGATEVLIVAQGTICTGFISS-ANSVYLATLKQGDIMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            +P+GLLHFQINSG   A AFV+FSS NPGLQI  FALF N+LP+ +V   TFLD AQ+KK
Sbjct  139  YPRGLLHFQINSGKTPALAFVSFSSANPGLQILDFALFANNLPSALVEKTTFLDDAQVKK  198

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  199  LKAVLGGS  206



>ref|NP_197563.1| germin-like protein subfamily 3 member 3 [Arabidopsis thaliana]
 sp|P94072.1|GL33_ARATH RecName: Full=Germin-like protein subfamily 3 member 3; Short=AtGER3; 
Short=AtGLP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB51571.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51573.1| germin-like protein [Arabidopsis thaliana]
 emb|CAA73213.1| GLP3 protein [Arabidopsis thaliana]
 dbj|BAA77208.1| germin-like protein 2 precursor [Arabidopsis thaliana]
 emb|CAB54516.1| GER3 protein [Arabidopsis thaliana]
 gb|AAK62573.1| AT5g20630/T1M15_30 [Arabidopsis thaliana]
 gb|AAL06953.1| AT5g20630/T1M15_30 [Arabidopsis thaliana]
 gb|AED92868.1| germin-like protein subfamily 3 member 3 [Arabidopsis thaliana]
Length=211

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsas--shalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M +Q  FI+SL+S    +   DFCV +   P  P+GY CK    VTENDF ++GL  AGN
Sbjct  3    MIIQIFFIISLISTISFASVQDFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            T+NIIKAAVTPAF   + G+NGLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAG
Sbjct  63   TSNIIKAAVTPAFAPAYAGINGLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAG  122

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  N VY K LN+GD MVFPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF 
Sbjct  123  FISS-ANKVYLKTLNRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFA  181

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            NDLP+++V   TFL  A++KKLKGVLGGTN
Sbjct  182  NDLPSELVEATTFLSDAEVKKLKGVLGGTN  211



>gb|AAB51566.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51581.1| germin-like protein [Arabidopsis thaliana]
Length=211

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsas--shalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M +Q  FI+SL+S    +   DFCV +   P  P+GY CK    VTENDF ++GL  AGN
Sbjct  3    MIIQIFFIISLISTISFASVQDFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGKAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            T+NIIKAAVTPAF   + G+NGLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAG
Sbjct  63   TSNIIKAAVTPAFAPAYAGINGLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAG  122

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  N VY K LN+GD MVFPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF 
Sbjct  123  FISS-ANKVYLKTLNRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFA  181

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            NDLP+++V   TFL  A++KKLKGVLGGTN
Sbjct  182  NDLPSELVEATTFLSDAEVKKLKGVLGGTN  211



>gb|KFK26288.1| hypothetical protein AALP_AA8G228400 [Arabis alpina]
Length=211

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 157/210 (75%), Gaps = 3/210 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsas--shalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M +Q  FILSL+S+   +   DFCV +   P  P+GY CK    VTENDF +SGLA AGN
Sbjct  3    MIIQIFFILSLVSSISFASVQDFCVADPKGPQSPSGYSCKDPEQVTENDFAFSGLAKAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            T+NIIKAAVTPAF   F G NGLG+S+ARLDLA  GVIPLHTHPG SE LVV QGTICAG
Sbjct  63   TSNIIKAAVTPAFAPAFAGTNGLGVSLARLDLAGGGVIPLHTHPGASEALVVIQGTICAG  122

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  N VY K LN+GD M+FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF 
Sbjct  123  FISS-ANKVYLKTLNRGDSMIFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFA  181

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            NDLP+++V   TFL   ++KKLKGVLGGTN
Sbjct  182  NDLPSELVEATTFLSDEEVKKLKGVLGGTN  211



>gb|AAB51583.1| germin-like protein, partial [Arabidopsis thaliana]
Length=188

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF ++GL  AGNT+NIIKAAVTPAF   + G+N
Sbjct  1    DFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGNTSNIIKAAVTPAFAPAYAGIN  60

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K LN+GD MV
Sbjct  61   GLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLNRGDSMV  119

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF NDLP+++V   TFL  A++KK
Sbjct  120  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDAEVKK  179

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  180  LKGVLGGTN  188



>emb|CDX70935.1| BnaC03g10190D [Brassica napus]
Length=211

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTE DF +SGLA AGNT+NIIKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTEKDFAFSGLAKAGNTSNIIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K L +GD MV
Sbjct  84   GLGVSIARLDLATGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLERGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A A+V F S +PGLQI +FALF NDLP+++V   TFL  A++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAYVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>gb|KCW82144.1| hypothetical protein EUGRSUZ_C03535 [Eucalyptus grandis]
Length=207

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 151/188 (80%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GP GY CKK ++VT NDFV+SGL  AGNT+N+IKAA TPAF  QFPG+N
Sbjct  23   DFCVADLSAPEGPTGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAATPAFVTQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ RLD+A  GVIPLHTHPGGSE+++V +G+ICAGFISS  NT     LNKGD M+
Sbjct  83   GLGLSLVRLDMAPGGVIPLHTHPGGSEVILVLEGSICAGFISSSANTT----LNKGDSMI  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQ+N+    A AFV+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ+KK
Sbjct  139  FPRGLLHFQLNAAKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVKK  198

Query  645  LKGVLGGT  668
            LKG+LGGT
Sbjct  199  LKGILGGT  206



>gb|KEH37575.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK  + VT NDFVY GLAAAGNTTNIIKAAVT A DAQFPGVN
Sbjct  23   DFCVADYNAPNGPAGYSCKPPSKVTVNDFVYHGLAAAGNTTNIIKAAVTTAIDAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+AV GVIPLHTHPG SE+LVV +GTI AGF+SS +N VY K L+KGDVM+
Sbjct  83   GLGISIARLDIAVGGVIPLHTHPGASEVLVVIKGTISAGFVSS-DNVVYLKTLHKGDVMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A  F +FSS NP LQI  +ALF++D PT ++   TF+D A +KK
Sbjct  142  FPQGLLHFQINVGGSNALTFNSFSSANPRLQILDYALFESDFPTKLITATTFIDPAVVKK  201

Query  645  LKGVLGG  665
            LKG+LGG
Sbjct  202  LKGILGG  208



>emb|CAC32847.1| adenosine diphosphate glucose pyrophosphatase [Hordeum vulgare 
subsp. vulgare]
Length=212

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+P+HTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNGGSSSAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>ref|XP_011072583.1| PREDICTED: auxin-binding protein ABP19a [Sesamum indicum]
Length=221

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L  P GPAGY CK    VT  DFV++G  AAGNTTNII AAV+PAF AQFPG+N
Sbjct  34   DFCVGDLKAPEGPAGYSCKSPADVTVADFVFTGFRAAGNTTNIINAAVSPAFAAQFPGLN  93

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GV+P+HTHPG SE+L+V QG+I  GFISS  N VY K+L KGD+MV
Sbjct  94   GLGLSIARLDLAPGGVVPMHTHPGASELLLVVQGSIVTGFISS-ANNVYVKKLVKGDIMV  152

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AF +FSS NPGLQIT FALF N LP+ +V   TFLD AQ+KK
Sbjct  153  FPQGLLHFQINAGGRTAVAFASFSSQNPGLQITDFALFGNTLPSSLVEKTTFLDDAQVKK  212

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  213  LKAVLGGS  220



>ref|XP_010261910.1| PREDICTED: auxin-binding protein ABP19a-like [Nelumbo nucifera]
Length=207

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CKK   VT NDFVYS L+AAGNT+NIIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLTAPEGPAGYSCKKPAKVTVNDFVYS-LSAAGNTSNIIKAAVTPAFAAQFPGLN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLA  GV+P+HTHPG +E+L+V QGTI   FI S  ++VY K L KGD+MV
Sbjct  80   GLGISMARLDLAPGGVVPMHTHPGATELLLVVQGTITTAFIDS-ASSVYLKTLKKGDIMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            +PQGLLHFQ+N+G   A AFV+FSS NPGLQI  FALF N LPT +V   TFLD AQ+KK
Sbjct  139  YPQGLLHFQVNAGGIPAIAFVSFSSSNPGLQILDFALFANSLPTPLVEKTTFLDEAQVKK  198

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  199  LKAVLGGS  206



>ref|XP_002874007.1| hypothetical protein ARALYDRAFT_910104 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50266.1| hypothetical protein ARALYDRAFT_910104 [Arabidopsis lyrata subsp. 
lyrata]
Length=211

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGL  AGNT+NIIKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLGKAGNTSNIIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPG SE LVV QGTICAGFISS  N VY K LN+GD M+
Sbjct  84   GLGVSLARLDLAGGGVIPLHTHPGASEALVVIQGTICAGFISS-ANKVYLKTLNRGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF NDLP+++V   TFL  A++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDAEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>gb|ABG46233.1| germin-like protein 2a [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+P+HTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNGGSSSAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>dbj|BAK03467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+P+HTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNGGSSAAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>ref|NP_001061976.1| Os08g0460000 [Oryza sativa Japonica Group]
 sp|Q6ZBZ2.1|GL814_ORYSJ RecName: Full=Germin-like protein 8-14; AltName: Full=Germin-like 
protein 1; AltName: Full=Germin-like protein 5; Short=OsGER5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAC04836.1| germin-like protein 5 [Oryza sativa Japonica Group]
 dbj|BAB17848.1| germin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAD09603.1| germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD09958.1| germin-like protein [Oryza sativa Japonica Group]
 dbj|BAF23890.1| Os08g0460000 [Oryza sativa Japonica Group]
 gb|EAZ07240.1| hypothetical protein OsI_29484 [Oryza sativa Indica Group]
 gb|EAZ42986.1| hypothetical protein OsJ_27575 [Oryza sativa Japonica Group]
 dbj|BAG89446.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96911.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score =   260 bits (664),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK   SV   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP  SE+L VTQGT+ AGFI+S  NTVY + L  GD+MV
Sbjct  85   GLGISAARLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTVYTRTLYAGDIMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G   A A V FS PNPGLQIT +ALF N+LP+ IV  VTFLD AQ+KK
Sbjct  145  FPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVKK  204

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  205  LKSVLGGS  212



>gb|ABL86676.1| GLP2 [Gossypium barbadense]
Length=205

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 154/188 (82%), Gaps = 3/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG L+ P GPAGY CKK+   TE+DF +SGL  AGNT+N++KAA+TPAF  QFPGVN
Sbjct  20   DFCVGGLNGPVGPAGYSCKKT--ATEDDFSFSGLRTAGNTSNLVKAAITPAFSTQFPGVN  77

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLAV GVIP+HT P  SE+++V  GT+ AGFISS +N VY K LN+GD+M+
Sbjct  78   GLGISIARLDLAVGGVIPMHTQPRASELILVMDGTLFAGFISS-DNKVYSKSLNEGDIMI  136

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G  ++ AFV+F+S +PG+QI  FALF NDLPTDI+   TFLD AQIKK
Sbjct  137  FPQGLLHFQINTGKTQSVAFVSFNSADPGVQILDFALFTNDLPTDIIEGTTFLDAAQIKK  196

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  197  LKGVLGGT  204



>ref|XP_006400624.1| hypothetical protein EUTSA_v10014670mg [Eutrema salsugineum]
 gb|ESQ42077.1| hypothetical protein EUTSA_v10014670mg [Eutrema salsugineum]
Length=211

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA +GNT+N+IKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKSGNTSNLIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K L +GD MV
Sbjct  84   GLGVSMARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLQRGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF NDLP+++V   TFL   ++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>dbj|BAJ98277.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87478.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96386.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92946.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGYPCK    V   DF Y GLA AGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLACPDTPAGYPCKPG--VGAGDFYYHGLATAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAVGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V TVTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNGGGSSAVALVAFSGPNPGLQITDYALFANNLPSAVVETVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>gb|KEH37574.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK  + VT NDFVY GLAAAGNTTNIIKAAVT A DAQFPGVN
Sbjct  23   DFCVADYNAPNGPAGYSCKPPSKVTVNDFVYHGLAAAGNTTNIIKAAVTTAIDAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+AV GVIPLHTHPG SE+LVV +GTI AGF+SS +N VY K L+KGDVM+
Sbjct  83   GLGISIARLDIAVGGVIPLHTHPGASEVLVVIKGTISAGFVSS-DNVVYLKTLHKGDVMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A  F +FSS NP LQI  +ALF++D PT ++   TF+D A +KK
Sbjct  142  FPQGLLHFQINVGGSNALTFNSFSSANPRLQILDYALFESDFPTKLITATTFIDPAVVKK  201

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  202  LKSVLGGS  209



>ref|XP_006361339.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=208

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK  T VT NDFV+SGL+AAG+T+NIIKA+V+PAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVTKVTVNDFVFSGLSAAGDTSNIIKASVSPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GV+P HTHPG SE+L+V QG+I A F+SS  NTVY K + KG++MV
Sbjct  81   GLGLSAARLDLAPGGVVPFHTHPGASEVLLVVQGSITAAFVSS-ANTVYLKTIKKGELMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+    + A+V FSS NPGLQIT FALF NDL T +V   TFLD AQIKK
Sbjct  140  FPQGLLHFQVNAVGFNSVAYVFFSSSNPGLQITDFALFANDLSTKLVEATTFLDEAQIKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>gb|AAO92740.1| auxin binding protein [Gossypium hirsutum]
Length=206

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL-AAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCVG+L+ P GPAGY CKK+   TE+DF +SGL   AGNT+N++KAA+TPAF  QFPGV
Sbjct  20   DFCVGDLNGPVGPAGYSCKKT--ATEDDFSFSGLLRTAGNTSNLVKAAITPAFSTQFPGV  77

Query  282  NGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVM  461
            NGLG+S+ARLDLAV GVIP+HTHP  SE+++V  GT+ AGFISS +N VY K LN+GD+M
Sbjct  78   NGLGISIARLDLAVGGVIPMHTHPRASELILVMDGTLFAGFISS-DNKVYSKSLNEGDIM  136

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            +FPQGLLHFQIN+G  ++ AFV+F+S +PG+QI  FALF NDLPTDI+   TFLD AQIK
Sbjct  137  IFPQGLLHFQINTGKTQSVAFVSFNSADPGVQILDFALFTNDLPTDIIEGTTFLDAAQIK  196

Query  642  KLKGVLGGT  668
            KLKGVLGGT
Sbjct  197  KLKGVLGGT  205



>gb|AAF21988.2|AF116537_1 fiber protein GLP1 [Gossypium hirsutum]
Length=206

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL-AAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCVG+L+ P GPAGY CKK+   TE+DF +SGL   AGNT+N++KAA+TPAF  QFPGV
Sbjct  20   DFCVGDLNGPVGPAGYSCKKT--ATEDDFSFSGLLRTAGNTSNLVKAAITPAFSTQFPGV  77

Query  282  NGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVM  461
            NGLG+S+ARLDLAV GVIP+HTHP  SE+++V  GT+ AGFISS +N VY K LN+GD+M
Sbjct  78   NGLGISIARLDLAVGGVIPMHTHPRASELILVMDGTLFAGFISS-DNKVYSKSLNEGDIM  136

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            +FPQGLLHFQIN+G  ++ AFV+F+S +PG+QI  FALF NDLPTDI+   TFLD AQIK
Sbjct  137  IFPQGLLHFQINTGKTQSVAFVSFNSADPGVQILDFALFTNDLPTDIIEGTTFLDAAQIK  196

Query  642  KLKGVLGGT  668
            KLKGVLGGT
Sbjct  197  KLKGVLGGT  205



>ref|XP_009126456.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY45080.1| BnaA02g04960D [Brassica napus]
Length=211

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+N+IKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNLIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K L +GD MV
Sbjct  84   GLGVSMARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLQRGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF NDLP+++V   TFL   ++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGT+
Sbjct  203  LKGVLGGTD  211



>emb|CAC85479.1| adenosine diphosphate glucose pyrophosphatase [Triticum aestivum]
Length=212

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK    V+  DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--AGVSAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A+ GV+PLHTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAMGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNGGGSAAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>ref|XP_008784308.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=210

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    P+GY CKK  +VT NDFV++GL  AGNT+N+IKAAVTPAF AQFPGVN
Sbjct  23   DFCVADLTGRLTPSGYECKKEAAVTTNDFVFTGLGKAGNTSNLIKAAVTPAFVAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A  GV+PLHTHP  +E LVVTQGTICAGFIS+  N VY+K LN GD M+
Sbjct  83   GLGISAARLDIAPGGVVPLHTHPAATEFLVVTQGTICAGFIST-ANNVYYKSLNTGDSML  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A A V+FSSP+PGLQIT+FALF N+LP+ +V  VTFLD A++KK
Sbjct  142  FPQGLLHFQVNGGGTTAVAIVSFSSPSPGLQITSFALFANNLPSALVEKVTFLDDAEVKK  201

Query  645  LKGVLGGT  668
            LK +LGGT
Sbjct  202  LKKLLGGT  209



>ref|XP_009600028.1| PREDICTED: auxin-binding protein ABP19a [Nicotiana tomentosiformis]
Length=208

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK   +VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP HTHPG SE+L+V QG+I AGF+SS  N VY K L KGD+MV
Sbjct  81   GLGLSAARLDLAPGGVIPFHTHPGASEVLLVIQGSITAGFVSS-ANAVYLKTLKKGDLMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ++     +  FV FSS +PGLQIT FALF NDLPT +V   TFLD A IKK
Sbjct  140  FPQGLLHFQVSDAGYTSVGFVFFSSSSPGLQITDFALFANDLPTKLVEATTFLDEATIKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>emb|CAA75907.1| Germin-like protein 1 [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKA VTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAVVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+P+HTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNGGSSAAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>ref|XP_009760539.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=208

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK   +VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP HTHPG SE+L+V QG+I AGF+SS  N VY K L KGD+M+
Sbjct  81   GLGLSAARLDLAPGGVIPFHTHPGASEVLLVVQGSITAGFVSS-ANAVYLKTLKKGDLMI  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ++     +  FV FSS +PGLQIT FALF NDLPT +V   TFLD A IKK
Sbjct  140  FPQGLLHFQVSDAGYTSVGFVFFSSSSPGLQITDFALFANDLPTKLVEATTFLDEATIKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>gb|AAC05682.1| germin-like protein [Oryza sativa Japonica Group]
Length=213

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK   SV   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S A+LD+AV GV+PLHTHP  SE+L VTQGT+ AGFI+S  NTVY + L  GD+MV
Sbjct  85   GLGISAAKLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTVYTRTLYAGDIMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G   A A V FS PNPGLQIT +ALF N+LP+ IV  VTFLD AQ+KK
Sbjct  145  FPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVKK  204

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  205  LKSVLGGS  212



>ref|XP_006426654.1| hypothetical protein CICLE_v10026481mg [Citrus clementina]
 gb|ESR39894.1| hypothetical protein CICLE_v10026481mg [Citrus clementina]
Length=211

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L L   PAGYPC     VT +DFV+SGL  AGNTT+II AAVTPAF AQFP VN
Sbjct  23   DFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP+HTHP  SEIL+V  G I AGFISS  NTVY K L KGD+M+
Sbjct  83   GLGLSLARLDLAKGGVIPMHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG   A  FV+F+SPNPGLQIT FALF N+L + +V   TFLD A +K+
Sbjct  143  FPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKR  202

Query  645  LKGVLGGT  668
            LKG+LGGT
Sbjct  203  LKGILGGT  210



>gb|EMS51159.1| Germin-like protein 8-14 [Triticum urartu]
Length=213

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAG PCKK   V   DF Y GLA AGNT N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLACPDTPAGDPCKKG--VGPGDFYYHGLATAGNTNNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  85   GLGISAARLDIAVGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N G   A A V FS PNPGLQIT +ALF N+LP+ +V TVTFLD AQ+KK
Sbjct  145  FPQGLLHYQYNGGSSPAVALVAFSGPNPGLQITDYALFANNLPSAVVETVTFLDDAQVKK  204

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  205  LKSVLGGT  212



>dbj|BAA74702.1| germin-like protein 1 [Oryza sativa]
Length=213

 Score =   257 bits (656),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK   SV   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP  SE+L VTQGT+ AGFI+S  NTVY + L  GD+MV
Sbjct  85   GLGISAARLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTVYTRTLYAGDIMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G   A A V FS PNPGLQI  +ALF N+LP+ IV  VTFLD AQ+KK
Sbjct  145  FPQGLLHYQYNAGQSAAVALVGFSGPNPGLQINDYALFANNLPSAIVEKVTFLDDAQVKK  204

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  205  LKSVLGGS  212



>ref|XP_008786632.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=205

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     P+GY CK  ++VT +DFV++GL   GNT+NIIKAAVTPAF AQFPGVN
Sbjct  18   DFCVADLMGSLTPSGYQCKVESAVTTDDFVFTGLGVVGNTSNIIKAAVTPAFAAQFPGVN  77

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLHTHP  SE+LVVT+G I AGFISS  NTVY+  L+KGD MV
Sbjct  78   GLGISAARLDLAAGGVIPLHTHPAASELLVVTKGIIVAGFISS-ANTVYYMTLHKGDTMV  136

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A A V+FSSP+PGLQIT+FALF N+LP+ +V  VTFLD A++KK
Sbjct  137  FPQGLLHFQVNGGGTPAVAIVSFSSPSPGLQITSFALFANNLPSALVEKVTFLDDAEVKK  196

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  197  LKKVLGGT  204



>gb|ABK95684.1| unknown [Populus trichocarpa]
Length=210

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  + VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  22   DFCVAKLKGAGSPAGYACRMPSKVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDLA  GVIP+HTHPG SEIL V QG I AGFISS  NTVY K L KGDVMV
Sbjct  82   GLGLSMARLDLAPAGVIPMHTHPGASEILFVVQGKITAGFISSSANTVYVKTLKKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN+   +A A V+FS P+PGLQIT FA F NDL ++++   TFLD AQ+KK
Sbjct  142  FPRGLLHFQINAAGIQAIAVVSFSDPDPGLQITDFAFFANDLSSELLEKSTFLDDAQVKK  201

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  202  LKKVLGGT  209



>ref|XP_002304136.2| germin-like family protein [Populus trichocarpa]
 gb|EEE79115.2| germin-like family protein [Populus trichocarpa]
Length=210

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  ++VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  22   DFCVAKLKGAGSPAGYACRMPSNVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDLA  GVIP+HTHPG SEIL V QG I AGFISS  NTVY K L KGDVMV
Sbjct  82   GLGLSMARLDLAPAGVIPMHTHPGASEILFVVQGKITAGFISSSANTVYVKTLKKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN+   +A A V+FS P+PGLQIT FA F NDL ++++   TFLD AQ+KK
Sbjct  142  FPRGLLHFQINAAGIQAIAVVSFSDPDPGLQITDFAFFANDLSSELLEKSTFLDDAQVKK  201

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  202  LKKVLGGT  209



>ref|XP_010910722.1| PREDICTED: auxin-binding protein ABP20-like [Elaeis guineensis]
Length=210

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    P+GY CK+ +SVT +DFV+SGL   GNT+NIIKAAVTPAF AQFPGVN
Sbjct  23   DFCVADLTGHLTPSGYDCKEESSVTTDDFVFSGLGVPGNTSNIIKAAVTPAFVAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLHTHP  SE LVVT GTICAGFISS  N VY+  L  GD MV
Sbjct  83   GLGISAARLDLAPGGVIPLHTHPAASEFLVVTHGTICAGFISS-ANKVYYTTLKTGDSMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N  + +A A V+FSSP+PGLQIT FALF N+LP+++V  VTFLD A++KK
Sbjct  142  FPQGLLHFQVNGDETKAMAIVSFSSPSPGLQITAFALFANNLPSELVEMVTFLDDAEVKK  201

Query  645  LKGVLGGT  668
            LK +LGGT
Sbjct  202  LKKLLGGT  209



>ref|XP_006465923.1| PREDICTED: auxin-binding protein ABP19a-like [Citrus sinensis]
 gb|KDO65035.1| hypothetical protein CISIN_1g028365mg [Citrus sinensis]
Length=210

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L L   PAGYPC     VT +DFV+SGL  AGNTT+II AAVTPAF AQFP VN
Sbjct  22   DFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP+HTHP  SEIL+V  G I AGFISS  NTVY K L KGD+M+
Sbjct  82   GLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG   A  FV+F+SPNPGLQIT FALF N+L + +V   TFLD A +K+
Sbjct  142  FPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKR  201

Query  645  LKGVLGGT  668
            LK +LGGT
Sbjct  202  LKAILGGT  209



>ref|XP_008362989.1| PREDICTED: LOW QUALITY PROTEIN: auxin-binding protein ABP20-like 
[Malus domestica]
Length=206

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 147/189 (78%), Gaps = 4/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L++P GPAGY CK    V  +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADLTVPDGPAGYSCK---XVKVDDFVFSGLDIAGNTTNIIKAAVTPAFAAQFPGVN  78

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            G G+S+ RLDLAV G +P HTHPG   +L+V +GTICA F+S   NTVY + L KGD+MV
Sbjct  79   GXGISLTRLDLAVGGXVPFHTHPGALGVLIVIKGTICASFVS-LANTVYLRTLEKGDIMV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G+  A AF +FS P+PG QI  FALFKNDL T+++   TFLD AQIKK
Sbjct  138  FPQGLLHFQVNGGETPALAFASFSRPSPGRQILDFALFKNDLXTELIAQTTFLDAAQIKK  197

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  198  LKGVLGGTN  206



>ref|XP_011078074.1| PREDICTED: auxin-binding protein ABP19a-like [Sesamum indicum]
Length=210

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 154/210 (73%), Gaps = 2/210 (1%)
 Frame = +3

Query  48   MFLQTLFI--lsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M L+ LFI  L + ++ +   DFCV +LSLP GP GY CK   SVTENDF Y GLA  G+
Sbjct  1    MRLRYLFIFSLLVAASYALVQDFCVADLSLPAGPTGYSCKTPASVTENDFFYHGLATPGS  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            T N   A V+ AFD+QFPG+NGLG+S  RLDLAV GV PLH+HP  +E++V+ +GT+  G
Sbjct  61   TNNRAGAGVSWAFDSQFPGLNGLGISSLRLDLAVGGVAPLHSHPAATELVVIVEGTLTLG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISSF++ VY K LNK DVMV PQGLLHF INSG+  A AF +FSS NPGLQ T FALFK
Sbjct  121  FISSFDDKVYIKTLNKWDVMVVPQGLLHFAINSGNTTALAFASFSSQNPGLQTTAFALFK  180

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ND PT++V   TFLD  QIKKLK +LGGTN
Sbjct  181  NDFPTELVAKTTFLDAEQIKKLKALLGGTN  210



>sp|P45854.1|GLP1_SINAL RecName: Full=Germin-like protein 1; Flags: Precursor [Sinapis 
alba]
 emb|CAA59257.1| Glp1 [Sinapis alba]
Length=211

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGL  AGNT+N+IKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQNPSGYSCKNPDQVTENDFAFSGLGKAGNTSNVIKAAVTPAFAPAFAGLN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GL +S+ARLDLA  GVIPLHTHPG SE+LVV QGTICAGFISS  N VY K L++GD MV
Sbjct  84   GLDVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYLKTLSRGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF NDLP+++V   TFL   ++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>ref|XP_011035719.1| PREDICTED: auxin-binding protein ABP19a-like [Populus euphratica]
Length=208

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  + VT +DFVY+GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  20   DFCVAKLKGAGNPAGYACRMPSKVTVDDFVYTGLGVAGNTTNIISAAVTPAFVQQFPGVN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDLA  GVIP+HTHPG SE+L V +G I AGFISS  NTVY K L KGDVMV
Sbjct  80   GLGLSMARLDLAPAGVIPMHTHPGASELLFVVRGKITAGFISSLANTVYVKTLKKGDVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN G+  A A V+FS P+PGLQIT FA F N+L ++++   TFLD AQ+KK
Sbjct  140  FPRGLLHFQINDGEINAVAVVSFSDPDPGLQITDFAFFANNLSSELLEKSTFLDDAQVKK  199

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  200  LKKVLGGT  207



>ref|XP_002299591.2| germin-like family protein [Populus trichocarpa]
 gb|EEE84396.2| germin-like family protein [Populus trichocarpa]
Length=207

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  + VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  19   DFCVAKLKGAGNPAGYACRMPSKVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  78

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDLA  GVIP+HTHPG SE+L V QG I AGFISS  NTVY K L KGDVMV
Sbjct  79   GLGLSMARLDLAPAGVIPMHTHPGASEVLFVVQGKITAGFISSLANTVYVKTLKKGDVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN G+  A A V+FS P+PGLQIT FA F N+L ++++   TFLD AQ+KK
Sbjct  139  FPRGLLHFQINDGEINAVAVVSFSDPDPGLQITDFAFFANNLSSELLEKSTFLDDAQVKK  198

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  199  LKKVLGGT  206



>ref|XP_004973627.1| PREDICTED: germin-like protein 8-14-like [Setaria italica]
Length=212

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  +SV+ NDF Y GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--SSVSANDFYYHGLAGMGKINPLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+ V GV+PLHTHP GSE+L VTQGT+ AGFISS  NT Y K LN GD+MV
Sbjct  84   GLGISAARLDMEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTPYTKTLNAGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G G A A V FSSPNPGLQIT FALF N+LP+ +V  VTFLD A +KK
Sbjct  144  FPQGLLHYQYNAGSGPAVALVAFSSPNPGLQITDFALFANNLPSAVVEKVTFLDDATVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>gb|AEQ39055.1| putative germin-like protein [Wolffia arrhiza]
Length=211

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GYPCKK  ++T +DFV+SGL  AGNTTNIIKAAVTPAF AQ+P VN
Sbjct  24   DFCVADLTAPLTPSGYPCKKEAALTVDDFVFSGLGKAGNTTNIIKAAVTPAFVAQYPAVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIPLH HP G+E+LVVT G I AGFISS  N+VY+K LNKGD MV
Sbjct  84   GLGISAARLDLAAGGVIPLHVHPNGNELLVVTSGRIVAGFISS-GNSVYYKTLNKGDAMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A+A VTFSS +PGLQIT+ ALF +  P+ +V+  TFL  A++++
Sbjct  143  FPQGLLHFQINGGGTPASAIVTFSSASPGLQITSIALFGSSFPSKLVSGTTFLSPAEVQR  202

Query  645  LKGVLGGTN  671
            LK VLGGTN
Sbjct  203  LKAVLGGTN  211



>ref|XP_004141699.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis sativus]
 ref|XP_004155922.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis sativus]
 gb|KGN45492.1| hypothetical protein Csa_7G450510 [Cucumis sativus]
Length=208

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGY CK ++ VT +DFV+SGL AAGN +++IKAAVTPAF  Q+PGVN
Sbjct  21   DFCVADLKGPQGPAGYSCKIASVVTADDFVFSGLRAAGNISSLIKAAVTPAFVEQYPGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIPLHTHPG SE+L+VTQG I AGFISS  N VY K L KGD+MV
Sbjct  81   GLGLSAARLDLAPGGVIPLHTHPGASELLLVTQGIIEAGFISS-ANAVYVKTLKKGDLMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A  F  FSSP+PGLQI  FALF NDL TD+V+  TFLD A IKK
Sbjct  140  FPQGLLHFQINAGGVTAVGFPVFSSPSPGLQILDFALFANDLSTDLVSKTTFLDPALIKK  199

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  200  LKSVLGGS  207



>ref|XP_009120792.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY22866.1| BnaA06g02110D [Brassica napus]
 emb|CDY16549.1| BnaC09g37240D [Brassica napus]
 emb|CDX92448.1| BnaA10g14870D [Brassica napus]
 emb|CDX85429.1| BnaA02g03840D [Brassica napus]
Length=211

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+NIIKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQNPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVTPAFAPAFAGLN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GL +S+ARLDLA  GVIPLHTHPG SE+LVV QGTI AGFISS  N VY K L++GD MV
Sbjct  84   GLDVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTISAGFISS-ANKVYLKTLSRGDSMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G A AFV F S +PGLQI  FALF NDLP+++V   TFL   ++KK
Sbjct  143  FPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>ref|XP_008462312.1| PREDICTED: auxin-binding protein ABP19a [Cucumis melo]
Length=210

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGY CK ++ VT +DFVY+GL AAGN +++IKAAVTPAF  Q+PGVN
Sbjct  23   DFCVADLKGPQGPAGYSCKIASVVTADDFVYTGLGAAGNISSLIKAAVTPAFVEQYPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIPLHTHPG SE+L+VTQG I AGFISS  N VY K L KGD+MV
Sbjct  83   GLGLSAARLDLAPGGVIPLHTHPGASELLLVTQGIIEAGFISS-ANAVYVKTLKKGDLMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A  F  FSSP+PGLQI  FALF NDL TD+V+  TFLD   IKK
Sbjct  142  FPQGLLHFQINAGGVTAVGFPVFSSPSPGLQILDFALFANDLSTDLVSKTTFLDPVLIKK  201

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  202  LKAVLGGS  209



>gb|AFY10819.1| germin-like protein [Camellia sinensis]
Length=231

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +  LP GPAGY CKK   VT +DFV++GL  A NT+NIIKAAVTPAFDAQFPGVN
Sbjct  23   DFCVADPKLPQGPAGYSCKKPAKVTVDDFVFTGLGMAANTSNIIKAAVTPAFDAQFPGVN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP+HTHPG SE+L+V QG I AGF+ S  N VY K+L KGDVMV
Sbjct  83   GLGLSIARLDLAPGGVIPMHTHPGASELLLVVQGFIVAGFVDS-SNAVYVKKLKKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G   A AF TF SPNPGLQI  FALF N+LP+ +V   TFLD A++KK
Sbjct  142  FPQGLLHFQVNGGGIPAIAFPTFGSPNPGLQILDFALFANNLPSPLVEKTTFLDDAEVKK  201

Query  645  LKG  653
            LKG
Sbjct  202  LKG  204



>gb|EYU45887.1| hypothetical protein MIMGU_mgv1a022096mg [Erythranthe guttata]
Length=210

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GY CK   +VT  DFV++G    GNTTNII AAV+PAFDAQFPG+N
Sbjct  23   DFCVADLTGPQTPSGYTCKPPANVTAEDFVFTGFRKGGNTTNIINAAVSPAFDAQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP+HTHPG SE+++V QG++  GF+SS  N VY K+L KGD+MV
Sbjct  83   GLGLSIARLDLAPGGVIPMHTHPGASEVILVVQGSLVTGFVSS-ANAVYVKKLLKGDIMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            +PQGLLHFQIN G   + AF +FSSPNPGLQIT FALF N+LP+ ++   TFLD AQ+KK
Sbjct  142  YPQGLLHFQINGGGKTSVAFASFSSPNPGLQITDFALFANNLPSMLIEKTTFLDDAQVKK  201

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  202  LKSVLGGT  209



>ref|NP_001140857.1| uncharacterized protein LOC100272933 precursor [Zea mays]
 gb|AAQ95582.1| germin-like protein [Zea mays]
 gb|ACF78801.1| unknown [Zea mays]
 gb|ACF84824.1| unknown [Zea mays]
 gb|ACF85121.1| unknown [Zea mays]
 gb|ACF85990.1| unknown [Zea mays]
 gb|AFW77165.1| germin-like protein [Zea mays]
Length=212

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK  +SVT NDF + GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLTCSDTPAGYPCK--SSVTANDFYFHGLAGQGKINPLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+ V GV+PLHTHP GSE+L VTQGT+ AGFISS  NTVY K L  GD+MV
Sbjct  84   GLGISAARLDIEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTVYTKTLYAGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G G A   V FSSPNPGLQIT FALF N+LP+ +V  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNAGTGAAVGLVAFSSPNPGLQITDFALFANNLPSAVVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>ref|XP_010428148.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPALN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V +G+I AGF+SS  NTVY + L  G VMV
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLEGSITAGFVSSSANTVYVQTLKPGQVMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G  +A AFVTFSS NPGLQI  FALF N+LPTD+V   TFLD   +KK
Sbjct  141  FPQGLLHFQINQGKAKAAAFVTFSSANPGLQILDFALFANNLPTDLVVGTTFLDPTTVKK  200

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  201  LKGVLGGT  208



>ref|XP_002439350.1| hypothetical protein SORBIDRAFT_09g004970 [Sorghum bicolor]
 gb|EES17780.1| hypothetical protein SORBIDRAFT_09g004970 [Sorghum bicolor]
Length=221

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK  +SVT NDF Y GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  35   DFCVADLTCSDTPAGYPCK--SSVTANDFYYHGLAGQGKINPLIKAAVTPAFVGQFPGVN  92

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+ V GV+PLHTHP GSE+L VTQGT+ AGFISS  NTVY K L  GDVMV
Sbjct  93   GLGISAARLDIEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTVYTKTLYAGDVMV  152

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G G A   V FSS NPGLQIT FALF N+LP+ +V  VTFLD AQ+KK
Sbjct  153  FPQGLLHYQYNAGTGPAVGLVAFSSSNPGLQITDFALFANNLPSAVVEKVTFLDDAQVKK  212

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  213  LKSVLGGS  220



>ref|XP_010064035.1| PREDICTED: auxin-binding protein ABP19a [Eucalyptus grandis]
 gb|KCW71333.1| hypothetical protein EUGRSUZ_F04417 [Eucalyptus grandis]
Length=208

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL  P  PAGY CK    VT  DFV+SGL  AGNTTNIIKAAVTPAF  QFPGVN
Sbjct  21   DFCVANLKGPDTPAGYTCKSPAKVTVKDFVFSGLGVAGNTTNIIKAAVTPAFVGQFPGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GV+PLHTHPG SE+L V  G I AGFISS  N VY   L +GD+MV
Sbjct  81   GLGISAARLDLAPAGVVPLHTHPGASELLFVVHGKILAGFISS-ANDVYLMTLKRGDIMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G  +A A V+FSS NPGLQI  FALF N+ P+ +V   TFLD AQ+KK
Sbjct  140  FPQGLLHFQINAGGSKAIAVVSFSSANPGLQILDFALFANNFPSPLVEKTTFLDDAQVKK  199

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  200  LKAVLGGT  207



>ref|XP_008228197.1| PREDICTED: auxin-binding protein ABP19a [Prunus mume]
Length=212

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGYPCK   +VT +DFV+SGLA  GNTTNII+AAVTPAF AQFPGVN
Sbjct  25   DFCVADLKGPDGPAGYPCKSPANVTVSDFVFSGLAKGGNTTNIIQAAVTPAFVAQFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDLA  GVIP HTHPG SEILVVT+G I AGF+SS  +TVY + L KGDVMV
Sbjct  85   GLGLSMARLDLAPGGVIPFHTHPGASEILVVTRGHITAGFVSS-ASTVYLETLKKGDVMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+    ++AFV+FSS +PGLQI  FALF N+LP+ +V   TFLD+AQIKK
Sbjct  144  FPQGLLHFQVNAAKIHSSAFVSFSSASPGLQILDFALFANNLPSALVGQTTFLDLAQIKK  203

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  204  LKGVLGGT  211



>ref|XP_010932415.1| PREDICTED: germin-like protein 8-14 [Elaeis guineensis]
Length=205

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    P+GY CK  +SVT NDFV+SGL   GNT+NIIKAAVTPAF AQFPGVN
Sbjct  17   DFCVADLTGRLTPSGYECKMESSVTTNDFVFSGLGVPGNTSNIIKAAVTPAFVAQFPGVN  76

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDL   GVIPLHTHP  SE LVVTQGTIC GFIS+  N VY K L  GD MV
Sbjct  77   GLGISAARLDLNPGGVIPLHTHPAASEFLVVTQGTICGGFIST-ANNVYLKTLKTGDSMV  135

Query  465  FPQGLLHFQINSGDG-EATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            FPQGLLHFQ+N G    A A V+FSSP+PGLQIT FALF N+LP+ +V  VTFLD A++K
Sbjct  136  FPQGLLHFQVNCGGSTTAVAIVSFSSPSPGLQITAFALFANNLPSALVEMVTFLDDAEVK  195

Query  642  KLKGVLGGT  668
            KLK +LGGT
Sbjct  196  KLKKLLGGT  204



>ref|XP_011036430.1| PREDICTED: auxin-binding protein ABP19a-like [Populus euphratica]
Length=210

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  ++VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  22   DFCVAKLKGAGTPAGYACRMPSNVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP+HTHPG SEIL V QG I AGFISS  NTVY K L KGDVMV
Sbjct  82   GLGLSIARLDLAPAGVIPMHTHPGASEILFVVQGKITAGFISSSANTVYVKTLKKGDVMV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQIN+    + A V+FS P+PGLQIT FA F NDL ++++   TFLD AQ+KK
Sbjct  142  FPRGLLHFQINAAGINSIAVVSFSDPDPGLQITDFAFFANDLSSELLEKSTFLDDAQVKK  201

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  202  LKKVLGGT  209



>ref|XP_006849665.1| hypothetical protein AMTR_s00024p00231430 [Amborella trichopoda]
 gb|ERN11246.1| hypothetical protein AMTR_s00024p00231430 [Amborella trichopoda]
Length=209

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CV +LSLPP P+G+PCK  + +T +DF ++GL  AGNT+NIIKAAVTPAF  QFP VN
Sbjct  22   DYCVADLSLPPTPSGFPCKSPSKLTSDDFYFTGLGVAGNTSNIIKAAVTPAFSPQFPAVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLD+   GVIPLHTHP G+E LV+ QGT+CAGF+ +  N V+ + L KGDVMV
Sbjct  82   GLGLSLARLDVLPGGVIPLHTHPAGNEALVMIQGTLCAGFVDT-ANNVFLQTLKKGDVMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQINSG   A AFVTFSSP PGLQIT+ ALF ++ P+ ++   TFL  A++K+
Sbjct  141  FPQGLLHFQINSGGIPALAFVTFSSPTPGLQITSIALFGSNFPSKLIEGTTFLSDAEVKR  200

Query  645  LKGVLGGT  668
            LKG+LGG+
Sbjct  201  LKGILGGS  208



>ref|XP_010537615.1| PREDICTED: germin-like protein subfamily 3 member 1 [Tarenaya 
hassleriana]
Length=208

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     P+GYPC +  +V   DFV++GL+  GNT++II AAVTPAF AQFPGVN
Sbjct  21   DFCVANLKHADTPSGYPCIRPINVKATDFVFTGLSTPGNTSSIINAAVTPAFVAQFPGVN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  GVIP+HTHPG SEIL V  G I AGF+SS  N VY + L  G VMV
Sbjct  81   GLGLSIARLDLAPKGVIPMHTHPGASEILYVLDGCITAGFVSS-SNAVYVQTLKAGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ N+G   A A V+FSSPNPGLQI  FALF N LPT++V   TFLD AQIKK
Sbjct  140  FPQGLLHFQTNAGASTAAAIVSFSSPNPGLQILDFALFANGLPTELVAATTFLDAAQIKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_010051414.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
Length=231

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+ +IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSGLIKAAVTTAFANQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+  LD+A  GVIPLHTHPGGSE++ V QG+I AGFISS  NTVY K LNKGD M+
Sbjct  83   GLGISLVHLDMAPGGVIPLHTHPGGSEVIFVIQGSISAGFISSSANTVYLKTLNKGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            FPQGLLHFQ+N+G   A AFV+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ+K
Sbjct  143  FPQGLLHFQLNAGKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVK  201



>ref|XP_004287630.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=211

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK   +VT +DFVYS L   GNT+N+IK  +T AF  QFPG+N
Sbjct  24   DFCVADYTAPQGPAGYSCKDPANVTVDDFVYSALGVPGNTSNMIKTGITTAFSPQFPGLN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+++AR DLAV GV+P+HTH G SEI+++ +GTI AGFISS +N VY K L KGD+MV
Sbjct  84   GLGVALARADLAVGGVVPMHTHHGASEIVLIIEGTITAGFISS-DNEVYVKTLKKGDIMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N GD  A  FV+FSS NPGLQI   ALF+NDLPTD++   TFLD A+IKK
Sbjct  143  FPQGLLHFQVNVGDTPALEFVSFSSDNPGLQILYTALFQNDLPTDLIARSTFLDTAEIKK  202

Query  645  LKGVLGGTN  671
            LK +LGGTN
Sbjct  203  LKALLGGTN  211



>gb|ABG76199.2| germin-like protein [Capsicum chinense]
Length=203

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  42   LIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            LI+FL    ILS  +A     DFCV +L  P  P GY CK  T+VT +DFV+SGL+AAGN
Sbjct  4    LIIFLLATLILSSNAAVQ---DFCVADLKAPESPCGYSCKSVTNVTVDDFVFSGLSAAGN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
            T +IIKAAVTPAF AQFPG+NGLGLS ARLDLA  GVIP HTHPG SE+L+VTQG+I AG
Sbjct  61   TASIIKAAVTPAFAAQFPGLNGLGLSAARLDLAPGGVIPFHTHPGASEVLLVTQGSITAG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            F+SS  N+V  K L KGD+M+FPQGLLHFQ++     +  FV FSS NPGLQIT FALF 
Sbjct  121  FVSS-ANSVLKKTLKKGDIMIFPQGLLHFQMSHAGYTSVGFVFFSSSNPGLQITDFALFA  179

Query  582  NDLPTDIVNTVTFLDVAQIKKLKG  653
            NDLPT +V   TFLD A IKKLKG
Sbjct  180  NDLPTKLVGATTFLDEATIKKLKG  203



>ref|XP_010090139.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB38936.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + S P GPAGY CK    VT + FVYSGL   GNTTN+IKAAVT AFD QFPGVN
Sbjct  24   DFCVADYSAPQGPAGYSCKNPAKVTVDSFVYSGLGITGNTTNLIKAAVTTAFDNQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+AR DLA  GVIP HTH G SEI++V +G++CA F+SS +N VY K L KGD+M+
Sbjct  84   GLGISLARADLAPGGVIPFHTHHGASEIIIVIEGSLCAAFVSS-DNKVYLKSLKKGDIMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+G   A  FV F+SPNPGLQ+  +ALF NDL T++V   +FLD A+IK+
Sbjct  143  FPQGLLHFQLNAGKSNALFFVAFNSPNPGLQLLDYALFGNDLATELVAAASFLDPAEIKR  202

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  203  LKAVLGGS  210



>gb|KCW81975.1| hypothetical protein EUGRSUZ_C033371, partial [Eucalyptus grandis]
Length=199

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+ +IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSGLIKAAVTTAFANQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+  LD+A  GVIPLHTHPGGSE++ V QG+I AGFISS  NTVY K LNKGD M+
Sbjct  83   GLGISLVHLDMAPGGVIPLHTHPGGSEVIFVIQGSISAGFISSSANTVYLKTLNKGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQ  635
            FPQGLLHFQ+N+G   A AFV+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ
Sbjct  143  FPQGLLHFQLNAGKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQ  199



>sp|L8BRS3.1|GLP1_MORAL RecName: Full=Germin-like protein; Short=Ma-Glp; Flags: Precursor 
[Morus alba]
 emb|CCH57381.3| auxin binding protein [Morus alba]
Length=209

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + S P GPAGY CK    VT ++FVYSGL   GNTTN+IKAAVT AFD QFPGVN
Sbjct  22   DFCVADYSAPQGPAGYSCKNPAKVTVDNFVYSGLGITGNTTNLIKAAVTTAFDNQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+AR DLA  GVIP HTHPG SEI++V +G++CA F+SS +N VY K L KGD M+
Sbjct  82   GLGISLARPDLAPGGVIPFHTHPGASEIIIVIEGSLCAAFVSS-DNKVYLKSLKKGDTMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP GLLHFQ+N+G   A  FV F+SPNPGLQ+  +ALF NDL T++V   +FLD A+IK+
Sbjct  141  FPSGLLHFQLNAGKNNALFFVAFNSPNPGLQLVDYALFGNDLATELVAAASFLDPAEIKR  200

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  201  LKAVLGGS  208



>ref|XP_010471285.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFPG+N
Sbjct  22   DFCVANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G I AGF+SS  N VY + L  G VMV
Sbjct  82   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANAVYVQTLKPGQVMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G  +A AFVTFSS NPGLQI  FALF N+LPTD+V   TFLD   +KK
Sbjct  141  FPQGLLHFQINQGKAKAAAFVTFSSANPGLQILDFALFANNLPTDLVVGTTFLDATTVKK  200

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  201  LKGVLGGT  208



>ref|NP_177405.1| germin-like protein subfamily 3 member 1 [Arabidopsis thaliana]
 sp|P94040.1|GL31_ARATH RecName: Full=Germin-like protein subfamily 3 member 1; Short=At-GERM1; 
Short=AtGER1; Short=AtGLP1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51848.1|AC010926_11 germin-like protein; 70589-71215 [Arabidopsis thaliana]
 gb|AAB51567.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51568.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51574.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51575.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51579.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51584.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51751.1| germin-like protein [Arabidopsis thaliana]
 gb|AAD05223.1| germin-like protein 1 [Arabidopsis thaliana]
 dbj|BAA77207.1| germin-like protein precursor [Arabidopsis thaliana]
 gb|AAM63161.1| germin-like protein [Arabidopsis thaliana]
 gb|AAN60267.1| unknown [Arabidopsis thaliana]
 gb|AEE35348.1| germin-like protein subfamily 3 member 1 [Arabidopsis thaliana]
Length=208

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G+I AGF+SS  N VY + L  G VMV
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYVQTLKPGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A+A VTF+S NPGLQI  FALF N LPT++V   TFLD   +KK
Sbjct  140  FPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_006659477.1| PREDICTED: germin-like protein 8-14-like [Oryza brachyantha]
Length=212

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 139/188 (74%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK    V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLTCSDTPAGYPCK--AGVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+AV GV+PLHTHP        TQG + AGFISS  NTVY + L  GD+MV
Sbjct  84   GLGISAARLDIAVGGVVPLHTHPAAXXXXXXTQGPVAAGFISSSSNTVYTRTLYAGDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G   A A V FS PNPGLQIT +ALF N+LP+ IV  VTFLD AQ+KK
Sbjct  144  FPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVKK  203

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  204  LKSVLGGS  211



>ref|XP_002888885.1| hypothetical protein ARALYDRAFT_476393 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65144.1| hypothetical protein ARALYDRAFT_476393 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score =   246 bits (629),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G+I AGF+SS  N VY + L  G VM+
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLYVLSGSITAGFVSS-ANAVYVQTLKPGQVMI  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A VTF+S NPGLQI  FALF N LPT++V   TFLD   +KK
Sbjct  140  FPQGLLHFQINAGKSSAAAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>gb|AAB51750.1| germin-like protein [Arabidopsis thaliana]
Length=204

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  17   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  76

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G+I AGF+SS  N VY + L  G VMV
Sbjct  77   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYVQTLKPGQVMV  135

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A+A VTF+S NPGLQI  FALF N LPT++V   TFLD   +KK
Sbjct  136  FPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVKK  195

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  196  LKGVLGGT  203



>ref|XP_010416015.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=208

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRQIHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V +G+I AGF+SS  N V+ + L  G VMV
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLEGSITAGFVSS-ANAVFVQTLKPGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A AFVTFSS +PGLQI  FALF N+LPTD+V   TFLD   +KK
Sbjct  140  FPQGLLHFQINQGKSSAAAFVTFSSASPGLQILDFALFANNLPTDLVVGTTFLDATTVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>dbj|BAH15357.1| germin like protein [Nicotiana tabacum]
Length=208

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK   +VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP HTHPG SE+L+V QG+I AGF+SS  N VY K L KGD+M+
Sbjct  81   GLGLSAARLDLAPGGVIPFHTHPGASEVLLVVQGSITAGFVSS-ANAVYLKTLKKGDLMI  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ++     +  FV  SS +PGLQIT FALF NDLPT +V   TFLD A IKK
Sbjct  140  FPQGLLHFQVSDAGYTSVGFVFSSSSSPGLQITDFALFANDLPTKLVEATTFLDEATIKK  199

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  200  LKGVLGGTN  208



>gb|AAL38307.1| germin-like protein [Arabidopsis thaliana]
 gb|AAM10138.1| germin-like protein [Arabidopsis thaliana]
Length=208

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G+I AGF+SS  N VY + L  G VMV
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYVQTLKPGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A+A VTF+S NPGLQI  FALF N LP ++V   TFLD   +KK
Sbjct  140  FPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPAELVVGTTFLDATTVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_010471286.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFPG+N
Sbjct  22   DFCVANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G I AGFISS  N VY + L  G VMV
Sbjct  82   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFISS-ANAVYVQTLKPGQVMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G  +A AFVTFSS NPGLQI   ALF N+LPTD++   TFLD   +KK
Sbjct  141  FPQGLLHFQINQGKAKAAAFVTFSSANPGLQILNSALFANNLPTDLIVGTTFLDATTVKK  200

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  201  LKGVLGGT  208



>ref|XP_006302822.1| hypothetical protein CARUB_v10020953mg [Capsella rubella]
 gb|EOA35720.1| hypothetical protein CARUB_v10020953mg [Capsella rubella]
Length=208

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGY C +   V  +DFV+SGL   GNTTNII AAVTP F  QFP +N
Sbjct  21   DFCVANLKRAETPAGYQCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPALN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G+I AGF+SS  N VY + L  G VMV
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFVSS-ANAVYLQTLKPGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G   A AFVTFSS NPGLQI  FALF N+LPTD+V   TFLD A +KK
Sbjct  140  FPQGLLHFQINQGKTPAAAFVTFSSANPGLQILDFALFANNLPTDLVVGTTFLDAATVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_004296080.1| PREDICTED: auxin-binding protein ABP19b-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 152/210 (72%), Gaps = 1/210 (0%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+++  +F L +  + +   DFCV + + P GPAGY CKK   VT +DFVYSGL   GNT
Sbjct  3    IIYVFCMFSLLVSFSYAAVQDFCVADYTAPSGPAGYSCKKDEMVTADDFVYSGLNTTGNT  62

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
             NI KAA TPA   QFPGVNGLG+SMAR+D+A  GVIPLH HPG +E+L V +GT+ AGF
Sbjct  63   VNIFKAANTPASADQFPGVNGLGISMARVDVAAGGVIPLHIHPGANEVLFVAEGTLDAGF  122

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGE-ATAFVTFSSPNPGLQITTFALFK  581
            ISS  NTVY K + KGD++VFP+GLLHFQ+N G+G    AF ++SS  PGLQI  FALFK
Sbjct  123  ISSDRNTVYVKTIKKGDIIVFPRGLLHFQVNVGNGTPVVAFASYSSARPGLQIVDFALFK  182

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            ++L T+++   TFLD  QIKKLK V GGTN
Sbjct  183  SNLSTELIKRSTFLDFLQIKKLKIVFGGTN  212



>ref|XP_007024622.1| Germin-like protein 1 [Theobroma cacao]
 gb|EOY27244.1| Germin-like protein 1 [Theobroma cacao]
Length=224

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  108  FCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNG  287
             CV NL     P+GY CKK+  VT +D++++GL   GNTTNIIKAAV+PAF AQFPG+NG
Sbjct  38   LCVANLKGAETPSGYACKKAAKVTADDYMFTGLGLEGNTTNIIKAAVSPAFVAQFPGLNG  97

Query  288  LGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMVF  467
            LG+S ARLDLAV G IP+HTHP  +E+L V  G I AGFIS   N+VY K L +GD+MVF
Sbjct  98   LGMSAARLDLAVGGAIPMHTHPAATELLCVVHGHITAGFISP-ANSVYLKTLKRGDIMVF  156

Query  468  PQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKKL  647
            P GLLHFQI+SG     A V+F+SPNPGLQI  FALF NDLP+ +V T TFLD AQ+KKL
Sbjct  157  PPGLLHFQISSGKRPGLAIVSFNSPNPGLQILDFALFANDLPSGLVETTTFLDDAQVKKL  216

Query  648  KGVLGGT  668
            KGVLGGT
Sbjct  217  KGVLGGT  223



>ref|XP_006390643.1| hypothetical protein EUTSA_v10019138mg [Eutrema salsugineum]
 gb|ESQ27929.1| hypothetical protein EUTSA_v10019138mg [Eutrema salsugineum]
Length=208

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVT  F AQFPG+N
Sbjct  21   DFCVANLKKAETPAGYPCIRPIHVKAKDFVFSGLGTPGNTTNIINAAVTAGFVAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHP  SE+L V +G+I AGF+SS  N+VY + L  G VMV
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPAASEVLFVLEGSITAGFVSS-ANSVYVQTLKPGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A VTF+S NPGLQI  FALF N+LPTD+V   TFLD A +KK
Sbjct  140  FPQGLLHFQINAGKSAAAAVVTFNSANPGLQILDFALFANNLPTDLVVGTTFLDPATVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_010086822.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB23832.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGY CK    VT +DFVYSGLAA GNTTNII AAVTPAF +QF  +N
Sbjct  24   DFCVADLTAPDTPAGYHCKDPKKVTADDFVYSGLAAPGNTTNIISAAVTPAFVSQFAALN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIPLHTHPG +EIL+VT G +  GFISS  N  Y K L KGD+ V
Sbjct  84   GLGLSAARLDLAPGGVIPLHTHPGANEILLVTHGRLTVGFISS-ANVPYVKSLKKGDIAV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N     A +FV F+SP PGLQ+  FALF NDL + +V   TFLD A +KK
Sbjct  143  FPQGLLHFQLNDHKTHAQSFVFFNSPYPGLQLLDFALFANDLASILVEKTTFLDEATVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>emb|CDY11164.1| BnaC06g24160D [Brassica napus]
Length=207

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 139/188 (74%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+S L   GNTTNII AAVTP F AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKVKDFVFS-LGTPGNTTNIISAAVTPGFSAQFPGLN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G I AGF+SS  N+VY + L  G VMV
Sbjct  80   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AFVTFSS +PGLQI  FALF N LPT++V+  TFLD A +KK
Sbjct  139  FPQGLLHFQINAGKSAAAAFVTFSSASPGLQILDFALFANSLPTELVSATTFLDPALVKK  198

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  199  LKGVLGGT  206



>ref|XP_010086820.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB23830.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGY CK    VT +DFVYSGLAA GNTTNII AAVTPAF +QF  +N
Sbjct  24   DFCVADLTAPDTPAGYHCKDPKKVTADDFVYSGLAAPGNTTNIISAAVTPAFVSQFAALN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIPLHTHPG +EIL+VT G +  GFISS  N  Y K L KGD+ V
Sbjct  84   GLGLSAARLDLAPGGVIPLHTHPGANEILLVTHGRLTVGFISS-ANVPYVKSLKKGDIAV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N     A +FV F+SP PGLQ+  FALF NDL + +V   TFLD A +KK
Sbjct  143  FPQGLLHFQLNDHKTHAQSFVFFNSPYPGLQLLDFALFANDLASILVEKTTFLDEATVKK  202

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  203  LKGVLGGTN  211



>emb|CAA63014.1| germin1 [Arabidopsis thaliana]
Length=208

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GL LS ARLDLA  GVIP+HTHPG SE+L V  G+I AGF+SS  N VY + L  G VMV
Sbjct  81   GLALSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYVQTLKPGQVMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A+A VTF+S N GLQI  FALF N LPT++V   TFLD   +KK
Sbjct  140  FPQGLLHFQINAGKSSASAVVTFNSANRGLQILDFALFANSLPTELVVGTTFLDATTVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>ref|XP_002521328.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
 gb|EEF40996.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
Length=207

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL  L I+    A+    DFCV  L     P+GY C+    VT +DFV+SGL  +GNT
Sbjct  4    ILFLVALLIVPSSHAA----DFCVAKLKGAGSPSGYACRNPALVTADDFVFSGLGTSGNT  59

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
            TNII AAVTPAF  QFPG+NGLGLS ARLDLA  GV+PLHTHP  SE L V  G I AGF
Sbjct  60   TNIISAAVTPAFVQQFPGLNGLGLSGARLDLAPGGVVPLHTHPAASEFLFVVDGKITAGF  119

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            ISS  NTVY K L KGDVMVFPQGLLHFQIN+G   + A VTF+SP PGLQI  FALF +
Sbjct  120  ISS-ANTVYTKTLKKGDVMVFPQGLLHFQINAGGIPSLAIVTFNSPEPGLQILDFALFAS  178

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            + PT +V   TFLD AQIKKLKGVLGGT
Sbjct  179  NFPTPLVEKTTFLDEAQIKKLKGVLGGT  206



>gb|KCW82145.1| hypothetical protein EUGRSUZ_C03536 [Eucalyptus grandis]
Length=195

 Score =   241 bits (614),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 143/188 (76%), Gaps = 16/188 (9%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTTAFANQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GVIPLHTHPGGSE+L+V QG+I AGFISS  NT             
Sbjct  83   GLGISLARLDLAPGGVIPLHTHPGGSEVLLVLQGSISAGFISSSANT-------------  129

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
               GLLHFQ+N+G G A A V+FSSP+PGLQI  FALF N+ P+++V   TFLD AQ+KK
Sbjct  130  ---GLLHFQLNAGKGPALAIVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVKK  186

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  187  LKGVLGGT  194



>ref|XP_004510467.1| PREDICTED: germin-like protein subfamily 3 member 1-like [Cicer 
arietinum]
Length=226

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV ++     PAGYPCK +T+VT +DF YSGL  AGNTTNII AAVTPAF AQFP +N
Sbjct  39   DFCVADIKASDTPAGYPCKAATTVTSDDFAYSGLIEAGNTTNIINAAVTPAFVAQFPALN  98

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDL   GVIPLHTHPG SE+L+V QG I AGF+SS  NTVY K L KG++MV
Sbjct  99   GLGLSAARLDLGPAGVIPLHTHPGASELLIVKQGHITAGFVSS-ANTVYIKTLKKGEIMV  157

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ  +G  +A AF  FSS +PGLQI  FALF ++  T ++   TFLD   +KK
Sbjct  158  FPQGLLHFQATAGKRDAVAFAIFSSASPGLQILDFALFASNFSTPLITKTTFLDPVLVKK  217

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  218  LKSVLGGS  225



>emb|CDX68260.1| BnaA07g23000D [Brassica napus]
Length=207

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+S L   GNTTNII AAVTP F  QFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKAKDFVFS-LGIPGNTTNIISAAVTPGFAGQFPGLN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDLA  GVIP+HTHPG SE+L V  G I AGF+SS  N+VY + L  G VMV
Sbjct  80   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AFVTFSS +PGLQI  FALF N LPT++V+  TFLD A +KK
Sbjct  139  FPQGLLHFQINAGKSPAAAFVTFSSASPGLQILDFALFANSLPTELVSATTFLDPALVKK  198

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  199  LKGVLGGT  206



>gb|KFK41682.1| hypothetical protein AALP_AA2G159300 [Arabis alpina]
Length=208

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGY C +   V   DFV+SGL  AGNTTNII AAVTP F  Q+P +N
Sbjct  21   DFCVANLKRGETPAGYQCIRPIHVKSKDFVFSGLGTAGNTTNIINAAVTPGFVGQYPALN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIP+HTHPG SE+L V  G+I AGFISS  N VY + L  G VM+
Sbjct  81   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFISS-ANAVYVETLKPGQVMI  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   ++AFV+F+S NPGLQI  FALF N+LPT++V   TFLD A +KK
Sbjct  140  FPQGLLHFQINAGKSSSSAFVSFNSANPGLQILDFALFANNLPTELVVGTTFLDAATVKK  199

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  200  LKGVLGGT  207



>gb|KCW82126.1| hypothetical protein EUGRSUZ_C03507 [Eucalyptus grandis]
Length=193

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 141/188 (75%), Gaps = 18/188 (10%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV++GL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFAGLGMAGNTSNLIKAAVTTAFVNQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+A  GVIPLHTHPGGSE+L V QG+I AGFISS  NTVY K LNKGD M+
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLFVLQGSISAGFISSSANTVYLKTLNKGDSMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG+                  SSP+PGLQI  FALF N+ P+++V   TFLD AQ+KK
Sbjct  143  FPQGI------------------SSPSPGLQILDFALFANNFPSELVEATTFLDDAQVKK  184

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  185  LKGVLGGT  192



>ref|XP_009104850.1| PREDICTED: germin-like protein 1 [Brassica rapa]
Length=207

 Score =   238 bits (608),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+S L   GNTTNII AAVTP F  QFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKAKDFVFS-LGIPGNTTNIISAAVTPGFAGQFPGLN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARL+LA  GVIP+HTHPG SE+L V  G I AGF+SS  N+VY + L  G VMV
Sbjct  80   GLGLSTARLELAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AFVTFSS +PGLQI  FALF N LPT++V+  TFLD A +KK
Sbjct  139  FPQGLLHFQINAGKSPAAAFVTFSSASPGLQILDFALFANSLPTELVSATTFLDPALVKK  198

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  199  LKGVLGGT  206



>gb|AFK42476.1| unknown [Lotus japonicus]
Length=209

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L    GPAGYPCK   +VT +DFV++GL+A GN TNII AAVTPAF  QFPGVN
Sbjct  22   DFCVADLKGSDGPAGYPCKTPATVTSDDFVFAGLSAPGNITNIIGAAVTPAFVGQFPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLD+   GVIPLHTHPG +E+L+VTQG I AGFISS  +TVY K L KG++MV
Sbjct  82   GLGLSAARLDIGPGGVIPLHTHPGANELLIVTQGHITAGFISS-ASTVYIKTLKKGELMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+ +G  +A  F  FSS +PGLQI  FALF ++  T ++   TFLD A +KK
Sbjct  141  FPQGLLHFQVAAGKTKAIGFAIFSSASPGLQILDFALFASNFSTPLITKTTFLDPALVKK  200

Query  645  LKGVLGGTN  671
            LKGVLGG+ 
Sbjct  201  LKGVLGGSG  209



>ref|XP_011078075.1| PREDICTED: auxin-binding protein ABP20-like [Sesamum indicum]
Length=212

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKKS SVT NDF Y GL   G+T N + A    AFDAQFPGVN
Sbjct  24   DFCVADLSLPAGPAGYPCKKSASVTVNDFFYHGLTTPGSTKNRVGAGFAAAFDAQFPGVN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S++RLDL V G++P+H+HP  +E+++V +GT+  GFISS++N VY K LNK D+MV
Sbjct  84   GLGISISRLDLEVGGLVPIHSHPAAAELVLVAEGTLTFGFISSYDNKVYIKTLNKWDIMV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQGLLHF IN+G+    AF +FSS NPG+Q T  ALFKND PT++V   TFLDV Q+KK
Sbjct  144  APQGLLHFAINAGNTTVLAFASFSSQNPGIQTTPLALFKNDFPTNLVAKTTFLDVEQVKK  203

Query  645  LKGVLGGT  668
            LK +LGGT
Sbjct  204  LKALLGGT  211



>ref|XP_002274625.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=208

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGY CK    VT +DFVYSGL  AGNT+N IKA++  AF  +FPG+N
Sbjct  21   DFCVADLKAPQGPAGYSCKTPAKVTVDDFVYSGLGVAGNTSNFIKASINTAFADKFPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMAR+DLA  G IP+H+HPG SE L+V +G++ A F+SS +NTVY K L +GD+MV
Sbjct  81   GLGLSMARVDLAPGGAIPMHSHPGASETLLVAKGSVIAAFVSS-DNTVYSKTLKEGDIMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHF++N+G   A  +V+FSS NPGLQI ++ALF++ LP++++   TFLD  ++K+
Sbjct  140  FPQGLLHFEVNTGRTPALIWVSFSSSNPGLQILSYALFRSSLPSELIEKTTFLDDDEVKR  199

Query  645  LKGVLGGT  668
            LK +LGG+
Sbjct  200  LKALLGGS  207



>gb|ABK25578.1| unknown [Picea sitchensis]
Length=213

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    P+GYPCK ++S+T + FV++GL AAGN +N I AAVTPAF AQFP VN
Sbjct  26   DFCVADLSSELTPSGYPCKAASSLTSDSFVFTGLEAAGNVSNNIGAAVTPAFSAQFPAVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA +GVIPLH HP G+EIL+V +G ICAGFISS  N VY K LN GDVMV
Sbjct  86   GLGVSIARLDLAPNGVIPLHIHPAGNEILLVLKGIICAGFISS-SNVVYSKTLNVGDVMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLH+QIN G   A AF +FSSP PGLQI   +LF ++LP+ ++   TFL  +++K+
Sbjct  145  FPKGLLHYQINVGKYNAIAFASFSSPLPGLQIVPLSLFASNLPSFVIEKTTFLSDSEVKR  204

Query  645  LKGVLGGT  668
            LK  LGG+
Sbjct  205  LKAFLGGS  212



>ref|XP_003627273.1| Germin-like protein [Medicago truncatula]
 gb|AET01749.1| auxin-binding protein ABP19a [Medicago truncatula]
 gb|AFK45666.1| unknown [Medicago truncatula]
Length=208

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 148/208 (71%), Gaps = 4/208 (2%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL +LF+    ++     DFCV ++     P+GYPCK +++VT +DF + GL A GN 
Sbjct  4    IIFLLSLFLSISNASVQ---DFCVADIKGSDTPSGYPCKPASTVTSDDFAFEGLIAPGNI  60

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
            TNII AAVTPAF AQFP VNGLGLS ARLDL   GVIPLHTHPG SE+LVVTQG I AGF
Sbjct  61   TNIINAAVTPAFVAQFPAVNGLGLSAARLDLGPAGVIPLHTHPGASELLVVTQGHITAGF  120

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            +SS  NTVY K L KG++MVFPQGLLHFQ  +G   A AF  FSS +PGLQI  FALF +
Sbjct  121  VSS-ANTVYIKTLKKGELMVFPQGLLHFQATAGKRNAVAFAVFSSASPGLQILDFALFAS  179

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            +  T ++   TFLD   +KKLK +LGG+
Sbjct  180  NFSTPLITKTTFLDPVLVKKLKSILGGS  207



>ref|XP_002273384.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=209

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK    VT +DFVYSGL+  GNT+ +  AA+  AF  +FPG+N
Sbjct  22   DFCVADLTAPQGPAGYSCKTPAEVTADDFVYSGLSVPGNTSTLFNAAINTAFVEKFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMAR D+A  GVIP+HTHPG SEI+++ +G++ AG ISS +NTVY K L +GD+MV
Sbjct  82   GLGVSMARADIAPGGVIPMHTHPGASEIILIAKGSVTAGLISS-DNTVYLKTLKEGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+G  +A  + +F SPNPGLQI + ALF N+LP++++   TFLD  ++K+
Sbjct  141  FPQGLLHFQVNTGRTQAHLWASFGSPNPGLQILSNALFSNNLPSELIEKTTFLDDDEVKR  200

Query  645  LKGVLGGT  668
            LK +LGG+
Sbjct  201  LKALLGGS  208



>emb|CAN67670.1| hypothetical protein VITISV_008896 [Vitis vinifera]
Length=209

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK    VT +DFVYSGL+  GNT+ +  AA+  AF  +FPG+N
Sbjct  22   DFCVADLTAPQGPAGYSCKTPAEVTADDFVYSGLSVPGNTSTLFNAAINTAFVXKFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMAR D+A  GVIP+HTHPG SEI+++ +G++ AG ISS +NTVY K L +GD+MV
Sbjct  82   GLGVSMARADIAPGGVIPMHTHPGASEIILIAKGSVTAGLISS-DNTVYLKTLKEGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+G  +A  + +F SPNPGLQI + ALF N+LP++++   TFLD  ++K+
Sbjct  141  FPQGLLHFQVNTGRTQAXLWXSFGSPNPGLQILSNALFSNNLPSELIEKTTFLDDDEVKR  200

Query  645  LKGVLGGT  668
            LK +LGG+
Sbjct  201  LKALLGGS  208



>gb|ACG69484.1| germin-like protein 8 [Glycine max]
 gb|KHN01406.1| Auxin-binding protein ABP19a [Glycine soja]
Length=209

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = +3

Query  48   MFLQTLFIl--sllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MFL  +F+L     ++ +   DFCV +L     PAGYPCK   +VT +DFVY+GLA A N
Sbjct  1    MFLHIVFLLFLLSSTSHATVQDFCVADLKGADTPAGYPCKPPANVTSDDFVYTGLAEAAN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
             TNII AAVTPAF AQFPG+NGL LS ARLDL   GVIPLHTHPG +E+L+V QG I AG
Sbjct  61   VTNIINAAVTPAFVAQFPGLNGLELSAARLDLGPSGVIPLHTHPGANELLIVLQGHILAG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  N VY K L KG++MVFPQGLLHFQI  G  +A AF  FSS NPGLQI  FALF 
Sbjct  121  FISS-GNIVYQKVLKKGELMVFPQGLLHFQIAVGKRKALAFPVFSSANPGLQILDFALFA  179

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            ++  T +V   TFLD   +KKLKGVLGG+
Sbjct  180  SNFSTPLVTQTTFLDPDLVKKLKGVLGGS  208



>gb|KDP40703.1| hypothetical protein JCGZ_24702 [Jatropha curcas]
Length=207

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     P+GY C+   +VT +DFV+ GLAAAGNTTNII AAVTPAF  QFPG+N
Sbjct  20   DFCVAKLRGAGNPSGYACRSPANVTADDFVFKGLAAAGNTTNIISAAVTPAFVQQFPGLN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GV+P+HTHP  +EIL V  G I AGFISS  NT Y   L  G+VMV
Sbjct  80   GLGISTARLDLAPGGVVPMHTHPAATEILYVVYGKITAGFISS-ANTPYVNTLKTGEVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A V+F+SP PGLQI  FALF N L + ++   TFLD AQ+KK
Sbjct  139  FPQGLLHFQINAGGKPALAIVSFNSPEPGLQILDFALFGNSLSSALIEKTTFLDDAQVKK  198

Query  645  LKGVLGGT  668
            LK VLGGT
Sbjct  199  LKSVLGGT  206



>ref|NP_001236394.1| uncharacterized protein LOC100500326 precursor [Glycine max]
 gb|ACU15366.1| unknown [Glycine max]
Length=207

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = +3

Query  48   MFLQTLFIl--sllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MFL  +F+L     ++ +   DFCV +L     PAGYPCK   +VT +DFVY+GLA A N
Sbjct  1    MFLHIVFLLFLLSSTSHATVQDFCVADLKGADTPAGYPCKPPANVTSDDFVYTGLAEAAN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
             TNII AAVTPAF AQFPG+NGL LS ARLDL   GVIPLHTHPG +E+L+V QG I AG
Sbjct  61   VTNIINAAVTPAFVAQFPGLNGLELSAARLDLGPSGVIPLHTHPGANELLIVLQGHILAG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  N VY K L KG++MVFPQGLLHFQI  G  +A AF  FSS NPGLQI  FALF 
Sbjct  121  FISS-GNIVYQKVLKKGELMVFPQGLLHFQIAVGKRKALAFPVFSSANPGLQILDFALFA  179

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGG  665
            ++  T +V   TFLD   +KKLKGVLGG
Sbjct  180  SNFSTPLVTQTTFLDPDLVKKLKGVLGG  207



>gb|ABK22930.1| unknown [Picea sitchensis]
Length=213

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    P+GYPCK ++S+  + FV++GL  AGN +N I AAVTPAF AQFP VN
Sbjct  26   DFCVADLSSELTPSGYPCKPASSLNSDSFVFTGLETAGNVSNNIGAAVTPAFSAQFPAVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+A +GVIPLH HPGG+EIL+V +G I AGFISS  N VY K LN GD+MV
Sbjct  86   GLGVSIARLDIAPNGVIPLHIHPGGNEILLVVKGVINAGFISS-SNVVYSKTLNVGDLMV  144

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+QIN+G+  A AF +FSSP PGLQI   +LF ++LP+ ++   TFL  +++K+
Sbjct  145  FPQGLLHYQINAGESTAIAFASFSSPIPGLQIVALSLFASNLPSAVIEKTTFLADSEVKR  204

Query  645  LKGVLGGT  668
            LK  LGG+
Sbjct  205  LKAFLGGS  212



>ref|XP_009105920.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 gb|AAX35339.1| oxalic acid oxidase [Brassica napus]
Length=207

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIP+HTHPG SE+L V  G+I AGFISS  N+VY + L  G VMV
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AFVTFSS +PGLQI  FALF N L T++V+  TFL  A +K 
Sbjct  139  FPQGLLHFQINAGKTPAAAFVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVKT  198

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  199  LKGVLGGT  206



>ref|XP_002274457.1| PREDICTED: germin-like protein [Vitis vinifera]
Length=209

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK    VT +DFVYSGL+  GNT+++  AA+  AF  +FPG+N
Sbjct  22   DFCVADLTAPQGPAGYSCKTPAEVTADDFVYSGLSQPGNTSSLFNAAINTAFVDKFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMAR DLA  GV+P+HTH G SE +++ +G+I AGFISS +NTVY K L +GD+MV
Sbjct  82   GLGLSMARADLAPGGVVPMHTHHGASETILIAKGSITAGFISS-DNTVYLKTLKEGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N+G  +A  +V+F S NPG+QI + ALF N+LP++++   TFLD  ++K+
Sbjct  141  FPQGLLHFQVNTGRTQAHFWVSFGSSNPGIQILSNALFSNNLPSELIEKTTFLDDDEVKR  200

Query  645  LKGVLGGT  668
            LK +LGG+
Sbjct  201  LKALLGGS  208



>gb|KCW81978.1| hypothetical protein EUGRSUZ_C03347 [Eucalyptus grandis]
Length=193

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 18/188 (10%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P  P   P ++                  N +N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSPPRAPRATPARR------------------NISNLIKAAVTTAFVNQFPGLN  64

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+A  GVIPLHTHPGGSE+L+V QG+ICAGFISS  NTVY K LNKGD M+
Sbjct  65   GLGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGSICAGFISSSANTVYLKTLNKGDSMI  124

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQ+N+G G A A V+FSSP+PGLQI  FALF N+ P+++V   TF D AQ+KK
Sbjct  125  FPRGLLHFQLNAGKGPALAVVSFSSPSPGLQILDFALFANNFPSELVEATTFPDDAQVKK  184

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  185  LKGVLGGT  192



>sp|P46271.1|GLP1_BRANA RecName: Full=Germin-like protein 1; Flags: Precursor [Brassica 
napus]
 gb|AAA86365.1| germin-like protein [Brassica napus]
Length=207

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIP+HTHPG SE+L V  G+I AGFISS  N+VY + L  G VMV
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A A VTFSS +PGLQI  FALF N L T++V+  TFL  A +K 
Sbjct  139  FPQGLLHFQINAGKTPAAALVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVKT  198

Query  645  LKGVLGGT  668
            LKGVLGGT
Sbjct  199  LKGVLGGT  206



>ref|XP_010666274.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=210

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGYPC+   ++T +DFV+SGL  AGNT+NI +  VT AFD  FP +N
Sbjct  24   DFCVADFNFPVGPAGYPCRNPANLTVDDFVFSGLGVAGNTSNIFRVGVTAAFDLTFPALN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLD+ V GV+P+H+H   SE+++V +GTI AGFISS +NT YFK LN+GD+M+
Sbjct  84   GLGLSMARLDIGVGGVVPIHSHR-VSEVIMVIEGTIIAGFISS-DNTAYFKTLNRGDIMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP  LLHFQ+N G+  A AFV+ +S NPG Q  T ++  NDLPTD+V  +T LD AQ+++
Sbjct  142  FPHTLLHFQVNVGETPALAFVSLNSANPGFQFFTTSIGANDLPTDVVQKITLLDAAQVQR  201

Query  645  LKGVLGGTN  671
            +K + GGTN
Sbjct  202  VKRIFGGTN  210



>ref|XP_003547722.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=209

 Score =   228 bits (582),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     P+GYPCK   +VT +DFVY+GLA A N TNII AAVTPAF AQFPG+N
Sbjct  22   DFCVADLKGADTPSGYPCKPPANVTSDDFVYTGLAEAANVTNIINAAVTPAFVAQFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GL LS ARLDL   GVIPLHTHPG +E+L+V QG I AGFISS  N VY K L KG++MV
Sbjct  82   GLDLSAARLDLGPGGVIPLHTHPGANELLIVLQGHILAGFISS-GNIVYQKVLKKGELMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQI  G  +A AF  FSS  PGLQI  FALF ++  T +V   TFLD A +KK
Sbjct  141  FPQGLLHFQIAVGKRKALAFPVFSSAFPGLQILDFALFASNFSTPLVTQTTFLDPAIVKK  200

Query  645  LKGVLGGT  668
            LKGVLGG+
Sbjct  201  LKGVLGGS  208



>ref|XP_007135442.1| hypothetical protein PHAVU_010G129900g [Phaseolus vulgaris]
 gb|ESW07436.1| hypothetical protein PHAVU_010G129900g [Phaseolus vulgaris]
Length=209

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = +3

Query  48   MFLQTLFIls--llsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MFLQ +F+LS  L ++ +   DFCV +L    GPAG+PC     VT +DFV++GL+ A N
Sbjct  1    MFLQIVFLLSFLLSTSHATVQDFCVADLKSADGPAGFPCVPPAKVTSDDFVFAGLSEAAN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAG  401
             TNII AAV+PAF  QFPGVNGL LS ARLDL   GVIPLHTHPG +E+L+V QG I AG
Sbjct  61   VTNIINAAVSPAFVGQFPGVNGLDLSAARLDLGPAGVIPLHTHPGANELLIVNQGHILAG  120

Query  402  FISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFK  581
            FISS  N VY K L +G++MVFPQGLLHFQI +   +A AF  FSS NPGLQI  FALF 
Sbjct  121  FISS-SNVVYQKVLKRGELMVFPQGLLHFQIAAHKRKAIAFAVFSSANPGLQILDFALFA  179

Query  582  NDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            ++  T ++   TFLD   +KKLK VLGG+
Sbjct  180  SNFSTPLIAQTTFLDPDLVKKLKSVLGGS  208



>gb|EMT30411.1| Germin-like protein 8-14 [Aegilops tauschii]
Length=252

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 141/228 (62%), Gaps = 42/228 (18%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK    V   DF Y GLAAAGNT+N+IKAAVTPAF  Q P  N
Sbjct  26   DFCVADLSCSDTPAGYPCK--AGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQLPRAN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A+ GV+PLHTHP  SE+L VT+GTI AGFISS  NTVY K L KGD+MV
Sbjct  84   GLGISAARLDIAMGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTVYTKTLYKGDIMV  143

Query  465  F----------------------------------------PQGLLHFQINSGDGEATAF  524
            F                                        P GLLH+Q N G   A A 
Sbjct  144  FPPGPAPLPVQRRQLAGVALVAFSGPNPGLADHRLRALRQQPAGLLHYQYNGGSSPAVAL  203

Query  525  VTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            V FS PNPGLQIT +ALF N+LP+ +V  VTFLD AQ+KKLK VLGG+
Sbjct  204  VAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKKLKSVLGGS  251



>gb|ACG30276.1| auxin-binding protein ABP20 precursor [Zea mays]
Length=197

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 133/188 (71%), Gaps = 17/188 (9%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L                 T +DF + GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADL-----------------TCSDFYFHGLAGQGKINPLIKAAVTPAFVGQFPGVN  68

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+ V GV+PLHTHP GSE+L VTQGT+ AGFISS  NTVY K L  GD+MV
Sbjct  69   GLGISAARLDIEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTVYTKTLYAGDIMV  128

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLH+Q N+G G A   V FSSPNPGLQIT FALF N+LP+ +V  VTFLD AQ+KK
Sbjct  129  FPQGLLHYQYNAGTGAAVGLVAFSSPNPGLQITDFALFANNLPSAVVEKVTFLDDAQVKK  188

Query  645  LKGVLGGT  668
            LK VLGG+
Sbjct  189  LKSVLGGS  196



>emb|CDX72929.1| BnaC06g33770D [Brassica napus]
Length=217

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 132/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIP+HTHPG SE+L V  G+I AGFISS  N+VY + L  G VMV
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AFVTFSS +PGLQI  FALF N L T++V+  TFLD   IK 
Sbjct  139  FPQGLLHFQINAGKSAAVAFVTFSSASPGLQILDFALFANSLSTELVSATTFLDPKVIKT  198

Query  645  LKG  653
            LKG
Sbjct  199  LKG  201



>ref|XP_009126460.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY45077.1| BnaA02g04990D [Brassica napus]
 emb|CDY27880.1| BnaA07g04700D [Brassica napus]
Length=212

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + S P GP+G+ CK    VT NDF +SGLA AGNT+N+IKAAVT AF   F GVN
Sbjct  25   DFCVADPSGPQGPSGFSCKNPDQVTANDFAFSGLAKAGNTSNMIKAAVTTAFAPAFSGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ RLDLA  GV+PLH H G SE+L+V +GTI  GFISS +N VY K L KG+V+V
Sbjct  85   GLGISVVRLDLAAGGVVPLHIHRGASEVLIVIEGTIRGGFISS-DNKVYLKTLQKGEVIV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHF +N+G G A AF    S NPG+Q+   ALF +DLP+++V   TFL   +I++
Sbjct  144  FPQGLLHFALNNGTGPALAFAALGSSNPGVQLVPSALFASDLPSELVEATTFLSREEIRR  203

Query  645  LKGVLGGTN  671
            LK V GG+N
Sbjct  204  LKRVFGGSN  212



>emb|CDX96421.1| BnaA07g30320D [Brassica napus]
Length=217

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 132/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  GVIP+HTHPG SE+L V  G+I AGFISS  N+VY + L  G VMV
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISS-ANSVYVQTLKPGQVMV  138

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN+G   A AFVTFSS +PGLQI  FALF N L T++V+  TFL  A +K 
Sbjct  139  FPQGLLHFQINAGKTPAAAFVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVKT  198

Query  645  LKG  653
            LKG
Sbjct  199  LKG  201



>ref|XP_010666275.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=210

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 137/189 (72%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY C+   ++T +DFV+SGL   GNT+NI  ++   A D  FP +N
Sbjct  24   DFCVADFNFPVGPAGYSCRNPANLTVDDFVFSGLGVPGNTSNIFNSSAFLAIDVTFPALN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDL V G IP+H+H   SE+++V +GTI AGFI S +NT Y+K LN+GD+M+
Sbjct  84   GLGLSMARLDLDVGGTIPVHSHRV-SEVIIVIEGTIIAGFIGS-DNTAYYKTLNRGDIMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ LLHFQ+N GD  A AFV  +S +PG Q TTFAL  NDLPTDI+  +T LD  Q++K
Sbjct  142  FPQTLLHFQVNIGDSPALAFVALNSASPGFQTTTFALAANDLPTDIIQKITLLDAGQVRK  201

Query  645  LKGVLGGTN  671
            LK + GGTN
Sbjct  202  LKTIFGGTN  210



>ref|XP_010666280.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   223 bits (569),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGYPC+   ++T +DFV+SG   AGNT+NI   AVT A D  FP +N
Sbjct  25   DFCVADFNYPVGPAGYPCRNPANLTVDDFVFSGFGVAGNTSNIFGVAVTSANDLTFPALN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SM+RLD+ V GV+P+H+H   SE+++V +G I AGFISS E+ VY+K LNKGD+M+
Sbjct  85   GLGISMSRLDIGVGGVVPIHSHRV-SELILVIEGKIIAGFISS-EDKVYYKTLNKGDIMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ LLHFQ+N G   A AFV+ +S +P  Q TT +LF NDLPT+++  +T LDV Q+KK
Sbjct  143  FPQSLLHFQVNVGKTPAVAFVSLNSASPNFQTTTTSLFANDLPTNVIEKITLLDVGQVKK  202

Query  645  LKGVLGGTN  671
            LK + GGTN
Sbjct  203  LKRIFGGTN  211



>ref|XP_003528524.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=208

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 141/211 (67%), Gaps = 6/211 (3%)
 Frame = +3

Query  33   KITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAA  212
            K+  I FL  L      ++ +   DFCV NL  P  P+GY CK   +VT NDFV SG  A
Sbjct  2    KMIYIFFLLALL---SSTSHASVNDFCVANLKGPDSPSGYQCKPPNTVTVNDFVLSGFVA  58

Query  213  AGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTI  392
             GNTTN   AA+TPAF  + PGVNGLG+S ARLDLA  G +P+H+HPG SEIL++ +G I
Sbjct  59   -GNTTNAFNAALTPAFVTELPGVNGLGISAARLDLAKGGSVPMHSHPGASEILIMVKGQI  117

Query  393  CAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFA  572
             AG ++     VY K L  GDVMVFPQGLLHFQ NSG G+ATAFV FSS NPG Q+    
Sbjct  118  TAGILT--PGAVYEKTLKPGDVMVFPQGLLHFQANSGKGKATAFVAFSSANPGAQLLDLL  175

Query  573  LFKNDLPTDIVNTVTFLDVAQIKKLKGVLGG  665
            LF N LP+D+V   TFLDVAQ+KKLK   GG
Sbjct  176  LFGNSLPSDLVAQTTFLDVAQVKKLKARFGG  206



>ref|XP_010666307.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGYPC+  +++T +DFV+SGL  AGNT NI  ++   A D  FP +N
Sbjct  24   DFCVADLSFPGGPAGYPCRNPSNLTVDDFVFSGLGVAGNTENIFNSSAFLAIDTTFPALN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDL V GVIP+H+H   SE+++V +GTI AGFI S +NT Y+K L KGD+M+
Sbjct  84   GLGLSMARLDLGVGGVIPIHSHR-VSEVILVIEGTIIAGFIGS-DNTPYYKTLKKGDIMI  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP  LLHFQ+N G   A AFV+ +S +PG Q TT AL  NDLPTD++  +T LD  Q++K
Sbjct  142  FPHTLLHFQVNIGKTPALAFVSLNSASPGFQTTTIALAANDLPTDVIQKITLLDATQVRK  201

Query  645  LKGVLGGTN  671
            LK + GGTN
Sbjct  202  LKTIFGGTN  210



>gb|KHN01407.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL  P  P+GY CK   +VT NDFV SG  A GNTTN   AA+TPAF  + PGVN
Sbjct  21   DFCVANLKGPDSPSGYQCKPPNTVTVNDFVLSGFVA-GNTTNAFNAALTPAFVTELPGVN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLDLA  G +P+H+HPG SEIL++ +G I AG ++     VY K L  GDVMV
Sbjct  80   GLGISAARLDLAKGGSVPMHSHPGASEILIMVKGQITAGILT--PGAVYEKTLKPGDVMV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ NSG G+ATAFV FSS NPG Q+    LF N LP+D+V   TFLDVAQ+KK
Sbjct  138  FPQGLLHFQANSGKGKATAFVAFSSANPGAQLLDLLLFGNSLPSDLVAQTTFLDVAQVKK  197

Query  645  LKGVLGG  665
            LK   GG
Sbjct  198  LKARFGG  204



>ref|XP_006595343.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=179

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +3

Query  150  YPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDG  329
            + CKK   VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF G+NGLG+S+A LDLA  G
Sbjct  9    HSCKKPAKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGLNGLGISVACLDLAAGG  68

Query  330  VIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDG  509
            VIPLHTHPG SE+LVV +G I AGFISS   T+   +L  GDVM FPQGLLHFQIN+G  
Sbjct  69   VIPLHTHPGASELLVVIEGRILAGFISS--ATLSTSKL-LGDVMAFPQGLLHFQINAGKS  125

Query  510  EATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
             A   V FSS NPGLQI  FALFK+  PT ++   TF+DVA +KKLKGVLGG+
Sbjct  126  SALTIVRFSSSNPGLQILDFALFKSSFPTPLIVQTTFIDVALVKKLKGVLGGS  178



>ref|XP_008786633.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=205

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GY CKK ++VT +DFV +GL   GN + + KAA   AF AQFPG+N
Sbjct  18   DFCVADLTGPETPSGYQCKKESAVTADDFVITGLGVPGNFSTMFKAAPKTAFVAQFPGLN  77

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S A +  A  G IP+H+HP G+E+LVVT+GT+ AGFISS  N  Y+K LNKGD MV
Sbjct  78   GLGISAAYVYYAPGGFIPVHSHPAGTELLVVTEGTLLAGFISS-ANNPYYKTLNKGDAMV  136

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G+  A   V FSSP+PG+Q+T+ ALF N+LP+ +V  VT+LD A++KK
Sbjct  137  FPQGLLHFQVNVGETTAVGVVGFSSPSPGIQVTSPALFSNNLPSAVVEKVTYLDDAEVKK  196

Query  645  LKGVLGGT  668
            LK +LGGT
Sbjct  197  LKKMLGGT  204



>ref|XP_009126458.1| PREDICTED: germin-like protein subfamily 3 member 3 [Brassica 
rapa]
 emb|CDY45079.1| BnaA02g04970D [Brassica napus]
Length=219

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 134/189 (71%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ + S P  P+GY CK    VT +DF +SGLA +GNT+N+IKAAV   F   F GVN
Sbjct  25   DFCIADPSGPQSPSGYSCKNPDQVTADDFAFSGLAKSGNTSNMIKAAVATGFAPAFAGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLDLA  GV+P+H H G SE+L+V +GTI AG ISS  N VY K L KG+V+V
Sbjct  85   GLGVSVARLDLAEGGVVPIHIHSGASEVLIVIEGTIRAGIISS-ANKVYLKTLQKGEVIV  143

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHF +N G G A AF  F S NPG+Q+   ALF +DLP ++V    FL   ++K+
Sbjct  144  FPQGLLHFALNGGTGPAMAFAAFGSSNPGVQLVPNALFASDLPAELVEATNFLSHEEVKR  203

Query  645  LKGVLGGTN  671
            LKGVLGGTN
Sbjct  204  LKGVLGGTN  212



>ref|XP_004288274.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFVYSGL  +GNT+NI K    PA   QFPG+N
Sbjct  24   DFCVADYTAPQGPAGYSCKDPAKVTVDDFVYSGLRVSGNTSNIHKFGFVPAVVTQFPGLN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT-ICAGFISSFENTVYFKQLNKGDVM  461
            GLG+S+AR DL V GVIP HTH G +E+L+V +G+ +  GF+ S  N VY K ++KGD M
Sbjct  84   GLGVSVARTDLGVGGVIPFHTHRGATEVLIVAEGSSVIGGFVDS-NNKVYMKTMSKGDCM  142

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            VFP+GLLHF +N GD  A  + + SS NPGL +    LFKNDLPTD+++  T LD +QI+
Sbjct  143  VFPRGLLHFAVNQGDTPALMYASLSSENPGLDVLETQLFKNDLPTDLIHKTTLLDKSQIR  202

Query  642  KLKGVLGGTN  671
            KLK +LGGTN
Sbjct  203  KLKRLLGGTN  212



>ref|XP_010666277.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 2/208 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTT  227
            MFL   F  S+ SA ++ +DFCV +L+ P GPAGYPCK   ++T +DFVYSGL  +GNT+
Sbjct  6    MFLFLSFFASISSAHTNIVDFCVADLNYPVGPAGYPCKNPANLTVDDFVYSGLGVSGNTS  65

Query  228  NIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFI  407
            N+    VT A D  FP +NGL +SM RLD+ V GV+P+H+H   SE+++V QG I AGFI
Sbjct  66   NVFGVGVTFAIDLTFPALNGLDISMTRLDIGVGGVVPMHSHR-VSELIIVIQGRIIAGFI  124

Query  408  SSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKND  587
            SS +  VY+K L KGD+M+FPQ LLHFQ+N G   A AFV+ +S  P  Q T+ +LF ND
Sbjct  125  SS-DTKVYYKTLKKGDIMIFPQSLLHFQVNVGKTPALAFVSLNSARPNFQTTSTSLFGND  183

Query  588  LPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
            LPT+++  +T LD  Q+KKLK + GGTN
Sbjct  184  LPTNLIEKLTLLDAEQVKKLKSIFGGTN  211



>ref|XP_004510469.1| PREDICTED: auxin-binding protein ABP19a-like [Cicer arietinum]
Length=211

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P GY CK  T++T +DFV+ G  A G+T N   AA+T AF   FPGVN
Sbjct  26   DFCVADLKAPETPTGYHCKPLTNITADDFVFHGFVA-GDTKNTFNAALTSAFVTDFPGVN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A  G IP+HTHPG +E+L++ +G I AGF+++  + VY K+L  GDVMV
Sbjct  85   GLGISAARLDIAEGGSIPMHTHPGATELLIMVKGEITAGFMTT--SAVYSKKLKVGDVMV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG+LHFQ+NSG GEATAF++FSS NPG Q+    LF N+L +D V   TFLDVAQ+KK
Sbjct  143  FPQGMLHFQVNSGKGEATAFLSFSSANPGAQLLDLLLFANNLSSDFVAQTTFLDVAQVKK  202

Query  645  LKGVLGG  665
            LK   GG
Sbjct  203  LKTRFGG  209



>ref|XP_010917183.1| PREDICTED: germin-like protein 8-14 [Elaeis guineensis]
Length=206

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GY CK  ++VT +DFV +GL   GN +++ KAA   AF  QFPG+N
Sbjct  19   DFCVADLTGPETPSGYHCKNESAVTADDFVMTGLGVPGNFSSMFKAAPKAAFVRQFPGIN  78

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S A +  A  G IPLHTHP GSE++VVTQGT+ AGFISS  N  Y+K LN GD MV
Sbjct  79   GLGISAAFVYYAPGGFIPLHTHPAGSELIVVTQGTLLAGFISS-ANNAYYKTLNTGDAMV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+N G+  A A V FSSP+PG+Q T+F+LF  +LP+ +V  VTFLD  ++KK
Sbjct  138  FPQGLLHFQVNVGETTAIAVVGFSSPSPGIQTTSFSLFAGNLPSALVEKVTFLDDDEVKK  197

Query  645  LKGVLGGT  668
            LK +LGGT
Sbjct  198  LKKMLGGT  205



>ref|XP_003627279.1| Germin-like protein [Medicago truncatula]
 gb|AET01755.1| germin family 3 protein [Medicago truncatula]
 gb|AFK44135.1| unknown [Medicago truncatula]
Length=209

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   ++T +DFV+ G  A GNT N   AA+T AF  +FPG+N
Sbjct  24   DFCVADLKAPDTPSGYQCKPLANITSDDFVFHGFVA-GNTNNSFNAALTSAFVTEFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A +G IP+HTHPG +E+L++ QG I AGF++    +VY K L  GD+MV
Sbjct  83   GLGISAARLDIAENGSIPMHTHPGATELLIIVQGEITAGFLT--PTSVYSKTLKPGDLMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG+LHFQIN+G G+ATAF+TFSS NPG Q+    LF N+LP+++V   TFLD+AQ++K
Sbjct  141  FPQGMLHFQINTGKGKATAFLTFSSANPGAQLLDLLLFSNNLPSELVAQTTFLDLAQVQK  200

Query  645  LKGVLGG  665
            LK   GG
Sbjct  201  LKARFGG  207



>ref|XP_007135441.1| hypothetical protein PHAVU_010G129800g [Phaseolus vulgaris]
 gb|ESW07435.1| hypothetical protein PHAVU_010G129800g [Phaseolus vulgaris]
Length=208

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL+ P GP+GY CK   +VT +DFV+SG  A GNT+ I  AA+TPAF +Q PGVN
Sbjct  23   DFCVANLNGPDGPSGYECKAPNTVTVDDFVFSGFVA-GNTSGIFNAAITPAFVSQLPGVN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS+ARLDLA  G +PLH+H   SEIL++ +G I AGFI+      Y K L  GD+MV
Sbjct  82   GLGLSVARLDLAKGGFVPLHSHTASSEILIMVKGEITAGFIT--PAAAYQKTLKPGDIMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG G+ATA++ FS+P+PG Q+    LF N+LP+ ++   T LD AQ+KK
Sbjct  140  FPQGLLHFQVNSGKGKATAYLAFSNPSPGAQLLDLLLFGNNLPSQLIAQTTLLDYAQVKK  199

Query  645  LKGVLGG  665
            LK   GG
Sbjct  200  LKARFGG  206



>ref|XP_004973626.1| PREDICTED: germin-like protein 8-14-like [Setaria italica]
Length=216

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 143/214 (67%), Gaps = 0/214 (0%)
 Frame = +3

Query  27   SKKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL  206
            +K + L++ +     L   S+ +   DFCV +L     PAGYPCK  T+VT +DF Y GL
Sbjct  2    AKAVVLLLVVTPFLSLLPFSSLALNQDFCVADLPRGDTPAGYPCKPQTAVTADDFYYRGL  61

Query  207  AAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQG  386
               G T N     ++ AF  +FPGVNGLG+S AR+D A  GV+PLH+HPGG+E+L V +G
Sbjct  62   GTTGPTINPFNIGLSSAFVTRFPGVNGLGISAARVDFAPGGVVPLHSHPGGTELLYVIEG  121

Query  387  TICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITT  566
             + AGFI+S  N VY K L KGD+MVFPQGLLHFQ N G+  A A  ++SS NPGL I  
Sbjct  122  AMAAGFITSLTNQVYTKTLYKGDLMVFPQGLLHFQYNLGNDTAVALSSYSSANPGLMILD  181

Query  567  FALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            FALF N+LP+DIV+ +T LD  ++KKLK + GG+
Sbjct  182  FALFANNLPSDIVSKLTVLDELEVKKLKALFGGS  215



>ref|XP_004510468.1| PREDICTED: germin-like protein 8-14-like [Cicer arietinum]
Length=206

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 139/188 (74%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GYPCK  +SVT +DFV++     GNT+N  K+++TPAF  QFP +N
Sbjct  22   DFCVADLTSPQTPSGYPCK--SSVTIDDFVFTNFKP-GNTSNPFKSSLTPAFVHQFPAIN  78

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDL V GV+P+H+H G SE++++ QG I AGFISS +N+V+ K L KGD++V
Sbjct  79   GLGLSAARLDLGVGGVVPMHSHRGASELMIMVQGFITAGFISS-DNSVFVKTLTKGDILV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQGLLHFQ N+G  +ATAF+T SS NPG Q+  FALF N L +  V   TFLD AQ+KK
Sbjct  138  IPQGLLHFQFNAGKNKATAFLTLSSSNPGAQLVDFALFGNSLNSAFVEKTTFLDHAQVKK  197

Query  645  LKGVLGGT  668
            LK V GG+
Sbjct  198  LKAVFGGS  205



>emb|CAN74028.1| hypothetical protein VITISV_013539 [Vitis vinifera]
Length=206

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +     G AGY CK    V + DFVYSGL  AGN ++I K+A+  AF  Q PG+N
Sbjct  20   DFCVADFKATQGLAGYQCKVPEVVVD-DFVYSGLNVAGNFSDIPKSAINIAFVDQLPGLN  78

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDL++  VIP+H+HPGGSE+L+VTQG+I AGFISS  N VY K L KGD+MV
Sbjct  79   GLGLSMARLDLSLGSVIPMHSHPGGSEVLLVTQGSIIAGFISS-NNIVYMKTLKKGDIMV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQ+NSG   A  + +FSS NPG Q+ + ALF N+LP+++   VTFLD  +++K
Sbjct  138  FPKGLLHFQVNSGPVPALLWSSFSSSNPGQQVLSNALFSNNLPSELTEKVTFLDELEVEK  197

Query  645  LKGVLGGT  668
            LK + GG+
Sbjct  198  LKALFGGS  205



>emb|CAI56441.1| germin-like protein [Cicer arietinum]
Length=185

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +3

Query  108  FCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNG  287
            FCV +L  P  P GY CK  T++T +DFV+ G  A G+T N   AA+T AF   FPGVNG
Sbjct  1    FCVADLKAPETPTGYHCKPLTNITADDFVFHGFVA-GDTKNTFNAALTSAFVTDFPGVNG  59

Query  288  LGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMVF  467
            LG+S ARLD+A  G IP+HTHPG +E+L++ +G I AGF+++  + VY K+L  GDVMVF
Sbjct  60   LGISAARLDIAEGGSIPMHTHPGATELLIMVKGEITAGFMTT--SAVYSKKLKVGDVMVF  117

Query  468  PQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKKL  647
            PQG+LHFQ+NSG GEATAF++FSS NPG Q+    LF N+L +D V   TFLDVAQ+KKL
Sbjct  118  PQGMLHFQVNSGKGEATAFLSFSSANPGAQLLDLLLFANNLSSDFVAQTTFLDVAQVKKL  177

Query  648  KGVLGG  665
            K   GG
Sbjct  178  KTRFGG  183



>ref|XP_003627277.1| Germin-like protein [Medicago truncatula]
 gb|AET01753.1| germin family 3 protein [Medicago truncatula]
Length=209

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   ++T +DFV+ G  A GNT N   AA+T AF   FPG+N
Sbjct  24   DFCVADLKAPDTPSGYHCKPLANITSDDFVFHGFKA-GNTNNSFNAALTSAFVTDFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A +G IP+HTHPG +E+L++ QG I AGF++     VY K L  GD+MV
Sbjct  83   GLGISAARLDIAENGSIPMHTHPGATELLIIVQGEITAGFLT--PTAVYSKTLKPGDLMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG+LHFQIN+G G+ATAF+TFSS NPG Q+    LF N+LP+ +V   TFLD+AQ++K
Sbjct  141  FPQGMLHFQINTGKGKATAFLTFSSANPGAQLLDLLLFSNNLPSQLVAQTTFLDLAQVQK  200

Query  645  LKGVLGG  665
            LK   GG
Sbjct  201  LKARFGG  207



>ref|XP_003627275.1| Germin-like protein [Medicago truncatula]
 gb|AET01751.1| auxin-binding protein ABP19a [Medicago truncatula]
 gb|AFK41104.1| unknown [Medicago truncatula]
Length=207

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 148/211 (70%), Gaps = 5/211 (2%)
 Frame = +3

Query  36   ITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAA  215
            +  I+FL TL   S  + ++  LDFCV +LS    P+GYPCKKS  VT NDFVYS   + 
Sbjct  1    MIFIIFLLTLL--SHSTTNASVLDFCVADLSSSQTPSGYPCKKS--VTINDFVYSNFNSG  56

Query  216  GNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTIC  395
              +TN  K ++TPAF  QFP VNGLGLS A+LDL V G+IP+H+H G SE+++V QG I 
Sbjct  57   NTSTNFFKFSITPAFVNQFPAVNGLGLSAAKLDLDVGGIIPMHSHRGASELMIVVQGRIT  116

Query  396  AGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFAL  575
            AGFISS +NTV+ K L+KG ++V PQGLLHFQ N+G  +A+A++TFSS NPG Q+   AL
Sbjct  117  AGFISS-DNTVFIKTLSKGQILVLPQGLLHFQYNAGRNKASAYLTFSSENPGSQVLDLAL  175

Query  576  FKNDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            F N+L +  +   T LD AQ+KKLK + GG+
Sbjct  176  FGNNLSSANLIKSTLLDPAQVKKLKAIFGGS  206



>ref|NP_001240182.1| auxin-binding protein ABP19a-like precursor [Glycine max]
 gb|ACG69485.1| germin-like protein 9 [Glycine max]
 gb|KHN01408.1| Auxin-binding protein ABP19a [Glycine soja]
Length=208

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = +3

Query  36   ITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAA  215
            + +I FL  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG  A 
Sbjct  1    MKMIHFL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-  58

Query  216  GNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTIC  395
            GNTTN   AA+T AF   FPGVNGLG+S ARLD+A  G IP+HTHP  +E+L++ +G I 
Sbjct  59   GNTTNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQIT  118

Query  396  AGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFAL  575
            AGF++     +Y K L  GD+MVFPQG LHFQ+NSG+G+ATAF+ FSS NPG Q+    L
Sbjct  119  AGFMT--PTALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLL  176

Query  576  FKNDLPTDIVNTVTFLDVAQIKKLKGVLGG  665
            F N LP+D+V   TFLDVAQ+KKLK   GG
Sbjct  177  FGNTLPSDLVAQTTFLDVAQVKKLKARFGG  206



>ref|NP_001236898.1| uncharacterized protein LOC100527498 precursor [Glycine max]
 gb|ACU16594.1| unknown [Glycine max]
Length=208

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = +3

Query  36   ITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAA  215
            + +I FL  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG  A 
Sbjct  1    MKMIHFL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-  58

Query  216  GNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTIC  395
            GNTTN   AA+T AF   FPGVNGLG+S ARLD+A  G IP+HTHP  +E+L++ +G I 
Sbjct  59   GNTTNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQIT  118

Query  396  AGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFAL  575
            AGF++     +Y K L  GD+MVFPQG LHFQ+NSG+G+ATAF+ FSS NPG Q+    L
Sbjct  119  AGFMT--PTALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLL  176

Query  576  FKNDLPTDIVNTVTFLDVAQIKKLKGVLGG  665
            F N LP+D+V   TFLDVAQ+KKLK   GG
Sbjct  177  FGNTLPSDLVAQTTFLDVAQVKKLKARFGG  206



>ref|XP_010495333.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=182

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            K I  + F+ +LF      A +   DFCV +   P  P+GY CK    V ENDFV+SGL 
Sbjct  2    KMIIHVFFIISLF---SSIAFASVQDFCVADPKGPQSPSGYSCKNPDQVNENDFVFSGLG  58

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGT  389
             AGNT+NIIKAAVTPAF   F G+NGLG+SMARLDLA  GVIPLHTHPG SE+LVV QGT
Sbjct  59   KAGNTSNIIKAAVTPAFAPAFAGINGLGISMARLDLAGGGVIPLHTHPGASEVLVVIQGT  118

Query  390  ICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNP  548
            ICAGFISS  N VY K LN+GD MVFPQGLLHFQ+NSG G A AFV F SP+P
Sbjct  119  ICAGFISS-ANKVYLKTLNRGDTMVFPQGLLHFQLNSGKGPALAFVAFGSPSP  170



>ref|XP_003528531.2| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=225

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 146/213 (69%), Gaps = 4/213 (2%)
 Frame = +3

Query  27   SKKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL  206
            S K+ +I  L  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG 
Sbjct  15   SSKMKMIHVL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGF  73

Query  207  AAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQG  386
             A GNTTN   AA+T AF   FPGVNGLG+S+ARLD+A  G IP+HTHP  +E+L++ +G
Sbjct  74   VA-GNTTNTFNAALTSAFVTDFPGVNGLGVSVARLDIAKGGSIPMHTHPAATELLIMVEG  132

Query  387  TICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITT  566
             I AGF++     +Y K L  GD+MVFPQG LHFQ+NSG+G+ATAF+ FSS NPG Q+  
Sbjct  133  QITAGFMT--PTALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLD  190

Query  567  FALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGG  665
              LF N LP+D+V   TFLDVAQ+KK+K   GG
Sbjct  191  LLLFGNTLPSDLVAQTTFLDVAQVKKVKARFGG  223



>gb|KHN01412.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   +VT +DFV+SG  A GNTTN   AA+T AF   FPGVN
Sbjct  21   DFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-GNTTNTFNAALTSAFVTDFPGVN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A  G IP+HTHP  +E+L++ +G I AGF++     +Y K L  GD+MV
Sbjct  80   GLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQITAGFMT--PTALYTKTLKPGDIMV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG LHFQ+NSG+G+ATAF+ FSS NPG Q+    LF N LP+D+V   TFLDVAQ+KK
Sbjct  138  FPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLLFGNTLPSDLVAQTTFLDVAQVKK  197

Query  645  LKGVLGG  665
            LK   GG
Sbjct  198  LKARFGG  204



>gb|ADD71875.1| germin-like protein subfamily 3 member 3 precursor [Arachis hypogaea]
Length=220

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 140/209 (67%), Gaps = 3/209 (1%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            ++FL +L       + +   DFCV +L  P  P+GY CK  ++VT +DFVYSGL A G+T
Sbjct  8    VLFLFSLLSTIPHYSYASVNDFCVADLKGPDSPSGYNCKPVSAVTADDFVYSGLVA-GDT  66

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
             N  KAA+T AF   FP VNGLG+S ARLD+A  G IP+HTHPG +E+L++ +G I AGF
Sbjct  67   NNTFKAALTSAFVTDFPAVNGLGVSAARLDIAKGGSIPMHTHPGATELLIMVEGEITAGF  126

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            ++ F   +Y K L  GDV VFPQG LHFQ+NSG  +ATAF+ FSS NPG Q+    LF N
Sbjct  127  MTPF--ALYSKTLKPGDVFVFPQGQLHFQVNSGKKKATAFLAFSSANPGAQLLDLLLFGN  184

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
             L +DIV   TFLD+ Q+KKLK   GG N
Sbjct  185  ALSSDIVAQTTFLDIDQVKKLKARFGGKN  213



>ref|XP_010688043.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 135/189 (71%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            ++CVG+LSLP GPAGY CK    VT +DFVYSGL  A NTTN+ K     AF AQFPG+N
Sbjct  23   NYCVGDLSLPSGPAGYSCKDPAKVTVDDFVYSGLRVAANTTNLFKFGGNNAFTAQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            G+GLS+ R+D+ V G  P+HTH    E+  + +GTI AGFI SF NT ++K LNKGD+M+
Sbjct  83   GMGLSIVRVDMDVGGYFPIHTH-RVPELFTLIEGTIVAGFIDSF-NTPFYKTLNKGDIMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP  L+HF IN G     A+ TFSS NPG+Q+   ALF+N++P+D+V  +T LD AQ+KK
Sbjct  141  FPPSLIHFAINVGSTPVLAYATFSSENPGVQLIDTALFRNNMPSDLVQKITLLDPAQVKK  200

Query  645  LKGVLGGTN  671
            LK + GGTN
Sbjct  201  LKNLFGGTN  209



>gb|ABS86850.1| oxalate oxidase [Arachis hypogaea]
Length=220

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 140/209 (67%), Gaps = 3/209 (1%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            ++FL +L       + +   DFCV +L  P  P+GY CK  ++VT +DFVYSGL A G+T
Sbjct  8    VLFLFSLLSTIPHYSYASVNDFCVADLKGPDSPSGYNCKPVSAVTADDFVYSGLVA-GDT  66

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
             N  KAA+T AF   FP VNGLG+S ARLD+A  G IP+HTHPG +E+L++ +G I AGF
Sbjct  67   NNTFKAALTSAFVTDFPAVNGLGVSAARLDIAKGGSIPMHTHPGATELLIMVEGEITAGF  126

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            ++ F   +Y K L  GDV VFPQG LHFQ+NSG  +ATAF+ FSS NPG Q+    LF N
Sbjct  127  MTPF--ALYSKTLKPGDVFVFPQGQLHFQVNSGKKKATAFLAFSSANPGAQLLDLLLFGN  184

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGGTN  671
             L +DIV   TFLD+ Q+KKLK   GG N
Sbjct  185  ALSSDIVAQTTFLDIDQVKKLKARFGGKN  213



>ref|XP_003627280.1| Germin-like protein [Medicago truncatula]
 gb|AET01756.1| germin family 3 protein [Medicago truncatula]
 gb|AFK34826.1| unknown [Medicago truncatula]
Length=209

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 5/211 (2%)
 Frame = +3

Query  33   KITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAA  212
            KIT I+FL TL   S  ++ +   DFCVG++  P  P GY C    ++T +DFV+ G  A
Sbjct  2    KITPILFLFTLL--SSTTSYASVHDFCVGDIKAPETPTGYHCMPLANITSDDFVFHGFVA  59

Query  213  AGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTI  392
             GNT N   AA+T AF   FP +N LG+S ARLD+A  G IP+HTHPG +E+L++  G I
Sbjct  60   -GNTNNSFNAALTSAFVTDFPALNDLGISAARLDIAKGGSIPMHTHPGATELLIMVHGEI  118

Query  393  CAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFA  572
             AGF+++    VY K L  GD+MVFPQG+LHFQ+NSG G+ATAF+TFSS NPG Q+    
Sbjct  119  TAGFLTT--TAVYSKTLKPGDLMVFPQGMLHFQVNSGKGKATAFLTFSSANPGAQLLDLL  176

Query  573  LFKNDLPTDIVNTVTFLDVAQIKKLKGVLGG  665
            LF N+LP+++V   TFLD+AQ+KKLK   GG
Sbjct  177  LFSNNLPSELVAQTTFLDLAQVKKLKARFGG  207



>gb|KHN01409.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   +VT +DFV+SG  A GNTTN   AA+T AF   FPGVN
Sbjct  21   DFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-GNTTNTFNAALTSAFVTDFPGVN  79

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S ARLD+A  G IP+HTHP  +E+L++ +G I AGF++     +Y K L  GD+MV
Sbjct  80   GLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQITAGFMT--PTALYTKTLKPGDIMV  137

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQG LHFQ+NSG+G+ATAF+ FSS NPG Q+    LF N LP+D+V   TFLDVAQ+KK
Sbjct  138  FPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLLFGNTLPSDLVAQTTFLDVAQVKK  197

Query  645  LKGVLGG  665
            +K   GG
Sbjct  198  VKARFGG  204



>ref|XP_007135440.1| hypothetical protein PHAVU_010G129700g [Phaseolus vulgaris]
 emb|CAB77393.1| germin-like protein [Phaseolus vulgaris]
 gb|ESW07434.1| hypothetical protein PHAVU_010G129700g [Phaseolus vulgaris]
Length=206

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            ++++  LF L   ++++   DFCV +L  P  P+GY CK +  VT +DFV+SGL A GNT
Sbjct  1    MIYILFLFSLLAFTSNAAVNDFCVADLKGPDSPSGYQCKPTKEVTVDDFVFSGLVA-GNT  59

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGF  404
            TN   AA+T AF   FPGVNGLG+S ARLD+A  G IP+HTHP  +E+L++ +G I AGF
Sbjct  60   TNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGKITAGF  119

Query  405  ISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKN  584
            ++ F   VY K L  GD+MVFPQG LHFQ+NSG G+ATAF+ FSS NPG Q+    LF N
Sbjct  120  MTPF--AVYTKTLKPGDIMVFPQGQLHFQVNSGKGKATAFLAFSSANPGAQLLDLLLFGN  177

Query  585  DLPTDIVNTVTFLDVAQIKKLKGVLGG  665
             +P++++   TFLDV Q+KK+K   GG
Sbjct  178  SIPSELIAQTTFLDVDQVKKVKRRFGG  204



>ref|XP_010687709.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
 gb|AAO92348.1| germin-like protein Kiel 1 [Beta vulgaris]
Length=211

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 133/189 (70%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CV +L+ P GPAGYPC+   ++T +DFVYSGL AAGN +    AA   A D  FP +N
Sbjct  25   DYCVADLTFPVGPAGYPCRNPATLTADDFVYSGLGAAGNFSTTFNAAAVLAVDTTFPALN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDL V GVIP+H+H   SE+++V +GTI AGFI +  NT + K LNKGD+M+
Sbjct  85   GLGLSMARLDLGVGGVIPIHSH-RASEVILVVEGTIVAGFIDT-NNTAFHKTLNKGDIMM  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP  LLHFQ+N G   A AFVT +S +PG Q T+ AL   DLPT ++  VT LD  ++++
Sbjct  143  FPPTLLHFQVNIGKSPALAFVTLNSASPGFQTTSIALGATDLPTHLIQKVTLLDAREVRR  202

Query  645  LKGVLGGTN  671
            LK + GG+N
Sbjct  203  LKNIFGGSN  211



>gb|AFK35921.1| unknown [Lotus japonicus]
 gb|AFK41304.1| unknown [Lotus japonicus]
Length=211

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 136/187 (73%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGY CKK   +T NDFV+S   A GNT+N + AA+ PAF  QFPG+N
Sbjct  26   DFCVADLSRSVSPAGYACKKP-PLTVNDFVFSNFKA-GNTSNFLNAALNPAFVDQFPGIN  83

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLS ARLDL   GV+P+H+HPG SE++++ QG I  GFIS+ +NTVY K L KGD++V
Sbjct  84   GLGLSAARLDLDAGGVVPIHSHPGASELVIILQGRITVGFIST-DNTVYQKTLMKGDIIV  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQGLLHFQ+N+G   A+A +TFSS NP  Q+   ALF N+L + +V   TFLD+AQ+KK
Sbjct  143  IPQGLLHFQLNAGGNRASAVLTFSSTNPVAQLVDVALFGNNLDSGLVARTTFLDLAQVKK  202

Query  645  LKGVLGG  665
            LK V GG
Sbjct  203  LKAVFGG  209



>ref|XP_003632366.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=209

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GP GY C+    VT +DFVYSGL   GNT++I  A+V  AF  +FP +N
Sbjct  22   DFCVADFTAPQGPTGYSCRTPAEVTADDFVYSGLRQPGNTSSIFNASVNSAFVHKFPVLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+AR D+A  GV PLHTHPG +EI++V +G + AG ISS +NTVY K + +GD+MV
Sbjct  82   GLGVSLARADVAPGGVFPLHTHPGATEIILVARGAVTAGLISS-DNTVYVKTVEEGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHF +N+G  EA  +V+FSSP+PGLQ+   ALF N+L +D++  +T L   ++++
Sbjct  141  FPQGLLHFVVNNGGTEALIWVSFSSPSPGLQVLNTALFGNNLDSDLLEKITLLGDDEVQR  200

Query  645  LKGVLGGT  668
            LKG+ GGT
Sbjct  201  LKGIFGGT  208



>ref|XP_002274739.1| PREDICTED: auxin-binding protein ABP19a [Vitis vinifera]
 emb|CBI35875.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +     G AGY CK    V  +D VYSGL  AGN ++I K+A+   F  Q PG+N
Sbjct  21   DFCVADFKATQGLAGYQCKVPEEVVVDDLVYSGLNVAGNFSDIPKSAINAVFVDQLPGLN  80

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSMARLDL++ GVIP+H+HPGGSE+L+VTQG+I AGFISS  N  Y K L KGD+MV
Sbjct  81   GLGLSMARLDLSLGGVIPMHSHPGGSEVLLVTQGSIIAGFISS-NNIAYMKTLKKGDIMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP+GLLHFQ+ SG   A  + +FSS NPG Q+ + ALF N+L ++++  VTFLD  +++K
Sbjct  140  FPKGLLHFQVKSGPVPALLWSSFSSSNPGQQVLSNALFSNNLASELIEKVTFLDELEVEK  199

Query  645  LKGVLGGT  668
            LK + GG+
Sbjct  200  LKVLFGGS  207



>ref|XP_010672291.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 134/189 (71%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CVG+LSLP GPAGY CK  T+VT NDFV S L    NT NI K++ T A   QFPG+N
Sbjct  25   DYCVGDLSLPSGPAGYSCKDPTTVTVNDFVSSNLRVPRNTENIFKSSATTALVNQFPGLN  84

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            G+G+S+ R D+ V GV+P+HTH   SE+++V +GTI AGFI +  NT ++K LNKGDVM+
Sbjct  85   GMGISIVRSDMDVGGVVPIHTH-RVSELIIVVEGTILAGFIDT-NNTAFYKTLNKGDVMI  142

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             P  LLHFQ+N G   +  + TF S NPG Q+ + ALF++ LP +IV  +T LD AQ+KK
Sbjct  143  LPPILLHFQVNVGSTPSVVYATFPSENPGFQVLSTALFRSSLPLEIVEKITLLDHAQVKK  202

Query  645  LKGVLGGTN  671
            LK V GGTN
Sbjct  203  LKKVFGGTN  211



>ref|XP_002445609.1| hypothetical protein SORBIDRAFT_07g022520 [Sorghum bicolor]
 gb|EES15104.1| hypothetical protein SORBIDRAFT_07g022520 [Sorghum bicolor]
Length=218

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 134/189 (71%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +L+    PAGYPCK  T VT +DF Y GL + G T N     ++ AF  +FPGVN
Sbjct  29   DFCIADLARGDTPAGYPCKPQTGVTADDFYYRGLNSTGPTINPFNIGLSSAFVTRFPGVN  88

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S AR+D A  GV+PLH+HPGG+E+L V +G + AGFISS  N V+ K L KGD+MV
Sbjct  89   GLGISAARVDFAPGGVVPLHSHPGGTELLFVIEGAMSAGFISSLTNQVFVKTLYKGDLMV  148

Query  465  FPQGLLHFQIN-SGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            FPQGLLHFQ N +G+  A A  ++SS NPGL I  FALF N+LP+D+V+ VT +D  +++
Sbjct  149  FPQGLLHFQYNLAGNDTAVALSSYSSANPGLMILDFALFANNLPSDVVSKVTVVDELEVR  208

Query  642  KLKGVLGGT  668
            KLK + GG+
Sbjct  209  KLKALFGGS  217



>ref|XP_010688042.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 133/189 (70%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            ++CVG+LSLP GPAGY CK    VT +DFVYSGL    NTTN+ K     AF AQFPG+N
Sbjct  23   NYCVGDLSLPSGPAGYACKDPAKVTVDDFVYSGLRVGANTTNLFKFGGNNAFTAQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            G+GLS+ R+D+ V G  P+HTH    E+  + +GTI AGFI SF NT ++K LNKGD+M+
Sbjct  83   GMGLSIVRVDMEVGGYFPIHTH-RVPELFTLVEGTIVAGFIDSF-NTPFYKTLNKGDIMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FP  L+HF IN G     A+ TFSS NPG+Q+   ALF+N++P+D+V  +T LD AQ+ K
Sbjct  141  FPPTLIHFAINIGSTPVLAYATFSSENPGVQLIDTALFRNNMPSDLVQKITLLDPAQVTK  200

Query  645  LKGVLGGTN  671
            LK + GGTN
Sbjct  201  LKNLFGGTN  209



>ref|XP_010672290.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 133/189 (70%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CVG+LSLP GPAGY CK  T+VT NDFV S L   GNT NI K   T A   QFPG+N
Sbjct  54   DYCVGDLSLPSGPAGYSCKDPTTVTVNDFVSSNLRVPGNTANIFKFGATTALVNQFPGIN  113

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            G+G+SM R D+ V GV+P+HTH   SE+++V +GTI AGFI +  NT ++K LNKGDVM+
Sbjct  114  GMGISMLRSDMDVGGVVPIHTH-RVSELIIVVEGTILAGFIDT-NNTAFYKTLNKGDVMI  171

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             P  LLHFQ+N G   +  + TF S NPG+Q  + ALF++ LP++IV  +T LD AQ+KK
Sbjct  172  LPPILLHFQVNVGSTPSVVYATFPSENPGVQALSAALFQSSLPSEIVEKITLLDHAQVKK  231

Query  645  LKGVLGGTN  671
            LK V GG N
Sbjct  232  LKKVFGGIN  240



>ref|XP_002264949.1| PREDICTED: auxin-binding protein ABP19a [Vitis vinifera]
 ref|XP_003632367.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
 emb|CBI37285.3| unnamed protein product [Vitis vinifera]
 emb|CBI37287.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GP GY C+    VT +DFVYSGL   GNT++I  A++  A   +FP +N
Sbjct  22   DFCVADFTAPQGPTGYSCRTPAEVTADDFVYSGLRQPGNTSSIFNASINSASVHKFPVLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+AR D+A  GV+PLHTHPG +EI++V +G + AG ISS +NTVY K + +GD+MV
Sbjct  82   GLGVSVARADVAPGGVLPLHTHPGATEIILVARGAVTAGLISS-DNTVYVKTVEEGDIMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHF +N+G  EA  +V+FSSP+PGLQ+   ALF N+L +D++  +T L   ++++
Sbjct  141  FPQGLLHFLVNTGGTEALIWVSFSSPSPGLQVLNTALFGNNLDSDLLEKITLLGDDEVQR  200

Query  645  LKGVLGGT  668
            LKG+ GGT
Sbjct  201  LKGIFGGT  208



>ref|XP_010666278.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
 emb|CAK22420.1| germin-like protein [Beta vulgaris]
Length=211

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 135/190 (71%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN-TTNIIKAAVTPAFDAQFPGV  281
            D+CV + + P GPAGYPCK   ++T +DFV+SGL  A N TT    A+   A D  FP +
Sbjct  24   DYCVADFNFPVGPAGYPCKNPATLTADDFVFSGLGVAANSTTTPFNASSVFAVDVTFPAL  83

Query  282  NGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVM  461
            NGLGLS+ RLD+ V G +P+H+H   SE+++V++GTI AGFI +  NT Y+K LNKGD+M
Sbjct  84   NGLGLSIGRLDIGVGGAVPIHSH-RASEVILVSEGTIIAGFIDT-NNTAYYKTLNKGDIM  141

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            +FP  LLHFQ+N G   A A+VT +S +PG +ITTFAL  ND P+D++  +T +D AQ+K
Sbjct  142  IFPPTLLHFQVNVGKSPALAYVTLNSASPGFEITTFALAGNDFPSDLIQKITLVDTAQVK  201

Query  642  KLKGVLGGTN  671
            KLK + GGTN
Sbjct  202  KLKRIFGGTN  211



>gb|AAG36666.1| oxalate oxidase-like germin 171 [Beta vulgaris]
Length=208

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 132/186 (71%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   S+T +DFVY+G      TTNI K  VT AF   FP +N
Sbjct  23   DFCVGDLSLPRGPQGYACKDPASITTDDFVYTGFRGERTTTNIFKNNVTLAFADAFPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLD  V GVIP+H+H   SE++++T+G+I AGFI +  NT Y+++L  GDVM+
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIILTKGSIIAGFIDT-TNTAYYRRLKVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NP +Q+TT A+F ++LP DIV+ +T L   ++ +
Sbjct  141  FPQSMLHFQVNVGKTPATAFVSLNGANPAIQLTTTAIFASNLPADIVDQITLLSNEEVMR  200

Query  645  LKGVLG  662
            LK + G
Sbjct  201  LKRIFG  206



>ref|XP_010666282.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=218

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 129/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+ SLP GP GY CK   ++T +DFVY+G      TTNI +  VT AF   FP +N
Sbjct  33   DFCVGDPSLPRGPQGYACKNPATITTDDFVYTGFRGERTTTNIFRNNVTLAFANAFPALN  92

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLD  + GVIPLH+H   SE+++V  GTI AGFI +  NT Y+K+L  GDVMV
Sbjct  93   GLGISMARLDFGIGGVIPLHSHR-TSEVIIVNHGTIIAGFIDT-SNTAYYKRLEVGDVMV  150

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G+  ATAFV+ +  NPGLQ+TT +LF  +LP DI   +T L   ++ +
Sbjct  151  FPQAMLHFQVNVGNTPATAFVSLNGANPGLQLTTPSLFAGNLPADIAEQITLLSHNEVMR  210

Query  645  LKGVLG  662
            LKGV G
Sbjct  211  LKGVFG  216



>ref|XP_010670849.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 132/186 (71%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   S+T +DFVY+G      TTNI K  VT AF   FP +N
Sbjct  23   DFCVGDLSLPRGPQGYACKDPASITTDDFVYTGFRGERTTTNIFKNNVTLAFADAFPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLD  V GVIP+H+H   SE++++T+G+I AGFI +  NT Y+++L  GDVM+
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIILTKGSIIAGFIDT-TNTAYYRRLKVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NP +Q+TT ALF ++LP DIV+ +T L   ++ +
Sbjct  141  FPQSMLHFQVNVGKTPATAFVSLNGANPAIQLTTTALFASNLPADIVDQITLLSNEEVMR  200

Query  645  LKGVLG  662
            +K + G
Sbjct  201  VKRIFG  206



>ref|XP_004303796.1| PREDICTED: auxin-binding protein ABP19a-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=208

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 131/188 (70%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P  PAGY CK    VT +DFV+SGL  AGN ++I K  ++ AF   FPG+N
Sbjct  22   DFCVADYAAPQSPAGYACKDPVKVTVDDFVFSGLRVAGNISSINKIGLSAAFAVNFPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+++ R D AV GV+P+H+H   +E++++ +GT+ AGFI+S  N  Y K L+KGD MV
Sbjct  82   GLGVALVRADFAVGGVVPIHSHRDATELVILVEGTVVAGFIAS-NNKAYVKTLHKGDTMV  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGL HF +N G   A A+ +FSS NPG+Q    ALF+NDLPT+I+   T LD  QI+K
Sbjct  141  FPQGLFHFLVNVGRTPALAYASFSSANPGVQTLETALFQNDLPTEIIAKSTLLDKVQIQK  200

Query  645  LKGVLGGT  668
            LK +LGG+
Sbjct  201  LKRLLGGS  208



>ref|XP_010666281.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=218

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+ SLP GP GY CK   ++T +DFVY+G      TTNI +  VT AF   FP +N
Sbjct  33   DFCVGDPSLPRGPQGYACKNPATITTDDFVYTGFRGERTTTNIFRNNVTLAFANAFPALN  92

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLD  + GVIPLH+H   SE+++V +GTI AGFI +  NT Y+K+L  GDVMV
Sbjct  93   GLGISMARLDFGIGGVIPLHSH-RTSEVIIVNRGTIIAGFIDT-SNTAYYKRLEVGDVMV  150

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G+  ATAFV+ +  NPGLQ+TT +LF  +LP DI   +T L   ++ +
Sbjct  151  FPQAMLHFQVNVGNTPATAFVSLNGANPGLQLTTPSLFAGNLPADIAEQITLLSHNEVMR  210

Query  645  LKGVLG  662
            LK V G
Sbjct  211  LKRVFG  216



>ref|XP_004288296.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=208

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 126/189 (67%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  PAGY CK  + V  +DFVYSGL   GN +N+ K  ++ A  AQ PG+N
Sbjct  22   DFCVADYKAPTSPAGYACKNPSDVKVDDFVYSGLGVPGNISNLSKVGISAALVAQVPGLN  81

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGLSM R DL V GV+PLHTH   SE + V +G + AGFI+S +N  Y K L KGD MV
Sbjct  82   GLGLSMVRADLEVGGVVPLHTHR-ASEAIFVAEGKVIAGFIAS-DNKAYVKNLKKGDFMV  139

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             P+ LLHFQ+N+G   A  +  FSS +PG+QI   ALF+ND  T+++   T LD A+IKK
Sbjct  140  LPRSLLHFQVNAGSTPALVYALFSSDDPGVQILQNALFQNDFQTELIAKTTLLDTAEIKK  199

Query  645  LKGVLGGTN  671
            LK +LGGTN
Sbjct  200  LKALLGGTN  208



>ref|XP_006652155.1| PREDICTED: germin-like protein 8-14-like [Oryza brachyantha]
Length=238

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 132/203 (65%), Gaps = 15/203 (7%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+    PAGYPCK   +VT +DF Y GL+A G T      A++ AF  +FPGVN
Sbjct  35   DFCVGDLARGDTPAGYPCKPEAAVTADDFSYRGLSATGPTIEPFNIALSSAFSPRFPGVN  94

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S A +     GV+PLH+HPGGSE+L V +GT+ AGFISS  N VY + L KGD+MV
Sbjct  95   GLGISAAIVHFGPGGVVPLHSHPGGSELLFVVEGTLSAGFISSVTNKVYTQTLRKGDLMV  154

Query  465  FPQGLLHFQINSGDGEA---------------TAFVTFSSPNPGLQITTFALFKNDLPTD  599
            FPQGLLHFQI +G G                  A   +SS NPGLQI  FALF N+LP+D
Sbjct  155  FPQGLLHFQIATGAGAGGNDDNATAPAAVAAAVALSMYSSSNPGLQILDFALFANNLPSD  214

Query  600  IVNTVTFLDVAQIKKLKGVLGGT  668
            +++ V+ LD  QIKKLK +  GT
Sbjct  215  VLSKVSVLDELQIKKLKSLFRGT  237



>gb|EMS64736.1| Germin-like protein 8-14 [Triticum urartu]
Length=217

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 128/189 (68%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            +FCV +L+    PAGYPCK   +VT +DF Y GL   G T N  K +++ AF   FPGVN
Sbjct  28   EFCVADLASSDTPAGYPCKPQAAVTADDFYYRGLGTTGPTVNPFKISLSSAFVTSFPGVN  87

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENT-VYFKQLNKGDVM  461
            GLG+S AR+D AV GV+PLH HP  +E++ V +GT+  GFIS+  N  VY   L+KGD+M
Sbjct  88   GLGISAARVDFAVGGVVPLHWHPAATELIFVVEGTLSCGFISATSNNRVYTNTLHKGDIM  147

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            V PQG  HFQ N G+  A A  T+SSPNPG+Q   FALF N+LP++++  VT LD  Q++
Sbjct  148  VLPQGQPHFQYNLGNTTAVALSTYSSPNPGVQTLDFALFANNLPSEVLTKVTLLDDLQVR  207

Query  642  KLKGVLGGT  668
            KLK + GGT
Sbjct  208  KLKALFGGT  216



>ref|XP_010687789.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 129/189 (68%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CVG+LSLP GP GY CK    VT +DFVYSG+  AGNT N+ K  V  AF A FPG+N
Sbjct  23   DYCVGDLSLPSGPTGYSCKDPAKVTVDDFVYSGMRVAGNTANLFKFGVKRAFVADFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ R D  V GV P+HTH   SE+L+VT+GT+ AG I +  NT Y+K L KGD+M 
Sbjct  83   GLGISITRTDFDVWGVFPMHTH-RVSELLMVTEGTLIAGIIDT-NNTAYYKSLYKGDIMA  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             P  LLHF+IN G     A+  F+S NPG+QI   +LF+N LP++++  VT LD AQ+ K
Sbjct  141  IPPTLLHFEINVGSTPVLAYTIFTSANPGVQILDTSLFQNSLPSEMIEKVTLLDHAQVTK  200

Query  645  LKGVLGGTN  671
            LK + G T+
Sbjct  201  LKKIFGDTD  209



>gb|EAZ30088.1| hypothetical protein OsJ_14150 [Oryza sativa Japonica Group]
Length=222

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 130/196 (66%), Gaps = 8/196 (4%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+    PAGYPCK   +VT  DF Y GL   G T N    A++ AF  +FPGVN
Sbjct  26   DFCVGDLARGDTPAGYPCKPEATVTAEDFCYRGLVTTGPTVNPFNIALSSAFSTRFPGVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GL +S AR+D +  G++PLH+HP G+E++ V +GT+ AGFISS  N VY   L KGD+MV
Sbjct  86   GLDISAARVDFSPGGIVPLHSHPSGTELIYVVEGTLSAGFISSTSNKVYTSTLRKGDLMV  145

Query  465  FPQGLLHFQINSGDG--------EATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTF  620
            FPQGLLHFQIN   G         A A   +SS NPGLQI  FALF N+LPTD+++ VT 
Sbjct  146  FPQGLLHFQINDNGGGGDGNNATAAMAVSFYSSSNPGLQIMDFALFANNLPTDVLSKVTV  205

Query  621  LDVAQIKKLKGVLGGT  668
            LD  +I+KLK +  GT
Sbjct  206  LDDLEIRKLKSLFRGT  221



>ref|XP_010670843.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 131/186 (70%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK  + +T +DFVY+G      T+N+ +  VT AF   +P +N
Sbjct  23   DFCVGDLSLPRGPEGYACKDPSDITTDDFVYTGFRGERTTSNLFRNNVTLAFVDAYPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLD  V GVIP+H+H   SE++++  G+I AGFI +  NT Y+++L  GDVM+
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIILATGSIIAGFIDT-TNTAYYRRLEVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +S NPGLQ+TT ALF ++LP DIV  +T L   ++ +
Sbjct  141  FPQAMLHFQVNVGPTPATAFVSLNSANPGLQLTTTALFASNLPGDIVEQITLLSNEEVMR  200

Query  645  LKGVLG  662
            LK + G
Sbjct  201  LKRIFG  206



>gb|EMT28865.1| Germin-like protein 8-14 [Aegilops tauschii]
Length=220

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 127/189 (67%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            +FCV +L+    PAGYPCK   +VT +DF Y GL   G T N  K +++ AF   FPGVN
Sbjct  31   EFCVADLASSDTPAGYPCKPQAAVTADDFYYRGLGTTGPTVNPFKISLSSAFVTSFPGVN  90

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENT-VYFKQLNKGDVM  461
            GLG+S AR+D AV GV+PLH HP  +E++ V +GT+  GFIS+  N  VY   L KGD+M
Sbjct  91   GLGISAARVDFAVGGVVPLHWHPAATELIFVVEGTLSCGFISATSNNRVYTNTLYKGDIM  150

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            V PQG  HFQ N G+  A A  T+SSPNPG+Q   FALF N+LP++++  VT LD  Q++
Sbjct  151  VLPQGQPHFQYNLGNTTAVALSTYSSPNPGVQTLDFALFANNLPSEVLTKVTLLDDLQVR  210

Query  642  KLKGVLGGT  668
            KLK + GGT
Sbjct  211  KLKALFGGT  219



>dbj|BAJ98352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 126/188 (67%), Gaps = 0/188 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            +FCV +L+    PAGYPCK   +VT +DF Y GL   G   N  K +++ AF   FPGVN
Sbjct  26   EFCVADLASSDTPAGYPCKPQAAVTADDFYYRGLGTTGPAINPFKISLSSAFVTNFPGVN  85

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S AR+D AV GV+PLH HP  +E++ V +GT+  GFIS+  N VY K L KGD+MV
Sbjct  86   GLGISAARVDFAVGGVVPLHWHPAATELIFVLEGTLSCGFISATSNRVYTKTLYKGDLMV  145

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQG  HFQ N G+  A A  T+SS NP +Q   FALF N+LP+++VN VT LD  +++K
Sbjct  146  LPQGQQHFQYNLGNTTAAALSTYSSYNPVVQTLDFALFANNLPSEVVNKVTLLDELEVRK  205

Query  645  LKGVLGGT  668
            LK + GGT
Sbjct  206  LKALFGGT  213



>ref|XP_010670845.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 129/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   ++T +DFVY+G      T+NI +  VT AF   FP +N
Sbjct  23   DFCVGDLSLPRGPQGYACKDPANITTDDFVYTGFRGERTTSNIFRNNVTLAFADAFPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SMARLD  V GVIP+H+H   SE++++  G+I AGFI +  NT Y+++L  GDVM+
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIIIATGSIIAGFIDT-TNTAYYRRLEVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NP +Q+TT ALF ++LP DIV  +T L   ++ +
Sbjct  141  FPQSMLHFQVNVGTTPATAFVSLNGANPAIQLTTTALFASNLPGDIVEQITLLSNEEVMR  200

Query  645  LKGVLG  662
            LK + G
Sbjct  201  LKRIFG  206



>ref|XP_004973625.1| PREDICTED: germin-like protein 8-14-like [Setaria italica]
Length=222

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 124/186 (67%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL LP  P+GYPCK    V  NDF    L+ +G   +     + PA   Q PG+N
Sbjct  31   DFCVANLLLPNTPSGYPCKPKALVNANDFYTDDLSRSGPVFSPFNTGLAPANVKQVPGLN  90

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S  R+D+ V GV+PLHTHP GSE++ V +GTI  GFIS+  NT Y K LNKGD+ V
Sbjct  91   GLGISATRVDIGVGGVVPLHTHPEGSELIFVVEGTISVGFISAETNTAYTKTLNKGDLFV  150

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQIN G+  A A   +SS NPGLQIT +ALF + L  D+V+ VTF++ A+++K
Sbjct  151  FPQGLLHFQINIGNTTAVAINAYSSSNPGLQITPYALFGDTLRADVVSKVTFINEAEVRK  210

Query  645  LKGVLG  662
             K   G
Sbjct  211  EKAEFG  216



>ref|XP_010687565.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=242

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 127/189 (67%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+LP GP+G+ CK  T VT +DFVYSG+  A NT+N+ K  +  A   QFPG+N
Sbjct  50   DFCVGDLNLPSGPSGFSCKDPTKVTADDFVYSGMRVASNTSNLFKFGIRRALSPQFPGLN  109

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+AR D  V G  P+HTH   SEIL+VT+GT+ AGFI +  N  Y+K L K D+M+
Sbjct  110  GLGISIARADFDVGGFFPMHTH-RTSEILMVTEGTLMAGFIDT-NNKAYYKTLMKEDIMI  167

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             P  L+HF IN G     A+  F+  NPG+Q+   ALF+NDLP +++  VT LD AQ+ K
Sbjct  168  IPPTLVHFMINVGSTPVLAYTIFTGANPGVQLLDTALFQNDLPPEVIEKVTLLDHAQVTK  227

Query  645  LKGVLGGTN  671
            LK +   TN
Sbjct  228  LKKIFNDTN  236



>ref|XP_006837025.1| hypothetical protein AMTR_s00110p00020470 [Amborella trichopoda]
 gb|ERM99878.1| hypothetical protein AMTR_s00110p00020470 [Amborella trichopoda]
Length=210

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CV + SLP   +G+PCK  +++T +DF YSGLA  GNT+N IKA VTPAF  +FP +N
Sbjct  23   DYCVADTSLPQTFSGFPCKNPSNLTADDFSYSGLANPGNTSNTIKATVTPAFLTEFPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLGL++ R+D+A  GVIPLHTHP  +E LV+ QGT+  GF+ +  N  Y K L  GDV V
Sbjct  83   GLGLAVGRVDVAPGGVIPLHTHPDANEALVLIQGTLIVGFVDT-SNKAYIKSLKTGDVFV  141

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQGLLHFQ+NSG   A A +T +S  PG Q+T+F+LF +D  + ++ T TFL  A++K+
Sbjct  142  FPQGLLHFQVNSGTTPAFAIITLNSAAPGAQLTSFSLFSSDFSSKLIETTTFLSEAEVKR  201

Query  645  LKGVLGGTN  671
            LK +LGG+N
Sbjct  202  LKTLLGGSN  210



>gb|AFK33656.1| unknown [Lotus japonicus]
Length=209

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 134/206 (65%), Gaps = 3/206 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTT  227
            +++  LF     ++ +   D CV +   P  P+GY C    ++T +DFV+ GL A GNTT
Sbjct  4    IYILFLFTFLSTTSYASVNDLCVADFKGPSTPSGYHCMPLANLTSDDFVFHGLVA-GNTT  62

Query  228  NIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFI  407
            N   AA+T AF   FP +NGLG+S ARLD+A  G IP+HTHPG +E+L++ +G I AGF+
Sbjct  63   NSFNAALTSAFVTDFPALNGLGVSAARLDIAKGGSIPMHTHPGATELLMMVKGKITAGFM  122

Query  408  SSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKND  587
            +     +Y K +  GD+MVFPQG+LHFQ+NSG G A AF+ FSS NPG Q+    LF N 
Sbjct  123  T--PTALYSKTVKPGDIMVFPQGMLHFQVNSGVGTANAFLAFSSENPGAQLLDLLLFANG  180

Query  588  LPTDIVNTVTFLDVAQIKKLKGVLGG  665
            L +DIV   TFLD+AQ+KKLK    G
Sbjct  181  LDSDIVAKTTFLDLAQVKKLKARFNG  206



>ref|XP_010666317.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 124/186 (67%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+LP GP GY CK  T++T +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLNLPRGPQGYACKNPTTITTDDFVYTGFRGEKATTNIFRNNVTLASAEAYPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SM RL+  V GVIPLH+H   SE+++V +GTI AGFI +  N  Y+K+L  GDVM+
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYYKRLEVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQIN G   ATAFV+ +  NPG Q+TT +LF  +LP  I   +T L   ++ +
Sbjct  141  FPQAMLHFQINVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHNEVMR  200

Query  645  LKGVLG  662
            LK   G
Sbjct  201  LKRAFG  206



>gb|EAZ07239.1| hypothetical protein OsI_29483 [Oryza sativa Indica Group]
Length=219

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 125/189 (66%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSL-PPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCV NL L    P+GY C+ + +VT  DF    LA  G        ++  AF  Q+P V
Sbjct  30   DFCVANLPLGADTPSGYQCRPAATVTAADFYSGALARPGILIRPFNTSLASAFVRQYPAV  89

Query  282  NGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVM  461
            NGLG+S +R+D+   GV+PLHTHP GSE+L V  G + AGFISS +N VY+K+++KG + 
Sbjct  90   NGLGISASRVDILPGGVVPLHTHPAGSELLYVLDGALVAGFISSSDNKVYYKEVSKGGMF  149

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            VFPQGLLHFQ N+GD  A AF  +SS NPGLQI  +ALF N+LPT  V   TFL  A+++
Sbjct  150  VFPQGLLHFQYNTGDTTAVAFAAYSSSNPGLQILDYALFANNLPTSYVVKGTFLAEAEVR  209

Query  642  KLKGVLGGT  668
            +LK   GG+
Sbjct  210  RLKSKFGGS  218



>gb|KCW82113.1| hypothetical protein EUGRSUZ_C03488 [Eucalyptus grandis]
Length=154

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LS P GPAGY CKK ++VT NDFV+SGL+ AGNT+N+IKAAVTPAF  QFPG+N
Sbjct  23   DFCVGDLSAPEGPAGYSCKKVSAVTVNDFVFSGLSVAGNTSNLIKAAVTPAFVTQFPGLN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S+ARLD+A  GVIPLHTHPGGSE+L V QG+I  GFISS  NTVY K LNKGD M+
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLFVIQGSISVGFISSSANTVYLKTLNKGDSMI  142

Query  465  FPQGL  479
            FPQ +
Sbjct  143  FPQAI  147



>ref|NP_001175609.1| Os08g0459700 [Oryza sativa Japonica Group]
 sp|Q6Z964.1|GL813_ORYSJ RecName: Full=Germin-like protein 8-13; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD09600.1| putative adenosine diphosphate glucose pyrophosphatase [Oryza 
sativa Japonica Group]
 dbj|BAD09955.1| putative adenosine diphosphate glucose pyrophosphatase [Oryza 
sativa Japonica Group]
 gb|EAZ42985.1| hypothetical protein OsJ_27574 [Oryza sativa Japonica Group]
 dbj|BAH94337.1| Os08g0459700 [Oryza sativa Japonica Group]
Length=219

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 125/189 (66%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSL-PPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCV NL L    P+GY C+ + +VT  DF    LA  G        ++  AF  Q+P V
Sbjct  30   DFCVANLPLGADTPSGYQCRPAATVTAADFYSGALARPGILIRPFNTSLASAFVQQYPAV  89

Query  282  NGLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVM  461
            NGLG+S +R+D+   GV+PLHTHP GSE+L V  G + AGFISS +N VY+K+++KG + 
Sbjct  90   NGLGISASRVDILPGGVVPLHTHPAGSELLYVLDGALVAGFISSSDNKVYYKEVSKGGMF  149

Query  462  VFPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIK  641
            VFPQGLLHFQ N+GD  A AF  +SS NPGLQI  +ALF N+LPT  V   TFL  A+++
Sbjct  150  VFPQGLLHFQYNTGDTTAVAFAAYSSSNPGLQILDYALFANNLPTSYVVKGTFLAEAEVR  209

Query  642  KLKGVLGGT  668
            +LK   GG+
Sbjct  210  RLKSKFGGS  218



>ref|XP_010666313.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 124/186 (67%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   ++T +DFVY+G      TTNI +  VT A  + +P +N
Sbjct  23   DFCVGDLSLPRGPEGYACKNPATITTDDFVYTGFRGEKATTNIFRNNVTLASASAYPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SM RL+  V GVIPLH+H   SE+++V +GTI AGFI +  N  Y+K+L  GDVM+
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYYKRLKVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NPG Q+TT +LF  +LP  I   +T L   ++ +
Sbjct  141  FPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHNEVMR  200

Query  645  LKGVLG  662
            LK   G
Sbjct  201  LKRAFG  206



>ref|XP_010666297.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   +VT +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLSLPRGPQGYACKNPATVTTDDFVYTGFRGEKATTNIFRNNVTLASANAYPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SM RL+  V GVIPLH+H   SE+++V +GTI AGFI +  N  Y+K+L  GDVM+
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYYKRLEVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NPG Q+TT +LF  +LP  I   +T L   ++ +
Sbjct  141  FPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHDEVMR  200

Query  645  LKGVLG  662
            LK   G
Sbjct  201  LKRAFG  206



>ref|NP_001266709.1| auxin-binding protein ABP20 precursor [Zea mays]
 gb|ACG44908.1| auxin-binding protein ABP20 precursor [Zea mays]
Length=221

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 121/187 (65%), Gaps = 0/187 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS    P GYPCK    VT +DF Y GLA  G      K ++  A    FPG+N
Sbjct  33   DFCIADLSAAATPGGYPCKPPKDVTADDFHYGGLATPGTALKPFKISLGSAVVTTFPGLN  92

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S AR+ +   GV PLH+HPGG+E++ V +G++  GFIS+  N VY K L  GD+MV
Sbjct  93   GLGISAARMVMVPGGVAPLHSHPGGTELIFVIEGSVVCGFISATLNRVYTKTLYAGDLMV  152

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQG LHFQ + G+  A    +FSS NPGLQI  FALF NDLPT++VN VT LD  QI K
Sbjct  153  LPQGQLHFQYSHGNTTAVTLSSFSSDNPGLQILDFALFANDLPTEVVNKVTNLDELQIVK  212

Query  645  LKGVLGG  665
            LK + GG
Sbjct  213  LKALFGG  219



>ref|XP_010666316.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP  Y CK  T++T +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLSLPRGPQAYTCKNPTTITTDDFVYTGFRGEKATTNIFRNNVTLASANAYPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SM RL+  V GVIPLH+H   SE+++V +GTI AGFI +  N  Y+K+L  GDVM+
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYYKRLEVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NPG Q+TT +LF  +LP  I   +T L   ++ +
Sbjct  141  FPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHNEVMR  200

Query  645  LKGVLG  662
            LK   G
Sbjct  201  LKRAFG  206



>gb|AFW78895.1| auxin-binding protein ABP20 [Zea mays]
Length=220

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 121/187 (65%), Gaps = 0/187 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS    P GYPCK    VT +DF Y GLA  G      K ++  A    FPG+N
Sbjct  32   DFCIADLSAAATPGGYPCKPPKDVTADDFHYGGLATPGTALKPFKISLGSAVVTTFPGLN  91

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S AR+ +   GV PLH+HPGG+E++ V +G++  GFIS+  N VY K L  GD+MV
Sbjct  92   GLGISAARMVMVPGGVAPLHSHPGGTELIFVIEGSVVCGFISATLNRVYTKTLYAGDLMV  151

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQG LHFQ + G+  A    +FSS NPGLQI  FALF NDLPT++VN VT LD  QI K
Sbjct  152  LPQGQLHFQYSHGNTTAVTLSSFSSDNPGLQILDFALFANDLPTEVVNKVTNLDELQIVK  211

Query  645  LKGVLGG  665
            LK + GG
Sbjct  212  LKALFGG  218



>ref|NP_001130872.1| uncharacterized protein LOC100191976 precursor [Zea mays]
 gb|ACF79244.1| unknown [Zea mays]
Length=220

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 121/187 (65%), Gaps = 0/187 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS    P GYPCK    VT +DF Y GLA  G      K ++  A    FPG+N
Sbjct  32   DFCIADLSAAATPGGYPCKPPKDVTADDFHYGGLATPGTALKPFKISLGSAVVTTFPGLN  91

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+S AR+ +   GV PLH+HPGG+E++ V +G++  GFIS+  N VY K L  GD+MV
Sbjct  92   GLGISAARMVMVPGGVAPLHSHPGGTELIFVIEGSVVCGFISATLNRVYTKTLYAGDLMV  151

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
             PQG LHFQ + G+  A    +FSS NPGLQI  FALF NDLPT++VN VT LD  QI K
Sbjct  152  LPQGHLHFQYSHGNTTAVTLSSFSSDNPGLQILDFALFANDLPTEVVNKVTNLDELQIVK  211

Query  645  LKGVLGG  665
            LK + GG
Sbjct  212  LKALFGG  218



>ref|XP_010666311.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+LP GP GY CK   ++T +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLTLPRGPEGYACKNPATITTDDFVYTGFRGEKATTNIFRNNVTLASANAYPALN  82

Query  285  GLGLSMARLDLAVDGVIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMV  464
            GLG+SM RL+  V GVIPLH+H   SE+++V +GTI AGFI +  N  Y+K+L  GDVM+
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYYKRLEVGDVMI  140

Query  465  FPQGLLHFQINSGDGEATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKK  644
            FPQ +LHFQ+N G   ATAFV+ +  NPG Q+TT +LF  +LP  I   +T L   ++ +
Sbjct  141  FPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHDEVMR  200

Query  645  LKGVLG  662
            LK   G
Sbjct  201  LKRAFG  206



>emb|CAN81765.1| hypothetical protein VITISV_038014 [Vitis vinifera]
Length=193

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = +3

Query  150  YPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDLAVDG  329
            Y C+    VT +DFVYSGL   GNT++I  A++  A   +FP +NGLG+S+AR D+A  G
Sbjct  21   YSCRTPAEVTADDFVYSGLRQPGNTSSIFNASINSAXVHKFPVLNGLGVSVARADVAPGG  80

Query  330  VIPLHTHPGGSEILVVTQGTICAGFISSFENTVYFKQLNKGDVMVFPQGLLHFQINSGDG  509
            V PLHTHPG +EI++V +G + AG ISS +NTVY K + +GD+MVFPQGLLHF +N G  
Sbjct  81   VXPLHTHPGATEIILVARGAVTAGLISS-DNTVYVKTVEEGDIMVFPQGLLHFXVNXGGT  139

Query  510  EATAFVTFSSPNPGLQITTFALFKNDLPTDIVNTVTFLDVAQIKKLKGVLGGT  668
            EA  +V+FSSP+PGLQ+   ALF N+L +D++  +T L   ++++LKG+ GGT
Sbjct  140  EALIWVSFSSPSPGLQVLNTALFGNNLDSDLLEKITLLGDDEVQRLKGIFGGT  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2351319000596