BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24761_g11_i1 len=699 path=[13571:0-306 13877:307-553 12246:554-600
14170:601-698]

Length=699
                                                                      Score     E

gb|EYU28339.1|  hypothetical protein MIMGU_mgv1a013656mg                297   2e-98   
gb|EYU25861.1|  hypothetical protein MIMGU_mgv1a013719mg                293   9e-97   
ref|XP_011093822.1|  PREDICTED: auxin-binding protein ABP19a-like       293   1e-96   
gb|EPS70693.1|  germin-like protein                                     290   2e-95   
ref|XP_010666273.1|  PREDICTED: auxin-binding protein ABP19a            280   1e-91   
gb|KDP33908.1|  hypothetical protein JCGZ_07479                         277   1e-90   
gb|AFK44812.1|  unknown                                                 277   1e-90   
ref|XP_004243715.1|  PREDICTED: auxin-binding protein ABP19a-like       277   3e-90   
ref|XP_007012661.1|  Germin protein subfamily 3 member 3                278   5e-90   
gb|ABV03161.1|  germin-like protein                                     275   2e-89   Chimonanthus praecox [wintersweet]
ref|XP_006342367.1|  PREDICTED: auxin-binding protein ABP19a-like       275   2e-89   
ref|XP_008337872.1|  PREDICTED: auxin-binding protein ABP19a            274   4e-89   
ref|XP_009361697.1|  PREDICTED: auxin-binding protein ABP19a            273   5e-89   
gb|ABL86677.1|  GLP3                                                    272   1e-88   Gossypium barbadense [Egyptian cotton]
ref|XP_008337871.1|  PREDICTED: auxin-binding protein ABP20             273   2e-88   
ref|XP_008450917.1|  PREDICTED: auxin-binding protein ABP19a-like       272   2e-88   
emb|CDP03095.1|  unnamed protein product                                271   3e-88   
gb|AEN02469.1|  germin-like protein                                     271   3e-88   
ref|XP_004287629.1|  PREDICTED: auxin-binding protein ABP19a-like       271   3e-88   
ref|XP_004287628.1|  PREDICTED: auxin-binding protein ABP19a-like       271   6e-88   
ref|XP_007202571.1|  hypothetical protein PRUPE_ppa011460mg             270   7e-88   
sp|O04011.1|ABP20_PRUPE  RecName: Full=Auxin-binding protein ABP2...    270   9e-88   Prunus persica
gb|AFK39466.1|  unknown                                                 270   1e-87   
gb|AFK43419.1|  unknown                                                 270   1e-87   
ref|XP_004513480.1|  PREDICTED: auxin-binding protein ABP19a-like       269   4e-87   
ref|XP_007202573.1|  hypothetical protein PRUPE_ppa011467mg             268   4e-87   
ref|XP_011045993.1|  PREDICTED: auxin-binding protein ABP20             268   5e-87   
gb|ACA03784.1|  putative auxin-binding protein 3                        268   8e-87   Prunus salicina [Japanese plum]
gb|ADD71879.1|  germin-like protein subfamily 3 member 4 precursor      267   1e-86   Arachis hypogaea [goober]
ref|XP_004144029.1|  PREDICTED: auxin-binding protein ABP20-like        266   3e-86   
ref|XP_009784907.1|  PREDICTED: auxin-binding protein ABP19a-like       266   3e-86   
emb|CAN67380.1|  hypothetical protein VITISV_017918                     265   4e-86   Vitis vinifera
ref|XP_006381632.1|  hypothetical protein POPTR_0006s14510g             268   4e-86   
ref|XP_009596795.1|  PREDICTED: auxin-binding protein ABP19a-like       266   5e-86   
ref|NP_001268059.1|  germin-like protein 6 precursor                    266   5e-86   
gb|ACA03785.1|  putative auxin-binding protein 2                        266   6e-86   Prunus salicina [Japanese plum]
ref|XP_007138665.1|  hypothetical protein PHAVU_009G227800g             265   1e-85   
gb|ABL86676.1|  GLP2                                                    265   1e-85   Gossypium barbadense [Egyptian cotton]
ref|NP_001241062.1|  auxin-binding protein ABP19a-like precursor        265   1e-85   
ref|XP_008242223.1|  PREDICTED: auxin-binding protein ABP20             266   1e-85   
gb|AAO92740.1|  auxin binding protein                                   264   2e-85   Gossypium hirsutum [American cotton]
gb|AAF21988.2|AF116537_1  fiber protein GLP1                            264   2e-85   Gossypium hirsutum [American cotton]
gb|KEH37574.1|  auxin-binding protein ABP19a                            264   3e-85   
ref|XP_008362990.1|  PREDICTED: auxin-binding protein ABP19a-like       264   3e-85   
ref|XP_008242222.1|  PREDICTED: auxin-binding protein ABP19a            263   4e-85   
ref|XP_010235197.1|  PREDICTED: germin-like protein 8-14                264   4e-85   
emb|CAC34417.1|  Germin-like protein                                    263   7e-85   Pisum sativum [garden pea]
ref|XP_010049430.1|  PREDICTED: auxin-binding protein ABP19a-like       263   8e-85   
ref|XP_010049517.1|  PREDICTED: auxin-binding protein ABP19a-like       263   9e-85   
ref|XP_003574592.1|  PREDICTED: germin-like protein 8-14                262   1e-84   
ref|XP_009417703.1|  PREDICTED: germin-like protein 8-14                262   2e-84   
ref|XP_010261910.1|  PREDICTED: auxin-binding protein ABP19a-like       261   2e-84   
gb|KEH37575.1|  auxin-binding protein ABP19a                            261   5e-84   
ref|XP_009594759.1|  PREDICTED: auxin-binding protein ABP19a-like       260   6e-84   
ref|XP_007154588.1|  hypothetical protein PHAVU_003G131400g             260   7e-84   
ref|XP_003551125.1|  PREDICTED: auxin-binding protein ABP19a-like       259   1e-83   
ref|XP_011078074.1|  PREDICTED: auxin-binding protein ABP19a-like       259   2e-83   
ref|XP_006342915.1|  PREDICTED: auxin-binding protein ABP19a-like       259   2e-83   
ref|XP_011072583.1|  PREDICTED: auxin-binding protein ABP19a            259   2e-83   
gb|ACU18952.1|  unknown                                                 259   2e-83   Glycine max [soybeans]
ref|XP_009784603.1|  PREDICTED: auxin-binding protein ABP19a-like       258   4e-83   
sp|O04012.1|AB19B_PRUPE  RecName: Full=Auxin-binding protein ABP1...    258   5e-83   Prunus persica
ref|XP_007204735.1|  hypothetical protein PRUPE_ppa011385mg             258   6e-83   
ref|NP_001061976.1|  Os08g0460000                                       258   7e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004303688.1|  PREDICTED: auxin-binding protein ABP19a-like       258   9e-83   
ref|XP_002516286.1|  Auxin-binding protein ABP19a precursor, puta...    257   1e-82   Ricinus communis
ref|XP_010261909.1|  PREDICTED: auxin-binding protein ABP20-like        256   2e-82   
gb|ABG46233.1|  germin-like protein 2a                                  257   2e-82   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010049516.1|  PREDICTED: auxin-binding protein ABP19a-like       256   2e-82   
emb|CAC32847.1|  adenosine diphosphate glucose pyrophosphatase          256   2e-82   Hordeum vulgare [barley]
dbj|BAK03467.1|  predicted protein                                      256   2e-82   
dbj|BAJ98277.1|  predicted protein                                      256   2e-82   
ref|XP_008391398.1|  PREDICTED: auxin-binding protein ABP19a-like       256   3e-82   
ref|XP_004235542.1|  PREDICTED: auxin-binding protein ABP19a            256   4e-82   
gb|AAC05682.1|  germin-like protein                                     256   4e-82   Oryza sativa Japonica Group [Japonica rice]
emb|CAC85479.1|  adenosine diphosphate glucose pyrophosphatase          256   5e-82   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010049513.1|  PREDICTED: auxin-binding protein ABP19a-like       255   6e-82   
ref|XP_009131804.1|  PREDICTED: germin-like protein subfamily 3 m...    255   7e-82   
ref|XP_006361339.1|  PREDICTED: auxin-binding protein ABP19a-like       255   8e-82   
ref|XP_009375459.1|  PREDICTED: auxin-binding protein ABP19a            255   9e-82   
dbj|BAA74702.1|  germin-like protein 1                                  255   9e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760539.1|  PREDICTED: auxin-binding protein ABP19a-like       255   1e-81   
ref|XP_010454369.1|  PREDICTED: germin-like protein subfamily 3 m...    255   1e-81   
ref|XP_009600028.1|  PREDICTED: auxin-binding protein ABP19a            254   1e-81   
emb|CAA75907.1|  Germin-like protein 1                                  254   1e-81   Hordeum vulgare [barley]
gb|EMS51159.1|  Germin-like protein 8-14                                254   1e-81   
emb|CDY51841.1|  BnaA03g56080D                                          254   1e-81   
ref|XP_010910722.1|  PREDICTED: auxin-binding protein ABP20-like        254   2e-81   
ref|XP_010420905.1|  PREDICTED: germin-like protein subfamily 3 m...    254   2e-81   
ref|XP_004287630.1|  PREDICTED: auxin-binding protein ABP19a-like       254   3e-81   
ref|XP_006289376.1|  hypothetical protein CARUB_v10002870mg             254   3e-81   
ref|XP_009389677.1|  PREDICTED: germin-like protein 8-14                253   4e-81   
ref|XP_002439350.1|  hypothetical protein SORBIDRAFT_09g004970          253   8e-81   Sorghum bicolor [broomcorn]
gb|KCW82144.1|  hypothetical protein EUGRSUZ_C03535                     252   8e-81   
ref|XP_010064035.1|  PREDICTED: auxin-binding protein ABP19a            251   2e-80   
ref|NP_001140857.1|  uncharacterized protein LOC100272933 precursor     251   5e-80   Zea mays [maize]
ref|XP_008784308.1|  PREDICTED: germin-like protein 8-14                250   9e-80   
ref|XP_006465923.1|  PREDICTED: auxin-binding protein ABP19a-like       250   1e-79   
ref|XP_010428148.1|  PREDICTED: germin-like protein subfamily 3 m...    249   1e-79   
emb|CDX70935.1|  BnaC03g10190D                                          249   1e-79   
ref|XP_010932415.1|  PREDICTED: germin-like protein 8-14                249   2e-79   
ref|XP_006426654.1|  hypothetical protein CICLE_v10026481mg             249   2e-79   
ref|XP_006400624.1|  hypothetical protein EUTSA_v10014670mg             249   2e-79   
gb|AEQ39055.1|  putative germin-like protein                            249   2e-79   
ref|NP_197563.1|  germin-like protein subfamily 3 member 3              248   3e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141699.1|  PREDICTED: auxin-binding protein ABP19a-like       248   3e-79   
ref|XP_009120792.1|  PREDICTED: germin-like protein 1                   248   4e-79   
ref|XP_004973627.1|  PREDICTED: germin-like protein 8-14-like           248   4e-79   
ref|XP_009126456.1|  PREDICTED: germin-like protein 1                   248   4e-79   
gb|EYU45887.1|  hypothetical protein MIMGU_mgv1a022096mg                248   4e-79   
gb|AAB51566.1|  germin-like protein                                     248   4e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAB51583.1|  germin-like protein                                     247   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786632.1|  PREDICTED: germin-like protein 8-14                248   6e-79   
ref|XP_010090139.1|  Auxin-binding protein ABP19a                       248   6e-79   
gb|KFK26288.1|  hypothetical protein AALP_AA8G228400                    248   8e-79   
ref|XP_002874007.1|  hypothetical protein ARALYDRAFT_910104             247   1e-78   
ref|XP_002304136.2|  germin-like family protein                         247   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_004296080.1|  PREDICTED: auxin-binding protein ABP19b-like       247   1e-78   
sp|L8BRS3.1|GLP1_MORAL  RecName: Full=Germin-like protein; Short=...    247   1e-78   
ref|XP_002274625.1|  PREDICTED: auxin-binding protein ABP19a-like       247   1e-78   Vitis vinifera
gb|ABK95684.1|  unknown                                                 247   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_008462312.1|  PREDICTED: auxin-binding protein ABP19a            247   2e-78   
ref|XP_011035719.1|  PREDICTED: auxin-binding protein ABP19a-like       246   2e-78   
ref|XP_011078075.1|  PREDICTED: auxin-binding protein ABP20-like        246   3e-78   
ref|XP_002299591.2|  germin-like family protein                         246   4e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010471285.1|  PREDICTED: germin-like protein subfamily 3 m...    246   4e-78   
ref|XP_008228197.1|  PREDICTED: auxin-binding protein ABP19a            246   5e-78   
ref|XP_006849665.1|  hypothetical protein AMTR_s00024p00231430          245   5e-78   
ref|XP_006659477.1|  PREDICTED: germin-like protein 8-14-like           245   6e-78   
gb|ABG76199.2|  germin-like protein                                     244   1e-77   Capsicum chinense [Scotch bonnet]
ref|XP_010416015.1|  PREDICTED: germin-like protein subfamily 3 m...    244   2e-77   
ref|NP_177405.1|  germin-like protein subfamily 3 member 1              244   2e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AFY10819.1|  germin-like protein                                     244   2e-77   
sp|P45854.1|GLP1_SINAL  RecName: Full=Germin-like protein 1; Flag...    244   2e-77   Sinapis alba [bai jie]
gb|AAB51750.1|  germin-like protein                                     243   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888885.1|  hypothetical protein ARALYDRAFT_476393             243   3e-77   
ref|XP_006302822.1|  hypothetical protein CARUB_v10020953mg             243   6e-77   
ref|XP_010537615.1|  PREDICTED: germin-like protein subfamily 3 m...    243   6e-77   
ref|XP_010471286.1|  PREDICTED: germin-like protein subfamily 3 m...    242   8e-77   
gb|AAL38307.1|  germin-like protein                                     242   9e-77   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH15357.1|  germin like protein                                    242   1e-76   Nicotiana tabacum [American tobacco]
ref|XP_011036430.1|  PREDICTED: auxin-binding protein ABP19a-like       242   1e-76   
ref|XP_010051414.1|  PREDICTED: auxin-binding protein ABP19a-like       243   1e-76   
ref|XP_008362989.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-bindin...    241   1e-76   
ref|XP_010086822.1|  Auxin-binding protein ABP19a                       241   2e-76   
ref|XP_010086820.1|  Auxin-binding protein ABP19a                       241   2e-76   
ref|XP_006390643.1|  hypothetical protein EUTSA_v10019138mg             241   2e-76   
gb|KCW81975.1|  hypothetical protein EUGRSUZ_C033371                    240   3e-76   
emb|CAN67670.1|  hypothetical protein VITISV_008896                     241   4e-76   Vitis vinifera
ref|XP_002273384.1|  PREDICTED: auxin-binding protein ABP19a-like       240   5e-76   Vitis vinifera
gb|AFK42476.1|  unknown                                                 239   1e-75   
emb|CDY11164.1|  BnaC06g24160D                                          239   1e-75   
ref|XP_002521328.1|  Auxin-binding protein ABP19a precursor, puta...    239   1e-75   Ricinus communis
ref|XP_002274457.1|  PREDICTED: germin-like protein                     239   2e-75   Vitis vinifera
emb|CAA63014.1|  germin1                                                239   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510467.1|  PREDICTED: germin-like protein subfamily 3 m...    239   3e-75   
emb|CDX68260.1|  BnaA07g23000D                                          237   6e-75   
ref|XP_007024622.1|  Germin-like protein 1                              237   2e-74   
ref|XP_009104850.1|  PREDICTED: germin-like protein 1                   236   2e-74   
gb|KFK41682.1|  hypothetical protein AALP_AA2G159300                    235   5e-74   
gb|KDP40703.1|  hypothetical protein JCGZ_24702                         234   2e-73   
gb|ACG69484.1|  germin-like protein 8                                   233   2e-73   Glycine max [soybeans]
gb|KCW82145.1|  hypothetical protein EUGRSUZ_C03536                     233   3e-73   
ref|NP_001236394.1|  uncharacterized protein LOC100500326 precursor     233   4e-73   
ref|XP_010666274.1|  PREDICTED: auxin-binding protein ABP19a-like       233   4e-73   
ref|XP_003627273.1|  Germin-like protein                                233   5e-73   
ref|XP_010666307.1|  PREDICTED: auxin-binding protein ABP19a-like       233   6e-73   
ref|XP_010666277.1|  PREDICTED: auxin-binding protein ABP19a-like       232   1e-72   
ref|XP_003547722.1|  PREDICTED: auxin-binding protein ABP19a-like       231   1e-72   
gb|ABK25578.1|  unknown                                                 231   3e-72   Picea sitchensis
gb|ABK22930.1|  unknown                                                 230   5e-72   Picea sitchensis
ref|XP_007135442.1|  hypothetical protein PHAVU_010G129900g             230   5e-72   
ref|XP_009105920.1|  PREDICTED: germin-like protein 1                   229   6e-72   
ref|XP_010666280.1|  PREDICTED: auxin-binding protein ABP19a-like       229   1e-71   
gb|KCW82126.1|  hypothetical protein EUGRSUZ_C03507                     227   4e-71   
sp|P46271.1|GLP1_BRANA  RecName: Full=Germin-like protein 1; Flag...    228   4e-71   Brassica napus [oilseed rape]
ref|XP_010666275.1|  PREDICTED: auxin-binding protein ABP19a-like       227   1e-70   
ref|XP_009126460.1|  PREDICTED: germin-like protein 1                   225   4e-70   
gb|ACG30276.1|  auxin-binding protein ABP20 precursor                   223   2e-69   Zea mays [maize]
ref|XP_003528524.1|  PREDICTED: auxin-binding protein ABP19a-like       223   2e-69   
gb|EMT30411.1|  Germin-like protein 8-14                                224   3e-69   
gb|KHN01407.1|  Auxin-binding protein ABP19a                            223   4e-69   
ref|XP_010688043.1|  PREDICTED: auxin-binding protein ABP19a-like       223   4e-69   
ref|XP_004973626.1|  PREDICTED: germin-like protein 8-14-like           223   5e-69   
gb|ADD71875.1|  germin-like protein subfamily 3 member 3 precursor      223   6e-69   Arachis hypogaea [goober]
ref|XP_004288274.1|  PREDICTED: auxin-binding protein ABP19a-like       222   6e-69   
emb|CDX96421.1|  BnaA07g30320D                                          222   9e-69   
emb|CDX72929.1|  BnaC06g33770D                                          222   9e-69   
gb|ABS86850.1|  oxalate oxidase                                         222   1e-68   Arachis hypogaea [goober]
ref|XP_008786633.1|  PREDICTED: germin-like protein 8-14                221   2e-68   
ref|XP_004510468.1|  PREDICTED: germin-like protein 8-14-like           219   5e-68   
ref|XP_010672291.1|  PREDICTED: auxin-binding protein ABP19a-like       219   7e-68   
ref|XP_010672290.1|  PREDICTED: auxin-binding protein ABP19a-like       219   2e-67   
ref|XP_006595343.1|  PREDICTED: auxin-binding protein ABP19a-like       217   2e-67   
ref|XP_003627275.1|  Germin-like protein                                218   2e-67   
ref|XP_007135441.1|  hypothetical protein PHAVU_010G129800g             217   5e-67   
ref|XP_003627279.1|  Germin-like protein                                217   7e-67   
ref|XP_003627280.1|  Germin-like protein                                217   8e-67   
ref|XP_010917183.1|  PREDICTED: germin-like protein 8-14                216   8e-67   
ref|XP_010688042.1|  PREDICTED: auxin-binding protein ABP19a-like       217   9e-67   
emb|CAN74028.1|  hypothetical protein VITISV_013539                     216   9e-67   Vitis vinifera
gb|EAZ30088.1|  hypothetical protein OsJ_14150                          217   1e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001240182.1|  auxin-binding protein ABP19a-like precursor        216   1e-66   
ref|NP_001236898.1|  uncharacterized protein LOC100527498 precursor     216   1e-66   
gb|KHN01412.1|  Auxin-binding protein ABP19a                            216   2e-66   
ref|XP_009126458.1|  PREDICTED: germin-like protein subfamily 3 m...    216   2e-66   
ref|XP_007135440.1|  hypothetical protein PHAVU_010G129700g             215   2e-66   
ref|XP_010687709.1|  PREDICTED: auxin-binding protein ABP19a-like       216   2e-66   
ref|XP_003528531.2|  PREDICTED: auxin-binding protein ABP19a-like       216   3e-66   
ref|XP_003627277.1|  Germin-like protein                                215   3e-66   
ref|XP_002445609.1|  hypothetical protein SORBIDRAFT_07g022520          216   3e-66   Sorghum bicolor [broomcorn]
gb|KHN01409.1|  Auxin-binding protein ABP19a                            214   6e-66   
ref|XP_004510469.1|  PREDICTED: auxin-binding protein ABP19a-like       214   9e-66   
gb|AFK35921.1|  unknown                                                 214   1e-65   
ref|XP_002274739.1|  PREDICTED: auxin-binding protein ABP19a            214   1e-65   Vitis vinifera
gb|EMS64736.1|  Germin-like protein 8-14                                214   1e-65   
ref|XP_004303796.1|  PREDICTED: auxin-binding protein ABP19a-like...    214   1e-65   
ref|XP_010666278.1|  PREDICTED: auxin-binding protein ABP19a-like       213   2e-65   
gb|EMT28865.1|  Germin-like protein 8-14                                213   2e-65   
ref|XP_006652155.1|  PREDICTED: germin-like protein 8-14-like           213   4e-65   
ref|XP_010687565.1|  PREDICTED: auxin-binding protein ABP19a-like       213   5e-65   
gb|KCW81978.1|  hypothetical protein EUGRSUZ_C03347                     211   9e-65   
emb|CAI56441.1|  germin-like protein                                    211   1e-64   Cicer arietinum [garbanzo]
ref|XP_004288296.1|  PREDICTED: auxin-binding protein ABP19a-like       211   2e-64   
ref|XP_003632366.1|  PREDICTED: auxin-binding protein ABP19a-like       211   2e-64   
dbj|BAJ98352.1|  predicted protein                                      210   3e-64   
gb|AAG36666.1|  oxalate oxidase-like germin 171                         209   7e-64   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010670849.1|  PREDICTED: auxin-binding protein ABP19a-like       209   9e-64   
ref|XP_010687789.1|  PREDICTED: auxin-binding protein ABP19a-like       209   1e-63   
ref|XP_002264949.1|  PREDICTED: auxin-binding protein ABP19a            208   2e-63   Vitis vinifera
ref|XP_010670843.1|  PREDICTED: auxin-binding protein ABP19a-like       206   8e-63   
ref|XP_010666281.1|  PREDICTED: auxin-binding protein ABP19b-like       206   2e-62   
ref|XP_010670845.1|  PREDICTED: auxin-binding protein ABP19a-like       205   3e-62   
ref|XP_010666282.1|  PREDICTED: auxin-binding protein ABP19b-like       205   3e-62   
ref|XP_004973625.1|  PREDICTED: germin-like protein 8-14-like           204   1e-61   
ref|XP_010666313.1|  PREDICTED: auxin-binding protein ABP19b-like       202   4e-61   
ref|XP_006837025.1|  hypothetical protein AMTR_s00110p00020470          202   4e-61   
ref|XP_010666317.1|  PREDICTED: auxin-binding protein ABP19b-like       201   8e-61   
gb|EAZ07239.1|  hypothetical protein OsI_29483                          202   8e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001175609.1|  Os08g0459700                                       201   8e-61   
ref|XP_010666297.1|  PREDICTED: auxin-binding protein ABP19b-like       200   3e-60   
ref|XP_010666316.1|  PREDICTED: auxin-binding protein ABP19b-like       199   6e-60   
gb|AFK33656.1|  unknown                                                 198   1e-59   
ref|XP_010666311.1|  PREDICTED: auxin-binding protein ABP19b-like       198   2e-59   
ref|NP_001266709.1|  auxin-binding protein ABP20 precursor              198   2e-59   
ref|NP_001130872.1|  uncharacterized protein LOC100191976 precursor     197   3e-59   Zea mays [maize]
gb|AFW78895.1|  auxin-binding protein ABP20                             197   3e-59   
ref|XP_010495333.1|  PREDICTED: germin-like protein subfamily 3 m...    196   4e-59   
sp|P45853.1|GLP1_IPONI  RecName: Full=Germin-like protein; Flags:...    197   6e-59   Ipomoea nil [qian niu]
ref|XP_010665051.1|  PREDICTED: uncharacterized protein LOC100266509    203   1e-58   
ref|XP_004288941.1|  PREDICTED: auxin-binding protein ABP19a-like       195   2e-58   
ref|XP_003595410.1|  Germin-like protein                                195   3e-58   
ref|XP_010683942.1|  PREDICTED: auxin-binding protein ABP19a-like       193   1e-57   
ref|XP_010683952.1|  PREDICTED: auxin-binding protein ABP19a-like       193   1e-57   
ref|XP_010683943.1|  PREDICTED: auxin-binding protein ABP19a-like       193   2e-57   
ref|XP_010670847.1|  PREDICTED: auxin-binding protein ABP19a-like       192   2e-57   
ref|XP_010683953.1|  PREDICTED: auxin-binding protein ABP19a-like       192   3e-57   
ref|XP_010684017.1|  PREDICTED: auxin-binding protein ABP19a-like       194   3e-57   
gb|KEH37655.1|  auxin-binding protein ABP19a                            192   4e-57   
gb|AAG36667.1|  oxalate oxidase-like germin 172                         192   4e-57   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAG36665.1|  oxalate oxidase-like germin 165                         191   5e-57   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010689545.1|  PREDICTED: auxin-binding protein ABP19a-like       191   5e-57   
ref|XP_010683950.1|  PREDICTED: auxin-binding protein ABP19a-like       191   6e-57   
ref|XP_010683929.1|  PREDICTED: auxin-binding protein ABP19a-like       191   8e-57   
ref|XP_010670844.1|  PREDICTED: auxin-binding protein ABP19a-like       190   1e-56   
ref|XP_010670848.1|  PREDICTED: auxin-binding protein ABP19a-like       190   2e-56   
gb|AHM10392.1|  GLP                                                     190   2e-56   
ref|XP_010683951.1|  PREDICTED: auxin-binding protein ABP19a-like       190   2e-56   
emb|CAN81765.1|  hypothetical protein VITISV_038014                     189   3e-56   Vitis vinifera
gb|AAO85278.1|  germin-like protein Wageningen 1                        189   4e-56   Beta vulgaris [beet]
ref|XP_010675440.1|  PREDICTED: auxin-binding protein ABP19a-like       189   5e-56   
ref|XP_010689601.1|  PREDICTED: auxin-binding protein ABP19b-like       189   6e-56   
ref|XP_006659476.1|  PREDICTED: germin-like protein 8-13-like           189   8e-56   
ref|XP_003594910.1|  Germin-like protein subfamily 3 member             188   9e-56   
gb|AFK44522.1|  unknown                                                 188   1e-55   
gb|AES68967.2|  germin family 3 protein                                 188   1e-55   
ref|XP_010683949.1|  PREDICTED: auxin-binding protein ABP19a-like       187   2e-55   
ref|XP_010670840.1|  PREDICTED: auxin-binding protein ABP19a-like       187   2e-55   
gb|ADD71881.1|  germin-like protein subfamily 3 member 2 precursor      187   2e-55   Arachis hypogaea [goober]
ref|XP_010670839.1|  PREDICTED: auxin-binding protein ABP19a-like       187   8e-55   
ref|XP_010670841.1|  PREDICTED: auxin-binding protein ABP19a-like       186   1e-54   
ref|XP_010670838.1|  PREDICTED: auxin-binding protein ABP19a-like       185   2e-54   
ref|XP_003604394.1|  Germin-like protein                                185   2e-54   
gb|KCW82113.1|  hypothetical protein EUGRSUZ_C03488                     183   2e-54   
ref|XP_003598716.1|  Germin-like protein 8-14                           187   4e-54   
ref|XP_008664608.1|  PREDICTED: germin-like protein 8-13                184   5e-54   
ref|XP_008664607.1|  PREDICTED: germin-like protein 8-13                184   8e-54   
ref|XP_003598711.1|  Germin-like protein                                183   1e-53   
ref|NP_001148746.1|  germin-like protein 1 precursor                    183   2e-53   
ref|XP_010683946.1|  PREDICTED: auxin-binding protein ABP19a-like       182   2e-53   
ref|XP_003598714.1|  Germin-like protein                                184   2e-53   
gb|AES68965.2|  auxin-binding protein ABP19a                            182   3e-53   
gb|KHN01411.1|  Germin-like protein subfamily 3 member 3                182   3e-53   
gb|AAK28807.1|AF310960_3  germin-like protein                           181   6e-53   
ref|XP_003627289.1|  Germin-like protein                                181   1e-52   
ref|XP_004510470.1|  PREDICTED: uncharacterized protein LOC101508818    186   1e-52   
ref|XP_002445608.1|  hypothetical protein SORBIDRAFT_07g022510          180   1e-52   
ref|NP_001236424.1|  uncharacterized protein LOC100305768 precursor     179   5e-52   
ref|XP_003612996.1|  Auxin-binding protein ABP19a                       178   1e-51   
ref|XP_004287631.1|  PREDICTED: auxin-binding protein ABP19b-like       178   1e-51   
ref|XP_006604971.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    177   1e-51   
tpg|DAA48780.1|  TPA: hypothetical protein ZEAMMB73_768604              178   2e-51   
gb|KEH16191.1|  germin family 3 protein                                 176   4e-51   
ref|XP_004288978.1|  PREDICTED: auxin-binding protein ABP19a-like       175   1e-50   
ref|XP_002985836.1|  hypothetical protein SELMODRAFT_271813             176   1e-50   
ref|XP_002961897.1|  hypothetical protein SELMODRAFT_227249             175   1e-50   
ref|XP_002984776.1|  hypothetical protein SELMODRAFT_271729             175   2e-50   
ref|XP_003621280.1|  Germin-like protein 8-14                           174   3e-50   
ref|XP_002971188.1|  hypothetical protein SELMODRAFT_228015             173   8e-50   
ref|XP_002988491.1|  hypothetical protein SELMODRAFT_229376             173   1e-49   
ref|XP_003627287.1|  Germin-like protein                                172   2e-49   
tpg|DAA48779.1|  TPA: hypothetical protein ZEAMMB73_510963              175   2e-49   
ref|XP_002263714.1|  PREDICTED: auxin-binding protein ABP19a-like       171   2e-49   
ref|XP_002986338.1|  hypothetical protein SELMODRAFT_123774             172   3e-49   
ref|XP_002985837.1|  hypothetical protein SELMODRAFT_446428             174   4e-49   
ref|XP_002981345.1|  hypothetical protein SELMODRAFT_114208             171   5e-49   
gb|KHN39629.1|  Auxin-binding protein ABP19a                            170   5e-49   
ref|XP_002986337.1|  hypothetical protein SELMODRAFT_123769             171   5e-49   
ref|XP_002979113.1|  hypothetical protein SELMODRAFT_109813             171   6e-49   
ref|XP_002986434.1|  hypothetical protein SELMODRAFT_123878             171   7e-49   
ref|XP_002979115.1|  hypothetical protein SELMODRAFT_109970             171   1e-48   
ref|XP_003547710.1|  PREDICTED: auxin-binding protein ABP19a-like       170   1e-48   
ref|XP_002986439.1|  hypothetical protein SELMODRAFT_123791             170   1e-48   
ref|XP_002969737.1|  hypothetical protein SELMODRAFT_92705              170   1e-48   
ref|XP_002964838.1|  hypothetical protein SELMODRAFT_227520             170   2e-48   
ref|XP_002986433.1|  hypothetical protein SELMODRAFT_123956             170   2e-48   
ref|XP_002978995.1|  hypothetical protein SELMODRAFT_109968             169   2e-48   
ref|XP_002986335.1|  hypothetical protein SELMODRAFT_123975             169   2e-48   
ref|XP_002981346.1|  hypothetical protein SELMODRAFT_114245             169   3e-48   
ref|XP_002961768.1|  hypothetical protein SELMODRAFT_227294             169   4e-48   
ref|XP_002979117.1|  hypothetical protein SELMODRAFT_109767             169   4e-48   
ref|XP_003601113.1|  Germin-like protein 8-13                           168   5e-48   
ref|XP_002979114.1|  hypothetical protein SELMODRAFT_109995             169   6e-48   
ref|XP_004303797.1|  PREDICTED: auxin-binding protein ABP19a-like...    166   6e-48   
ref|NP_001052383.1|  Os04g0288100                                       169   6e-48   
ref|XP_002964624.1|  hypothetical protein SELMODRAFT_81894              168   7e-48   
ref|XP_002978861.1|  hypothetical protein SELMODRAFT_228582             168   8e-48   
ref|XP_002989518.1|  hypothetical protein SELMODRAFT_235813             168   9e-48   
ref|XP_003547711.1|  PREDICTED: auxin-binding protein ABP19a-like       168   9e-48   
gb|KHN27553.1|  Germin-like protein 1                                   167   1e-47   
gb|ADD71878.1|  germin-like protein subfamily 3 member 1 precursor      167   1e-47   
ref|XP_002962817.1|  hypothetical protein SELMODRAFT_78485              167   2e-47   
gb|KHN27554.1|  Germin-like protein 1                                   166   3e-47   
ref|XP_003627288.1|  Germin-like protein                                172   3e-47   
ref|XP_003547730.1|  PREDICTED: germin-like protein-like                166   4e-47   
emb|CAD40409.3|  OSJNBa0065J03.5                                        172   5e-47   
ref|XP_006599799.1|  PREDICTED: auxin-binding protein ABP19a-like       165   7e-47   
ref|XP_002981347.1|  hypothetical protein SELMODRAFT_114518             164   2e-46   
ref|XP_002969738.1|  hypothetical protein SELMODRAFT_92738              164   2e-46   
gb|KEH18478.1|  germin family 3 protein                                 163   3e-46   
emb|CAN80715.1|  hypothetical protein VITISV_042933                     174   6e-46   
gb|ABC86741.1|  auxin-binding protein                                   160   8e-46   
gb|AET01764.2|  auxin-binding protein ABP19b                            162   2e-45   
ref|XP_010688041.1|  PREDICTED: auxin-binding protein ABP19a-like       160   3e-45   
ref|XP_007099749.1|  Germin-like protein subfamily T member 2           162   7e-45   
ref|XP_006597668.1|  PREDICTED: putative germin-like protein 2-1-...    160   1e-44   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    158   5e-44   
ref|XP_003593959.1|  Auxin-binding protein ABP19a                       158   6e-44   
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     158   7e-44   
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    157   1e-43   
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     157   1e-43   
gb|KCW64213.1|  hypothetical protein EUGRSUZ_G01863                     156   1e-43   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     157   2e-43   
emb|CDP10146.1|  unnamed protein product                                156   3e-43   
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    156   3e-43   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     156   5e-43   
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     155   5e-43   
ref|XP_002968588.1|  hypothetical protein SELMODRAFT_89841              155   5e-43   
ref|XP_002975893.1|  hypothetical protein SELMODRAFT_104757             155   6e-43   
ref|XP_003546275.1|  PREDICTED: putative germin-like protein 2-1-...    155   1e-42   
gb|ABK23834.1|  unknown                                                 154   1e-42   
gb|EYU39943.1|  hypothetical protein MIMGU_mgv1a022829mg                154   2e-42   
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     154   2e-42   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    154   2e-42   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    154   2e-42   
gb|KDP34915.1|  hypothetical protein JCGZ_09203                         154   2e-42   
gb|AAM28275.1|  germin-like protein                                     154   2e-42   
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     154   4e-42   
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     153   4e-42   
emb|CAN74027.1|  hypothetical protein VITISV_013538                     157   5e-42   
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...    153   5e-42   
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     153   6e-42   
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    153   8e-42   
emb|CDP12575.1|  unnamed protein product                                158   9e-42   
ref|XP_002994219.1|  hypothetical protein SELMODRAFT_272356             152   1e-41   
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    152   1e-41   
ref|XP_002266412.1|  PREDICTED: putative germin-like protein 2-1        152   1e-41   
ref|XP_010485791.1|  PREDICTED: germin-like protein subfamily 1 m...    152   1e-41   
ref|XP_006597667.1|  PREDICTED: putative germin-like protein 2-1-...    152   1e-41   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     152   1e-41   
ref|XP_001782709.1|  predicted protein                                  152   2e-41   
ref|XP_006299201.1|  hypothetical protein CARUB_v10015347mg             152   2e-41   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    152   2e-41   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    152   2e-41   
ref|XP_008779054.1|  PREDICTED: oxalate oxidase 1-like                  152   2e-41   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    157   2e-41   
ref|XP_004158659.1|  PREDICTED: putative germin-like protein 2-1-...    151   2e-41   
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...    152   2e-41   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    151   2e-41   
ref|XP_008777189.1|  PREDICTED: germin-like protein 3-8                 151   3e-41   
ref|XP_007147457.1|  hypothetical protein PHAVU_006G126200g             151   3e-41   
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    151   4e-41   
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    151   4e-41   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    151   4e-41   
ref|XP_008439537.1|  PREDICTED: putative germin-like protein 2-1        150   4e-41   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    150   5e-41   
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    150   6e-41   
ref|XP_009604370.1|  PREDICTED: putative germin-like protein 2-3        150   6e-41   
emb|CAN74480.1|  hypothetical protein VITISV_042844                     149   6e-41   
ref|XP_004299636.1|  PREDICTED: germin-like protein subfamily T m...    150   6e-41   
emb|CAN71631.1|  hypothetical protein VITISV_015711                     150   7e-41   
ref|XP_006362217.1|  PREDICTED: putative germin-like protein 2-3-...    150   7e-41   
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    155   7e-41   
ref|XP_002267172.1|  PREDICTED: putative germin-like protein 2-2        150   7e-41   
emb|CAN70189.1|  hypothetical protein VITISV_016562                     150   7e-41   
ref|XP_011037744.1|  PREDICTED: putative germin-like protein 2-1        150   7e-41   
ref|XP_003594592.1|  Germin-like protein subfamily 1 member             150   8e-41   
emb|CAA11031.1|  germin-like protein                                    146   8e-41   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          150   9e-41   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        150   1e-40   
gb|KEH37070.1|  rhicadhesin receptor                                    149   1e-40   
emb|CAN66771.1|  hypothetical protein VITISV_022559                     149   1e-40   
ref|XP_010678642.1|  PREDICTED: germin-like protein subfamily T m...    150   1e-40   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     150   1e-40   
ref|XP_009388348.1|  PREDICTED: germin-like protein 3-8                 150   1e-40   
ref|XP_009762345.1|  PREDICTED: putative germin-like protein 2-3        149   1e-40   
ref|XP_008439536.1|  PREDICTED: germin-like protein 8-2                 150   1e-40   
ref|XP_010053014.1|  PREDICTED: putative germin-like protein 2-3        149   1e-40   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    150   1e-40   
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        150   1e-40   
ref|XP_002523176.1|  Rhicadhesin receptor precursor, putative           149   1e-40   
ref|XP_004134617.1|  PREDICTED: putative germin-like protein 2-1-...    149   1e-40   
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    149   1e-40   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    149   1e-40   
emb|CBI33612.3|  unnamed protein product                                149   1e-40   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        149   1e-40   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    149   2e-40   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        149   2e-40   
ref|XP_010054737.1|  PREDICTED: putative germin-like protein 2-1        149   2e-40   
ref|XP_004249175.1|  PREDICTED: putative germin-like protein 2-3        149   2e-40   
ref|XP_011037778.1|  PREDICTED: putative germin-like protein 2-1        149   2e-40   
gb|EYU42241.1|  hypothetical protein MIMGU_mgv1a020139mg                149   2e-40   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        149   2e-40   
ref|XP_008225641.1|  PREDICTED: putative germin-like protein 2-1 ...    149   3e-40   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...    149   3e-40   
emb|CBI33611.3|  unnamed protein product                                150   3e-40   
ref|XP_004134615.1|  PREDICTED: putative germin-like protein 2-1-...    148   3e-40   
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    149   3e-40   
ref|XP_006448875.1|  hypothetical protein CICLE_v10016638mg             148   4e-40   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    148   4e-40   
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1        147   4e-40   
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        148   4e-40   
ref|XP_009396913.1|  PREDICTED: germin-like protein 3-8                 148   4e-40   
gb|EPS67173.1|  hypothetical protein M569_07603                         148   4e-40   
ref|XP_006362219.1|  PREDICTED: putative germin-like protein 2-3-...    148   4e-40   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        148   4e-40   
emb|CDP10107.1|  unnamed protein product                                148   5e-40   
ref|XP_008393086.1|  PREDICTED: germin-like protein subfamily T m...    148   5e-40   
gb|EYU39286.1|  hypothetical protein MIMGU_mgv1a023985mg                148   5e-40   
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    148   5e-40   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    148   5e-40   
ref|XP_004134614.1|  PREDICTED: putative germin-like protein 2-3-...    148   6e-40   
ref|XP_009758467.1|  PREDICTED: putative germin-like protein 2-3        148   6e-40   
ref|NP_001050793.1|  Os03g0651800                                       148   6e-40   
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    147   6e-40   
emb|CBI33610.3|  unnamed protein product                                150   6e-40   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584    154   6e-40   
ref|XP_008239678.1|  PREDICTED: germin-like protein subfamily T m...    148   6e-40   
ref|XP_004163319.1|  PREDICTED: germin-like protein subfamily 3 m...    147   7e-40   
ref|XP_010934325.1|  PREDICTED: oxalate oxidase 1-like                  148   7e-40   
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     147   7e-40   
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          147   7e-40   
gb|EMT24696.1|  hypothetical protein F775_52705                         147   8e-40   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        148   8e-40   
ref|XP_011075127.1|  PREDICTED: putative germin-like protein 2-1 ...    147   8e-40   
ref|XP_004134624.1|  PREDICTED: putative germin-like protein 2-1-...    147   8e-40   
ref|XP_009761605.1|  PREDICTED: putative germin-like protein 2-3        146   8e-40   
ref|XP_007211145.1|  hypothetical protein PRUPE_ppa026808mg             147   9e-40   
ref|XP_003598719.1|  Germin-like protein                                150   9e-40   
gb|EYU42260.1|  hypothetical protein MIMGU_mgv1a020034mg                147   9e-40   
gb|KDP23867.1|  hypothetical protein JCGZ_27136                         147   9e-40   
ref|XP_008439539.1|  PREDICTED: putative germin-like protein 2-1        147   1e-39   
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...    147   1e-39   
ref|XP_001764390.1|  predicted protein                                  147   1e-39   
ref|XP_009362202.1|  PREDICTED: putative germin-like protein 2-1        147   1e-39   
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...    147   1e-39   
ref|NP_001268198.1|  germin-like protein 3 precursor                    147   1e-39   
emb|CBI36791.3|  unnamed protein product                                147   1e-39   
ref|XP_006468353.1|  PREDICTED: putative germin-like protein 2-1-...    147   1e-39   
ref|XP_001756112.1|  predicted protein                                  147   1e-39   
ref|XP_010272156.1|  PREDICTED: germin-like protein subfamily T m...    147   1e-39   
ref|XP_010053013.1|  PREDICTED: putative germin-like protein 2-1        147   1e-39   
ref|XP_009362201.1|  PREDICTED: putative germin-like protein 2-1        147   2e-39   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    147   2e-39   
ref|XP_008225640.1|  PREDICTED: putative germin-like protein 2-1 ...    146   2e-39   
ref|XP_004952510.1|  PREDICTED: putative germin-like protein 2-2-...    147   2e-39   
ref|XP_004143382.1|  PREDICTED: germin-like protein subfamily 3 m...    146   2e-39   
ref|XP_006377955.1|  germin-like protein 1                              146   2e-39   
emb|CAN72994.1|  hypothetical protein VITISV_000563                     146   2e-39   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        146   2e-39   



>gb|EYU28339.1| hypothetical protein MIMGU_mgv1a013656mg [Erythranthe guttata]
Length=214

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 2/191 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS P GPAGYPCKKS+SVTENDF + GLAAAGNT NII AAVTPAFD QFPGVN
Sbjct  25   DFCIADLSHPAGPAGYPCKKSSSVTENDFFFHGLAAAGNTKNIISAAVTPAFDGQFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+PLHTHP GSEILVV +GT++AG +SSF+NKVY  KTL +GDVM
Sbjct  85   GLGLSIARLDLAPGGVIPLHTHPAGSEILVVIQGTITAGLISSFENKVYI-KTLNKGDVM  143

Query  465  VFPQGLLHFQINVGK-TKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            VFPQGLLHFQIN GK T A AFV+FSSQNPGLQIT FALF+ND PT++V   TFLD AQI
Sbjct  144  VFPQGLLHFQINSGKGTPAQAFVSFSSQNPGLQITDFALFQNDFPTELVAKTTFLDVAQI  203

Query  642  KKLKSVLGGTN  674
            KKLK VLGGTN
Sbjct  204  KKLKGVLGGTN  214



>gb|EYU25861.1| hypothetical protein MIMGU_mgv1a013719mg [Erythranthe guttata]
Length=212

 Score =   293 bits (750),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKKS+SVT +DF + GLAAAGNTTNII AAVTPAFD QFPGVN
Sbjct  24   DFCVADLSLPAGPAGYPCKKSSSVTADDFAFHGLAAAGNTTNIISAAVTPAFDGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+P+HTHP  SEILVV EGT+ AG +SSFDN VY  KTL +GDVM
Sbjct  84   GLGVSIARLDLAAGGVIPIHTHPAASEILVVIEGTICAGLISSFDNVVYL-KTLFKGDVM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A A+V+FS QNPGLQIT FALF ND PT++V   TFLD AQIK
Sbjct  143  VFPQGLLHFQINSGKTPALAYVSFSGQNPGLQITDFALFANDFPTELVAKTTFLDVAQIK  202

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  203  KLKGVLGGT  211



>ref|XP_011093822.1| PREDICTED: auxin-binding protein ABP19a-like [Sesamum indicum]
Length=211

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKK+ SVT +DF Y GLA AGNT+NII A VTPAFDAQFPGVN
Sbjct  23   DFCVADLSLPAGPAGYPCKKAASVTADDFAYHGLATAGNTSNIISAFVTPAFDAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGV+PLHTHP  SEILVV EGT+ AG +SSFDN VY  KTL +GDVM
Sbjct  83   GLGVSIARLDLGVGGVIPLHTHPAASEILVVIEGTICAGLISSFDNVVYL-KTLNKGDVM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A AFV+FS  NPGLQI  FALFKND PT++V   TFLD AQIK
Sbjct  142  VFPQGLLHFQINSGKTPALAFVSFSGPNPGLQILDFALFKNDFPTELVAKTTFLDVAQIK  201

Query  645  KLKSVLGGTN  674
            KLK+VLGGTN
Sbjct  202  KLKAVLGGTN  211



>gb|EPS70693.1| germin-like protein, partial [Genlisea aurea]
Length=204

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKK++ VT +DF Y GLAAAGNTTNII+AAVTPAFD QFP VN
Sbjct  17   DFCVADLSLPAGPAGYPCKKTSEVTADDFAYGGLAAAGNTTNIIRAAVTPAFDGQFPAVN  76

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GL +S+ARLD+ VGGV+PLHTHP  SE+LVV +GT+ AGF+SSF+N VY  KTL +GDVM
Sbjct  77   GLEISIARLDLAVGGVIPLHTHPAASEVLVVIQGTICAGFISSFENVVYL-KTLNKGDVM  135

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   + AFV+FSSQNPGLQIT FALFKND PTD+V   TFLD  QIK
Sbjct  136  VFPQGLLHFQINSGNHPSIAFVSFSSQNPGLQITDFALFKNDFPTDLVAKTTFLDVQQIK  195

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  196  KLKGVLGGT  204



>ref|XP_010666273.1| PREDICTED: auxin-binding protein ABP19a [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 157/190 (83%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+LP GPAGY CK    VT +DFVY GLAAAGNT+N+IKAAVTPAF AQFPGVN
Sbjct  21   DFCVADLNLPDGPAGYSCKSPAKVTADDFVYHGLAAAGNTSNLIKAAVTPAFSAQFPGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI VGGV+P+HTHPGGSEILVV +G + AGFVSS  N VY  KTL  GDVM
Sbjct  81   GLGISIARLDIAVGGVIPMHTHPGGSEILVVIQGQICAGFVSS-ANSVYI-KTLNRGDVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A AFV+FS  +PGLQIT FALF N LPT+IV T TFLD+A +K
Sbjct  139  VFPQGLLHFQINSGKSPAIAFVSFSDPSPGLQITDFALFANSLPTEIVTTTTFLDKATVK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>gb|KDP33908.1| hypothetical protein JCGZ_07479 [Jatropha curcas]
Length=208

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 159/190 (84%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LS P GPAG+ CKK+ SVT  DFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  21   DFCVGDLSGPEGPAGFSCKKAASVTVKDFVYSGLGVAGNTTNIIKAAVTPAFAAQFPGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+  GGV+P HTHPG SE+LVV +GT+ AGFVSS  NKV++ +TLK+GD+M
Sbjct  81   GLGISMARLDLAPGGVIPFHTHPGASEVLVVIQGTICAGFVSS-ANKVFF-QTLKKGDIM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G + A AFV+FSS  PGLQI  +ALF NDLP+DI++  TFLD AQ+K
Sbjct  139  VFPQGLLHFQINGGGSPALAFVSFSSPFPGLQILDYALFGNDLPSDIIEMTTFLDAAQVK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>gb|AFK44812.1| unknown [Lotus japonicus]
Length=210

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 156/189 (83%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAF AQFPGVN
Sbjct  23   DFCVGDLTFPNGPAGYACKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFGAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE LVV +GT+ AGFV+S DN VY  KTLK+GDVM
Sbjct  83   GLGISLARLDLASGGVIPLHTHPGASEALVVVQGTICAGFVAS-DNTVYL-KTLKKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G + A AFV+FSS NPGLQI  FALFK+D PTD++   TFLD AQIK
Sbjct  141  VFPQGLLHFQINDGGSSALAFVSFSSANPGLQILDFALFKSDFPTDLIAATTFLDAAQIK  200

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  201  KLKGVLGGS  209



>ref|XP_004243715.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum lycopersicum]
Length=211

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 166/212 (78%), Gaps = 4/212 (2%)
 Frame = +3

Query  48   MFLQTLFI---lsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAG  218
            M+ Q LF+   + + S+ +  LDFCVG+LSLP GP GY CKK + VT +DFV+SGLAA G
Sbjct  1    MYFQALFLFSLVIISSSQAAVLDFCVGDLSLPDGPGGYACKKPSKVTADDFVFSGLAATG  60

Query  219  NTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSA  398
                +IKAAVTPAF  QFPGVNGLG+SMARLD+ + GV+P+HTHPG SE+L V +G + A
Sbjct  61   KIIPLIKAAVTPAFAPQFPGVNGLGISMARLDLAISGVIPMHTHPGASEVLYVVQGEICA  120

Query  399  GFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFAL  578
            GF+SS DNKV++ KTLK+GD+MVFPQGLLHFQIN GKT A A ++FSS  PGLQIT FAL
Sbjct  121  GFISSSDNKVFF-KTLKQGDIMVFPQGLLHFQINSGKTSALAIISFSSPTPGLQITDFAL  179

Query  579  FKNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            F NDLPT++V   TFLD A IKKLK VLGGTN
Sbjct  180  FANDLPTELVAATTFLDAALIKKLKGVLGGTN  211



>ref|XP_007012661.1| Germin protein subfamily 3 member 3 [Theobroma cacao]
 gb|EOY30280.1| Germin protein subfamily 3 member 3 [Theobroma cacao]
Length=275

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 4/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     PAGY CK  T+VT +DFV+SGL AAGNT+N+IKAAVTPAFDAQFPGVN
Sbjct  90   DFCVADLKGLQSPAGYSCK--TAVTVDDFVFSGLGAAGNTSNLIKAAVTPAFDAQFPGVN  147

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGVVP+HTHPGGSEIL+V +G++ AGF+SS  NKVY+ K+LK GD+M
Sbjct  148  GLGVSIARLDLAVGGVVPMHTHPGGSEILLVVQGSICAGFISS-ANKVYF-KSLKRGDIM  205

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A AF +FSS NPGLQI  FALF NDLPT+I+K VTFLD+AQ+K
Sbjct  206  VFPQGLLHFQINAGKTLALAFASFSSPNPGLQILDFALFGNDLPTEIIKQVTFLDDAQVK  265

Query  645  KLKSVLGGTN  674
            KLK VLGG N
Sbjct  266  KLKRVLGGIN  275



>gb|ABV03161.1| germin-like protein [Chimonanthus praecox]
Length=214

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK   VT +DFV+SGL  AGNT+NII+AAVTPAF AQFPG+N
Sbjct  26   DFCVGDLTGPEGPAGYSCKKPAIVTVDDFVFSGLGKAGNTSNIIRAAVTPAFSAQFPGLN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+ V GV+PLHTHPGGSE+LVV +GT+ AGF+SS  N VY+ KTLK+GD+M
Sbjct  86   GLGLSIARLDLAVEGVIPLHTHPGGSELLVVVQGTICAGFISSSANTVYF-KTLKKGDIM  144

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   A  FV+FSS +PGLQIT FALF N+LP+++V+  TFLD+AQ+K
Sbjct  145  VFPQGLLHFQINGGGIPAIGFVSFSSPSPGLQITAFALFANNLPSELVEKTTFLDDAQVK  204

Query  645  KLKSVLGGT  671
            KLK+VLGGT
Sbjct  205  KLKAVLGGT  213



>ref|XP_006342367.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=211

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 166/212 (78%), Gaps = 4/212 (2%)
 Frame = +3

Query  48   MFLQTLFI---lsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAG  218
            M+ Q LFI   L + S+ +  LDFCVG+LSLP GP GY CKK + VT +DFV+SGLAA  
Sbjct  1    MYFQGLFIFSLLIISSSEAAVLDFCVGDLSLPDGPGGYACKKPSKVTSDDFVFSGLAAPV  60

Query  219  NTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSA  398
                +IKAAVTPAF  QFPG+NGLG+SMARLD+ +GGV+P+HTHPG SE+L V +G + A
Sbjct  61   KLIPLIKAAVTPAFAPQFPGLNGLGISMARLDLAIGGVIPMHTHPGASEVLYVVQGEICA  120

Query  399  GFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFAL  578
            GF+SS DNKV++ KTLK+GD+MVFPQGLLHFQIN GKT A A V+FSS  PGLQIT FAL
Sbjct  121  GFISSSDNKVFF-KTLKQGDIMVFPQGLLHFQINSGKTSALAIVSFSSPTPGLQITDFAL  179

Query  579  FKNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            F NDLPT++V   TFLD A IKKLK VLGGTN
Sbjct  180  FANDLPTELVAATTFLDAALIKKLKGVLGGTN  211



>ref|XP_008337872.1| PREDICTED: auxin-binding protein ABP19a [Malus domestica]
Length=209

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV N   P GPAGY CKK   VT +DFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVANYKAPEGPAGYACKKPAKVTVDDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+D GGV+P HTHPG SE+L+VA+GT+ AGFVSS  N VY  KTLK+GD+M
Sbjct  82   GLGISLARLDLDAGGVIPFHTHPGASEVLLVAQGTIIAGFVSS-ANTVYL-KTLKKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  KT + A+V+FSS +PGLQI  FALF+NDLPT+++   TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGDKTPSLAYVSFSSPSPGLQILDFALFQNDLPTELIAQTTFLDVAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|XP_009361697.1| PREDICTED: auxin-binding protein ABP19a [Pyrus x bretschneideri]
Length=209

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV N   P GPAGY CKK   VT +DFVYSGL   GNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVANYKAPEGPAGYSCKKPAKVTVDDFVYSGLGIPGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGV+P HTHPG SE+L+VA+GT+ AGFVSS  N VY  KTLK+GD+M
Sbjct  82   GLGISLARLDLAVGGVIPFHTHPGASEVLLVAQGTIIAGFVSS-ANTVYL-KTLKKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  KT A AFV+FSS +PGLQI  FALF+NDLPT+++   TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGDKTPALAFVSFSSPSPGLQILDFALFQNDLPTELIAQTTFLDAAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>gb|ABL86677.1| GLP3 [Gossypium barbadense]
Length=205

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK+  VT NDFVYSGLAA GNT+N+IKAAVTPAF AQFPGVN
Sbjct  19   DFCVGDLNGPVGPAGYSCKKT--VTVNDFVYSGLAATGNTSNLIKAAVTPAFSAQFPGVN  76

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGV+P+HTHPG SE+++V  GTL AGF+SS D+K  YSKTL EGD+M
Sbjct  77   GLGISIARLDLAVGGVIPMHTHPGASELILVMHGTLLAGFMSS-DSKSVYSKTLNEGDIM  135

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN GKT++ AFV+F+S +PG+QI   ++F NDLPT ++   TFLD AQIK
Sbjct  136  VFPRGLLHFQINAGKTQSVAFVSFNSADPGIQIFHLSMFANDLPTGVIAKTTFLDTAQIK  195

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  196  KLKGVLGGT  204



>ref|XP_008337871.1| PREDICTED: auxin-binding protein ABP20 [Malus domestica]
Length=233

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK   +V  +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  46   DFCVADLTAPDGPAGYSCKSPANVKVDDFVFSGLGVAGNTTNIIKAAVTPAFAAQFPGVN  105

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGV+P HTHPGGSE+L+V EGT+ AGFVSS  N VY  +TL++GD+M
Sbjct  106  GLGISLARLDLAVGGVIPFHTHPGGSEVLIVIEGTICAGFVSS-ANTVYL-QTLEKGDIM  163

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+T A AFV+FSS +PGLQI  +ALFKNDLPT+++   TFLD AQIK
Sbjct  164  VFPQGLLHFQVNGGETMALAFVSFSSPSPGLQILDYALFKNDLPTELIAQTTFLDVAQIK  223

Query  645  KLKSVLGGTN  674
            KLK+ LGGTN
Sbjct  224  KLKAALGGTN  233



>ref|XP_008450917.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis melo]
Length=215

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+G+PCKK++ VTE DFVYSGL  AGNT+N+IKAAVTPAF AQFPGVN
Sbjct  28   DFCVADLKSPDTPSGFPCKKASLVTEKDFVYSGLGVAGNTSNLIKAAVTPAFTAQFPGVN  87

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI VGGV+P+HTHP GSEIL+V EGT+ AGFVSS  N VY+ KTL +GD+M
Sbjct  88   GLGISLARLDIAVGGVIPMHTHPAGSEILLVVEGTICAGFVSS-ANTVYF-KTLNKGDIM  145

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK  A  FV+FSS NPGLQI  FALF N+LPTDIV   TFLD   IK
Sbjct  146  VFPQGLLHFQINSGKNTALGFVSFSSPNPGLQILDFALFGNELPTDIVAKTTFLDAVTIK  205

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  206  KLKGVLGGS  214



>emb|CDP03095.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 167/209 (80%), Gaps = 2/209 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTT  227
            M +Q LF  SLL AS+ A DFCV + SLP GPAGY CKK+  VT +DF++S LAA+GNT+
Sbjct  1    MLIQALFFFSLLVASTQAFDFCVADPSLPVGPAGYSCKKTADVTVDDFIFS-LAASGNTS  59

Query  228  NIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFV  407
            NII AAVTPAF   F GVNGLG+S+ARLD  VGGV+P HTHPGGSEILVV +G L AGF+
Sbjct  60   NIISAAVTPAFPPTFAGVNGLGISIARLDFAVGGVIPFHTHPGGSEILVVIQGQLCAGFI  119

Query  408  SSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKN  587
            SS +N+VY+ KTL +GDVM FP+GLLHFQ N GK+ A AFV+FSS NPGLQ+T FA FKN
Sbjct  120  SSLENQVYF-KTLVKGDVMAFPRGLLHFQFNSGKSPALAFVSFSSPNPGLQVTDFAFFKN  178

Query  588  DLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            DLPT+IV   TFLD  QIKKLK++LGGTN
Sbjct  179  DLPTEIVAKTTFLDIPQIKKLKAILGGTN  207



>gb|AEN02469.1| germin-like protein [Camellia sinensis]
Length=212

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 3/210 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsass--halDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M+L  LF++SLL + S    LDFCV + SLP GPAGY CKK   VT NDFVYS L  AG+
Sbjct  3    MYLPILFVVSLLFSYSHGSVLDFCVADFSLPDGPAGYSCKKPAKVTVNDFVYSALGIAGD  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            T N+IKA VTPAF AQFPGVNGLGLSMARLD+ V GVVP+HTHPGGSEIL V EGT+ AG
Sbjct  63   TNNLIKAKVTPAFAAQFPGVNGLGLSMARLDLAVDGVVPIHTHPGGSEILFVVEGTICAG  122

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS  N VY+ KTL +GDVMVFPQGLLHFQ N G   A A V+FSS +PGLQIT FALF
Sbjct  123  FISSSANTVYF-KTLYKGDVMVFPQGLLHFQFNSGNKPALAIVSFSSPSPGLQITDFALF  181

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
             N+LP+ +V+ VTFLD+AQ+KKLK+VLGGT
Sbjct  182  ANNLPSALVEKVTFLDDAQVKKLKAVLGGT  211



>ref|XP_004287629.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CKK   VT +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADLTAPEGPAGYSCKKPAKVTVDDFVFSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ V GV+P HTHPG SE+L+V EGT+ AGFVSS DN VY  +TL+ GD M
Sbjct  82   GLGISLARLDLAVDGVIPFHTHPGASEVLIVVEGTICAGFVSS-DNTVYL-QTLETGDSM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A AFV+FSS +PGLQI  FALFKNDLPT ++   TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGGDTPALAFVSFSSASPGLQILDFALFKNDLPTSLIAQTTFLDVAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|XP_004287628.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   271 bits (692),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK+ +VT +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPEGPAGYSCKKAATVTVDDFVFSGLGVAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+P HTHPG SE+LVV +G + AGF+SS  N VY  KTLK+GD+M
Sbjct  82   GLGISLARLDLAPGGVIPFHTHPGASEVLVVTQGAIVAGFISS-ANTVYL-KTLKKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G + A AFV+FSS +PGLQI  FALFKNDLPT +V + TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGGGSSAVAFVSFSSPSPGLQILDFALFKNDLPTSLVASTTFLDVAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|XP_007202571.1| hypothetical protein PRUPE_ppa011460mg [Prunus persica]
 gb|EMJ03770.1| hypothetical protein PRUPE_ppa011460mg [Prunus persica]
Length=209

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAG+ CKK  SV  NDFV+SGL  AGNT+NIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVTPAFVAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGVVP HTHPG SE+L+VA+GT+ AGFV+S DN  Y  +TL++GD+M
Sbjct  82   GLGISIARLDLAVGGVVPFHTHPGASEVLIVAQGTICAGFVAS-DNTPYL-QTLEKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+  A AF +F S +PGLQI  FALFKNDLPT+++   TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGGEAPALAFASFGSASPGLQILDFALFKNDLPTEVIAQTTFLDAAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>sp|O04011.1|ABP20_PRUPE RecName: Full=Auxin-binding protein ABP20; Flags: Precursor [Prunus 
persica]
 gb|AAB51240.1| auxin-binding protein [Prunus persica]
Length=214

 Score =   270 bits (691),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAG+ CKK  SV  NDFV+SGL  AGNT+NIIKAAVTPAF AQFPGVN
Sbjct  27   DFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVTPAFVAQFPGVN  86

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGVVP HTHPG SE+L+VA+GT+ AGFV+S DN  Y  +TL++GD+M
Sbjct  87   GLGISIARLDLAVGGVVPFHTHPGASEVLIVAQGTICAGFVAS-DNTPYL-QTLEKGDIM  144

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+  A AF +F S +PGLQI  FALFKNDLPT+++   TFLD AQIK
Sbjct  145  VFPQGLLHFQVNGGEAPALAFASFGSASPGLQILDFALFKNDLPTEVIAQTTFLDAAQIK  204

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  205  KLKGVLGGTN  214



>gb|AFK39466.1| unknown [Medicago truncatula]
Length=210

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + +LP GPAGY CK  + VTENDF Y GLAAAGNT+NIIKAAVTPAFDAQF G+N
Sbjct  23   DFCVADYNLPNGPAGYSCKTPSKVTENDFAYHGLAAAGNTSNIIKAAVTPAFDAQFAGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGFVSS  N VY  KTL +GDVM
Sbjct  83   GLGISLARLDLAAGGVIPLHTHPGASEVLVVIQGTICAGFVSS-ANTVYI-KTLYKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G + A AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +K
Sbjct  141  VFPQGLLHFQINSGGSNALAFVSFSSANPGLQILDFALFKSDFPTELITATTFIDAAVVK  200

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  201  KLKGVLGGS  209



>gb|AFK43419.1| unknown [Medicago truncatula]
 gb|KEH37573.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + +LP GPAGY CK  + VTENDF Y GLAAAGNT+NIIKAAVTPAFDAQF G+N
Sbjct  23   DFCVADYNLPNGPAGYSCKTPSKVTENDFAYHGLAAAGNTSNIIKAAVTPAFDAQFAGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGFVSS  N VY  KTL +GDVM
Sbjct  83   GLGISLARLDLAAGGVIPLHTHPGASEVLVVIQGTICAGFVSS-ANTVYI-KTLYKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G + A AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +K
Sbjct  141  VFPQGLLHFQINSGGSNALAFVSFSSANPGLQILDFALFKSDFPTELITATTFIDAAVVK  200

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  201  KLKGVLGGS  209



>ref|XP_004513480.1| PREDICTED: auxin-binding protein ABP19a-like [Cicer arietinum]
Length=210

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DFVY GL+A GNTTNIIKAAVTPAFDAQFPGVN
Sbjct  23   DFCVADYTFPNGPAGYSCKKPSKVTADDFVYHGLSAGGNTTNIIKAAVTPAFDAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +G + AGFVSS DN VY  KTL +GDVM
Sbjct  83   GLGISIARLDLAAGGVIPLHTHPGASEVLVVVQGKICAGFVSS-DNTVYL-KTLYKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G + A AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +K
Sbjct  141  VFPQGLLHFQINGGGSNALAFVSFSSPNPGLQILDFALFKSDFPTELITATTFIDAAVVK  200

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  201  KLKGVLGGS  209



>ref|XP_007202573.1| hypothetical protein PRUPE_ppa011467mg [Prunus persica]
 sp|Q9ZRA4.1|AB19A_PRUPE RecName: Full=Auxin-binding protein ABP19a; Flags: Precursor 
[Prunus persica]
 gb|AAD00295.1| auxin-binding protein ABP19 [Prunus persica]
 gb|EMJ03772.1| hypothetical protein PRUPE_ppa011467mg [Prunus persica]
Length=209

 Score =   268 bits (686),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAKVTINDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+P HTHPG SE+L+V +GT+ AGFV+S DN  Y  KTLK+GD+M
Sbjct  82   GLGISLARLDLGPGGVIPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYL-KTLKKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A AF +FSS +PGLQI  FALFKNDLPT+++   TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLPTELIAQTTFLDAAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|XP_011045993.1| PREDICTED: auxin-binding protein ABP20 [Populus euphratica]
Length=209

 Score =   268 bits (685),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 158/189 (84%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P G+ CKK  +VT +DFV+SGL A GNT+NIIKAAVTPAF  +F GVN
Sbjct  22   DFCVADLTGPDTPTGFVCKKPAAVTVDDFVFSGLGAGGNTSNIIKAAVTPAFADKFAGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+ VGGVVP+HTHPGGSE+L+V  G++ AGF+SS DNKVY+ K+LK+GD+M
Sbjct  82   GLGISMARLDLAVGGVVPMHTHPGGSEVLIVVSGSICAGFISS-DNKVYF-KSLKKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN G T A AFV+FSS+ PGLQI  FALF NDLP++I++  TFLD+AQ+K
Sbjct  140  VFPRGLLHFQINAGGTSALAFVSFSSERPGLQILDFALFANDLPSEIIEKTTFLDDAQVK  199

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  200  KLKGVLGGT  208



>gb|ACA03784.1| putative auxin-binding protein 3 [Prunus salicina]
Length=214

 Score =   268 bits (685),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            ++ T+I  +   F L L S+++   DFCV +L+ P GPAG+ CKK  SV  NDFV+SGL 
Sbjct  2    RQATMIFPILFTFFLLLSSSNAAVQDFCVADLAAPEGPAGFSCKKPASVKVNDFVFSGLG  61

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGT  389
             AGNT+NIIKAAVTPAF AQFPGVNGLG+S+ARLD+ VGGVVP HTHPG SE+LVV EGT
Sbjct  62   IAGNTSNIIKAAVTPAFAAQFPGVNGLGISIARLDLAVGGVVPFHTHPGASEVLVVVEGT  121

Query  390  LSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITT  569
            + AGFV+S DN  Y  +TL++GD+MV PQGLLHFQ+N GK  A AF +F S +PGLQI  
Sbjct  122  ICAGFVAS-DNAPYL-QTLEKGDIMVSPQGLLHFQVNGGKASALAFASFGSASPGLQILD  179

Query  570  FALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            FALFKNDL T+++   TFLD AQIKKLK VLGGTN
Sbjct  180  FALFKNDLATELIAQTTFLDAAQIKKLKGVLGGTN  214



>gb|ADD71879.1| germin-like protein subfamily 3 member 4 precursor [Arachis hypogaea]
Length=211

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFVYSGL A GNT+NIIKAAVTPAFDAQF GVN
Sbjct  24   DFCVADYTAPNGPAGYSCKSPAKVTVDDFVYSGLGAVGNTSNIIKAAVTPAFDAQFAGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS DN VY+ KTLK+GDVM
Sbjct  84   GLGISTARLDLAPGGVIPLHTHPGASELLVVVQGTICAGFISS-DNTVYF-KTLKKGDVM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V+PQGLLHFQ+N G T+A AFV+FSS NPGLQI  FALFK+D PT+++   TFLD A +K
Sbjct  142  VYPQGLLHFQLNGGGTQALAFVSFSSANPGLQILDFALFKSDFPTELITQTTFLDAAXVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGG++
Sbjct  202  KLKGVLGGSS  211



>ref|XP_004144029.1| PREDICTED: auxin-binding protein ABP20-like [Cucumis sativus]
 ref|XP_004161110.1| PREDICTED: auxin-binding protein ABP20-like [Cucumis sativus]
 gb|KGN66292.1| hypothetical protein Csa_1G596420 [Cucumis sativus]
Length=215

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     P+G+PCKK++ VTE DFV+SGL  AGNT+N+IKAAVTPAF AQFPGVN
Sbjct  28   DFCVADLMSADTPSGFPCKKASLVTEKDFVFSGLGVAGNTSNLIKAAVTPAFTAQFPGVN  87

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI VGGV+P+HTHP GSEIL+V EG + AGFVSS  N VY+ KTL +GD+M
Sbjct  88   GLGVSLARLDIAVGGVIPMHTHPAGSEILLVVEGVICAGFVSS-ANTVYF-KTLNKGDIM  145

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQIN GKT A  FV+FSS NPGLQI  FALF N+LPTDIV   TFLD   IK
Sbjct  146  IFPQGLLHFQINSGKTAALGFVSFSSPNPGLQILDFALFGNELPTDIVAKTTFLDPVTIK  205

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  206  KLKGVLGGS  214



>ref|XP_009784907.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=210

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 164/211 (78%), Gaps = 3/211 (1%)
 Frame = +3

Query  48   MFLQTLFIlsll--sasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M  Q+ FI SLL  S+ +  LDFCVG+LS+P GP GY CKK ++VT NDFV+SGLA    
Sbjct  1    MLFQSFFIFSLLFLSSEAAVLDFCVGDLSVPDGPGGYACKKPSAVTANDFVFSGLATPVK  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
               +IKAAVTPAF  QFPG+NGLG+SMARLD+ +GGV+P+HTHPG SE+L V  G + AG
Sbjct  61   LNPLIKAAVTPAFAPQFPGLNGLGISMARLDLAIGGVIPMHTHPGASEVLYVVTGQICAG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS DNKV++ K LK+GD+MVFPQGLLHFQIN GKT + A V+FSS  PGLQIT FALF
Sbjct  121  FISSSDNKVFF-KNLKQGDIMVFPQGLLHFQINSGKTASLAIVSFSSPTPGLQITDFALF  179

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
             NDL T+IV+  TFLD A IKKLK VLGGTN
Sbjct  180  ANDLATEIVQATTFLDAATIKKLKGVLGGTN  210



>emb|CAN67380.1| hypothetical protein VITISV_017918 [Vitis vinifera]
Length=193

 Score =   265 bits (678),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK   VT +DFV+SGL  AGNT+N+IKAAVTPAF  QFPG+N
Sbjct  6    DFCVGDLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVTPAFAPQFPGLN  65

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+ VGGVVP+HTHPGGSE+L+V +G + AGF+SS  N VY+ KTLK+GD+M
Sbjct  66   GLGLSIARLDLAVGGVVPMHTHPGGSEVLLVTQGAICAGFISS-ANTVYF-KTLKKGDIM  123

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N     +TAFV+FSS  PGLQI  +ALF NDLPT++V   TFLD A +K
Sbjct  124  IFPQGLLHFQVNGAGIPSTAFVSFSSPQPGLQILDYALFANDLPTELVVQTTFLDAAVVK  183

Query  645  KLKSVLGGTN  674
            KLK+VLGGTN
Sbjct  184  KLKAVLGGTN  193



>ref|XP_006381632.1| hypothetical protein POPTR_0006s14510g [Populus trichocarpa]
 gb|ERP59429.1| hypothetical protein POPTR_0006s14510g [Populus trichocarpa]
Length=250

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 172/214 (80%), Gaps = 4/214 (2%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            +K+ L +FL  +F L   ++++   DFCV +L+ P  P G+ CKK  +VT +DFV+SGL 
Sbjct  40   EKMILPIFL--IFSLLSSTSNAAVQDFCVADLTGPDTPTGFVCKKPAAVTVDDFVFSGLG  97

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGT  389
            A GNT+NIIKAAVTPAF  +F GVNGLG+SMARLD+ VGGV+P+HTHPGGSE+L+V  G+
Sbjct  98   AGGNTSNIIKAAVTPAFADKFGGVNGLGISMARLDLAVGGVIPMHTHPGGSEVLIVVSGS  157

Query  390  LSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITT  569
            + AGF+SS DNKVY+ K+LK+GD+M FP+GLLHFQIN G T A AFV+FSS+ PGLQI  
Sbjct  158  ICAGFISS-DNKVYF-KSLKKGDIMAFPRGLLHFQINAGGTPALAFVSFSSERPGLQILD  215

Query  570  FALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            FALF NDLP++I++T TFLD+AQ+KKLK VLGGT
Sbjct  216  FALFANDLPSEIIETTTFLDDAQVKKLKGVLGGT  249



>ref|XP_009596795.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana tomentosiformis]
 dbj|BAC77634.1| 24K germin like protein [Nicotiana tabacum]
Length=210

 Score =   266 bits (679),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 163/211 (77%), Gaps = 3/211 (1%)
 Frame = +3

Query  48   MFLQTLFIlsll--sasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MF Q  FI SLL  S+ +  LDFCVG+LS+P GP GY CKK ++VT NDFV+SGLA    
Sbjct  1    MFFQAFFIFSLLFLSSDAAVLDFCVGDLSVPDGPGGYACKKPSAVTANDFVFSGLATPVK  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
               +IKAAVTPAF  QFPG+NGLG+SMARLD+ +GGV+P+HTHPG SE+L V  G + AG
Sbjct  61   LNPLIKAAVTPAFAPQFPGLNGLGISMARLDLAIGGVIPMHTHPGASEVLYVVTGEICAG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS DNKV++ K LK+GD+MVFPQGLLHFQIN GKT   A V+FSS  PGLQIT FALF
Sbjct  121  FISSSDNKVFF-KNLKQGDIMVFPQGLLHFQINSGKTTGLAIVSFSSPTPGLQITDFALF  179

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
             NDL T++V+  TFLD A IKKLK VLGGTN
Sbjct  180  ANDLATELVQATTFLDAATIKKLKGVLGGTN  210



>ref|NP_001268059.1| germin-like protein 6 precursor [Vitis vinifera]
 gb|ABL60875.1| germin-like protein 6 [Vitis vinifera]
Length=208

 Score =   266 bits (679),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+ P GPAGY CKK   VT +DFV+SGL  AGNT+N+IKAAVTPAF  QFPG+N
Sbjct  21   DFCVGDLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVTPAFAPQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+ VGGVVP+HTHPGGSE+L+V +G + AGF+SS  N VY+ KTLK+GD+M
Sbjct  81   GLGLSIARLDLAVGGVVPMHTHPGGSEVLLVTQGAICAGFISS-ANTVYF-KTLKKGDIM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N     +TAFV+FSS  PGLQI  +ALF NDLPT++V   TFLD A +K
Sbjct  139  IFPQGLLHFQVNGAGIPSTAFVSFSSPQPGLQILDYALFANDLPTELVVQTTFLDAAVVK  198

Query  645  KLKSVLGGTN  674
            KLK+VLGGTN
Sbjct  199  KLKAVLGGTN  208



>gb|ACA03785.1| putative auxin-binding protein 2 [Prunus salicina]
Length=209

 Score =   266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+P HTHPG SE+L+V +GT+ AGFV+S DN  Y  KTLK+GD+M
Sbjct  82   GLGISLARLDLAPGGVIPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYL-KTLKKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A AF +FSS +PGLQI  FALFKNDL T+++   TFLD AQIK
Sbjct  140  VFPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLATELIAQTTFLDAAQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|XP_007138665.1| hypothetical protein PHAVU_009G227800g [Phaseolus vulgaris]
 gb|ESW10659.1| hypothetical protein PHAVU_009G227800g [Phaseolus vulgaris]
Length=210

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT NDFVYSGLA AGNT+NIIKAAV+PAFDAQFPGVN
Sbjct  23   DFCVADYTAPNGPAGYSCKNPAKVTVNDFVYSGLATAGNTSNIIKAAVSPAFDAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV EG + AGFV S +N   Y KTL++GD+M
Sbjct  83   GLGISVARLDLASGGVIPLHTHPGASELLVVVEGQICAGFVDSGNN--VYLKTLEKGDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G ++  AFV+FSS NPGLQI  FALFK+D PT+++   TF+D A +K
Sbjct  141  VFPQGLLHFQINSGDSQGLAFVSFSSANPGLQILDFALFKSDFPTELITETTFIDAAVVK  200

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  201  KLKGVLGGS  209



>gb|ABL86676.1| GLP2 [Gossypium barbadense]
Length=205

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG L+ P GPAGY CKK+   TE+DF +SGL  AGNT+N++KAA+TPAF  QFPGVN
Sbjct  20   DFCVGGLNGPVGPAGYSCKKT--ATEDDFSFSGLRTAGNTSNLVKAAITPAFSTQFPGVN  77

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+ VGGV+P+HT P  SE+++V +GTL AGF+SS DNKVY SK+L EGD+M
Sbjct  78   GLGISIARLDLAVGGVIPMHTQPRASELILVMDGTLFAGFISS-DNKVY-SKSLNEGDIM  135

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQIN GKT++ AFV+F+S +PG+QI  FALF NDLPTDI++  TFLD AQIK
Sbjct  136  IFPQGLLHFQINTGKTQSVAFVSFNSADPGVQILDFALFTNDLPTDIIEGTTFLDAAQIK  195

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  196  KLKGVLGGT  204



>ref|NP_001241062.1| auxin-binding protein ABP19a-like precursor [Glycine max]
 gb|ACG69486.1| germin-like protein 10 [Glycine max]
Length=213

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFVYSGL  AGNT+NIIKAAVTPAFDAQFPGVN
Sbjct  26   DFCVADYTGPNGPAGYSCKSPAKVTVDDFVYSGLGTAGNTSNIIKAAVTPAFDAQFPGVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+  GFV+S DN VY  KTLK+GDVM
Sbjct  86   GLGISIARLDLAAGGVIPLHTHPGASELLVVVQGTICTGFVAS-DNTVYL-KTLKKGDVM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V+PQGLLHFQIN G+++A AFV+FSS NPGLQI  F+LFK+D PT+++   TF+D A +K
Sbjct  144  VYPQGLLHFQINDGESQALAFVSFSSANPGLQILDFSLFKSDFPTELITQTTFIDAAVVK  203

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  204  KLKGVLGGS  212



>ref|XP_008242223.1| PREDICTED: auxin-binding protein ABP20 [Prunus mume]
Length=237

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            ++ T+I  +   F L L S+++   DFCV +L+ P GPAG+ CKK   V  NDFV+SGL 
Sbjct  25   RQATMIFPILFTFFLLLSSSNAAVQDFCVADLAAPEGPAGFSCKKPAVVKVNDFVFSGLG  84

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGT  389
             AGNT+NIIKAAVTPAF AQFPGVNGLG+S+ARLD+ VGGVVP HTHPG SE+L+VAEGT
Sbjct  85   IAGNTSNIIKAAVTPAFVAQFPGVNGLGISIARLDLAVGGVVPFHTHPGASEVLIVAEGT  144

Query  390  LSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITT  569
            + AGFV+S DN  Y  +TL++GD+MVFPQGLLHFQ+N G+  A AF +F S +PGLQI  
Sbjct  145  ICAGFVAS-DNTPYL-QTLEKGDIMVFPQGLLHFQVNGGEAPALAFASFGSASPGLQILD  202

Query  570  FALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            FALFKNDL T ++   TFLD AQIKKLK VLGGTN
Sbjct  203  FALFKNDLATKLIAQTTFLDPAQIKKLKGVLGGTN  237



>gb|AAO92740.1| auxin binding protein [Gossypium hirsutum]
Length=206

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 160/190 (84%), Gaps = 5/190 (3%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL-AAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCVG+L+ P GPAGY CKK+   TE+DF +SGL   AGNT+N++KAA+TPAF  QFPGV
Sbjct  20   DFCVGDLNGPVGPAGYSCKKT--ATEDDFSFSGLLRTAGNTSNLVKAAITPAFSTQFPGV  77

Query  282  NGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDV  461
            NGLG+S+ARLD+ VGGV+P+HTHP  SE+++V +GTL AGF+SS DNKVY SK+L EGD+
Sbjct  78   NGLGISIARLDLAVGGVIPMHTHPRASELILVMDGTLFAGFISS-DNKVY-SKSLNEGDI  135

Query  462  MVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            M+FPQGLLHFQIN GKT++ AFV+F+S +PG+QI  FALF NDLPTDI++  TFLD AQI
Sbjct  136  MIFPQGLLHFQINTGKTQSVAFVSFNSADPGVQILDFALFTNDLPTDIIEGTTFLDAAQI  195

Query  642  KKLKSVLGGT  671
            KKLK VLGGT
Sbjct  196  KKLKGVLGGT  205



>gb|AAF21988.2|AF116537_1 fiber protein GLP1 [Gossypium hirsutum]
Length=206

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 160/190 (84%), Gaps = 5/190 (3%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL-AAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCVG+L+ P GPAGY CKK+   TE+DF +SGL   AGNT+N++KAA+TPAF  QFPGV
Sbjct  20   DFCVGDLNGPVGPAGYSCKKT--ATEDDFSFSGLLRTAGNTSNLVKAAITPAFSTQFPGV  77

Query  282  NGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDV  461
            NGLG+S+ARLD+ VGGV+P+HTHP  SE+++V +GTL AGF+SS DNKVY SK+L EGD+
Sbjct  78   NGLGISIARLDLAVGGVIPMHTHPRASELILVMDGTLFAGFISS-DNKVY-SKSLNEGDI  135

Query  462  MVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            M+FPQGLLHFQIN GKT++ AFV+F+S +PG+QI  FALF NDLPTDI++  TFLD AQI
Sbjct  136  MIFPQGLLHFQINTGKTQSVAFVSFNSADPGVQILDFALFTNDLPTDIIEGTTFLDAAQI  195

Query  642  KKLKSVLGGT  671
            KKLK VLGGT
Sbjct  196  KKLKGVLGGT  205



>gb|KEH37574.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK  + VT NDFVY GLAAAGNTTNIIKAAVT A DAQFPGVN
Sbjct  23   DFCVADYNAPNGPAGYSCKPPSKVTVNDFVYHGLAAAGNTTNIIKAAVTTAIDAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI VGGV+PLHTHPG SE+LVV +GT+SAGFVSS DN VY  KTL +GDVM
Sbjct  83   GLGISIARLDIAVGGVIPLHTHPGASEVLVVIKGTISAGFVSS-DNVVYL-KTLHKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQINVG + A  F +FSS NP LQI  +ALF++D PT ++   TF+D A +K
Sbjct  141  IFPQGLLHFQINVGGSNALTFNSFSSANPRLQILDYALFESDFPTKLITATTFIDPAVVK  200

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  201  KLKSVLGGS  209



>ref|XP_008362990.1| PREDICTED: auxin-binding protein ABP19a-like [Malus domestica]
Length=210

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ N     GPAGY CKK   VT +DFVYSGL   GNTTNI K+AVTPAF AQFPGVN
Sbjct  22   DFCIANYKAXEGPAGYSCKKPAKVTVDDFVYSGLGIPGNTTNIFKSAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+ VGGV+PLHTHP GSEIL+VA+GT+ AGFVSS +N V Y KTLK+GD+M
Sbjct  82   GLGISFARLDLAVGGVMPLHTHPRGSEILLVAQGTIIAGFVSSANNTV-YRKTLKKGDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
              PQGLLHFQ+N  KT A AFV+FSS +PGLQI  +ALF+NDLPT+++   T LD AQIK
Sbjct  141  AIPQGLLHFQVNGDKTPALAFVSFSSPSPGLQILDYALFQNDLPTELIAQTTVLDAAQIK  200

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  201  KLKGVLGGTN  210



>ref|XP_008242222.1| PREDICTED: auxin-binding protein ABP19a [Prunus mume]
Length=209

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAGNTTNIIKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+P HTHPG SE+L+V +GT+ AGFV+S DN  Y  KTL +GD+M
Sbjct  82   GLGISLARLDLAPGGVIPFHTHPGASELLLVVQGTIIAGFVAS-DNTPYL-KTLNKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A AF +FSS +PGLQI  FALFKNDLPT+++   TFLD +QIK
Sbjct  140  VFPQGLLHFQVNGGGTPALAFPSFSSPSPGLQILDFALFKNDLPTELIAQTTFLDASQIK  199

Query  645  KLKSVLGGTN  674
            KLK  LGGTN
Sbjct  200  KLKGALGGTN  209



>ref|XP_010235197.1| PREDICTED: germin-like protein 8-14 [Brachypodium distachyon]
Length=214

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK + SV+  DF Y GLAAAGNTTN+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCKAAGSVSSGDFYYHGLAAAGNTTNLIKAAVTPAFVGQFPGVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP  SE+L V EGT+ AGF++S  N V Y+KTL +GD+M
Sbjct  86   GLGISGARLDIAVGGVVPLHTHPAASELLFVVEGTVLAGFITSSSNTV-YTKTLYKGDIM  144

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+TVTFLD+AQ+K
Sbjct  145  VFPQGLLHYQYNGGASAAVALVAFSGPNPGLQITDYALFANNLPSAVVETVTFLDDAQVK  204

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  205  KLKAVLGGS  213



>emb|CAC34417.1| Germin-like protein [Pisum sativum]
Length=211

 Score =   263 bits (672),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFV+ GLA  GNTTNIIKAAVTPAFDAQFPGVN
Sbjct  24   DFCVADYNAPNGPAGYSCKTPKKVTVDDFVFHGLATGGNTTNIIKAAVTPAFDAQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGFVSS +  V Y KTL +GDVM
Sbjct  84   GLGISIARLDLAPGGVIPLHTHPGASEVLVVIQGTILAGFVSSAN--VVYLKTLNKGDVM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G++ A AFV+FSS NPGLQI  FALFK+D PT+++   TFLD   +K
Sbjct  142  VFPQGLLHFQINSGRSNALAFVSFSSANPGLQILDFALFKSDFPTELITATTFLDAGLVK  201

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  202  KLKGVLGGS  210



>ref|XP_010049430.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW81986.1| hypothetical protein EUGRSUZ_C03354 [Eucalyptus grandis]
Length=211

 Score =   263 bits (671),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTTAFVNQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI  GGV+PLHTHPGGSE+L+V +GT+ AGF+SS  N VY  KTL +GD M
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGTICAGFISSSANTVYL-KTLNKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N GK  A A V+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  142  IFPQGLLHFQLNSGKGPALAIVSFSSPSPGLQIVDFALFANNFPSELVEATTFLDDAQVK  201

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  202  KLKGVLGGT  210



>ref|XP_010049517.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW82146.1| hypothetical protein EUGRSUZ_C03537 [Eucalyptus grandis]
Length=211

 Score =   263 bits (671),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTTAFVNQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI  GGV+PLHTHPGGSE+L+V +GT+ AGF+SS  N VY  KTL +GD M
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGTICAGFISSSANTVYL-KTLNKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N GK  A A V+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  142  IFPQGLLHFQLNSGKGPALAIVSFSSPSPGLQIVDFALFANNFPSELVEATTFLDDAQVK  201

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  202  KLKGVLGGT  210



>ref|XP_003574592.1| PREDICTED: germin-like protein 8-14 [Brachypodium distachyon]
Length=214

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 151/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK + SV+  DF Y GLAAAGNTTN+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCKAAGSVSSGDFYYHGLAAAGNTTNLIKAAVTPAFVGQFPGVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP  SE+L V EGT+ AGF++S  N V Y+KTL +GD M
Sbjct  86   GLGISGARLDIAVGGVVPLHTHPAASELLFVVEGTILAGFITSSSNTV-YTKTLYKGDAM  144

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A AFV FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  145  VFPQGLLHYQYNGGASTAVAFVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVK  204

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  205  KLKAVLGGS  213



>ref|XP_009417703.1| PREDICTED: germin-like protein 8-14 [Musa acuminata subsp. malaccensis]
Length=209

 Score =   262 bits (669),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG++S    PAGYPCK  + VT NDFV+ GL  AGNT+NIIKAAVTPAF  QFPGVN
Sbjct  22   DFCVGDISASDTPAGYPCKDVSHVTTNDFVFKGLGKAGNTSNIIKAAVTPAFVGQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGVVPLHTHPGGSE+LVV +G + AGF+SS  N VYY+ TL +GD M
Sbjct  82   GLGISAARLDLAPGGVVPLHTHPGGSELLVVTQGMILAGFISS-ANGVYYT-TLHKGDTM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G   A A VTFSS NPGLQIT FALF N LP+ +V+ VTFLD+AQ+K
Sbjct  140  VFPQGLLHFQVNAGGVTAVAIVTFSSPNPGLQITAFALFANSLPSALVEKVTFLDDAQVK  199

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  200  KLKKVLGGS  208



>ref|XP_010261910.1| PREDICTED: auxin-binding protein ABP19a-like [Nelumbo nucifera]
Length=207

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 153/189 (81%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CKK   VT NDFVYS L+AAGNT+NIIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLTAPEGPAGYSCKKPAKVTVNDFVYS-LSAAGNTSNIIKAAVTPAFAAQFPGLN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+  GGVVP+HTHPG +E+L+V +GT++  F+ S  +   Y KTLK+GD+M
Sbjct  80   GLGISMARLDLAPGGVVPMHTHPGATELLLVVQGTITTAFIDSASS--VYLKTLKKGDIM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V+PQGLLHFQ+N G   A AFV+FSS NPGLQI  FALF N LPT +V+  TFLDEAQ+K
Sbjct  138  VYPQGLLHFQVNAGGIPAIAFVSFSSSNPGLQILDFALFANSLPTPLVEKTTFLDEAQVK  197

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  198  KLKAVLGGS  206



>gb|KEH37575.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK  + VT NDFVY GLAAAGNTTNIIKAAVT A DAQFPGVN
Sbjct  23   DFCVADYNAPNGPAGYSCKPPSKVTVNDFVYHGLAAAGNTTNIIKAAVTTAIDAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI VGGV+PLHTHPG SE+LVV +GT+SAGFVSS DN VY  KTL +GDVM
Sbjct  83   GLGISIARLDIAVGGVIPLHTHPGASEVLVVIKGTISAGFVSS-DNVVYL-KTLHKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQINVG + A  F +FSS NP LQI  +ALF++D PT ++   TF+D A +K
Sbjct  141  IFPQGLLHFQINVGGSNALTFNSFSSANPRLQILDYALFESDFPTKLITATTFIDPAVVK  200

Query  645  KLKSVLGG  668
            KLK +LGG
Sbjct  201  KLKGILGG  208



>ref|XP_009594759.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana tomentosiformis]
Length=208

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK +T VT NDFV+SGL+AAGNT+NIIKA+VTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKTATKVTVNDFVFSGLSAAGNTSNIIKASVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGVVP HTHPG SE+L+V +G+++A FVSS  N VY  KTLK+G++M
Sbjct  81   GLGLSAARLDLASGGVVPFHTHPGASEVLLVVQGSITAAFVSS-ANTVYL-KTLKKGELM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N     + A+V FSS +PGLQIT FALF NDL T +V+  TFLDEAQIK
Sbjct  139  VFPQGLLHFQVNAAGYTSVAYVFFSSSSPGLQITDFALFANDLSTKLVEATTFLDEAQIK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|XP_007154588.1| hypothetical protein PHAVU_003G131400g [Phaseolus vulgaris]
 gb|ESW26582.1| hypothetical protein PHAVU_003G131400g [Phaseolus vulgaris]
Length=208

 Score =   260 bits (665),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF GVN
Sbjct  21   DFCVADHAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLHTHPG SE+LVV +G++ AGF+SS DN VY  KTLK+GDVM
Sbjct  81   GLGISAARLDLAAGGVIPLHTHPGASELLVVIQGSILAGFISS-DNTVYL-KTLKKGDVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G + A A V+FSS NPGLQI  FALFK++ PT ++   TFLD A +K
Sbjct  139  VFPQGLLHFQINAGGSSALAIVSFSSSNPGLQILDFALFKSNFPTPLIVETTFLDAALVK  198

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  199  KLKAVLGGS  207



>ref|XP_003551125.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
 gb|KHN17718.1| Auxin-binding protein ABP19a [Glycine soja]
Length=208

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF G+N
Sbjct  21   DFCVADYAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLHTHPG SE+LVV EG++ AGF+SS +  + Y KTLK+GDVM
Sbjct  81   GLGISAARLDLAAGGVIPLHTHPGASELLVVIEGSILAGFISSAN--IVYLKTLKKGDVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
             FPQGLLHFQIN GK+ A A V+FSS NPGLQI  FALFK+  PT ++   TFLD A +K
Sbjct  139  AFPQGLLHFQINAGKSSALAIVSFSSSNPGLQILDFALFKSSFPTPLIVQTTFLDAALVK  198

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  199  KLKGVLGGS  207



>ref|XP_011078074.1| PREDICTED: auxin-binding protein ABP19a-like [Sesamum indicum]
Length=210

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 157/211 (74%), Gaps = 3/211 (1%)
 Frame = +3

Query  48   MFLQTLFI--lsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M L+ LFI  L + ++ +   DFCV +LSLP GP GY CK   SVTENDF Y GLA  G+
Sbjct  1    MRLRYLFIFSLLVAASYALVQDFCVADLSLPAGPTGYSCKTPASVTENDFFYHGLATPGS  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            T N   A V+ AFD+QFPG+NGLG+S  RLD+ VGGV PLH+HP  +E++V+ EGTL+ G
Sbjct  61   TNNRAGAGVSWAFDSQFPGLNGLGISSLRLDLAVGGVAPLHSHPAATELVVIVEGTLTLG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SSFD+KVY  KTL + DVMV PQGLLHF IN G T A AF +FSSQNPGLQ T FALF
Sbjct  121  FISSFDDKVYI-KTLNKWDVMVVPQGLLHFAINSGNTTALAFASFSSQNPGLQTTAFALF  179

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            KND PT++V   TFLD  QIKKLK++LGGTN
Sbjct  180  KNDFPTELVAKTTFLDAEQIKKLKALLGGTN  210



>ref|XP_006342915.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=208

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK  T+VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPGVN
Sbjct  21   DFCVADLKAPESPSGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+P HTHPG SEIL+V +G+++AGFVSS  N VY  KTLK+GD+M
Sbjct  81   GLGISAARLDLAAGGVIPFHTHPGASEILLVVQGSITAGFVSS-ANSVYL-KTLKKGDLM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ++     +  +V FSS NPGLQIT FALF NDLPT +V   TFLDEA IK
Sbjct  139  VFPQGLLHFQVSDAGYTSVGYVFFSSSNPGLQITDFALFANDLPTKLVGATTFLDEATIK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>ref|XP_011072583.1| PREDICTED: auxin-binding protein ABP19a [Sesamum indicum]
Length=221

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L  P GPAGY CK    VT  DFV++G  AAGNTTNII AAV+PAF AQFPG+N
Sbjct  34   DFCVGDLKAPEGPAGYSCKSPADVTVADFVFTGFRAAGNTTNIINAAVSPAFAAQFPGLN  93

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGVVP+HTHPG SE+L+V +G++  GF+SS +N   Y K L +GD+M
Sbjct  94   GLGLSIARLDLAPGGVVPMHTHPGASELLLVVQGSIVTGFISSANN--VYVKKLVKGDIM  151

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   A AF +FSSQNPGLQIT FALF N LP+ +V+  TFLD+AQ+K
Sbjct  152  VFPQGLLHFQINAGGRTAVAFASFSSQNPGLQITDFALFGNTLPSSLVEKTTFLDDAQVK  211

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  212  KLKAVLGGS  220



>gb|ACU18952.1| unknown [Glycine max]
Length=208

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CKK + VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF G+N
Sbjct  21   DFCVADYAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLHTHPG SE+LVV EG++ AGF+SS +  + Y KTLK+GDVM
Sbjct  81   GLGISAARLDLAAGGVIPLHTHPGASELLVVIEGSILAGFISSAN--IVYLKTLKKGDVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
             FPQGLLHFQIN GK+ A A V+FSS NPGLQI  FALFK+  PT ++   TFLD A +K
Sbjct  139  AFPQGLLHFQINAGKSSALAIVSFSSSNPGLQIQDFALFKSGFPTPLIVQTTFLDAALVK  198

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  199  KLKGVLGGS  207



>ref|XP_009784603.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=208

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 160/203 (79%), Gaps = 2/203 (1%)
 Frame = +3

Query  63   LFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKA  242
            LF + + S+++   DFCV +L  P  PAGY CK +T VT NDFV+SGL+AAGNT+NIIKA
Sbjct  7    LFAVLISSSNAAVQDFCVADLKGPESPAGYSCKNATKVTVNDFVFSGLSAAGNTSNIIKA  66

Query  243  AVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDN  422
            +VTPAF AQFPG+NGLGLS ARLD+  GGVVP HTHPG SE+L+V +G+++A FVSS  N
Sbjct  67   SVTPAFAAQFPGLNGLGLSAARLDLAPGGVVPFHTHPGASEVLLVVQGSITAAFVSS-AN  125

Query  423  KVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTD  602
             VY  KTLK+G++MVFPQGLLHFQ+N     + A+V FSS +PGLQIT FALF NDL T 
Sbjct  126  TVYL-KTLKKGELMVFPQGLLHFQVNAAGYTSVAYVFFSSSSPGLQITDFALFANDLSTK  184

Query  603  IVKTVTFLDEAQIKKLKSVLGGT  671
            +V+  TF+DEAQIKKLK VLGGT
Sbjct  185  LVEATTFVDEAQIKKLKGVLGGT  207



>sp|O04012.1|AB19B_PRUPE RecName: Full=Auxin-binding protein ABP19b; Flags: Precursor 
[Prunus persica]
 gb|AAB51241.1| auxin-binding protein [Prunus persica]
Length=209

 Score =   258 bits (659),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNI KAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGVVP HTHPG SE+L+V +GT+ AGFV+S DN  Y  KTLK+GD++
Sbjct  82   GLGISLARLDLGPGGVVPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYL-KTLKKGDII  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A AF +FSS +PGLQI  FALFKNDL T+++   T LD  QIK
Sbjct  140  VFPQGLLHFQVNGGDTPAIAFPSFSSPSPGLQIVDFALFKNDLATELIAQTTLLDAPQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|XP_007204735.1| hypothetical protein PRUPE_ppa011385mg [Prunus persica]
 gb|EMJ05934.1| hypothetical protein PRUPE_ppa011385mg [Prunus persica]
Length=212

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P GPAGY CKK   VT NDFVYSGL  AGNTTNI KAAVTPAF AQFPGVN
Sbjct  22   DFCVADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVTPAFAAQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGVVP HTHPG SE+L+V +GT+ AGFV+S DN  Y  KTLK+GD++
Sbjct  82   GLGISLARLDLGPGGVVPFHTHPGASEVLLVVQGTIIAGFVAS-DNTPYL-KTLKKGDII  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A AF +FSS +PGLQI  FALFKNDL T+++   T LD  QIK
Sbjct  140  VFPQGLLHFQVNGGDTPAIAFPSFSSPSPGLQIVDFALFKNDLATELIAQTTLLDAPQIK  199

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  200  KLKGVLGGTN  209



>ref|NP_001061976.1| Os08g0460000 [Oryza sativa Japonica Group]
 sp|Q6ZBZ2.1|GL814_ORYSJ RecName: Full=Germin-like protein 8-14; AltName: Full=Germin-like 
protein 1; AltName: Full=Germin-like protein 5; Short=OsGER5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAC04836.1| germin-like protein 5 [Oryza sativa Japonica Group]
 dbj|BAB17848.1| germin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAD09603.1| germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD09958.1| germin-like protein [Oryza sativa Japonica Group]
 dbj|BAF23890.1| Os08g0460000 [Oryza sativa Japonica Group]
 gb|EAZ07240.1| hypothetical protein OsI_29484 [Oryza sativa Indica Group]
 gb|EAZ42986.1| hypothetical protein OsJ_27575 [Oryza sativa Japonica Group]
 dbj|BAG89446.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96911.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 150/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK   SV   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP  SE+L V +GT++AGF++S  N V Y++TL  GD+M
Sbjct  85   GLGISAARLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTV-YTRTLYAGDIM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G++ A A V FS  NPGLQIT +ALF N+LP+ IV+ VTFLD+AQ+K
Sbjct  144  VFPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVK  203

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  204  KLKSVLGGS  212



>ref|XP_004303688.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   258 bits (659),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGY CK   +VT +DFVYSGLA AGNT+NII+AAVTPAF AQFPGVN
Sbjct  36   DFCVADLTGPDSPAGYFCKNPANVTVSDFVYSGLAKAGNTSNIIQAAVTPAFVAQFPGVN  95

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+P HTHPG SE+L+V  G ++AGFVSS  N VY  KTLK+GDVM
Sbjct  96   GLGLSLARLDLAPGGVIPFHTHPGASEVLIVLRGYITAGFVSS-ANTVYV-KTLKKGDVM  153

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  K  A A V+FSS +PGLQI  FALF NDLPT +V   TFLD AQI 
Sbjct  154  VFPQGLLHFQVNAAKIHAKAIVSFSSASPGLQILDFALFANDLPTSLVGKTTFLDPAQIM  213

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  214  KLKGVLGGT  222



>ref|XP_002516286.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
 gb|EEF46288.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
Length=208

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 162/211 (77%), Gaps = 3/211 (1%)
 Frame = +3

Query  42   LIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            +I+ +  +F L   S+ +   D+CVG+LS P GPAGY CKK+  VT NDFVYSGLAA G 
Sbjct  1    MILHIFLIFALLSSSSYALVQDYCVGDLSGPDGPAGYGCKKT--VTVNDFVYSGLAAPGK  58

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
               +IKA VTPAF  QFPG+NGLG+SMARLD+  GGV+P+HTHP  SE+L V  G++ AG
Sbjct  59   ILPLIKAGVTPAFVDQFPGLNGLGISMARLDLQPGGVIPMHTHPAASEVLTVISGSICAG  118

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS DNKV++ K L +GD+M+FPQGLLHFQIN G + A AFV+FSS  PGLQIT FALF
Sbjct  119  FISSSDNKVFF-KNLDKGDIMIFPQGLLHFQINSGGSSALAFVSFSSPRPGLQITDFALF  177

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
             NDLP+++V+  TFLD+A +KKLK+VLGG N
Sbjct  178  ANDLPSELVEKTTFLDDATVKKLKAVLGGKN  208



>ref|XP_010261909.1| PREDICTED: auxin-binding protein ABP20-like [Nelumbo nucifera]
Length=207

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 154/189 (81%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CKK   VT +DFV+S L   GNT+NIIKAAVTPAF  QFPGVN
Sbjct  21   DFCVADLTAPEGPAGYSCKKPAKVTVDDFVFS-LGTVGNTSNIIKAAVTPAFATQFPGVN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+   GVVP+HTHPG +E+L+VA+GT+  GF+SS  N VY + TLK+GD+M
Sbjct  80   GLGISMARLDLAPDGVVPMHTHPGATEVLIVAQGTICTGFISS-ANSVYLA-TLKQGDIM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V+P+GLLHFQIN GKT A AFV+FSS NPGLQI  FALF N+LP+ +V+  TFLD+AQ+K
Sbjct  138  VYPRGLLHFQINSGKTPALAFVSFSSANPGLQILDFALFANNLPSALVEKTTFLDDAQVK  197

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  198  KLKAVLGGS  206



>gb|ABG46233.1| germin-like protein 2a [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVP+HTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNGGSSSAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>ref|XP_010049516.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
Length=210

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GP GY CKK ++VT NDFV+SGL  AGNT+N+IKAA TPAF  QFPG+N
Sbjct  23   DFCVADLSAPEGPTGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAATPAFVTQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ RLD+  GGV+PLHTHPGGSE+++V EG++ AGF+SS  N VY  KTL +GD M
Sbjct  83   GLGLSLVRLDMAPGGVIPLHTHPGGSEVILVLEGSICAGFISS-ANTVYL-KTLNKGDSM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP+GLLHFQ+N  K  A AFV+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  141  IFPRGLLHFQLNAAKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVK  200

Query  645  KLKSVLGGT  671
            KLK +LGGT
Sbjct  201  KLKGILGGT  209



>emb|CAC32847.1| adenosine diphosphate glucose pyrophosphatase [Hordeum vulgare 
subsp. vulgare]
Length=212

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVP+HTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNGGSSSAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>dbj|BAK03467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVP+HTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNGGSSAAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>dbj|BAJ98277.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87478.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96386.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92946.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGYPCK    V   DF Y GLA AGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLACPDTPAGYPCKPG--VGAGDFYYHGLATAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAVGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+TVTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNGGGSSAVALVAFSGPNPGLQITDYALFANNLPSAVVETVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>ref|XP_008391398.1| PREDICTED: auxin-binding protein ABP19a-like [Malus domestica]
Length=213

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 159/209 (76%), Gaps = 2/209 (1%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL +L  LS  ++++   DFCV +L  P  P+GY CK +  VT +DFV+SGLA  GNT
Sbjct  6    ILFLFSLIFLSSSTSNASVNDFCVADLKGPDSPSGYTCKTAAMVTVSDFVFSGLAKGGNT  65

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
            TNII AAVTPAF AQFPGVNGLG+S+ARLD+  GGV+P HTHPG SEILVV  G + AGF
Sbjct  66   TNIISAAVTPAFVAQFPGVNGLGISIARLDLAPGGVIPFHTHPGASEILVVTRGIIKAGF  125

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            VSS  N VY  KTL +G+VMVFPQGLLHFQ+NV K  + AFV+FSS +PGLQI  FALF 
Sbjct  126  VSS-ANTVYL-KTLHKGEVMVFPQGLLHFQVNVAKIHSNAFVSFSSASPGLQILDFALFA  183

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            NDLP+++V   TFLD A IKKLK VLGGT
Sbjct  184  NDLPSELVAQTTFLDLATIKKLKGVLGGT  212



>ref|XP_004235542.1| PREDICTED: auxin-binding protein ABP19a [Solanum lycopersicum]
Length=208

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK  T+VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKAPESPSGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P HTHPG SEIL+V +G+++AGFVSS  N VY  KTLK+GD+M
Sbjct  81   GLGLSAARLDLAPSGVIPFHTHPGASEILLVVQGSITAGFVSS-ANSVYL-KTLKKGDLM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ++     +  +V FSS NPGLQIT FALF NDLPT +V   TFLDEA IK
Sbjct  139  VFPQGLLHFQVSDAGYTSVGYVFFSSSNPGLQITDFALFANDLPTKLVAATTFLDEATIK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>gb|AAC05682.1| germin-like protein [Oryza sativa Japonica Group]
Length=213

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 150/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK   SV   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S A+LDI VGGVVPLHTHP  SE+L V +GT++AGF++S  N V Y++TL  GD+M
Sbjct  85   GLGISAAKLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTV-YTRTLYAGDIM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G++ A A V FS  NPGLQIT +ALF N+LP+ IV+ VTFLD+AQ+K
Sbjct  144  VFPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVK  203

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  204  KLKSVLGGS  212



>emb|CAC85479.1| adenosine diphosphate glucose pyrophosphatase [Triticum aestivum]
Length=212

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK    V+  DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--AGVSAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI +GGVVPLHTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAMGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNGGGSAAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>ref|XP_010049513.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW82133.1| hypothetical protein EUGRSUZ_C03521 [Eucalyptus grandis]
Length=211

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 151/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVTPA   QFPG+N
Sbjct  23   DFCVGDLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTPALINQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            G G+S+ARLDI  GGV+PLHTHPGGSE+L+V +G++ AGF+SS  N +Y  KTL +GD M
Sbjct  83   GFGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGSICAGFISSSVNTIYL-KTLNKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N  K    A V+FSS +PGLQI  FAL  N+ P+++V+  TFLD+AQ+K
Sbjct  142  IFPQGLLHFQMNAVKGPGLAIVSFSSPSPGLQILDFALLANNFPSELVEATTFLDDAQVK  201

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  202  KLKGVLGGT  210



>ref|XP_009131804.1| PREDICTED: germin-like protein subfamily 3 member 3 [Brassica 
rapa]
Length=211

 Score =   255 bits (652),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+NIIKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVTPAFSPTFAGIN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL++GD M
Sbjct  84   GLGVSLARLDLASGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLEKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI +FALF NDLP+++V+  TFL +A++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_006361339.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=208

 Score =   255 bits (651),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK  T VT NDFV+SGL+AAG+T+NIIKA+V+PAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVTKVTVNDFVFSGLSAAGDTSNIIKASVSPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGVVP HTHPG SE+L+V +G+++A FVSS  N VY  KT+K+G++M
Sbjct  81   GLGLSAARLDLAPGGVVPFHTHPGASEVLLVVQGSITAAFVSS-ANTVYL-KTIKKGELM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N     + A+V FSS NPGLQIT FALF NDL T +V+  TFLDEAQIK
Sbjct  139  VFPQGLLHFQVNAVGFNSVAYVFFSSSNPGLQITDFALFANDLSTKLVEATTFLDEAQIK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|XP_009375459.1| PREDICTED: auxin-binding protein ABP19a [Pyrus x bretschneideri]
Length=213

 Score =   255 bits (651),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 158/209 (76%), Gaps = 2/209 (1%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL +L  LS  ++++   DFCV +L  P  P+GY CK    VT +DFV+SGLA  GNT
Sbjct  6    ILFLFSLIFLSSSTSNASVNDFCVADLKGPDSPSGYTCKIPAKVTVSDFVFSGLAKGGNT  65

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
            TNII AAVTPAF AQFPGVNGLG+S+ARLD+  GGV+P HTHPG SEILVV  G + AGF
Sbjct  66   TNIISAAVTPAFVAQFPGVNGLGISIARLDLAPGGVIPFHTHPGASEILVVTRGIIKAGF  125

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            VSS  N VY  KTL +G+VMVFPQGLLHFQ+NV K  + AFV+FSS +PGLQI  FALF 
Sbjct  126  VSS-ANTVYL-KTLHKGEVMVFPQGLLHFQVNVAKIHSNAFVSFSSASPGLQILDFALFA  183

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            NDLP+++V   TFLD A IKKLK VLGGT
Sbjct  184  NDLPSELVAQTTFLDLATIKKLKGVLGGT  212



>dbj|BAA74702.1| germin-like protein 1 [Oryza sativa]
Length=213

 Score =   255 bits (651),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK   SV   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP  SE+L V +GT++AGF++S  N V Y++TL  GD+M
Sbjct  85   GLGISAARLDIAVGGVVPLHTHPAASELLFVTQGTVAAGFITSSSNTV-YTRTLYAGDIM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G++ A A V FS  NPGLQI  +ALF N+LP+ IV+ VTFLD+AQ+K
Sbjct  144  VFPQGLLHYQYNAGQSAAVALVGFSGPNPGLQINDYALFANNLPSAIVEKVTFLDDAQVK  203

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  204  KLKSVLGGS  212



>ref|XP_009760539.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=208

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK   +VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+P HTHPG SE+L+V +G+++AGFVSS  N VY  KTLK+GD+M
Sbjct  81   GLGLSAARLDLAPGGVIPFHTHPGASEVLLVVQGSITAGFVSS-ANAVYL-KTLKKGDLM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ++     +  FV FSS +PGLQIT FALF NDLPT +V+  TFLDEA IK
Sbjct  139  IFPQGLLHFQVSDAGYTSVGFVFFSSSSPGLQITDFALFANDLPTKLVEATTFLDEATIK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>ref|XP_010454369.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=211

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 158/215 (73%), Gaps = 5/215 (2%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            K I  + F+ +LF+    ++     DFCV +   P  P+GY CK    V ENDFV+SGL 
Sbjct  2    KMIIHVFFIISLFLSIAFASVQ---DFCVADPKGPQSPSGYSCKNPDQVNENDFVFSGLG  58

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGT  389
             AGNT+NIIKAAVTPAF   F G+NGLG+SMARLD+  GGV+PLHTHPG SE+LVV +GT
Sbjct  59   KAGNTSNIIKAAVTPAFAPAFAGINGLGISMARLDLAGGGVIPLHTHPGASEVLVVIQGT  118

Query  390  LSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITT  569
            + AGF+SS  NKVY  KTL  GD MVFPQGLLHFQ+N GK  A AFV F S +PGLQIT+
Sbjct  119  ICAGFISS-ANKVYL-KTLNRGDTMVFPQGLLHFQLNSGKGPALAFVAFGSPSPGLQITS  176

Query  570  FALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            FALF NDLP+++V+  TFL + ++KKLK VLGGTN
Sbjct  177  FALFANDLPSELVEATTFLSDEEVKKLKGVLGGTN  211



>ref|XP_009600028.1| PREDICTED: auxin-binding protein ABP19a [Nicotiana tomentosiformis]
Length=208

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK   +VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+P HTHPG SE+L+V +G+++AGFVSS  N VY  KTLK+GD+M
Sbjct  81   GLGLSAARLDLAPGGVIPFHTHPGASEVLLVIQGSITAGFVSS-ANAVYL-KTLKKGDLM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ++     +  FV FSS +PGLQIT FALF NDLPT +V+  TFLDEA IK
Sbjct  139  VFPQGLLHFQVSDAGYTSVGFVFFSSSSPGLQITDFALFANDLPTKLVEATTFLDEATIK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>emb|CAA75907.1| Germin-like protein 1 [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  T V   DF Y GLAAAGNT+N+IKA VTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--TGVGAGDFYYHGLAAAGNTSNLIKAVVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVP+HTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAVGGVVPMHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNGGSSAAVALVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>gb|EMS51159.1| Germin-like protein 8-14 [Triticum urartu]
Length=213

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAG PCKK   V   DF Y GLA AGNT N+IKAAVTPAF  QFPGVN
Sbjct  27   DFCVADLACPDTPAGDPCKKG--VGPGDFYYHGLATAGNTNNLIKAAVTPAFVGQFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  85   GLGISAARLDIAVGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G + A A V FS  NPGLQIT +ALF N+LP+ +V+TVTFLD+AQ+K
Sbjct  144  VFPQGLLHYQYNGGSSPAVALVAFSGPNPGLQITDYALFANNLPSAVVETVTFLDDAQVK  203

Query  645  KLKSVLGGT  671
            KLKSVLGGT
Sbjct  204  KLKSVLGGT  212



>emb|CDY51841.1| BnaA03g56080D [Brassica napus]
Length=211

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+NIIKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVTPAFAPTFAGIN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL++GD M
Sbjct  84   GLGVSLARLDLASGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLEKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI +FALF NDLP+++V+  TFL +A++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_010910722.1| PREDICTED: auxin-binding protein ABP20-like [Elaeis guineensis]
Length=210

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    P+GY CK+ +SVT +DFV+SGL   GNT+NIIKAAVTPAF AQFPGVN
Sbjct  23   DFCVADLTGHLTPSGYDCKEESSVTTDDFVFSGLGVPGNTSNIIKAAVTPAFVAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLHTHP  SE LVV  GT+ AGF+SS  NKVYY+ TLK GD M
Sbjct  83   GLGISAARLDLAPGGVIPLHTHPAASEFLVVTHGTICAGFISS-ANKVYYT-TLKTGDSM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  +TKA A V+FSS +PGLQIT FALF N+LP+++V+ VTFLD+A++K
Sbjct  141  VFPQGLLHFQVNGDETKAMAIVSFSSPSPGLQITAFALFANNLPSELVEMVTFLDDAEVK  200

Query  645  KLKSVLGGT  671
            KLK +LGGT
Sbjct  201  KLKKLLGGT  209



>ref|XP_010420905.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
 ref|XP_010493167.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=211

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 157/215 (73%), Gaps = 5/215 (2%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            K I  + F+ +LF      A +   DFCV +   P  P+GY CK    V ENDFV+SGL 
Sbjct  2    KMIIHVFFIISLF---SSIAFASVQDFCVADPKGPQSPSGYSCKNPDQVNENDFVFSGLG  58

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGT  389
             AGNT+NIIKAAVTPAF   F G+NGLG+SMARLD+  GGV+PLHTHPG SE+LVV +GT
Sbjct  59   KAGNTSNIIKAAVTPAFAPAFAGINGLGISMARLDLAGGGVIPLHTHPGASEVLVVIQGT  118

Query  390  LSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITT  569
            + AGF+SS  NKVY  KTL  GD MVFPQGLLHFQ+N GK  A AFV F S +PGLQIT+
Sbjct  119  ICAGFISS-ANKVYL-KTLNRGDTMVFPQGLLHFQLNSGKGPALAFVAFGSPSPGLQITS  176

Query  570  FALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            FALF NDLP+++V+  TFL + ++KKLK VLGGTN
Sbjct  177  FALFANDLPSELVEATTFLSDEEVKKLKGVLGGTN  211



>ref|XP_004287630.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=211

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK   +VT +DFVYS L   GNT+N+IK  +T AF  QFPG+N
Sbjct  24   DFCVADYTAPQGPAGYSCKDPANVTVDDFVYSALGVPGNTSNMIKTGITTAFSPQFPGLN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+++AR D+ VGGVVP+HTH G SEI+++ EGT++AGF+SS DN+VY  KTLK+GD+M
Sbjct  84   GLGVALARADLAVGGVVPMHTHHGASEIVLIIEGTITAGFISS-DNEVYV-KTLKKGDIM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+NVG T A  FV+FSS NPGLQI   ALF+NDLPTD++   TFLD A+IK
Sbjct  142  VFPQGLLHFQVNVGDTPALEFVSFSSDNPGLQILYTALFQNDLPTDLIARSTFLDTAEIK  201

Query  645  KLKSVLGGTN  674
            KLK++LGGTN
Sbjct  202  KLKALLGGTN  211



>ref|XP_006289376.1| hypothetical protein CARUB_v10002870mg [Capsella rubella]
 gb|EOA22274.1| hypothetical protein CARUB_v10002870mg [Capsella rubella]
Length=212

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  PAGY CK    VTENDFV+SGL   GNT+NIIKAAVTPAF   F G N
Sbjct  25   DFCVADPKGPQSPAGYSCKNPDQVTENDFVFSGLGKTGNTSNIIKAAVTPAFAPAFAGTN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL  GD M
Sbjct  85   GLGVSMARLDLAAGGVIPLHTHPGASEVLVVVQGTICAGFISS-ANKVYL-KTLNRGDSM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI +FALF NDLP+++V+  TFL +A++K
Sbjct  143  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVK  202

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  203  KLKGVLGGTN  212



>ref|XP_009389677.1| PREDICTED: germin-like protein 8-14 [Musa acuminata subsp. malaccensis]
Length=215

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG LS    PAGYPCK+ ++VT +DFV++GL   G+T+N+IKAAVTPAF +QFPGVN
Sbjct  28   DFCVGELSSSDTPAGYPCKEVSTVTCDDFVFTGLGVPGDTSNLIKAAVTPAFVSQFPGVN  87

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI   GVVPLHTHPGGSE+L V EGT+ AGF+SS  N VY++ TL +GD M
Sbjct  88   GLGMSAARLDIAPDGVVPLHTHPGGSELLFVIEGTICAGFISS-ANDVYFT-TLNKGDTM  145

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQG LHFQIN G   A AFV+FSS NPGLQIT FALF N LP+ +V+ VTFLD+ Q+K
Sbjct  146  VFPQGQLHFQINAGDVNAVAFVSFSSPNPGLQITAFALFANSLPSPLVEKVTFLDDEQVK  205

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  206  KLKKVLGGS  214



>ref|XP_002439350.1| hypothetical protein SORBIDRAFT_09g004970 [Sorghum bicolor]
 gb|EES17780.1| hypothetical protein SORBIDRAFT_09g004970 [Sorghum bicolor]
Length=221

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 147/189 (78%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK  +SVT NDF Y GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  35   DFCVADLTCSDTPAGYPCK--SSVTANDFYYHGLAGQGKINPLIKAAVTPAFVGQFPGVN  92

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI+VGGVVPLHTHP GSE+L V +GT++AGF+SS  N V Y+KTL  GDVM
Sbjct  93   GLGISAARLDIEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTV-YTKTLYAGDVM  151

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G   A   V FSS NPGLQIT FALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  152  VFPQGLLHYQYNAGTGPAVGLVAFSSSNPGLQITDFALFANNLPSAVVEKVTFLDDAQVK  211

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  212  KLKSVLGGS  220



>gb|KCW82144.1| hypothetical protein EUGRSUZ_C03535 [Eucalyptus grandis]
Length=207

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GP GY CKK ++VT NDFV+SGL  AGNT+N+IKAA TPAF  QFPG+N
Sbjct  23   DFCVADLSAPEGPTGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAATPAFVTQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ RLD+  GGV+PLHTHPGGSE+++V EG++ AGF+SS  N      TL +GD M
Sbjct  83   GLGLSLVRLDMAPGGVIPLHTHPGGSEVILVLEGSICAGFISSSAN-----TTLNKGDSM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP+GLLHFQ+N  K  A AFV+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  138  IFPRGLLHFQLNAAKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVK  197

Query  645  KLKSVLGGT  671
            KLK +LGGT
Sbjct  198  KLKGILGGT  206



>ref|XP_010064035.1| PREDICTED: auxin-binding protein ABP19a [Eucalyptus grandis]
 gb|KCW71333.1| hypothetical protein EUGRSUZ_F04417 [Eucalyptus grandis]
Length=208

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL  P  PAGY CK    VT  DFV+SGL  AGNTTNIIKAAVTPAF  QFPGVN
Sbjct  21   DFCVANLKGPDTPAGYTCKSPAKVTVKDFVFSGLGVAGNTTNIIKAAVTPAFVGQFPGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+   GVVPLHTHPG SE+L V  G + AGF+SS ++   Y  TLK GD+M
Sbjct  81   GLGISAARLDLAPAGVVPLHTHPGASELLFVVHGKILAGFISSAND--VYLMTLKRGDIM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G +KA A V+FSS NPGLQI  FALF N+ P+ +V+  TFLD+AQ+K
Sbjct  139  VFPQGLLHFQINAGGSKAIAVVSFSSANPGLQILDFALFANNFPSPLVEKTTFLDDAQVK  198

Query  645  KLKSVLGGT  671
            KLK+VLGGT
Sbjct  199  KLKAVLGGT  207



>ref|NP_001140857.1| uncharacterized protein LOC100272933 precursor [Zea mays]
 gb|AAQ95582.1| germin-like protein [Zea mays]
 gb|ACF78801.1| unknown [Zea mays]
 gb|ACF84824.1| unknown [Zea mays]
 gb|ACF85121.1| unknown [Zea mays]
 gb|ACF85990.1| unknown [Zea mays]
 gb|AFW77165.1| germin-like protein [Zea mays]
Length=212

 Score =   251 bits (640),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 147/189 (78%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK  +SVT NDF + GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLTCSDTPAGYPCK--SSVTANDFYFHGLAGQGKINPLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI+VGGVVPLHTHP GSE+L V +GT++AGF+SS  N V Y+KTL  GD+M
Sbjct  84   GLGISAARLDIEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTV-YTKTLYAGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G   A   V FSS NPGLQIT FALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNAGTGAAVGLVAFSSPNPGLQITDFALFANNLPSAVVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>ref|XP_008784308.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=210

 Score =   250 bits (638),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    P+GY CKK  +VT NDFV++GL  AGNT+N+IKAAVTPAF AQFPGVN
Sbjct  23   DFCVADLTGRLTPSGYECKKEAAVTTNDFVFTGLGKAGNTSNLIKAAVTPAFVAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI  GGVVPLHTHP  +E LVV +GT+ AGF+S+ +N VYY K+L  GD M
Sbjct  83   GLGISAARLDIAPGGVVPLHTHPAATEFLVVTQGTICAGFISTANN-VYY-KSLNTGDSM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N G T A A V+FSS +PGLQIT+FALF N+LP+ +V+ VTFLD+A++K
Sbjct  141  LFPQGLLHFQVNGGGTTAVAIVSFSSPSPGLQITSFALFANNLPSALVEKVTFLDDAEVK  200

Query  645  KLKSVLGGT  671
            KLK +LGGT
Sbjct  201  KLKKLLGGT  209



>ref|XP_006465923.1| PREDICTED: auxin-binding protein ABP19a-like [Citrus sinensis]
 gb|KDO65035.1| hypothetical protein CISIN_1g028365mg [Citrus sinensis]
Length=210

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L L   PAGYPC     VT +DFV+SGL  AGNTT+II AAVTPAF AQFP VN
Sbjct  22   DFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+P+HTHP  SEIL+V  G ++AGF+SS  N VY  KTLK+GD+M
Sbjct  82   GLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYV-KTLKKGDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N G   A  FV+F+S NPGLQIT FALF N+L + +V+  TFLD+A +K
Sbjct  141  IFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVK  200

Query  645  KLKSVLGGT  671
            +LK++LGGT
Sbjct  201  RLKAILGGT  209



>ref|XP_010428148.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPALN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V EG+++AGFVSS  N VY  +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLEGSITAGFVSSSANTVYV-QTLKPGQVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK KA AFVTFSS NPGLQI  FALF N+LPTD+V   TFLD   +K
Sbjct  140  VFPQGLLHFQINQGKAKAAAFVTFSSANPGLQILDFALFANNLPTDLVVGTTFLDPTTVK  199

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  200  KLKGVLGGT  208



>emb|CDX70935.1| BnaC03g10190D [Brassica napus]
Length=211

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTE DF +SGLA AGNT+NIIKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTEKDFAFSGLAKAGNTSNIIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL+ GD M
Sbjct  84   GLGVSIARLDLATGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLERGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A A+V F S +PGLQI +FALF NDLP+++V+  TFL +A++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAYVAFGSSSPGLQILSFALFANDLPSELVEATTFLSDAEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_010932415.1| PREDICTED: germin-like protein 8-14 [Elaeis guineensis]
Length=205

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    P+GY CK  +SVT NDFV+SGL   GNT+NIIKAAVTPAF AQFPGVN
Sbjct  17   DFCVADLTGRLTPSGYECKMESSVTTNDFVFSGLGVPGNTSNIIKAAVTPAFVAQFPGVN  76

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD++ GGV+PLHTHP  SE LVV +GT+  GF+S+ +N   Y KTLK GD M
Sbjct  77   GLGISAARLDLNPGGVIPLHTHPAASEFLVVTQGTICGGFISTANN--VYLKTLKTGDSM  134

Query  465  VFPQGLLHFQINV-GKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            VFPQGLLHFQ+N  G T A A V+FSS +PGLQIT FALF N+LP+ +V+ VTFLD+A++
Sbjct  135  VFPQGLLHFQVNCGGSTTAVAIVSFSSPSPGLQITAFALFANNLPSALVEMVTFLDDAEV  194

Query  642  KKLKSVLGGT  671
            KKLK +LGGT
Sbjct  195  KKLKKLLGGT  204



>ref|XP_006426654.1| hypothetical protein CICLE_v10026481mg [Citrus clementina]
 gb|ESR39894.1| hypothetical protein CICLE_v10026481mg [Citrus clementina]
Length=211

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L L   PAGYPC     VT +DFV+SGL  AGNTT+II AAVTPAF AQFP VN
Sbjct  23   DFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+P+HTHP  SEIL+V  G ++AGF+SS  N VY  KTLK+GD+M
Sbjct  83   GLGLSLARLDLAKGGVIPMHTHPAASEILLVVHGCITAGFISSSANTVYV-KTLKKGDIM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N G   A  FV+F+S NPGLQIT FALF N+L + +V+  TFLD+A +K
Sbjct  142  IFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVK  201

Query  645  KLKSVLGGT  671
            +LK +LGGT
Sbjct  202  RLKGILGGT  210



>ref|XP_006400624.1| hypothetical protein EUTSA_v10014670mg [Eutrema salsugineum]
 gb|ESQ42077.1| hypothetical protein EUTSA_v10014670mg [Eutrema salsugineum]
Length=211

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA +GNT+N+IKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKSGNTSNLIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL+ GD M
Sbjct  84   GLGVSMARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLQRGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF NDLP+++V+  TFL + ++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>gb|AEQ39055.1| putative germin-like protein [Wolffia arrhiza]
Length=211

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GYPCKK  ++T +DFV+SGL  AGNTTNIIKAAVTPAF AQ+P VN
Sbjct  24   DFCVADLTAPLTPSGYPCKKEAALTVDDFVFSGLGKAGNTTNIIKAAVTPAFVAQYPAVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLH HP G+E+LVV  G + AGF+SS  N VYY KTL +GD M
Sbjct  84   GLGISAARLDLAAGGVIPLHVHPNGNELLVVTSGRIVAGFISS-GNSVYY-KTLNKGDAM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G T A+A VTFSS +PGLQIT+ ALF +  P+ +V   TFL  A+++
Sbjct  142  VFPQGLLHFQINGGGTPASAIVTFSSASPGLQITSIALFGSSFPSKLVSGTTFLSPAEVQ  201

Query  645  KLKSVLGGTN  674
            +LK+VLGGTN
Sbjct  202  RLKAVLGGTN  211



>ref|NP_197563.1| germin-like protein subfamily 3 member 3 [Arabidopsis thaliana]
 sp|P94072.1|GL33_ARATH RecName: Full=Germin-like protein subfamily 3 member 3; Short=AtGER3; 
Short=AtGLP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB51571.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51573.1| germin-like protein [Arabidopsis thaliana]
 emb|CAA73213.1| GLP3 protein [Arabidopsis thaliana]
 dbj|BAA77208.1| germin-like protein 2 precursor [Arabidopsis thaliana]
 emb|CAB54516.1| GER3 protein [Arabidopsis thaliana]
 gb|AAK62573.1| AT5g20630/T1M15_30 [Arabidopsis thaliana]
 gb|AAL06953.1| AT5g20630/T1M15_30 [Arabidopsis thaliana]
 gb|AED92868.1| germin-like protein subfamily 3 member 3 [Arabidopsis thaliana]
Length=211

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 157/211 (74%), Gaps = 4/211 (2%)
 Frame = +3

Query  48   MFLQTLFIlsllsas--shalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M +Q  FI+SL+S    +   DFCV +   P  P+GY CK    VTENDF ++GL  AGN
Sbjct  3    MIIQIFFIISLISTISFASVQDFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            T+NIIKAAVTPAF   + G+NGLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AG
Sbjct  63   TSNIIKAAVTPAFAPAYAGINGLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAG  122

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS  NKVY  KTL  GD MVFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF
Sbjct  123  FISS-ANKVYL-KTLNRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALF  180

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
             NDLP+++V+  TFL +A++KKLK VLGGTN
Sbjct  181  ANDLPSELVEATTFLSDAEVKKLKGVLGGTN  211



>ref|XP_004141699.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis sativus]
 ref|XP_004155922.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis sativus]
 gb|KGN45492.1| hypothetical protein Csa_7G450510 [Cucumis sativus]
Length=208

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGY CK ++ VT +DFV+SGL AAGN +++IKAAVTPAF  Q+PGVN
Sbjct  21   DFCVADLKGPQGPAGYSCKIASVVTADDFVFSGLRAAGNISSLIKAAVTPAFVEQYPGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+PLHTHPG SE+L+V +G + AGF+SS  N VY  KTLK+GD+M
Sbjct  81   GLGLSAARLDLAPGGVIPLHTHPGASELLLVTQGIIEAGFISS-ANAVYV-KTLKKGDLM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   A  F  FSS +PGLQI  FALF NDL TD+V   TFLD A IK
Sbjct  139  VFPQGLLHFQINAGGVTAVGFPVFSSPSPGLQILDFALFANDLSTDLVSKTTFLDPALIK  198

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  199  KLKSVLGGS  207



>ref|XP_009120792.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY22866.1| BnaA06g02110D [Brassica napus]
 emb|CDY16549.1| BnaC09g37240D [Brassica napus]
 emb|CDX92448.1| BnaA10g14870D [Brassica napus]
 emb|CDX85429.1| BnaA02g03840D [Brassica napus]
Length=211

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+NIIKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQNPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVTPAFAPAFAGLN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GL +S+ARLD+  GGV+PLHTHPG SE+LVV +GT+SAGF+SS  NKVY  KTL  GD M
Sbjct  84   GLDVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTISAGFISS-ANKVYL-KTLSRGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF NDLP+++V+  TFL + ++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_004973627.1| PREDICTED: germin-like protein 8-14-like [Setaria italica]
Length=212

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK  +SV+ NDF Y GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLSCSDTPAGYPCK--SSVSANDFYYHGLAGMGKINPLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD++VGGVVPLHTHP GSE+L V +GT++AGF+SS  N   Y+KTL  GD+M
Sbjct  84   GLGISAARLDMEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTP-YTKTLNAGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G   A A V FSS NPGLQIT FALF N+LP+ +V+ VTFLD+A +K
Sbjct  143  VFPQGLLHYQYNAGSGPAVALVAFSSPNPGLQITDFALFANNLPSAVVEKVTFLDDATVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>ref|XP_009126456.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY45080.1| BnaA02g04960D [Brassica napus]
Length=211

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGLA AGNT+N+IKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNLIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL+ GD M
Sbjct  84   GLGVSMARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLQRGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF NDLP+++V+  TFL + ++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGT+
Sbjct  202  KLKGVLGGTD  211



>gb|EYU45887.1| hypothetical protein MIMGU_mgv1a022096mg [Erythranthe guttata]
Length=210

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GY CK   +VT  DFV++G    GNTTNII AAV+PAFDAQFPG+N
Sbjct  23   DFCVADLTGPQTPSGYTCKPPANVTAEDFVFTGFRKGGNTTNIINAAVSPAFDAQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+P+HTHPG SE+++V +G+L  GFVSS  N VY  K LK GD+M
Sbjct  83   GLGLSIARLDLAPGGVIPMHTHPGASEVILVVQGSLVTGFVSS-ANAVYVKKLLK-GDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V+PQGLLHFQIN G   + AF +FSS NPGLQIT FALF N+LP+ +++  TFLD+AQ+K
Sbjct  141  VYPQGLLHFQINGGGKTSVAFASFSSPNPGLQITDFALFANNLPSMLIEKTTFLDDAQVK  200

Query  645  KLKSVLGGT  671
            KLKSVLGGT
Sbjct  201  KLKSVLGGT  209



>gb|AAB51566.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51581.1| germin-like protein [Arabidopsis thaliana]
Length=211

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 157/211 (74%), Gaps = 4/211 (2%)
 Frame = +3

Query  48   MFLQTLFIlsllsas--shalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M +Q  FI+SL+S    +   DFCV +   P  P+GY CK    VTENDF ++GL  AGN
Sbjct  3    MIIQIFFIISLISTISFASVQDFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGKAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            T+NIIKAAVTPAF   + G+NGLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AG
Sbjct  63   TSNIIKAAVTPAFAPAYAGINGLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAG  122

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS  NKVY  KTL  GD MVFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF
Sbjct  123  FISS-ANKVYL-KTLNRGDSMVFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALF  180

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
             NDLP+++V+  TFL +A++KKLK VLGGTN
Sbjct  181  ANDLPSELVEATTFLSDAEVKKLKGVLGGTN  211



>gb|AAB51583.1| germin-like protein, partial [Arabidopsis thaliana]
Length=188

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF ++GL  AGNT+NIIKAAVTPAF   + G+N
Sbjct  1    DFCVADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGNTSNIIKAAVTPAFAPAYAGIN  60

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL  GD M
Sbjct  61   GLGVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLNRGDSM  118

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF NDLP+++V+  TFL +A++K
Sbjct  119  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDAEVK  178

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  179  KLKGVLGGTN  188



>ref|XP_008786632.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=205

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     P+GY CK  ++VT +DFV++GL   GNT+NIIKAAVTPAF AQFPGVN
Sbjct  18   DFCVADLMGSLTPSGYQCKVESAVTTDDFVFTGLGVVGNTSNIIKAAVTPAFAAQFPGVN  77

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGV+PLHTHP  SE+LVV +G + AGF+SS  N VYY  TL +GD M
Sbjct  78   GLGISAARLDLAAGGVIPLHTHPAASELLVVTKGIIVAGFISS-ANTVYY-MTLHKGDTM  135

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A A V+FSS +PGLQIT+FALF N+LP+ +V+ VTFLD+A++K
Sbjct  136  VFPQGLLHFQVNGGGTPAVAIVSFSSPSPGLQITSFALFANNLPSALVEKVTFLDDAEVK  195

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  196  KLKKVLGGT  204



>ref|XP_010090139.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB38936.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + S P GPAGY CK    VT + FVYSGL   GNTTN+IKAAVT AFD QFPGVN
Sbjct  24   DFCVADYSAPQGPAGYSCKNPAKVTVDSFVYSGLGITGNTTNLIKAAVTTAFDNQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+AR D+  GGV+P HTH G SEI++V EG+L A FVSS DNKVY  K+LK+GD+M
Sbjct  84   GLGISLARADLAPGGVIPFHTHHGASEIIIVIEGSLCAAFVSS-DNKVYL-KSLKKGDIM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N GK+ A  FV F+S NPGLQ+  +ALF NDL T++V   +FLD A+IK
Sbjct  142  IFPQGLLHFQLNAGKSNALFFVAFNSPNPGLQLLDYALFGNDLATELVAAASFLDPAEIK  201

Query  645  KLKSVLGGT  671
            +LK+VLGG+
Sbjct  202  RLKAVLGGS  210



>gb|KFK26288.1| hypothetical protein AALP_AA8G228400 [Arabis alpina]
Length=211

 Score =   248 bits (632),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = +3

Query  48   MFLQTLFIlsllsas--shalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            M +Q  FILSL+S+   +   DFCV +   P  P+GY CK    VTENDF +SGLA AGN
Sbjct  3    MIIQIFFILSLVSSISFASVQDFCVADPKGPQSPSGYSCKDPEQVTENDFAFSGLAKAGN  62

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            T+NIIKAAVTPAF   F G NGLG+S+ARLD+  GGV+PLHTHPG SE LVV +GT+ AG
Sbjct  63   TSNIIKAAVTPAFAPAFAGTNGLGVSLARLDLAGGGVIPLHTHPGASEALVVIQGTICAG  122

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS  NKVY  KTL  GD M+FPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF
Sbjct  123  FISS-ANKVYL-KTLNRGDSMIFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALF  180

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
             NDLP+++V+  TFL + ++KKLK VLGGTN
Sbjct  181  ANDLPSELVEATTFLSDEEVKKLKGVLGGTN  211



>ref|XP_002874007.1| hypothetical protein ARALYDRAFT_910104 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50266.1| hypothetical protein ARALYDRAFT_910104 [Arabidopsis lyrata subsp. 
lyrata]
Length=211

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGL  AGNT+NIIKAAVTPAF   F G N
Sbjct  24   DFCVADPKGPQSPSGYSCKNPDQVTENDFAFSGLGKAGNTSNIIKAAVTPAFAPAFAGTN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPG SE LVV +GT+ AGF+SS  NKVY  KTL  GD M
Sbjct  84   GLGVSLARLDLAGGGVIPLHTHPGASEALVVIQGTICAGFISS-ANKVYL-KTLNRGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF NDLP+++V+  TFL +A++K
Sbjct  142  IFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDAEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_002304136.2| germin-like family protein [Populus trichocarpa]
 gb|EEE79115.2| germin-like family protein [Populus trichocarpa]
Length=210

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  ++VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  22   DFCVAKLKGAGSPAGYACRMPSNVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+   GV+P+HTHPG SEIL V +G ++AGF+SS  N VY  KTLK+GDVM
Sbjct  82   GLGLSMARLDLAPAGVIPMHTHPGASEILFVVQGKITAGFISSSANTVYV-KTLKKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN    +A A V+FS  +PGLQIT FA F NDL +++++  TFLD+AQ+K
Sbjct  141  VFPRGLLHFQINAAGIQAIAVVSFSDPDPGLQITDFAFFANDLSSELLEKSTFLDDAQVK  200

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  201  KLKKVLGGT  209



>ref|XP_004296080.1| PREDICTED: auxin-binding protein ABP19b-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 154/211 (73%), Gaps = 2/211 (1%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+++  +F L +  + +   DFCV + + P GPAGY CKK   VT +DFVYSGL   GNT
Sbjct  3    IIYVFCMFSLLVSFSYAAVQDFCVADYTAPSGPAGYSCKKDEMVTADDFVYSGLNTTGNT  62

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
             NI KAA TPA   QFPGVNGLG+SMAR+D+  GGV+PLH HPG +E+L VAEGTL AGF
Sbjct  63   VNIFKAANTPASADQFPGVNGLGISMARVDVAAGGVIPLHIHPGANEVLFVAEGTLDAGF  122

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGK-TKATAFVTFSSQNPGLQITTFALF  581
            +SS D    Y KT+K+GD++VFP+GLLHFQ+NVG  T   AF ++SS  PGLQI  FALF
Sbjct  123  ISS-DRNTVYVKTIKKGDIIVFPRGLLHFQVNVGNGTPVVAFASYSSARPGLQIVDFALF  181

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            K++L T+++K  TFLD  QIKKLK V GGTN
Sbjct  182  KSNLSTELIKRSTFLDFLQIKKLKIVFGGTN  212



>sp|L8BRS3.1|GLP1_MORAL RecName: Full=Germin-like protein; Short=Ma-Glp; Flags: Precursor 
[Morus alba]
 emb|CCH57381.3| auxin binding protein [Morus alba]
Length=209

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + S P GPAGY CK    VT ++FVYSGL   GNTTN+IKAAVT AFD QFPGVN
Sbjct  22   DFCVADYSAPQGPAGYSCKNPAKVTVDNFVYSGLGITGNTTNLIKAAVTTAFDNQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+AR D+  GGV+P HTHPG SEI++V EG+L A FVSS DNKVY  K+LK+GD M
Sbjct  82   GLGISLARPDLAPGGVIPFHTHPGASEIIIVIEGSLCAAFVSS-DNKVYL-KSLKKGDTM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP GLLHFQ+N GK  A  FV F+S NPGLQ+  +ALF NDL T++V   +FLD A+IK
Sbjct  140  IFPSGLLHFQLNAGKNNALFFVAFNSPNPGLQLVDYALFGNDLATELVAAASFLDPAEIK  199

Query  645  KLKSVLGGT  671
            +LK+VLGG+
Sbjct  200  RLKAVLGGS  208



>ref|XP_002274625.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=208

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGY CK    VT +DFVYSGL  AGNT+N IKA++  AF  +FPG+N
Sbjct  21   DFCVADLKAPQGPAGYSCKTPAKVTVDDFVYSGLGVAGNTSNFIKASINTAFADKFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMAR+D+  GG +P+H+HPG SE L+VA+G++ A FVSS DN V YSKTLKEGD+M
Sbjct  81   GLGLSMARVDLAPGGAIPMHSHPGASETLLVAKGSVIAAFVSS-DNTV-YSKTLKEGDIM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHF++N G+T A  +V+FSS NPGLQI ++ALF++ LP+++++  TFLD+ ++K
Sbjct  139  VFPQGLLHFEVNTGRTPALIWVSFSSSNPGLQILSYALFRSSLPSELIEKTTFLDDDEVK  198

Query  645  KLKSVLGGT  671
            +LK++LGG+
Sbjct  199  RLKALLGGS  207



>gb|ABK95684.1| unknown [Populus trichocarpa]
Length=210

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  + VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  22   DFCVAKLKGAGSPAGYACRMPSKVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+   GV+P+HTHPG SEIL V +G ++AGF+SS  N VY  KTLK+GDVM
Sbjct  82   GLGLSMARLDLAPAGVIPMHTHPGASEILFVVQGKITAGFISSSANTVYV-KTLKKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN    +A A V+FS  +PGLQIT FA F NDL +++++  TFLD+AQ+K
Sbjct  141  VFPRGLLHFQINAAGIQAIAVVSFSDPDPGLQITDFAFFANDLSSELLEKSTFLDDAQVK  200

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  201  KLKKVLGGT  209



>ref|XP_008462312.1| PREDICTED: auxin-binding protein ABP19a [Cucumis melo]
Length=210

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGY CK ++ VT +DFVY+GL AAGN +++IKAAVTPAF  Q+PGVN
Sbjct  23   DFCVADLKGPQGPAGYSCKIASVVTADDFVYTGLGAAGNISSLIKAAVTPAFVEQYPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+PLHTHPG SE+L+V +G + AGF+SS  N VY  KTLK+GD+M
Sbjct  83   GLGLSAARLDLAPGGVIPLHTHPGASELLLVTQGIIEAGFISS-ANAVYV-KTLKKGDLM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   A  F  FSS +PGLQI  FALF NDL TD+V   TFLD   IK
Sbjct  141  VFPQGLLHFQINAGGVTAVGFPVFSSPSPGLQILDFALFANDLSTDLVSKTTFLDPVLIK  200

Query  645  KLKSVLGGT  671
            KLK+VLGG+
Sbjct  201  KLKAVLGGS  209



>ref|XP_011035719.1| PREDICTED: auxin-binding protein ABP19a-like [Populus euphratica]
Length=208

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  + VT +DFVY+GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  20   DFCVAKLKGAGNPAGYACRMPSKVTVDDFVYTGLGVAGNTTNIISAAVTPAFVQQFPGVN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+   GV+P+HTHPG SE+L V  G ++AGF+SS  N VY  KTLK+GDVM
Sbjct  80   GLGLSMARLDLAPAGVIPMHTHPGASELLFVVRGKITAGFISSLANTVYV-KTLKKGDVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN G+  A A V+FS  +PGLQIT FA F N+L +++++  TFLD+AQ+K
Sbjct  139  VFPRGLLHFQINDGEINAVAVVSFSDPDPGLQITDFAFFANNLSSELLEKSTFLDDAQVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKKVLGGT  207



>ref|XP_011078075.1| PREDICTED: auxin-binding protein ABP20-like [Sesamum indicum]
Length=212

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LSLP GPAGYPCKKS SVT NDF Y GL   G+T N + A    AFDAQFPGVN
Sbjct  24   DFCVADLSLPAGPAGYPCKKSASVTVNDFFYHGLTTPGSTKNRVGAGFAAAFDAQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S++RLD++VGG+VP+H+HP  +E+++VAEGTL+ GF+SS+DNKVY  KTL + D+M
Sbjct  84   GLGISISRLDLEVGGLVPIHSHPAAAELVLVAEGTLTFGFISSYDNKVYI-KTLNKWDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQGLLHF IN G T   AF +FSSQNPG+Q T  ALFKND PT++V   TFLD  Q+K
Sbjct  143  VAPQGLLHFAINAGNTTVLAFASFSSQNPGIQTTPLALFKNDFPTNLVAKTTFLDVEQVK  202

Query  645  KLKSVLGGT  671
            KLK++LGGT
Sbjct  203  KLKALLGGT  211



>ref|XP_002299591.2| germin-like family protein [Populus trichocarpa]
 gb|EEE84396.2| germin-like family protein [Populus trichocarpa]
Length=207

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  + VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  19   DFCVAKLKGAGNPAGYACRMPSKVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  78

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+   GV+P+HTHPG SE+L V +G ++AGF+SS  N VY  KTLK+GDVM
Sbjct  79   GLGLSMARLDLAPAGVIPMHTHPGASEVLFVVQGKITAGFISSLANTVYV-KTLKKGDVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN G+  A A V+FS  +PGLQIT FA F N+L +++++  TFLD+AQ+K
Sbjct  138  VFPRGLLHFQINDGEINAVAVVSFSDPDPGLQITDFAFFANNLSSELLEKSTFLDDAQVK  197

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  198  KLKKVLGGT  206



>ref|XP_010471285.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFPG+N
Sbjct  22   DFCVANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V +G ++AGFVSS  N VY  +TLK G VM
Sbjct  82   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANAVYV-QTLKPGQVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK KA AFVTFSS NPGLQI  FALF N+LPTD+V   TFLD   +K
Sbjct  140  VFPQGLLHFQINQGKAKAAAFVTFSSANPGLQILDFALFANNLPTDLVVGTTFLDATTVK  199

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  200  KLKGVLGGT  208



>ref|XP_008228197.1| PREDICTED: auxin-binding protein ABP19a [Prunus mume]
Length=212

 Score =   246 bits (627),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P GPAGYPCK   +VT +DFV+SGLA  GNTTNII+AAVTPAF AQFPGVN
Sbjct  25   DFCVADLKGPDGPAGYPCKSPANVTVSDFVFSGLAKGGNTTNIIQAAVTPAFVAQFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+  GGV+P HTHPG SEILVV  G ++AGFVSS      Y +TLK+GDVM
Sbjct  85   GLGLSMARLDLAPGGVIPFHTHPGASEILVVTRGHITAGFVSS--ASTVYLETLKKGDVM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  K  ++AFV+FSS +PGLQI  FALF N+LP+ +V   TFLD AQIK
Sbjct  143  VFPQGLLHFQVNAAKIHSSAFVSFSSASPGLQILDFALFANNLPSALVGQTTFLDLAQIK  202

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  203  KLKGVLGGT  211



>ref|XP_006849665.1| hypothetical protein AMTR_s00024p00231430 [Amborella trichopoda]
 gb|ERN11246.1| hypothetical protein AMTR_s00024p00231430 [Amborella trichopoda]
Length=209

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CV +LSLPP P+G+PCK  + +T +DF ++GL  AGNT+NIIKAAVTPAF  QFP VN
Sbjct  22   DYCVADLSLPPTPSGFPCKSPSKLTSDDFYFTGLGVAGNTSNIIKAAVTPAFSPQFPAVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+PLHTHP G+E LV+ +GTL AGFV + +N   + +TLK+GDVM
Sbjct  82   GLGLSLARLDVLPGGVIPLHTHPAGNEALVMIQGTLCAGFVDTANN--VFLQTLKKGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   A AFVTFSS  PGLQIT+ ALF ++ P+ +++  TFL +A++K
Sbjct  140  VFPQGLLHFQINSGGIPALAFVTFSSPTPGLQITSIALFGSNFPSKLIEGTTFLSDAEVK  199

Query  645  KLKSVLGGT  671
            +LK +LGG+
Sbjct  200  RLKGILGGS  208



>ref|XP_006659477.1| PREDICTED: germin-like protein 8-14-like [Oryza brachyantha]
Length=212

 Score =   245 bits (626),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+    PAGYPCK    V   DF Y GLAAAGNT+N+IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADLTCSDTPAGYPCK--AGVGAGDFAYHGLAAAGNTSNLIKAAVTPAFVGQFPGVN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI VGGVVPLHTHP         +G ++AGF+SS  N V Y++TL  GD+M
Sbjct  84   GLGISAARLDIAVGGVVPLHTHPAAXXXXXXTQGPVAAGFISSSSNTV-YTRTLYAGDIM  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G++ A A V FS  NPGLQIT +ALF N+LP+ IV+ VTFLD+AQ+K
Sbjct  143  VFPQGLLHYQYNAGQSAAVALVAFSGPNPGLQITDYALFANNLPSAIVEKVTFLDDAQVK  202

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  203  KLKSVLGGS  211



>gb|ABG76199.2| germin-like protein [Capsicum chinense]
Length=203

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 154/204 (75%), Gaps = 5/204 (2%)
 Frame = +3

Query  42   LIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            LI+FL    ILS  +A     DFCV +L  P  P GY CK  T+VT +DFV+SGL+AAGN
Sbjct  4    LIIFLLATLILSSNAAVQ---DFCVADLKAPESPCGYSCKSVTNVTVDDFVFSGLSAAGN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            T +IIKAAVTPAF AQFPG+NGLGLS ARLD+  GGV+P HTHPG SE+L+V +G+++AG
Sbjct  61   TASIIKAAVTPAFAAQFPGLNGLGLSAARLDLAPGGVIPFHTHPGASEVLLVTQGSITAG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            FVSS ++ +   KTLK+GD+M+FPQGLLHFQ++     +  FV FSS NPGLQIT FALF
Sbjct  121  FVSSANSVL--KKTLKKGDIMIFPQGLLHFQMSHAGYTSVGFVFFSSSNPGLQITDFALF  178

Query  582  KNDLPTDIVKTVTFLDEAQIKKLK  653
             NDLPT +V   TFLDEA IKKLK
Sbjct  179  ANDLPTKLVGATTFLDEATIKKLK  202



>ref|XP_010416015.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=208

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRQIHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V EG+++AGFVSS  N V+  +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLEGSITAGFVSS-ANAVFV-QTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A AFVTFSS +PGLQI  FALF N+LPTD+V   TFLD   +K
Sbjct  139  VFPQGLLHFQINQGKSSAAAFVTFSSASPGLQILDFALFANNLPTDLVVGTTFLDATTVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|NP_177405.1| germin-like protein subfamily 3 member 1 [Arabidopsis thaliana]
 sp|P94040.1|GL31_ARATH RecName: Full=Germin-like protein subfamily 3 member 1; Short=At-GERM1; 
Short=AtGER1; Short=AtGLP1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51848.1|AC010926_11 germin-like protein; 70589-71215 [Arabidopsis thaliana]
 gb|AAB51567.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51568.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51574.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51575.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51579.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51584.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51751.1| germin-like protein [Arabidopsis thaliana]
 gb|AAD05223.1| germin-like protein 1 [Arabidopsis thaliana]
 dbj|BAA77207.1| germin-like protein precursor [Arabidopsis thaliana]
 gb|AAM63161.1| germin-like protein [Arabidopsis thaliana]
 gb|AAN60267.1| unknown [Arabidopsis thaliana]
 gb|AEE35348.1| germin-like protein subfamily 3 member 1 [Arabidopsis thaliana]
Length=208

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V  G+++AGFVSS  N VY  +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYV-QTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A+A VTF+S NPGLQI  FALF N LPT++V   TFLD   +K
Sbjct  139  VFPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>gb|AFY10819.1| germin-like protein [Camellia sinensis]
Length=231

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +  LP GPAGY CKK   VT +DFV++GL  A NT+NIIKAAVTPAFDAQFPGVN
Sbjct  23   DFCVADPKLPQGPAGYSCKKPAKVTVDDFVFTGLGMAANTSNIIKAAVTPAFDAQFPGVN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GGV+P+HTHPG SE+L+V +G + AGFV S  +   Y K LK+GDVM
Sbjct  83   GLGLSIARLDLAPGGVIPMHTHPGASELLLVVQGFIVAGFVDS--SNAVYVKKLKKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G   A AF TF S NPGLQI  FALF N+LP+ +V+  TFLD+A++K
Sbjct  141  VFPQGLLHFQVNGGGIPAIAFPTFGSPNPGLQILDFALFANNLPSPLVEKTTFLDDAEVK  200

Query  645  KLK  653
            KLK
Sbjct  201  KLK  203



>sp|P45854.1|GLP1_SINAL RecName: Full=Germin-like protein 1; Flags: Precursor [Sinapis 
alba]
 emb|CAA59257.1| Glp1 [Sinapis alba]
Length=211

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  P+GY CK    VTENDF +SGL  AGNT+N+IKAAVTPAF   F G+N
Sbjct  24   DFCVADPKGPQNPSGYSCKNPDQVTENDFAFSGLGKAGNTSNVIKAAVTPAFAPAFAGLN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GL +S+ARLD+  GGV+PLHTHPG SE+LVV +GT+ AGF+SS  NKVY  KTL  GD M
Sbjct  84   GLDVSLARLDLAGGGVIPLHTHPGASEVLVVIQGTICAGFISS-ANKVYL-KTLSRGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK  A AFV F S +PGLQI  FALF NDLP+++V+  TFL + ++K
Sbjct  142  VFPQGLLHFQLNSGKGPALAFVAFGSSSPGLQILPFALFANDLPSELVEATTFLSDEEVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>gb|AAB51750.1| germin-like protein [Arabidopsis thaliana]
Length=204

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  17   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  76

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V  G+++AGFVSS  N VY  +TLK G VM
Sbjct  77   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYV-QTLKPGQVM  134

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A+A VTF+S NPGLQI  FALF N LPT++V   TFLD   +K
Sbjct  135  VFPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVK  194

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  195  KLKGVLGGT  203



>ref|XP_002888885.1| hypothetical protein ARALYDRAFT_476393 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65144.1| hypothetical protein ARALYDRAFT_476393 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 139/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V  G+++AGFVSS +    Y +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLYVLSGSITAGFVSSAN--AVYVQTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQIN GK+ A A VTF+S NPGLQI  FALF N LPT++V   TFLD   +K
Sbjct  139  IFPQGLLHFQINAGKSSAAAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|XP_006302822.1| hypothetical protein CARUB_v10020953mg [Capsella rubella]
 gb|EOA35720.1| hypothetical protein CARUB_v10020953mg [Capsella rubella]
Length=208

 Score =   243 bits (619),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGY C +   V  +DFV+SGL   GNTTNII AAVTP F  QFP +N
Sbjct  21   DFCVANLKRAETPAGYQCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPALN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V +G+++AGFVSS  N VY  +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFVSS-ANAVYL-QTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A AFVTFSS NPGLQI  FALF N+LPTD+V   TFLD A +K
Sbjct  139  VFPQGLLHFQINQGKTPAAAFVTFSSANPGLQILDFALFANNLPTDLVVGTTFLDAATVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|XP_010537615.1| PREDICTED: germin-like protein subfamily 3 member 1 [Tarenaya 
hassleriana]
Length=208

 Score =   243 bits (619),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     P+GYPC +  +V   DFV++GL+  GNT++II AAVTPAF AQFPGVN
Sbjct  21   DFCVANLKHADTPSGYPCIRPINVKATDFVFTGLSTPGNTSSIINAAVTPAFVAQFPGVN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+   GV+P+HTHPG SEIL V +G ++AGFVSS  N VY  +TLK G VM
Sbjct  81   GLGLSIARLDLAPKGVIPMHTHPGASEILYVLDGCITAGFVSS-SNAVYV-QTLKAGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ N G + A A V+FSS NPGLQI  FALF N LPT++V   TFLD AQIK
Sbjct  139  VFPQGLLHFQTNAGASTAAAIVSFSSPNPGLQILDFALFANGLPTELVAATTFLDAAQIK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|XP_010471286.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score =   242 bits (618),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 139/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+SGL   GNTTNII AAVTP F  QFPG+N
Sbjct  22   DFCVANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVTPGFVGQFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V +G ++AGF+SS +    Y +TLK G VM
Sbjct  82   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFISSAN--AVYVQTLKPGQVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK KA AFVTFSS NPGLQI   ALF N+LPTD++   TFLD   +K
Sbjct  140  VFPQGLLHFQINQGKAKAAAFVTFSSANPGLQILNSALFANNLPTDLIVGTTFLDATTVK  199

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  200  KLKGVLGGT  208



>gb|AAL38307.1| germin-like protein [Arabidopsis thaliana]
 gb|AAM10138.1| germin-like protein [Arabidopsis thaliana]
Length=208

 Score =   242 bits (618),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V  G+++AGFVSS  N VY  +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYV-QTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A+A VTF+S NPGLQI  FALF N LP ++V   TFLD   +K
Sbjct  139  VFPQGLLHFQINAGKSSASAVVTFNSANPGLQILDFALFANSLPAELVVGTTFLDATTVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>dbj|BAH15357.1| germin like protein [Nicotiana tabacum]
Length=208

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  PAGY CK   +VT +DFV+SGL+AAGNT +IIKAAVTPAF AQFPG+N
Sbjct  21   DFCVADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+P HTHPG SE+L+V +G+++AGFVSS  N VY  KTLK+GD+M
Sbjct  81   GLGLSAARLDLAPGGVIPFHTHPGASEVLLVVQGSITAGFVSS-ANAVYL-KTLKKGDLM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ++     +  FV  SS +PGLQIT FALF NDLPT +V+  TFLDEA IK
Sbjct  139  IFPQGLLHFQVSDAGYTSVGFVFSSSSSPGLQITDFALFANDLPTKLVEATTFLDEATIK  198

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  199  KLKGVLGGTN  208



>ref|XP_011036430.1| PREDICTED: auxin-binding protein ABP19a-like [Populus euphratica]
Length=210

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     PAGY C+  ++VT +DFV++GL  AGNTTNII AAVTPAF  QFPGVN
Sbjct  22   DFCVAKLKGAGTPAGYACRMPSNVTVDDFVFTGLGVAGNTTNIISAAVTPAFVQQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+   GV+P+HTHPG SEIL V +G ++AGF+SS  N VY  KTLK+GDVM
Sbjct  82   GLGLSIARLDLAPAGVIPMHTHPGASEILFVVQGKITAGFISSSANTVYV-KTLKKGDVM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQIN     + A V+FS  +PGLQIT FA F NDL +++++  TFLD+AQ+K
Sbjct  141  VFPRGLLHFQINAAGINSIAVVSFSDPDPGLQITDFAFFANDLSSELLEKSTFLDDAQVK  200

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  201  KLKKVLGGT  209



>ref|XP_010051414.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
Length=231

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+ +IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSGLIKAAVTTAFANQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+  LD+  GGV+PLHTHPGGSE++ V +G++SAGF+SS  N VY  KTL +GD M
Sbjct  83   GLGISLVHLDMAPGGVIPLHTHPGGSEVIFVIQGSISAGFISSSANTVYL-KTLNKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQ+N GK  A AFV+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  142  IFPQGLLHFQLNAGKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVK  201

Query  645  KL  650
              
Sbjct  202  NF  203



>ref|XP_008362989.1| PREDICTED: LOW QUALITY PROTEIN: auxin-binding protein ABP20-like 
[Malus domestica]
Length=206

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 146/190 (77%), Gaps = 5/190 (3%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L++P GPAGY CK    V  +DFV+SGL  AGNTTNIIKAAVTPAF AQFPGVN
Sbjct  22   DFCVADLTVPDGPAGYSCK---XVKVDDFVFSGLDIAGNTTNIIKAAVTPAFAAQFPGVN  78

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            G G+S+ RLD+ VGG VP HTHPG   +L+V +GT+ A FVS   N VY  +TL++GD+M
Sbjct  79   GXGISLTRLDLAVGGXVPFHTHPGALGVLIVIKGTICASFVS-LANTVYL-RTLEKGDIM  136

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+T A AF +FS  +PG QI  FALFKNDL T+++   TFLD AQIK
Sbjct  137  VFPQGLLHFQVNGGETPALAFASFSRPSPGRQILDFALFKNDLXTELIAQTTFLDAAQIK  196

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  197  KLKGVLGGTN  206



>ref|XP_010086822.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB23832.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGY CK    VT +DFVYSGLAA GNTTNII AAVTPAF +QF  +N
Sbjct  24   DFCVADLTAPDTPAGYHCKDPKKVTADDFVYSGLAAPGNTTNIISAAVTPAFVSQFAALN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+PLHTHPG +EIL+V  G L+ GF+SS +  V Y K+LK+GD+ 
Sbjct  84   GLGLSAARLDLAPGGVIPLHTHPGANEILLVTHGRLTVGFISSAN--VPYVKSLKKGDIA  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  KT A +FV F+S  PGLQ+  FALF NDL + +V+  TFLDEA +K
Sbjct  142  VFPQGLLHFQLNDHKTHAQSFVFFNSPYPGLQLLDFALFANDLASILVEKTTFLDEATVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_010086820.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB23830.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  PAGY CK    VT +DFVYSGLAA GNTTNII AAVTPAF +QF  +N
Sbjct  24   DFCVADLTAPDTPAGYHCKDPKKVTADDFVYSGLAAPGNTTNIISAAVTPAFVSQFAALN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+  GGV+PLHTHPG +EIL+V  G L+ GF+SS +  V Y K+LK+GD+ 
Sbjct  84   GLGLSAARLDLAPGGVIPLHTHPGANEILLVTHGRLTVGFISSAN--VPYVKSLKKGDIA  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N  KT A +FV F+S  PGLQ+  FALF NDL + +V+  TFLDEA +K
Sbjct  142  VFPQGLLHFQLNDHKTHAQSFVFFNSPYPGLQLLDFALFANDLASILVEKTTFLDEATVK  201

Query  645  KLKSVLGGTN  674
            KLK VLGGTN
Sbjct  202  KLKGVLGGTN  211



>ref|XP_006390643.1| hypothetical protein EUTSA_v10019138mg [Eutrema salsugineum]
 gb|ESQ27929.1| hypothetical protein EUTSA_v10019138mg [Eutrema salsugineum]
Length=208

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVT  F AQFPG+N
Sbjct  21   DFCVANLKKAETPAGYPCIRPIHVKAKDFVFSGLGTPGNTTNIINAAVTAGFVAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHP  SE+L V EG+++AGFVSS ++   Y +TLK G VM
Sbjct  81   GLGLSTARLDLAPKGVIPMHTHPAASEVLFVLEGSITAGFVSSANS--VYVQTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A A VTF+S NPGLQI  FALF N+LPTD+V   TFLD A +K
Sbjct  139  VFPQGLLHFQINAGKSAAAAVVTFNSANPGLQILDFALFANNLPTDLVVGTTFLDPATVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>gb|KCW81975.1| hypothetical protein EUGRSUZ_C033371, partial [Eucalyptus grandis]
Length=199

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+ +IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSGLIKAAVTTAFANQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+  LD+  GGV+PLHTHPGGSE++ V +G++SAGF+SS  N VY  KTL +GD M
Sbjct  83   GLGISLVHLDMAPGGVIPLHTHPGGSEVIFVIQGSISAGFISSSANTVYL-KTLNKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQ  638
            +FPQGLLHFQ+N GK  A AFV+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ
Sbjct  142  IFPQGLLHFQLNAGKVPALAFVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQ  199



>emb|CAN67670.1| hypothetical protein VITISV_008896 [Vitis vinifera]
Length=209

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK    VT +DFVYSGL+  GNT+ +  AA+  AF  +FPG+N
Sbjct  22   DFCVADLTAPQGPAGYSCKTPAEVTADDFVYSGLSVPGNTSTLFNAAINTAFVXKFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMAR DI  GGV+P+HTHPG SEI+++A+G+++AG +SS DN VY  KTLKEGD+M
Sbjct  82   GLGVSMARADIAPGGVIPMHTHPGASEIILIAKGSVTAGLISS-DNTVYL-KTLKEGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+T+A  + +F S NPGLQI + ALF N+LP+++++  TFLD+ ++K
Sbjct  140  VFPQGLLHFQVNTGRTQAXLWXSFGSPNPGLQILSNALFSNNLPSELIEKTTFLDDDEVK  199

Query  645  KLKSVLGGT  671
            +LK++LGG+
Sbjct  200  RLKALLGGS  208



>ref|XP_002273384.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=209

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK    VT +DFVYSGL+  GNT+ +  AA+  AF  +FPG+N
Sbjct  22   DFCVADLTAPQGPAGYSCKTPAEVTADDFVYSGLSVPGNTSTLFNAAINTAFVEKFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMAR DI  GGV+P+HTHPG SEI+++A+G+++AG +SS DN VY  KTLKEGD+M
Sbjct  82   GLGVSMARADIAPGGVIPMHTHPGASEIILIAKGSVTAGLISS-DNTVYL-KTLKEGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+T+A  + +F S NPGLQI + ALF N+LP+++++  TFLD+ ++K
Sbjct  140  VFPQGLLHFQVNTGRTQAHLWASFGSPNPGLQILSNALFSNNLPSELIEKTTFLDDDEVK  199

Query  645  KLKSVLGGT  671
            +LK++LGG+
Sbjct  200  RLKALLGGS  208



>gb|AFK42476.1| unknown [Lotus japonicus]
Length=209

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 143/190 (75%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L    GPAGYPCK   +VT +DFV++GL+A GN TNII AAVTPAF  QFPGVN
Sbjct  22   DFCVADLKGSDGPAGYPCKTPATVTSDDFVFAGLSAPGNITNIIGAAVTPAFVGQFPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLDI  GGV+PLHTHPG +E+L+V +G ++AGF+SS      Y KTLK+G++M
Sbjct  82   GLGLSAARLDIGPGGVIPLHTHPGANELLIVTQGHITAGFISS--ASTVYIKTLKKGELM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+  GKTKA  F  FSS +PGLQI  FALF ++  T ++   TFLD A +K
Sbjct  140  VFPQGLLHFQVAAGKTKAIGFAIFSSASPGLQILDFALFASNFSTPLITKTTFLDPALVK  199

Query  645  KLKSVLGGTN  674
            KLK VLGG+ 
Sbjct  200  KLKGVLGGSG  209



>emb|CDY11164.1| BnaC06g24160D [Brassica napus]
Length=207

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+S L   GNTTNII AAVTP F AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKVKDFVFS-LGTPGNTTNIISAAVTPGFSAQFPGLN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V +G ++AGFVSS ++   Y +TLK G VM
Sbjct  80   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFVSSANS--VYVQTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A AFVTFSS +PGLQI  FALF N LPT++V   TFLD A +K
Sbjct  138  VFPQGLLHFQINAGKSAAAAFVTFSSASPGLQILDFALFANSLPTELVSATTFLDPALVK  197

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  198  KLKGVLGGT  206



>ref|XP_002521328.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
 gb|EEF40996.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
Length=207

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 150/209 (72%), Gaps = 6/209 (3%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL  L I+    A+    DFCV  L     P+GY C+    VT +DFV+SGL  +GNT
Sbjct  4    ILFLVALLIVPSSHAA----DFCVAKLKGAGSPSGYACRNPALVTADDFVFSGLGTSGNT  59

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
            TNII AAVTPAF  QFPG+NGLGLS ARLD+  GGVVPLHTHP  SE L V +G ++AGF
Sbjct  60   TNIISAAVTPAFVQQFPGLNGLGLSGARLDLAPGGVVPLHTHPAASEFLFVVDGKITAGF  119

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            +SS +    Y+KTLK+GDVMVFPQGLLHFQIN G   + A VTF+S  PGLQI  FALF 
Sbjct  120  ISSANT--VYTKTLKKGDVMVFPQGLLHFQINAGGIPSLAIVTFNSPEPGLQILDFALFA  177

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            ++ PT +V+  TFLDEAQIKKLK VLGGT
Sbjct  178  SNFPTPLVEKTTFLDEAQIKKLKGVLGGT  206



>ref|XP_002274457.1| PREDICTED: germin-like protein [Vitis vinifera]
Length=209

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P GPAGY CK    VT +DFVYSGL+  GNT+++  AA+  AF  +FPG+N
Sbjct  22   DFCVADLTAPQGPAGYSCKTPAEVTADDFVYSGLSQPGNTSSLFNAAINTAFVDKFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMAR D+  GGVVP+HTH G SE +++A+G+++AGF+SS DN VY  KTLKEGD+M
Sbjct  82   GLGLSMARADLAPGGVVPMHTHHGASETILIAKGSITAGFISS-DNTVYL-KTLKEGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G+T+A  +V+F S NPG+QI + ALF N+LP+++++  TFLD+ ++K
Sbjct  140  VFPQGLLHFQVNTGRTQAHFWVSFGSSNPGIQILSNALFSNNLPSELIEKTTFLDDDEVK  199

Query  645  KLKSVLGGT  671
            +LK++LGG+
Sbjct  200  RLKALLGGS  208



>emb|CAA63014.1| germin1 [Arabidopsis thaliana]
Length=208

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 139/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+SGL   GNTTNII AAVTPAF AQFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVTPAFAAQFPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GL LS ARLD+   GV+P+HTHPG SE+L V  G+++AGFVSS  N VY  +TLK G VM
Sbjct  81   GLALSTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFVSS-ANAVYV-QTLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A+A VTF+S N GLQI  FALF N LPT++V   TFLD   +K
Sbjct  139  VFPQGLLHFQINAGKSSASAVVTFNSANRGLQILDFALFANSLPTELVVGTTFLDATTVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>ref|XP_004510467.1| PREDICTED: germin-like protein subfamily 3 member 1-like [Cicer 
arietinum]
Length=226

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV ++     PAGYPCK +T+VT +DF YSGL  AGNTTNII AAVTPAF AQFP +N
Sbjct  39   DFCVADIKASDTPAGYPCKAATTVTSDDFAYSGLIEAGNTTNIINAAVTPAFVAQFPALN  98

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+PLHTHPG SE+L+V +G ++AGFVSS  N VY  KTLK+G++M
Sbjct  99   GLGLSAARLDLGPAGVIPLHTHPGASELLIVKQGHITAGFVSS-ANTVYI-KTLKKGEIM  156

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ   GK  A AF  FSS +PGLQI  FALF ++  T ++   TFLD   +K
Sbjct  157  VFPQGLLHFQATAGKRDAVAFAIFSSASPGLQILDFALFASNFSTPLITKTTFLDPVLVK  216

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  217  KLKSVLGGS  225



>emb|CDX68260.1| BnaA07g23000D [Brassica napus]
Length=207

 Score =   237 bits (605),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 139/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+S L   GNTTNII AAVTP F  QFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKAKDFVFS-LGIPGNTTNIISAAVTPGFAGQFPGLN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+   GV+P+HTHPG SE+L V +G ++AGFVSS  N VY  +TLK G VM
Sbjct  80   GLGLSTARLDLAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANSVYV-QTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A AFVTFSS +PGLQI  FALF N LPT++V   TFLD A +K
Sbjct  138  VFPQGLLHFQINAGKSPAAAFVTFSSASPGLQILDFALFANSLPTELVSATTFLDPALVK  197

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  198  KLKGVLGGT  206



>ref|XP_007024622.1| Germin-like protein 1 [Theobroma cacao]
 gb|EOY27244.1| Germin-like protein 1 [Theobroma cacao]
Length=224

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = +3

Query  108  FCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNG  287
             CV NL     P+GY CKK+  VT +D++++GL   GNTTNIIKAAV+PAF AQFPG+NG
Sbjct  38   LCVANLKGAETPSGYACKKAAKVTADDYMFTGLGLEGNTTNIIKAAVSPAFVAQFPGLNG  97

Query  288  LGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVMV  467
            LG+S ARLD+ VGG +P+HTHP  +E+L V  G ++AGF+S   N VY  KTLK GD+MV
Sbjct  98   LGMSAARLDLAVGGAIPMHTHPAATELLCVVHGHITAGFISP-ANSVYL-KTLKRGDIMV  155

Query  468  FPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIKK  647
            FP GLLHFQI+ GK    A V+F+S NPGLQI  FALF NDLP+ +V+T TFLD+AQ+KK
Sbjct  156  FPPGLLHFQISSGKRPGLAIVSFNSPNPGLQILDFALFANDLPSGLVETTTFLDDAQVKK  215

Query  648  LKSVLGGT  671
            LK VLGGT
Sbjct  216  LKGVLGGT  223



>ref|XP_009104850.1| PREDICTED: germin-like protein 1 [Brassica rapa]
Length=207

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 139/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V   DFV+S L   GNTTNII AAVTP F  QFPG+N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKAKDFVFS-LGIPGNTTNIISAAVTPGFAGQFPGLN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARL++   GV+P+HTHPG SE+L V +G ++AGFVSS  N VY  +TLK G VM
Sbjct  80   GLGLSTARLELAPKGVIPMHTHPGASEVLFVLDGYITAGFVSS-ANSVYV-QTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A AFVTFSS +PGLQI  FALF N LPT++V   TFLD A +K
Sbjct  138  VFPQGLLHFQINAGKSPAAAFVTFSSASPGLQILDFALFANSLPTELVSATTFLDPALVK  197

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  198  KLKGVLGGT  206



>gb|KFK41682.1| hypothetical protein AALP_AA2G159300 [Arabis alpina]
Length=208

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGY C +   V   DFV+SGL  AGNTTNII AAVTP F  Q+P +N
Sbjct  21   DFCVANLKRGETPAGYQCIRPIHVKSKDFVFSGLGTAGNTTNIINAAVTPGFVGQYPALN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+   GV+P+HTHPG SE+L V  G+++AGF+SS +    Y +TLK G VM
Sbjct  81   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLTGSITAGFISSAN--AVYVETLKPGQVM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQGLLHFQIN GK+ ++AFV+F+S NPGLQI  FALF N+LPT++V   TFLD A +K
Sbjct  139  IFPQGLLHFQINAGKSSSSAFVSFNSANPGLQILDFALFANNLPTELVVGTTFLDAATVK  198

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  199  KLKGVLGGT  207



>gb|KDP40703.1| hypothetical protein JCGZ_24702 [Jatropha curcas]
Length=207

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV  L     P+GY C+   +VT +DFV+ GLAAAGNTTNII AAVTPAF  QFPG+N
Sbjct  20   DFCVAKLRGAGNPSGYACRSPANVTADDFVFKGLAAAGNTTNIISAAVTPAFVQQFPGLN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GGVVP+HTHP  +EIL V  G ++AGF+SS +    Y  TLK G+VM
Sbjct  80   GLGISTARLDLAPGGVVPMHTHPAATEILYVVYGKITAGFISSANTP--YVNTLKTGEVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN G   A A V+F+S  PGLQI  FALF N L + +++  TFLD+AQ+K
Sbjct  138  VFPQGLLHFQINAGGKPALAIVSFNSPEPGLQILDFALFGNSLSSALIEKTTFLDDAQVK  197

Query  645  KLKSVLGGT  671
            KLKSVLGGT
Sbjct  198  KLKSVLGGT  206



>gb|ACG69484.1| germin-like protein 8 [Glycine max]
 gb|KHN01406.1| Auxin-binding protein ABP19a [Glycine soja]
Length=209

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = +3

Query  48   MFLQTLFIl--sllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MFL  +F+L     ++ +   DFCV +L     PAGYPCK   +VT +DFVY+GLA A N
Sbjct  1    MFLHIVFLLFLLSSTSHATVQDFCVADLKGADTPAGYPCKPPANVTSDDFVYTGLAEAAN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
             TNII AAVTPAF AQFPG+NGL LS ARLD+   GV+PLHTHPG +E+L+V +G + AG
Sbjct  61   VTNIINAAVTPAFVAQFPGLNGLELSAARLDLGPSGVIPLHTHPGANELLIVLQGHILAG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS    + Y K LK+G++MVFPQGLLHFQI VGK KA AF  FSS NPGLQI  FALF
Sbjct  121  FISS--GNIVYQKVLKKGELMVFPQGLLHFQIAVGKRKALAFPVFSSANPGLQILDFALF  178

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
             ++  T +V   TFLD   +KKLK VLGG+
Sbjct  179  ASNFSTPLVTQTTFLDPDLVKKLKGVLGGS  208



>gb|KCW82145.1| hypothetical protein EUGRSUZ_C03536 [Eucalyptus grandis]
Length=195

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 142/189 (75%), Gaps = 17/189 (9%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV+SGL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVTTAFANQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGV+PLHTHPGGSE+L+V +G++SAGF+SS  N              
Sbjct  83   GLGISLARLDLAPGGVIPLHTHPGGSEVLLVLQGSISAGFISSSANT-------------  129

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
                GLLHFQ+N GK  A A V+FSS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  130  ----GLLHFQLNAGKGPALAIVSFSSPSPGLQILDFALFANNFPSELVEATTFLDDAQVK  185

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  186  KLKGVLGGT  194



>ref|NP_001236394.1| uncharacterized protein LOC100500326 precursor [Glycine max]
 gb|ACU15366.1| unknown [Glycine max]
Length=207

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 148/209 (71%), Gaps = 4/209 (2%)
 Frame = +3

Query  48   MFLQTLFIl--sllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MFL  +F+L     ++ +   DFCV +L     PAGYPCK   +VT +DFVY+GLA A N
Sbjct  1    MFLHIVFLLFLLSSTSHATVQDFCVADLKGADTPAGYPCKPPANVTSDDFVYTGLAEAAN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
             TNII AAVTPAF AQFPG+NGL LS ARLD+   GV+PLHTHPG +E+L+V +G + AG
Sbjct  61   VTNIINAAVTPAFVAQFPGLNGLELSAARLDLGPSGVIPLHTHPGANELLIVLQGHILAG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS    + Y K LK+G++MVFPQGLLHFQI VGK KA AF  FSS NPGLQI  FALF
Sbjct  121  FISS--GNIVYQKVLKKGELMVFPQGLLHFQIAVGKRKALAFPVFSSANPGLQILDFALF  178

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
             ++  T +V   TFLD   +KKLK VLGG
Sbjct  179  ASNFSTPLVTQTTFLDPDLVKKLKGVLGG  207



>ref|XP_010666274.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=210

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGYPC+   ++T +DFV+SGL  AGNT+NI +  VT AFD  FP +N
Sbjct  24   DFCVADFNFPVGPAGYPCRNPANLTVDDFVFSGLGVAGNTSNIFRVGVTAAFDLTFPALN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLDI VGGVVP+H+H   SE+++V EGT+ AGF+SS DN  Y+ KTL  GD+M
Sbjct  84   GLGLSMARLDIGVGGVVPIHSHR-VSEVIMVIEGTIIAGFISS-DNTAYF-KTLNRGDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP  LLHFQ+NVG+T A AFV+ +S NPG Q  T ++  NDLPTD+V+ +T LD AQ++
Sbjct  141  IFPHTLLHFQVNVGETPALAFVSLNSANPGFQFFTTSIGANDLPTDVVQKITLLDAAQVQ  200

Query  645  KLKSVLGGTN  674
            ++K + GGTN
Sbjct  201  RVKRIFGGTN  210



>ref|XP_003627273.1| Germin-like protein [Medicago truncatula]
 gb|AET01749.1| auxin-binding protein ABP19a [Medicago truncatula]
 gb|AFK45666.1| unknown [Medicago truncatula]
Length=208

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 150/209 (72%), Gaps = 5/209 (2%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            I+FL +LF+    ++     DFCV ++     P+GYPCK +++VT +DF + GL A GN 
Sbjct  4    IIFLLSLFLSISNASVQ---DFCVADIKGSDTPSGYPCKPASTVTSDDFAFEGLIAPGNI  60

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
            TNII AAVTPAF AQFP VNGLGLS ARLD+   GV+PLHTHPG SE+LVV +G ++AGF
Sbjct  61   TNIINAAVTPAFVAQFPAVNGLGLSAARLDLGPAGVIPLHTHPGASELLVVTQGHITAGF  120

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            VSS  N VY  KTLK+G++MVFPQGLLHFQ   GK  A AF  FSS +PGLQI  FALF 
Sbjct  121  VSS-ANTVYI-KTLKKGELMVFPQGLLHFQATAGKRNAVAFAVFSSASPGLQILDFALFA  178

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            ++  T ++   TFLD   +KKLKS+LGG+
Sbjct  179  SNFSTPLITKTTFLDPVLVKKLKSILGGS  207



>ref|XP_010666307.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   233 bits (593),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGYPC+  +++T +DFV+SGL  AGNT NI  ++   A D  FP +N
Sbjct  24   DFCVADLSFPGGPAGYPCRNPSNLTVDDFVFSGLGVAGNTENIFNSSAFLAIDTTFPALN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+ VGGV+P+H+H   SE+++V EGT+ AGF+ S DN  YY KTLK+GD+M
Sbjct  84   GLGLSMARLDLGVGGVIPIHSHR-VSEVILVIEGTIIAGFIGS-DNTPYY-KTLKKGDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP  LLHFQ+N+GKT A AFV+ +S +PG Q TT AL  NDLPTD+++ +T LD  Q++
Sbjct  141  IFPHTLLHFQVNIGKTPALAFVSLNSASPGFQTTTIALAANDLPTDVIQKITLLDATQVR  200

Query  645  KLKSVLGGTN  674
            KLK++ GGTN
Sbjct  201  KLKTIFGGTN  210



>ref|XP_010666277.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  48   MFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTT  227
            MFL   F  S+ SA ++ +DFCV +L+ P GPAGYPCK   ++T +DFVYSGL  +GNT+
Sbjct  6    MFLFLSFFASISSAHTNIVDFCVADLNYPVGPAGYPCKNPANLTVDDFVYSGLGVSGNTS  65

Query  228  NIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFV  407
            N+    VT A D  FP +NGL +SM RLDI VGGVVP+H+H   SE+++V +G + AGF+
Sbjct  66   NVFGVGVTFAIDLTFPALNGLDISMTRLDIGVGGVVPMHSHR-VSELIIVIQGRIIAGFI  124

Query  408  SSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKN  587
            SS D KVYY KTLK+GD+M+FPQ LLHFQ+NVGKT A AFV+ +S  P  Q T+ +LF N
Sbjct  125  SS-DTKVYY-KTLKKGDIMIFPQSLLHFQVNVGKTPALAFVSLNSARPNFQTTSTSLFGN  182

Query  588  DLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            DLPT++++ +T LD  Q+KKLKS+ GGTN
Sbjct  183  DLPTNLIEKLTLLDAEQVKKLKSIFGGTN  211



>ref|XP_003547722.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=209

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L     P+GYPCK   +VT +DFVY+GLA A N TNII AAVTPAF AQFPG+N
Sbjct  22   DFCVADLKGADTPSGYPCKPPANVTSDDFVYTGLAEAANVTNIINAAVTPAFVAQFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GL LS ARLD+  GGV+PLHTHPG +E+L+V +G + AGF+SS    + Y K LK+G++M
Sbjct  82   GLDLSAARLDLGPGGVIPLHTHPGANELLIVLQGHILAGFISS--GNIVYQKVLKKGELM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQI VGK KA AF  FSS  PGLQI  FALF ++  T +V   TFLD A +K
Sbjct  140  VFPQGLLHFQIAVGKRKALAFPVFSSAFPGLQILDFALFASNFSTPLVTQTTFLDPAIVK  199

Query  645  KLKSVLGGT  671
            KLK VLGG+
Sbjct  200  KLKGVLGGS  208



>gb|ABK25578.1| unknown [Picea sitchensis]
Length=213

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    P+GYPCK ++S+T + FV++GL AAGN +N I AAVTPAF AQFP VN
Sbjct  26   DFCVADLSSELTPSGYPCKAASSLTSDSFVFTGLEAAGNVSNNIGAAVTPAFSAQFPAVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+   GV+PLH HP G+EIL+V +G + AGF+SS  + V YSKTL  GDVM
Sbjct  86   GLGVSIARLDLAPNGVIPLHIHPAGNEILLVLKGIICAGFISS--SNVVYSKTLNVGDVM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLH+QINVGK  A AF +FSS  PGLQI   +LF ++LP+ +++  TFL ++++K
Sbjct  144  VFPKGLLHYQINVGKYNAIAFASFSSPLPGLQIVPLSLFASNLPSFVIEKTTFLSDSEVK  203

Query  645  KLKSVLGGT  671
            +LK+ LGG+
Sbjct  204  RLKAFLGGS  212



>gb|ABK22930.1| unknown [Picea sitchensis]
Length=213

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    P+GYPCK ++S+  + FV++GL  AGN +N I AAVTPAF AQFP VN
Sbjct  26   DFCVADLSSELTPSGYPCKPASSLNSDSFVFTGLETAGNVSNNIGAAVTPAFSAQFPAVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI   GV+PLH HPGG+EIL+V +G ++AGF+SS  + V YSKTL  GD+M
Sbjct  86   GLGVSIARLDIAPNGVIPLHIHPGGNEILLVVKGVINAGFISS--SNVVYSKTLNVGDLM  143

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+QIN G++ A AF +FSS  PGLQI   +LF ++LP+ +++  TFL ++++K
Sbjct  144  VFPQGLLHYQINAGESTAIAFASFSSPIPGLQIVALSLFASNLPSAVIEKTTFLADSEVK  203

Query  645  KLKSVLGGT  671
            +LK+ LGG+
Sbjct  204  RLKAFLGGS  212



>ref|XP_007135442.1| hypothetical protein PHAVU_010G129900g [Phaseolus vulgaris]
 gb|ESW07436.1| hypothetical protein PHAVU_010G129900g [Phaseolus vulgaris]
Length=209

 Score =   230 bits (586),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = +3

Query  48   MFLQTLFIls--llsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            MFLQ +F+LS  L ++ +   DFCV +L    GPAG+PC     VT +DFV++GL+ A N
Sbjct  1    MFLQIVFLLSFLLSTSHATVQDFCVADLKSADGPAGFPCVPPAKVTSDDFVFAGLSEAAN  60

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
             TNII AAV+PAF  QFPGVNGL LS ARLD+   GV+PLHTHPG +E+L+V +G + AG
Sbjct  61   VTNIINAAVSPAFVGQFPGVNGLDLSAARLDLGPAGVIPLHTHPGANELLIVNQGHILAG  120

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F+SS  + V Y K LK G++MVFPQGLLHFQI   K KA AF  FSS NPGLQI  FALF
Sbjct  121  FISS--SNVVYQKVLKRGELMVFPQGLLHFQIAAHKRKAIAFAVFSSANPGLQILDFALF  178

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
             ++  T ++   TFLD   +KKLKSVLGG+
Sbjct  179  ASNFSTPLIAQTTFLDPDLVKKLKSVLGGS  208



>ref|XP_009105920.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 gb|AAX35339.1| oxalic acid oxidase [Brassica napus]
Length=207

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 138/189 (73%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+   GV+P+HTHPG SE+L V +G+++AGF+SS ++   Y +TLK G VM
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISSANS--VYVQTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A AFVTFSS +PGLQI  FALF N L T++V   TFL  A +K
Sbjct  138  VFPQGLLHFQINAGKTPAAAFVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVK  197

Query  645  KLKSVLGGT  671
             LK VLGGT
Sbjct  198  TLKGVLGGT  206



>ref|XP_010666280.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGYPC+   ++T +DFV+SG   AGNT+NI   AVT A D  FP +N
Sbjct  25   DFCVADFNYPVGPAGYPCRNPANLTVDDFVFSGFGVAGNTSNIFGVAVTSANDLTFPALN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SM+RLDI VGGVVP+H+H   SE+++V EG + AGF+SS ++KVYY KTL +GD+M
Sbjct  85   GLGISMSRLDIGVGGVVPIHSHR-VSELILVIEGKIIAGFISS-EDKVYY-KTLNKGDIM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ LLHFQ+NVGKT A AFV+ +S +P  Q TT +LF NDLPT++++ +T LD  Q+K
Sbjct  142  IFPQSLLHFQVNVGKTPAVAFVSLNSASPNFQTTTTSLFANDLPTNVIEKITLLDVGQVK  201

Query  645  KLKSVLGGTN  674
            KLK + GGTN
Sbjct  202  KLKRIFGGTN  211



>gb|KCW82126.1| hypothetical protein EUGRSUZ_C03507 [Eucalyptus grandis]
Length=193

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 19/189 (10%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P GPAGY CKK ++VT NDFV++GL  AGNT+N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSAPEGPAGYSCKKVSAVTVNDFVFAGLGMAGNTSNLIKAAVTTAFVNQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI  GGV+PLHTHPGGSE+L V +G++SAGF+SS  N VY  KTL +GD M
Sbjct  83   GLGISLARLDIAPGGVIPLHTHPGGSEVLFVLQGSISAGFISSSANTVYL-KTLNKGDSM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQG+                  SS +PGLQI  FALF N+ P+++V+  TFLD+AQ+K
Sbjct  142  IFPQGI------------------SSPSPGLQILDFALFANNFPSELVEATTFLDDAQVK  183

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  184  KLKGVLGGT  192



>sp|P46271.1|GLP1_BRANA RecName: Full=Germin-like protein 1; Flags: Precursor [Brassica 
napus]
 gb|AAA86365.1| germin-like protein [Brassica napus]
Length=207

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 137/189 (72%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+   GV+P+HTHPG SE+L V +G+++AGF+SS ++   Y +TLK G VM
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISSANS--VYVQTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A A VTFSS +PGLQI  FALF N L T++V   TFL  A +K
Sbjct  138  VFPQGLLHFQINAGKTPAAALVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVK  197

Query  645  KLKSVLGGT  671
             LK VLGGT
Sbjct  198  TLKGVLGGT  206



>ref|XP_010666275.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=210

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 140/190 (74%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY C+   ++T +DFV+SGL   GNT+NI  ++   A D  FP +N
Sbjct  24   DFCVADFNFPVGPAGYSCRNPANLTVDDFVFSGLGVPGNTSNIFNSSAFLAIDVTFPALN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+DVGG +P+H+H   SE+++V EGT+ AGF+ S DN  YY KTL  GD+M
Sbjct  84   GLGLSMARLDLDVGGTIPVHSHRV-SEVIIVIEGTIIAGFIGS-DNTAYY-KTLNRGDIM  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ LLHFQ+N+G + A AFV  +S +PG Q TTFAL  NDLPTDI++ +T LD  Q++
Sbjct  141  IFPQTLLHFQVNIGDSPALAFVALNSASPGFQTTTFALAANDLPTDIIQKITLLDAGQVR  200

Query  645  KLKSVLGGTN  674
            KLK++ GGTN
Sbjct  201  KLKTIFGGTN  210



>ref|XP_009126460.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY45077.1| BnaA02g04990D [Brassica napus]
 emb|CDY27880.1| BnaA07g04700D [Brassica napus]
Length=212

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 139/190 (73%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + S P GP+G+ CK    VT NDF +SGLA AGNT+N+IKAAVT AF   F GVN
Sbjct  25   DFCVADPSGPQGPSGFSCKNPDQVTANDFAFSGLAKAGNTSNMIKAAVTTAFAPAFSGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ RLD+  GGVVPLH H G SE+L+V EGT+  GF+SS DNKVY  KTL++G+V+
Sbjct  85   GLGISVVRLDLAAGGVVPLHIHRGASEVLIVIEGTIRGGFISS-DNKVYL-KTLQKGEVI  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHF +N G   A AF    S NPG+Q+   ALF +DLP+++V+  TFL   +I+
Sbjct  143  VFPQGLLHFALNNGTGPALAFAALGSSNPGVQLVPSALFASDLPSELVEATTFLSREEIR  202

Query  645  KLKSVLGGTN  674
            +LK V GG+N
Sbjct  203  RLKRVFGGSN  212



>gb|ACG30276.1| auxin-binding protein ABP20 precursor [Zea mays]
Length=197

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 136/189 (72%), Gaps = 18/189 (10%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L                 T +DF + GLA  G    +IKAAVTPAF  QFPGVN
Sbjct  26   DFCVADL-----------------TCSDFYFHGLAGQGKINPLIKAAVTPAFVGQFPGVN  68

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI+VGGVVPLHTHP GSE+L V +GT++AGF+SS  N V Y+KTL  GD+M
Sbjct  69   GLGISAARLDIEVGGVVPLHTHPAGSELLFVTQGTVAAGFISSGSNTV-YTKTLYAGDIM  127

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLH+Q N G   A   V FSS NPGLQIT FALF N+LP+ +V+ VTFLD+AQ+K
Sbjct  128  VFPQGLLHYQYNAGTGAAVGLVAFSSPNPGLQITDFALFANNLPSAVVEKVTFLDDAQVK  187

Query  645  KLKSVLGGT  671
            KLKSVLGG+
Sbjct  188  KLKSVLGGS  196



>ref|XP_003528524.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=208

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 142/212 (67%), Gaps = 7/212 (3%)
 Frame = +3

Query  33   KITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAA  212
            K+  I FL  L      ++ +   DFCV NL  P  P+GY CK   +VT NDFV SG  A
Sbjct  2    KMIYIFFLLALL---SSTSHASVNDFCVANLKGPDSPSGYQCKPPNTVTVNDFVLSGFVA  58

Query  213  AGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTL  392
             GNTTN   AA+TPAF  + PGVNGLG+S ARLD+  GG VP+H+HPG SEIL++ +G +
Sbjct  59   -GNTTNAFNAALTPAFVTELPGVNGLGISAARLDLAKGGSVPMHSHPGASEILIMVKGQI  117

Query  393  SAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTF  572
            +AG ++       Y KTLK GDVMVFPQGLLHFQ N GK KATAFV FSS NPG Q+   
Sbjct  118  TAGILTP---GAVYEKTLKPGDVMVFPQGLLHFQANSGKGKATAFVAFSSANPGAQLLDL  174

Query  573  ALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
             LF N LP+D+V   TFLD AQ+KKLK+  GG
Sbjct  175  LLFGNSLPSDLVAQTTFLDVAQVKKLKARFGG  206



>gb|EMT30411.1| Germin-like protein 8-14 [Aegilops tauschii]
Length=252

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 144/229 (63%), Gaps = 43/229 (19%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGYPCK    V   DF Y GLAAAGNT+N+IKAAVTPAF  Q P  N
Sbjct  26   DFCVADLSCSDTPAGYPCK--AGVGAGDFYYHGLAAAGNTSNLIKAAVTPAFVGQLPRAN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI +GGVVPLHTHP  SE+L V EGT+ AGF+SS  N V Y+KTL +GD+M
Sbjct  84   GLGISAARLDIAMGGVVPLHTHPAASELLFVTEGTILAGFISSSSNTV-YTKTLYKGDIM  142

Query  465  VF----------------------------------------PQGLLHFQINVGKTKATA  524
            VF                                        P GLLH+Q N G + A A
Sbjct  143  VFPPGPAPLPVQRRQLAGVALVAFSGPNPGLADHRLRALRQQPAGLLHYQYNGGSSPAVA  202

Query  525  FVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
             V FS  NPGLQIT +ALF N+LP+ +V+ VTFLD+AQ+KKLKSVLGG+
Sbjct  203  LVAFSGPNPGLQITDYALFANNLPSAVVEKVTFLDDAQVKKLKSVLGGS  251



>gb|KHN01407.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL  P  P+GY CK   +VT NDFV SG  A GNTTN   AA+TPAF  + PGVN
Sbjct  21   DFCVANLKGPDSPSGYQCKPPNTVTVNDFVLSGFVA-GNTTNAFNAALTPAFVTELPGVN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+  GG VP+H+HPG SEIL++ +G ++AG ++       Y KTLK GDVM
Sbjct  80   GLGISAARLDLAKGGSVPMHSHPGASEILIMVKGQITAGILTP---GAVYEKTLKPGDVM  136

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ N GK KATAFV FSS NPG Q+    LF N LP+D+V   TFLD AQ+K
Sbjct  137  VFPQGLLHFQANSGKGKATAFVAFSSANPGAQLLDLLLFGNSLPSDLVAQTTFLDVAQVK  196

Query  645  KLKSVLGG  668
            KLK+  GG
Sbjct  197  KLKARFGG  204



>ref|XP_010688043.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 140/190 (74%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            ++CVG+LSLP GPAGY CK    VT +DFVYSGL  A NTTN+ K     AF AQFPG+N
Sbjct  23   NYCVGDLSLPSGPAGYSCKDPAKVTVDDFVYSGLRVAANTTNLFKFGGNNAFTAQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            G+GLS+ R+D+DVGG  P+HTH    E+  + EGT+ AGF+ SF+   Y  KTL +GD+M
Sbjct  83   GMGLSIVRVDMDVGGYFPIHTH-RVPELFTLIEGTIVAGFIDSFNTPFY--KTLNKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP  L+HF INVG T   A+ TFSS+NPG+Q+   ALF+N++P+D+V+ +T LD AQ+K
Sbjct  140  IFPPSLIHFAINVGSTPVLAYATFSSENPGVQLIDTALFRNNMPSDLVQKITLLDPAQVK  199

Query  645  KLKSVLGGTN  674
            KLK++ GGTN
Sbjct  200  KLKNLFGGTN  209



>ref|XP_004973626.1| PREDICTED: germin-like protein 8-14-like [Setaria italica]
Length=216

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 148/215 (69%), Gaps = 1/215 (0%)
 Frame = +3

Query  27   SKKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL  206
            +K + L++ +     L   S+ +   DFCV +L     PAGYPCK  T+VT +DF Y GL
Sbjct  2    AKAVVLLLVVTPFLSLLPFSSLALNQDFCVADLPRGDTPAGYPCKPQTAVTADDFYYRGL  61

Query  207  AAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEG  386
               G T N     ++ AF  +FPGVNGLG+S AR+D   GGVVPLH+HPGG+E+L V EG
Sbjct  62   GTTGPTINPFNIGLSSAFVTRFPGVNGLGISAARVDFAPGGVVPLHSHPGGTELLYVIEG  121

Query  387  TLSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQIT  566
             ++AGF++S  N+V Y+KTL +GD+MVFPQGLLHFQ N+G   A A  ++SS NPGL I 
Sbjct  122  AMAAGFITSLTNQV-YTKTLYKGDLMVFPQGLLHFQYNLGNDTAVALSSYSSANPGLMIL  180

Query  567  TFALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
             FALF N+LP+DIV  +T LDE ++KKLK++ GG+
Sbjct  181  DFALFANNLPSDIVSKLTVLDELEVKKLKALFGGS  215



>gb|ADD71875.1| germin-like protein subfamily 3 member 3 precursor [Arachis hypogaea]
Length=220

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 145/213 (68%), Gaps = 4/213 (2%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            ++FL +L       + +   DFCV +L  P  P+GY CK  ++VT +DFVYSGL A G+T
Sbjct  8    VLFLFSLLSTIPHYSYASVNDFCVADLKGPDSPSGYNCKPVSAVTADDFVYSGLVA-GDT  66

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
             N  KAA+T AF   FP VNGLG+S ARLDI  GG +P+HTHPG +E+L++ EG ++AGF
Sbjct  67   NNTFKAALTSAFVTDFPAVNGLGVSAARLDIAKGGSIPMHTHPGATELLIMVEGEITAGF  126

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            ++ F     YSKTLK GDV VFPQG LHFQ+N GK KATAF+ FSS NPG Q+    LF 
Sbjct  127  MTPF---ALYSKTLKPGDVFVFPQGQLHFQVNSGKKKATAFLAFSSANPGAQLLDLLLFG  183

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGGTN*SQ  683
            N L +DIV   TFLD  Q+KKLK+  GG N S+
Sbjct  184  NALSSDIVAQTTFLDIDQVKKLKARFGGKNLSK  216



>ref|XP_004288274.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 139/191 (73%), Gaps = 3/191 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GPAGY CK    VT +DFVYSGL  +GNT+NI K    PA   QFPG+N
Sbjct  24   DFCVADYTAPQGPAGYSCKDPAKVTVDDFVYSGLRVSGNTSNIHKFGFVPAVVTQFPGLN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEG-TLSAGFVSSFDNKVYYSKTLKEGDV  461
            GLG+S+AR D+ VGGV+P HTH G +E+L+VAEG ++  GFV S +NKVY  KT+ +GD 
Sbjct  84   GLGVSVARTDLGVGGVIPFHTHRGATEVLIVAEGSSVIGGFVDS-NNKVYM-KTMSKGDC  141

Query  462  MVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            MVFP+GLLHF +N G T A  + + SS+NPGL +    LFKNDLPTD++   T LD++QI
Sbjct  142  MVFPRGLLHFAVNQGDTPALMYASLSSENPGLDVLETQLFKNDLPTDLIHKTTLLDKSQI  201

Query  642  KKLKSVLGGTN  674
            +KLK +LGGTN
Sbjct  202  RKLKRLLGGTN  212



>emb|CDX96421.1| BnaA07g30320D [Brassica napus]
Length=217

 Score =   222 bits (566),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 133/183 (73%), Gaps = 3/183 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+   GV+P+HTHPG SE+L V +G+++AGF+SS  N VY  +TLK G VM
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISS-ANSVYV-QTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GKT A AFVTFSS +PGLQI  FALF N L T++V   TFL  A +K
Sbjct  138  VFPQGLLHFQINAGKTPAAAFVTFSSASPGLQILDFALFANTLSTELVSATTFLPPATVK  197

Query  645  KLK  653
             LK
Sbjct  198  TLK  200



>emb|CDX72929.1| BnaC06g33770D [Brassica napus]
Length=217

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 133/183 (73%), Gaps = 3/183 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL     PAGYPC +   V  +DFV+S L   GNTTNII AAVTP F AQFP +N
Sbjct  21   DFCVANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVTPGFVAQFPALN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLD+   GV+P+HTHPG SE+L V +G+++AGF+SS ++   Y +TLK G VM
Sbjct  80   GLGISTARLDLAPKGVIPMHTHPGASEVLFVLDGSITAGFISSANS--VYVQTLKPGQVM  137

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN GK+ A AFVTFSS +PGLQI  FALF N L T++V   TFLD   IK
Sbjct  138  VFPQGLLHFQINAGKSAAVAFVTFSSASPGLQILDFALFANSLSTELVSATTFLDPKVIK  197

Query  645  KLK  653
             LK
Sbjct  198  TLK  200



>gb|ABS86850.1| oxalate oxidase [Arachis hypogaea]
Length=220

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 143/210 (68%), Gaps = 4/210 (2%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            ++FL +L       + +   DFCV +L  P  P+GY CK  ++VT +DFVYSGL A G+T
Sbjct  8    VLFLFSLLSTIPHYSYASVNDFCVADLKGPDSPSGYNCKPVSAVTADDFVYSGLVA-GDT  66

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
             N  KAA+T AF   FP VNGLG+S ARLDI  GG +P+HTHPG +E+L++ EG ++AGF
Sbjct  67   NNTFKAALTSAFVTDFPAVNGLGVSAARLDIAKGGSIPMHTHPGATELLIMVEGEITAGF  126

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            ++ F     YSKTLK GDV VFPQG LHFQ+N GK KATAF+ FSS NPG Q+    LF 
Sbjct  127  MTPF---ALYSKTLKPGDVFVFPQGQLHFQVNSGKKKATAFLAFSSANPGAQLLDLLLFG  183

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGGTN  674
            N L +DIV   TFLD  Q+KKLK+  GG N
Sbjct  184  NALSSDIVAQTTFLDIDQVKKLKARFGGKN  213



>ref|XP_008786633.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=205

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GY CKK ++VT +DFV +GL   GN + + KAA   AF AQFPG+N
Sbjct  18   DFCVADLTGPETPSGYQCKKESAVTADDFVITGLGVPGNFSTMFKAAPKTAFVAQFPGLN  77

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S A +    GG +P+H+HP G+E+LVV EGTL AGF+SS +N  Y  KTL +GD M
Sbjct  78   GLGISAAYVYYAPGGFIPVHSHPAGTELLVVTEGTLLAGFISSANNPYY--KTLNKGDAM  135

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+NVG+T A   V FSS +PG+Q+T+ ALF N+LP+ +V+ VT+LD+A++K
Sbjct  136  VFPQGLLHFQVNVGETTAVGVVGFSSPSPGIQVTSPALFSNNLPSAVVEKVTYLDDAEVK  195

Query  645  KLKSVLGGT  671
            KLK +LGGT
Sbjct  196  KLKKMLGGT  204



>ref|XP_004510468.1| PREDICTED: germin-like protein 8-14-like [Cicer arietinum]
Length=206

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GYPCK  +SVT +DFV++     GNT+N  K+++TPAF  QFP +N
Sbjct  22   DFCVADLTSPQTPSGYPCK--SSVTIDDFVFTNFKP-GNTSNPFKSSLTPAFVHQFPAIN  78

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+ VGGVVP+H+H G SE++++ +G ++AGF+SS DN V+  KTL +GD++
Sbjct  79   GLGLSAARLDLGVGGVVPMHSHRGASELMIMVQGFITAGFISS-DNSVFV-KTLTKGDIL  136

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQGLLHFQ N GK KATAF+T SS NPG Q+  FALF N L +  V+  TFLD AQ+K
Sbjct  137  VIPQGLLHFQFNAGKNKATAFLTLSSSNPGAQLVDFALFGNSLNSAFVEKTTFLDHAQVK  196

Query  645  KLKSVLGGT  671
            KLK+V GG+
Sbjct  197  KLKAVFGGS  205



>ref|XP_010672291.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score =   219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 140/190 (74%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CVG+LSLP GPAGY CK  T+VT NDFV S L    NT NI K++ T A   QFPG+N
Sbjct  25   DYCVGDLSLPSGPAGYSCKDPTTVTVNDFVSSNLRVPRNTENIFKSSATTALVNQFPGLN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            G+G+S+ R D+DVGGVVP+HTH   SE+++V EGT+ AGF+ + +N  +Y KTL +GDVM
Sbjct  85   GMGISIVRSDMDVGGVVPIHTH-RVSELIIVVEGTILAGFIDT-NNTAFY-KTLNKGDVM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            + P  LLHFQ+NVG T +  + TF S+NPG Q+ + ALF++ LP +IV+ +T LD AQ+K
Sbjct  142  ILPPILLHFQVNVGSTPSVVYATFPSENPGFQVLSTALFRSSLPLEIVEKITLLDHAQVK  201

Query  645  KLKSVLGGTN  674
            KLK V GGTN
Sbjct  202  KLKKVFGGTN  211



>ref|XP_010672290.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 139/190 (73%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CVG+LSLP GPAGY CK  T+VT NDFV S L   GNT NI K   T A   QFPG+N
Sbjct  54   DYCVGDLSLPSGPAGYSCKDPTTVTVNDFVSSNLRVPGNTANIFKFGATTALVNQFPGIN  113

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            G+G+SM R D+DVGGVVP+HTH   SE+++V EGT+ AGF+ + +N  +Y KTL +GDVM
Sbjct  114  GMGISMLRSDMDVGGVVPIHTH-RVSELIIVVEGTILAGFIDT-NNTAFY-KTLNKGDVM  170

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            + P  LLHFQ+NVG T +  + TF S+NPG+Q  + ALF++ LP++IV+ +T LD AQ+K
Sbjct  171  ILPPILLHFQVNVGSTPSVVYATFPSENPGVQALSAALFQSSLPSEIVEKITLLDHAQVK  230

Query  645  KLKSVLGGTN  674
            KLK V GG N
Sbjct  231  KLKKVFGGIN  240



>ref|XP_006595343.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=179

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +3

Query  150  YPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGG  329
            + CKK   VT +DF YSGL  AGNT+NIIKAAVTPAFDAQF G+NGLG+S+A LD+  GG
Sbjct  9    HSCKKPAKVTADDFAYSGLGIAGNTSNIIKAAVTPAFDAQFAGLNGLGISVACLDLAAGG  68

Query  330  VVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGK  509
            V+PLHTHPG SE+LVV EG + AGF+SS    +  SK L  GDVM FPQGLLHFQIN GK
Sbjct  69   VIPLHTHPGASELLVVIEGRILAGFISS--ATLSTSKLL--GDVMAFPQGLLHFQINAGK  124

Query  510  TKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            + A   V FSS NPGLQI  FALFK+  PT ++   TF+D A +KKLK VLGG+
Sbjct  125  SSALTIVRFSSSNPGLQILDFALFKSSFPTPLIVQTTFIDVALVKKLKGVLGGS  178



>ref|XP_003627275.1| Germin-like protein [Medicago truncatula]
 gb|AET01751.1| auxin-binding protein ABP19a [Medicago truncatula]
 gb|AFK41104.1| unknown [Medicago truncatula]
Length=207

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 152/212 (72%), Gaps = 6/212 (3%)
 Frame = +3

Query  36   ITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAA  215
            +  I+FL TL   S  + ++  LDFCV +LS    P+GYPCKKS  VT NDFVYS   + 
Sbjct  1    MIFIIFLLTLL--SHSTTNASVLDFCVADLSSSQTPSGYPCKKS--VTINDFVYSNFNSG  56

Query  216  GNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLS  395
              +TN  K ++TPAF  QFP VNGLGLS A+LD+DVGG++P+H+H G SE+++V +G ++
Sbjct  57   NTSTNFFKFSITPAFVNQFPAVNGLGLSAAKLDLDVGGIIPMHSHRGASELMIVVQGRIT  116

Query  396  AGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFA  575
            AGF+SS DN V+  KTL +G ++V PQGLLHFQ N G+ KA+A++TFSS+NPG Q+   A
Sbjct  117  AGFISS-DNTVFI-KTLSKGQILVLPQGLLHFQYNAGRNKASAYLTFSSENPGSQVLDLA  174

Query  576  LFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            LF N+L +  +   T LD AQ+KKLK++ GG+
Sbjct  175  LFGNNLSSANLIKSTLLDPAQVKKLKAIFGGS  206



>ref|XP_007135441.1| hypothetical protein PHAVU_010G129800g [Phaseolus vulgaris]
 gb|ESW07435.1| hypothetical protein PHAVU_010G129800g [Phaseolus vulgaris]
Length=208

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL+ P GP+GY CK   +VT +DFV+SG  A GNT+ I  AA+TPAF +Q PGVN
Sbjct  23   DFCVANLNGPDGPSGYECKAPNTVTVDDFVFSGFVA-GNTSGIFNAAITPAFVSQLPGVN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS+ARLD+  GG VPLH+H   SEIL++ +G ++AGF++       Y KTLK GD+M
Sbjct  82   GLGLSVARLDLAKGGFVPLHSHTASSEILIMVKGEITAGFITP---AAAYQKTLKPGDIM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N GK KATA++ FS+ +PG Q+    LF N+LP+ ++   T LD AQ+K
Sbjct  139  VFPQGLLHFQVNSGKGKATAYLAFSNPSPGAQLLDLLLFGNNLPSQLIAQTTLLDYAQVK  198

Query  645  KLKSVLGG  668
            KLK+  GG
Sbjct  199  KLKARFGG  206



>ref|XP_003627279.1| Germin-like protein [Medicago truncatula]
 gb|AET01755.1| germin family 3 protein [Medicago truncatula]
 gb|AFK44135.1| unknown [Medicago truncatula]
Length=209

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 136/188 (72%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   ++T +DFV+ G  A GNT N   AA+T AF  +FPG+N
Sbjct  24   DFCVADLKAPDTPSGYQCKPLANITSDDFVFHGFVA-GNTNNSFNAALTSAFVTEFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI   G +P+HTHPG +E+L++ +G ++AGF++       YSKTLK GD+M
Sbjct  83   GLGISAARLDIAENGSIPMHTHPGATELLIIVQGEITAGFLTP---TSVYSKTLKPGDLM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQG+LHFQIN GK KATAF+TFSS NPG Q+    LF N+LP+++V   TFLD AQ++
Sbjct  140  VFPQGMLHFQINTGKGKATAFLTFSSANPGAQLLDLLLFSNNLPSELVAQTTFLDLAQVQ  199

Query  645  KLKSVLGG  668
            KLK+  GG
Sbjct  200  KLKARFGG  207



>ref|XP_003627280.1| Germin-like protein [Medicago truncatula]
 gb|AET01756.1| germin family 3 protein [Medicago truncatula]
 gb|AFK34826.1| unknown [Medicago truncatula]
Length=209

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 146/212 (69%), Gaps = 6/212 (3%)
 Frame = +3

Query  33   KITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAA  212
            KIT I+FL TL   S  ++ +   DFCVG++  P  P GY C    ++T +DFV+ G  A
Sbjct  2    KITPILFLFTLL--SSTTSYASVHDFCVGDIKAPETPTGYHCMPLANITSDDFVFHGFVA  59

Query  213  AGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTL  392
             GNT N   AA+T AF   FP +N LG+S ARLDI  GG +P+HTHPG +E+L++  G +
Sbjct  60   -GNTNNSFNAALTSAFVTDFPALNDLGISAARLDIAKGGSIPMHTHPGATELLIMVHGEI  118

Query  393  SAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTF  572
            +AGF+++      YSKTLK GD+MVFPQG+LHFQ+N GK KATAF+TFSS NPG Q+   
Sbjct  119  TAGFLTT---TAVYSKTLKPGDLMVFPQGMLHFQVNSGKGKATAFLTFSSANPGAQLLDL  175

Query  573  ALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
             LF N+LP+++V   TFLD AQ+KKLK+  GG
Sbjct  176  LLFSNNLPSELVAQTTFLDLAQVKKLKARFGG  207



>ref|XP_010917183.1| PREDICTED: germin-like protein 8-14 [Elaeis guineensis]
Length=206

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L+ P  P+GY CK  ++VT +DFV +GL   GN +++ KAA   AF  QFPG+N
Sbjct  19   DFCVADLTGPETPSGYHCKNESAVTADDFVMTGLGVPGNFSSMFKAAPKAAFVRQFPGIN  78

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S A +    GG +PLHTHP GSE++VV +GTL AGF+SS +N  Y  KTL  GD M
Sbjct  79   GLGISAAFVYYAPGGFIPLHTHPAGSELIVVTQGTLLAGFISSANNAYY--KTLNTGDAM  136

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+NVG+T A A V FSS +PG+Q T+F+LF  +LP+ +V+ VTFLD+ ++K
Sbjct  137  VFPQGLLHFQVNVGETTAIAVVGFSSPSPGIQTTSFSLFAGNLPSALVEKVTFLDDDEVK  196

Query  645  KLKSVLGGT  671
            KLK +LGGT
Sbjct  197  KLKKMLGGT  205



>ref|XP_010688042.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score =   217 bits (552),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 138/190 (73%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            ++CVG+LSLP GPAGY CK    VT +DFVYSGL    NTTN+ K     AF AQFPG+N
Sbjct  23   NYCVGDLSLPSGPAGYACKDPAKVTVDDFVYSGLRVGANTTNLFKFGGNNAFTAQFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            G+GLS+ R+D++VGG  P+HTH    E+  + EGT+ AGF+ SF+   Y  KTL +GD+M
Sbjct  83   GMGLSIVRVDMEVGGYFPIHTH-RVPELFTLVEGTIVAGFIDSFNTPFY--KTLNKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP  L+HF IN+G T   A+ TFSS+NPG+Q+   ALF+N++P+D+V+ +T LD AQ+ 
Sbjct  140  IFPPTLIHFAINIGSTPVLAYATFSSENPGVQLIDTALFRNNMPSDLVQKITLLDPAQVT  199

Query  645  KLKSVLGGTN  674
            KLK++ GGTN
Sbjct  200  KLKNLFGGTN  209



>emb|CAN74028.1| hypothetical protein VITISV_013539 [Vitis vinifera]
Length=206

 Score =   216 bits (551),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 141/189 (75%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +     G AGY CK    V + DFVYSGL  AGN ++I K+A+  AF  Q PG+N
Sbjct  20   DFCVADFKATQGLAGYQCKVPEVVVD-DFVYSGLNVAGNFSDIPKSAINIAFVDQLPGLN  78

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+ +G V+P+H+HPGGSE+L+V +G++ AGF+SS  N + Y KTLK+GD+M
Sbjct  79   GLGLSMARLDLSLGSVIPMHSHPGGSEVLLVTQGSIIAGFISS--NNIVYMKTLKKGDIM  136

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQ+N G   A  + +FSS NPG Q+ + ALF N+LP+++ + VTFLDE +++
Sbjct  137  VFPKGLLHFQVNSGPVPALLWSSFSSSNPGQQVLSNALFSNNLPSELTEKVTFLDELEVE  196

Query  645  KLKSVLGGT  671
            KLK++ GG+
Sbjct  197  KLKALFGGS  205



>gb|EAZ30088.1| hypothetical protein OsJ_14150 [Oryza sativa Japonica Group]
Length=222

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 135/197 (69%), Gaps = 9/197 (5%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+    PAGYPCK   +VT  DF Y GL   G T N    A++ AF  +FPGVN
Sbjct  26   DFCVGDLARGDTPAGYPCKPEATVTAEDFCYRGLVTTGPTVNPFNIALSSAFSTRFPGVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GL +S AR+D   GG+VPLH+HP G+E++ V EGTLSAGF+SS  NKVY S TL++GD+M
Sbjct  86   GLDISAARVDFSPGGIVPLHSHPSGTELIYVVEGTLSAGFISSTSNKVYTS-TLRKGDLM  144

Query  465  VFPQGLLHFQI--------NVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVT  620
            VFPQGLLHFQI            T A A   +SS NPGLQI  FALF N+LPTD++  VT
Sbjct  145  VFPQGLLHFQINDNGGGGDGNNATAAMAVSFYSSSNPGLQIMDFALFANNLPTDVLSKVT  204

Query  621  FLDEAQIKKLKSVLGGT  671
             LD+ +I+KLKS+  GT
Sbjct  205  VLDDLEIRKLKSLFRGT  221



>ref|NP_001240182.1| auxin-binding protein ABP19a-like precursor [Glycine max]
 gb|ACG69485.1| germin-like protein 9 [Glycine max]
 gb|KHN01408.1| Auxin-binding protein ABP19a [Glycine soja]
Length=208

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 144/211 (68%), Gaps = 5/211 (2%)
 Frame = +3

Query  36   ITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAA  215
            + +I FL  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG  A 
Sbjct  1    MKMIHFL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-  58

Query  216  GNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLS  395
            GNTTN   AA+T AF   FPGVNGLG+S ARLDI  GG +P+HTHP  +E+L++ EG ++
Sbjct  59   GNTTNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQIT  118

Query  396  AGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFA  575
            AGF++       Y+KTLK GD+MVFPQG LHFQ+N G  KATAF+ FSS NPG Q+    
Sbjct  119  AGFMTP---TALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLL  175

Query  576  LFKNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
            LF N LP+D+V   TFLD AQ+KKLK+  GG
Sbjct  176  LFGNTLPSDLVAQTTFLDVAQVKKLKARFGG  206



>ref|NP_001236898.1| uncharacterized protein LOC100527498 precursor [Glycine max]
 gb|ACU16594.1| unknown [Glycine max]
Length=208

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 144/211 (68%), Gaps = 5/211 (2%)
 Frame = +3

Query  36   ITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAA  215
            + +I FL  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG  A 
Sbjct  1    MKMIHFL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-  58

Query  216  GNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLS  395
            GNTTN   AA+T AF   FPGVNGLG+S ARLDI  GG +P+HTHP  +E+L++ EG ++
Sbjct  59   GNTTNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQIT  118

Query  396  AGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFA  575
            AGF++       Y+KTLK GD+MVFPQG LHFQ+N G  KATAF+ FSS NPG Q+    
Sbjct  119  AGFMTP---TALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLL  175

Query  576  LFKNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
            LF N LP+D+V   TFLD AQ+KKLK+  GG
Sbjct  176  LFGNTLPSDLVAQTTFLDVAQVKKLKARFGG  206



>gb|KHN01412.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 143/209 (68%), Gaps = 5/209 (2%)
 Frame = +3

Query  42   LIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN  221
            +I FL  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG  A GN
Sbjct  1    MIHFL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-GN  58

Query  222  TTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAG  401
            TTN   AA+T AF   FPGVNGLG+S ARLDI  GG +P+HTHP  +E+L++ EG ++AG
Sbjct  59   TTNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQITAG  118

Query  402  FVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALF  581
            F++       Y+KTLK GD+MVFPQG LHFQ+N G  KATAF+ FSS NPG Q+    LF
Sbjct  119  FMTP---TALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLLF  175

Query  582  KNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
             N LP+D+V   TFLD AQ+KKLK+  GG
Sbjct  176  GNTLPSDLVAQTTFLDVAQVKKLKARFGG  204



>ref|XP_009126458.1| PREDICTED: germin-like protein subfamily 3 member 3 [Brassica 
rapa]
 emb|CDY45079.1| BnaA02g04970D [Brassica napus]
Length=219

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (71%), Gaps = 2/197 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ + S P  P+GY CK    VT +DF +SGLA +GNT+N+IKAAV   F   F GVN
Sbjct  25   DFCIADPSGPQSPSGYSCKNPDQVTADDFAFSGLAKSGNTSNMIKAAVATGFAPAFAGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLD+  GGVVP+H H G SE+L+V EGT+ AG +SS  NKVY  KTL++G+V+
Sbjct  85   GLGVSVARLDLAEGGVVPIHIHSGASEVLIVIEGTIRAGIISS-ANKVYL-KTLQKGEVI  142

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHF +N G   A AF  F S NPG+Q+   ALF +DLP ++V+   FL   ++K
Sbjct  143  VFPQGLLHFALNGGTGPAMAFAAFGSSNPGVQLVPNALFASDLPAELVEATNFLSHEEVK  202

Query  645  KLKSVLGGTN*SQLTRF  695
            +LK VLGGTN   L+ +
Sbjct  203  RLKGVLGGTNEPSLSLY  219



>ref|XP_007135440.1| hypothetical protein PHAVU_010G129700g [Phaseolus vulgaris]
 emb|CAB77393.1| germin-like protein [Phaseolus vulgaris]
 gb|ESW07434.1| hypothetical protein PHAVU_010G129700g [Phaseolus vulgaris]
Length=206

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 4/208 (2%)
 Frame = +3

Query  45   IMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNT  224
            ++++  LF L   ++++   DFCV +L  P  P+GY CK +  VT +DFV+SGL A GNT
Sbjct  1    MIYILFLFSLLAFTSNAAVNDFCVADLKGPDSPSGYQCKPTKEVTVDDFVFSGLVA-GNT  59

Query  225  TNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGF  404
            TN   AA+T AF   FPGVNGLG+S ARLDI  GG +P+HTHP  +E+L++ EG ++AGF
Sbjct  60   TNTFNAALTSAFVTDFPGVNGLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGKITAGF  119

Query  405  VSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFK  584
            ++ F     Y+KTLK GD+MVFPQG LHFQ+N GK KATAF+ FSS NPG Q+    LF 
Sbjct  120  MTPF---AVYTKTLKPGDIMVFPQGQLHFQVNSGKGKATAFLAFSSANPGAQLLDLLLFG  176

Query  585  NDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
            N +P++++   TFLD  Q+KK+K   GG
Sbjct  177  NSIPSELIAQTTFLDVDQVKKVKRRFGG  204



>ref|XP_010687709.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
 gb|AAO92348.1| germin-like protein Kiel 1 [Beta vulgaris]
Length=211

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 138/190 (73%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CV +L+ P GPAGYPC+   ++T +DFVYSGL AAGN +    AA   A D  FP +N
Sbjct  25   DYCVADLTFPVGPAGYPCRNPATLTADDFVYSGLGAAGNFSTTFNAAAVLAVDTTFPALN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+ VGGV+P+H+H   SE+++V EGT+ AGF+ +  N   + KTL +GD+M
Sbjct  85   GLGLSMARLDLGVGGVIPIHSH-RASEVILVVEGTIVAGFIDT--NNTAFHKTLNKGDIM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP  LLHFQ+N+GK+ A AFVT +S +PG Q T+ AL   DLPT +++ VT LD  +++
Sbjct  142  MFPPTLLHFQVNIGKSPALAFVTLNSASPGFQTTSIALGATDLPTHLIQKVTLLDAREVR  201

Query  645  KLKSVLGGTN  674
            +LK++ GG+N
Sbjct  202  RLKNIFGGSN  211



>ref|XP_003528531.2| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=225

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 146/214 (68%), Gaps = 5/214 (2%)
 Frame = +3

Query  27   SKKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGL  206
            S K+ +I  L  LF L   ++ +   DFCV +L  P  P+GY CK   +VT +DFV+SG 
Sbjct  15   SSKMKMIHVL-FLFALVSFTSHASVNDFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGF  73

Query  207  AAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEG  386
             A GNTTN   AA+T AF   FPGVNGLG+S+ARLDI  GG +P+HTHP  +E+L++ EG
Sbjct  74   VA-GNTTNTFNAALTSAFVTDFPGVNGLGVSVARLDIAKGGSIPMHTHPAATELLIMVEG  132

Query  387  TLSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQIT  566
             ++AGF++       Y+KTLK GD+MVFPQG LHFQ+N G  KATAF+ FSS NPG Q+ 
Sbjct  133  QITAGFMTP---TALYTKTLKPGDIMVFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLL  189

Query  567  TFALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGG  668
               LF N LP+D+V   TFLD AQ+KK+K+  GG
Sbjct  190  DLLLFGNTLPSDLVAQTTFLDVAQVKKVKARFGG  223



>ref|XP_003627277.1| Germin-like protein [Medicago truncatula]
 gb|AET01753.1| germin family 3 protein [Medicago truncatula]
Length=209

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   ++T +DFV+ G  A GNT N   AA+T AF   FPG+N
Sbjct  24   DFCVADLKAPDTPSGYHCKPLANITSDDFVFHGFKA-GNTNNSFNAALTSAFVTDFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI   G +P+HTHPG +E+L++ +G ++AGF++       YSKTLK GD+M
Sbjct  83   GLGISAARLDIAENGSIPMHTHPGATELLIIVQGEITAGFLTP---TAVYSKTLKPGDLM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQG+LHFQIN GK KATAF+TFSS NPG Q+    LF N+LP+ +V   TFLD AQ++
Sbjct  140  VFPQGMLHFQINTGKGKATAFLTFSSANPGAQLLDLLLFSNNLPSQLVAQTTFLDLAQVQ  199

Query  645  KLKSVLGG  668
            KLK+  GG
Sbjct  200  KLKARFGG  207



>ref|XP_002445609.1| hypothetical protein SORBIDRAFT_07g022520 [Sorghum bicolor]
 gb|EES15104.1| hypothetical protein SORBIDRAFT_07g022520 [Sorghum bicolor]
Length=218

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +L+    PAGYPCK  T VT +DF Y GL + G T N     ++ AF  +FPGVN
Sbjct  29   DFCIADLARGDTPAGYPCKPQTGVTADDFYYRGLNSTGPTINPFNIGLSSAFVTRFPGVN  88

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+D   GGVVPLH+HPGG+E+L V EG +SAGF+SS  N+V+  KTL +GD+M
Sbjct  89   GLGISAARVDFAPGGVVPLHSHPGGTELLFVIEGAMSAGFISSLTNQVFV-KTLYKGDLM  147

Query  465  VFPQGLLHFQINV-GKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            VFPQGLLHFQ N+ G   A A  ++SS NPGL I  FALF N+LP+D+V  VT +DE ++
Sbjct  148  VFPQGLLHFQYNLAGNDTAVALSSYSSANPGLMILDFALFANNLPSDVVSKVTVVDELEV  207

Query  642  KKLKSVLGGT  671
            +KLK++ GG+
Sbjct  208  RKLKALFGGS  217



>gb|KHN01409.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P+GY CK   +VT +DFV+SG  A GNTTN   AA+T AF   FPGVN
Sbjct  21   DFCVADLKGPDSPSGYQCKPPNTVTVDDFVFSGFVA-GNTTNTFNAALTSAFVTDFPGVN  79

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI  GG +P+HTHP  +E+L++ EG ++AGF++       Y+KTLK GD+M
Sbjct  80   GLGVSAARLDIAKGGSIPMHTHPAATELLIMVEGQITAGFMTP---TALYTKTLKPGDIM  136

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQG LHFQ+N G  KATAF+ FSS NPG Q+    LF N LP+D+V   TFLD AQ+K
Sbjct  137  VFPQGQLHFQVNSGNGKATAFLAFSSANPGAQLLDLLLFGNTLPSDLVAQTTFLDVAQVK  196

Query  645  KLKSVLGG  668
            K+K+  GG
Sbjct  197  KVKARFGG  204



>ref|XP_004510469.1| PREDICTED: auxin-binding protein ABP19a-like [Cicer arietinum]
Length=211

 Score =   214 bits (545),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +L  P  P GY CK  T++T +DFV+ G  A G+T N   AA+T AF   FPGVN
Sbjct  26   DFCVADLKAPETPTGYHCKPLTNITADDFVFHGFVA-GDTKNTFNAALTSAFVTDFPGVN  84

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S ARLDI  GG +P+HTHPG +E+L++ +G ++AGF+++      YSK LK GDVM
Sbjct  85   GLGISAARLDIAEGGSIPMHTHPGATELLIMVKGEITAGFMTT---SAVYSKKLKVGDVM  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQG+LHFQ+N GK +ATAF++FSS NPG Q+    LF N+L +D V   TFLD AQ+K
Sbjct  142  VFPQGMLHFQVNSGKGEATAFLSFSSANPGAQLLDLLLFANNLSSDFVAQTTFLDVAQVK  201

Query  645  KLKSVLGG  668
            KLK+  GG
Sbjct  202  KLKTRFGG  209



>gb|AFK35921.1| unknown [Lotus japonicus]
 gb|AFK41304.1| unknown [Lotus japonicus]
Length=211

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 139/188 (74%), Gaps = 4/188 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS    PAGY CKK   +T NDFV+S   A GNT+N + AA+ PAF  QFPG+N
Sbjct  26   DFCVADLSRSVSPAGYACKKP-PLTVNDFVFSNFKA-GNTSNFLNAALNPAFVDQFPGIN  83

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLS ARLD+D GGVVP+H+HPG SE++++ +G ++ GF+S+ DN V Y KTL +GD++
Sbjct  84   GLGLSAARLDLDAGGVVPIHSHPGASELVIILQGRITVGFIST-DNTV-YQKTLMKGDII  141

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQGLLHFQ+N G  +A+A +TFSS NP  Q+   ALF N+L + +V   TFLD AQ+K
Sbjct  142  VIPQGLLHFQLNAGGNRASAVLTFSSTNPVAQLVDVALFGNNLDSGLVARTTFLDLAQVK  201

Query  645  KLKSVLGG  668
            KLK+V GG
Sbjct  202  KLKAVFGG  209



>ref|XP_002274739.1| PREDICTED: auxin-binding protein ABP19a [Vitis vinifera]
 emb|CBI35875.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +     G AGY CK    V  +D VYSGL  AGN ++I K+A+   F  Q PG+N
Sbjct  21   DFCVADFKATQGLAGYQCKVPEEVVVDDLVYSGLNVAGNFSDIPKSAINAVFVDQLPGLN  80

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSMARLD+ +GGV+P+H+HPGGSE+L+V +G++ AGF+SS  N + Y KTLK+GD+M
Sbjct  81   GLGLSMARLDLSLGGVIPMHSHPGGSEVLLVTQGSIIAGFISS--NNIAYMKTLKKGDIM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFP+GLLHFQ+  G   A  + +FSS NPG Q+ + ALF N+L +++++ VTFLDE +++
Sbjct  139  VFPKGLLHFQVKSGPVPALLWSSFSSSNPGQQVLSNALFSNNLASELIEKVTFLDELEVE  198

Query  645  KLKSVLGGT  671
            KLK + GG+
Sbjct  199  KLKVLFGGS  207



>gb|EMS64736.1| Germin-like protein 8-14 [Triticum urartu]
Length=217

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 131/189 (69%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            +FCV +L+    PAGYPCK   +VT +DF Y GL   G T N  K +++ AF   FPGVN
Sbjct  28   EFCVADLASSDTPAGYPCKPQAAVTADDFYYRGLGTTGPTVNPFKISLSSAFVTSFPGVN  87

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+D  VGGVVPLH HP  +E++ V EGTLS GF+S+  N   Y+ TL +GD+M
Sbjct  88   GLGISAARVDFAVGGVVPLHWHPAATELIFVVEGTLSCGFISATSNNRVYTNTLHKGDIM  147

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQG  HFQ N+G T A A  T+SS NPG+Q   FALF N+LP++++  VT LD+ Q++
Sbjct  148  VLPQGQPHFQYNLGNTTAVALSTYSSPNPGVQTLDFALFANNLPSEVLTKVTLLDDLQVR  207

Query  645  KLKSVLGGT  671
            KLK++ GGT
Sbjct  208  KLKALFGGT  216



>ref|XP_004303796.1| PREDICTED: auxin-binding protein ABP19a-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=208

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 137/189 (72%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P  PAGY CK    VT +DFV+SGL  AGN ++I K  ++ AF   FPG+N
Sbjct  22   DFCVADYAAPQSPAGYACKDPVKVTVDDFVFSGLRVAGNISSINKIGLSAAFAVNFPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+++ R D  VGGVVP+H+H   +E++++ EGT+ AGF++S +NK Y  KTL +GD M
Sbjct  82   GLGVALVRADFAVGGVVPIHSHRDATELVILVEGTVVAGFIAS-NNKAYV-KTLHKGDTM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGL HF +NVG+T A A+ +FSS NPG+Q    ALF+NDLPT+I+   T LD+ QI+
Sbjct  140  VFPQGLFHFLVNVGRTPALAYASFSSANPGVQTLETALFQNDLPTEIIAKSTLLDKVQIQ  199

Query  645  KLKSVLGGT  671
            KLK +LGG+
Sbjct  200  KLKRLLGGS  208



>ref|XP_010666278.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
 emb|CAK22420.1| germin-like protein [Beta vulgaris]
Length=211

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 140/191 (73%), Gaps = 4/191 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGN-TTNIIKAAVTPAFDAQFPGV  281
            D+CV + + P GPAGYPCK   ++T +DFV+SGL  A N TT    A+   A D  FP +
Sbjct  24   DYCVADFNFPVGPAGYPCKNPATLTADDFVFSGLGVAANSTTTPFNASSVFAVDVTFPAL  83

Query  282  NGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDV  461
            NGLGLS+ RLDI VGG VP+H+H   SE+++V+EGT+ AGF+ + +N  YY KTL +GD+
Sbjct  84   NGLGLSIGRLDIGVGGAVPIHSH-RASEVILVSEGTIIAGFIDT-NNTAYY-KTLNKGDI  140

Query  462  MVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
            M+FP  LLHFQ+NVGK+ A A+VT +S +PG +ITTFAL  ND P+D+++ +T +D AQ+
Sbjct  141  MIFPPTLLHFQVNVGKSPALAYVTLNSASPGFEITTFALAGNDFPSDLIQKITLVDTAQV  200

Query  642  KKLKSVLGGTN  674
            KKLK + GGTN
Sbjct  201  KKLKRIFGGTN  211



>gb|EMT28865.1| Germin-like protein 8-14 [Aegilops tauschii]
Length=220

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 131/189 (69%), Gaps = 0/189 (0%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            +FCV +L+    PAGYPCK   +VT +DF Y GL   G T N  K +++ AF   FPGVN
Sbjct  31   EFCVADLASSDTPAGYPCKPQAAVTADDFYYRGLGTTGPTVNPFKISLSSAFVTSFPGVN  90

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+D  VGGVVPLH HP  +E++ V EGTLS GF+S+  N   Y+ TL +GD+M
Sbjct  91   GLGISAARVDFAVGGVVPLHWHPAATELIFVVEGTLSCGFISATSNNRVYTNTLYKGDIM  150

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQG  HFQ N+G T A A  T+SS NPG+Q   FALF N+LP++++  VT LD+ Q++
Sbjct  151  VLPQGQPHFQYNLGNTTAVALSTYSSPNPGVQTLDFALFANNLPSEVLTKVTLLDDLQVR  210

Query  645  KLKSVLGGT  671
            KLK++ GGT
Sbjct  211  KLKALFGGT  219



>ref|XP_006652155.1| PREDICTED: germin-like protein 8-14-like [Oryza brachyantha]
Length=238

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 138/204 (68%), Gaps = 16/204 (8%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+    PAGYPCK   +VT +DF Y GL+A G T      A++ AF  +FPGVN
Sbjct  35   DFCVGDLARGDTPAGYPCKPEAAVTADDFSYRGLSATGPTIEPFNIALSSAFSPRFPGVN  94

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S A +    GGVVPLH+HPGGSE+L V EGTLSAGF+SS  NKV Y++TL++GD+M
Sbjct  95   GLGISAAIVHFGPGGVVPLHSHPGGSELLFVVEGTLSAGFISSVTNKV-YTQTLRKGDLM  153

Query  465  VFPQGLLHFQINVGK---------------TKATAFVTFSSQNPGLQITTFALFKNDLPT  599
            VFPQGLLHFQI  G                  A A   +SS NPGLQI  FALF N+LP+
Sbjct  154  VFPQGLLHFQIATGAGAGGNDDNATAPAAVAAAVALSMYSSSNPGLQILDFALFANNLPS  213

Query  600  DIVKTVTFLDEAQIKKLKSVLGGT  671
            D++  V+ LDE QIKKLKS+  GT
Sbjct  214  DVLSKVSVLDELQIKKLKSLFRGT  237



>ref|XP_010687565.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=242

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 136/194 (70%), Gaps = 3/194 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+LP GP+G+ CK  T VT +DFVYSG+  A NT+N+ K  +  A   QFPG+N
Sbjct  50   DFCVGDLNLPSGPSGFSCKDPTKVTADDFVYSGMRVASNTSNLFKFGIRRALSPQFPGLN  109

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+AR D DVGG  P+HTH   SEIL+V EGTL AGF+ + +NK YY KTL + D+M
Sbjct  110  GLGISIARADFDVGGFFPMHTH-RTSEILMVTEGTLMAGFIDT-NNKAYY-KTLMKEDIM  166

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            + P  L+HF INVG T   A+  F+  NPG+Q+   ALF+NDLP ++++ VT LD AQ+ 
Sbjct  167  IIPPTLVHFMINVGSTPVLAYTIFTGANPGVQLLDTALFQNDLPPEVIEKVTLLDHAQVT  226

Query  645  KLKSVLGGTN*SQL  686
            KLK +   TN S L
Sbjct  227  KLKKIFNDTNISSL  240



>gb|KCW81978.1| hypothetical protein EUGRSUZ_C03347 [Eucalyptus grandis]
Length=193

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 134/189 (71%), Gaps = 19/189 (10%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +LS P  P   P ++                  N +N+IKAAVT AF  QFPG+N
Sbjct  23   DFCVADLSPPRAPRATPARR------------------NISNLIKAAVTTAFVNQFPGLN  64

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ARLDI  GGV+PLHTHPGGSE+L+V +G++ AGF+SS  N VY  KTL +GD M
Sbjct  65   GLGISLARLDIAPGGVIPLHTHPGGSEVLLVLQGSICAGFISSSANTVYL-KTLNKGDSM  123

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FP+GLLHFQ+N GK  A A V+FSS +PGLQI  FALF N+ P+++V+  TF D+AQ+K
Sbjct  124  IFPRGLLHFQLNAGKGPALAVVSFSSPSPGLQILDFALFANNFPSELVEATTFPDDAQVK  183

Query  645  KLKSVLGGT  671
            KLK VLGGT
Sbjct  184  KLKGVLGGT  192



>emb|CAI56441.1| germin-like protein [Cicer arietinum]
Length=185

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 133/187 (71%), Gaps = 4/187 (2%)
 Frame = +3

Query  108  FCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNG  287
            FCV +L  P  P GY CK  T++T +DFV+ G  A G+T N   AA+T AF   FPGVNG
Sbjct  1    FCVADLKAPETPTGYHCKPLTNITADDFVFHGFVA-GDTKNTFNAALTSAFVTDFPGVNG  59

Query  288  LGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVMV  467
            LG+S ARLDI  GG +P+HTHPG +E+L++ +G ++AGF+++      YSK LK GDVMV
Sbjct  60   LGISAARLDIAEGGSIPMHTHPGATELLIMVKGEITAGFMTT---SAVYSKKLKVGDVMV  116

Query  468  FPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIKK  647
            FPQG+LHFQ+N GK +ATAF++FSS NPG Q+    LF N+L +D V   TFLD AQ+KK
Sbjct  117  FPQGMLHFQVNSGKGEATAFLSFSSANPGAQLLDLLLFANNLSSDFVAQTTFLDVAQVKK  176

Query  648  LKSVLGG  668
            LK+  GG
Sbjct  177  LKTRFGG  183



>ref|XP_004288296.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=208

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 132/190 (69%), Gaps = 3/190 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV +   P  PAGY CK  + V  +DFVYSGL   GN +N+ K  ++ A  AQ PG+N
Sbjct  22   DFCVADYKAPTSPAGYACKNPSDVKVDDFVYSGLGVPGNISNLSKVGISAALVAQVPGLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGLSM R D++VGGVVPLHTH   SE + VAEG + AGF++S DNK Y  K LK+GD M
Sbjct  82   GLGLSMVRADLEVGGVVPLHTHR-ASEAIFVAEGKVIAGFIAS-DNKAYV-KNLKKGDFM  138

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V P+ LLHFQ+N G T A  +  FSS +PG+QI   ALF+ND  T+++   T LD A+IK
Sbjct  139  VLPRSLLHFQVNAGSTPALVYALFSSDDPGVQILQNALFQNDFQTELIAKTTLLDTAEIK  198

Query  645  KLKSVLGGTN  674
            KLK++LGGTN
Sbjct  199  KLKALLGGTN  208



>ref|XP_003632366.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=209

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 139/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GP GY C+    VT +DFVYSGL   GNT++I  A+V  AF  +FP +N
Sbjct  22   DFCVADFTAPQGPTGYSCRTPAEVTADDFVYSGLRQPGNTSSIFNASVNSAFVHKFPVLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+AR D+  GGV PLHTHPG +EI++VA G ++AG +SS DN VY  KT++EGD+M
Sbjct  82   GLGVSLARADVAPGGVFPLHTHPGATEIILVARGAVTAGLISS-DNTVYV-KTVEEGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHF +N G T+A  +V+FSS +PGLQ+   ALF N+L +D+++ +T L + +++
Sbjct  140  VFPQGLLHFVVNNGGTEALIWVSFSSPSPGLQVLNTALFGNNLDSDLLEKITLLGDDEVQ  199

Query  645  KLKSVLGGT  671
            +LK + GGT
Sbjct  200  RLKGIFGGT  208



>dbj|BAJ98352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 1/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            +FCV +L+    PAGYPCK   +VT +DF Y GL   G   N  K +++ AF   FPGVN
Sbjct  26   EFCVADLASSDTPAGYPCKPQAAVTADDFYYRGLGTTGPAINPFKISLSSAFVTNFPGVN  85

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+D  VGGVVPLH HP  +E++ V EGTLS GF+S+  N+V Y+KTL +GD+M
Sbjct  86   GLGISAARVDFAVGGVVPLHWHPAATELIFVLEGTLSCGFISATSNRV-YTKTLYKGDLM  144

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQG  HFQ N+G T A A  T+SS NP +Q   FALF N+LP+++V  VT LDE +++
Sbjct  145  VLPQGQQHFQYNLGNTTAAALSTYSSYNPVVQTLDFALFANNLPSEVVNKVTLLDELEVR  204

Query  645  KLKSVLGGT  671
            KLK++ GGT
Sbjct  205  KLKALFGGT  213



>gb|AAG36666.1| oxalate oxidase-like germin 171 [Beta vulgaris]
Length=208

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   S+T +DFVY+G      TTNI K  VT AF   FP +N
Sbjct  23   DFCVGDLSLPRGPQGYACKDPASITTDDFVYTGFRGERTTTNIFKNNVTLAFADAFPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD  VGGV+P+H+H   SE++++ +G++ AGF+ +  N  YY + LK GDVM
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIILTKGSIIAGFIDT-TNTAYYRR-LKVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVGKT ATAFV+ +  NP +Q+TT A+F ++LP DIV  +T L   ++ 
Sbjct  140  IFPQSMLHFQVNVGKTPATAFVSLNGANPAIQLTTTAIFASNLPADIVDQITLLSNEEVM  199

Query  645  KLKSVLG  665
            +LK + G
Sbjct  200  RLKRIFG  206



>ref|XP_010670849.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   S+T +DFVY+G      TTNI K  VT AF   FP +N
Sbjct  23   DFCVGDLSLPRGPQGYACKDPASITTDDFVYTGFRGERTTTNIFKNNVTLAFADAFPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD  VGGV+P+H+H   SE++++ +G++ AGF+ +  N  YY + LK GDVM
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIILTKGSIIAGFIDT-TNTAYYRR-LKVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVGKT ATAFV+ +  NP +Q+TT ALF ++LP DIV  +T L   ++ 
Sbjct  140  IFPQSMLHFQVNVGKTPATAFVSLNGANPAIQLTTTALFASNLPADIVDQITLLSNEEVM  199

Query  645  KLKSVLG  665
            ++K + G
Sbjct  200  RVKRIFG  206



>ref|XP_010687789.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 135/194 (70%), Gaps = 3/194 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CVG+LSLP GP GY CK    VT +DFVYSG+  AGNT N+ K  V  AF A FPG+N
Sbjct  23   DYCVGDLSLPSGPTGYSCKDPAKVTVDDFVYSGMRVAGNTANLFKFGVKRAFVADFPGLN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+ R D DV GV P+HTH   SE+L+V EGTL AG + + +N  YY K+L +GD+M
Sbjct  83   GLGISITRTDFDVWGVFPMHTH-RVSELLMVTEGTLIAGIIDT-NNTAYY-KSLYKGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
              P  LLHF+INVG T   A+  F+S NPG+QI   +LF+N LP+++++ VT LD AQ+ 
Sbjct  140  AIPPTLLHFEINVGSTPVLAYTIFTSANPGVQILDTSLFQNSLPSEMIEKVTLLDHAQVT  199

Query  645  KLKSVLGGTN*SQL  686
            KLK + G T+ S L
Sbjct  200  KLKKIFGDTDISYL  213



>ref|XP_002264949.1| PREDICTED: auxin-binding protein ABP19a [Vitis vinifera]
 ref|XP_003632367.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
 emb|CBI37285.3| unnamed protein product [Vitis vinifera]
 emb|CBI37287.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 139/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV + + P GP GY C+    VT +DFVYSGL   GNT++I  A++  A   +FP +N
Sbjct  22   DFCVADFTAPQGPTGYSCRTPAEVTADDFVYSGLRQPGNTSSIFNASINSASVHKFPVLN  81

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S+AR D+  GGV+PLHTHPG +EI++VA G ++AG +SS DN VY  KT++EGD+M
Sbjct  82   GLGVSVARADVAPGGVLPLHTHPGATEIILVARGAVTAGLISS-DNTVYV-KTVEEGDIM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHF +N G T+A  +V+FSS +PGLQ+   ALF N+L +D+++ +T L + +++
Sbjct  140  VFPQGLLHFLVNTGGTEALIWVSFSSPSPGLQVLNTALFGNNLDSDLLEKITLLGDDEVQ  199

Query  645  KLKSVLGGT  671
            +LK + GGT
Sbjct  200  RLKGIFGGT  208



>ref|XP_010670843.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK  + +T +DFVY+G      T+N+ +  VT AF   +P +N
Sbjct  23   DFCVGDLSLPRGPEGYACKDPSDITTDDFVYTGFRGERTTSNLFRNNVTLAFVDAYPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD  VGGV+P+H+H   SE++++A G++ AGF+ +  N  YY + L+ GDVM
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIILATGSIIAGFIDT-TNTAYYRR-LEVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVG T ATAFV+ +S NPGLQ+TT ALF ++LP DIV+ +T L   ++ 
Sbjct  140  IFPQAMLHFQVNVGPTPATAFVSLNSANPGLQLTTTALFASNLPGDIVEQITLLSNEEVM  199

Query  645  KLKSVLG  665
            +LK + G
Sbjct  200  RLKRIFG  206



>ref|XP_010666281.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=218

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 130/187 (70%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+ SLP GP GY CK   ++T +DFVY+G      TTNI +  VT AF   FP +N
Sbjct  33   DFCVGDPSLPRGPQGYACKNPATITTDDFVYTGFRGERTTTNIFRNNVTLAFANAFPALN  92

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD  +GGV+PLH+H   SE+++V  GT+ AGF+ +  N  YY K L+ GDVM
Sbjct  93   GLGISMARLDFGIGGVIPLHSH-RTSEVIIVNRGTIIAGFIDT-SNTAYY-KRLEVGDVM  149

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQ +LHFQ+NVG T ATAFV+ +  NPGLQ+TT +LF  +LP DI + +T L   ++ 
Sbjct  150  VFPQAMLHFQVNVGNTPATAFVSLNGANPGLQLTTPSLFAGNLPADIAEQITLLSHNEVM  209

Query  645  KLKSVLG  665
            +LK V G
Sbjct  210  RLKRVFG  216



>ref|XP_010670845.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   ++T +DFVY+G      T+NI +  VT AF   FP +N
Sbjct  23   DFCVGDLSLPRGPQGYACKDPANITTDDFVYTGFRGERTTSNIFRNNVTLAFADAFPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD  VGGV+P+H+H   SE++++A G++ AGF+ +  N  YY + L+ GDVM
Sbjct  83   GLGISMARLDFGVGGVIPIHSHR-TSEVIIIATGSIIAGFIDT-TNTAYYRR-LEVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVG T ATAFV+ +  NP +Q+TT ALF ++LP DIV+ +T L   ++ 
Sbjct  140  IFPQSMLHFQVNVGTTPATAFVSLNGANPAIQLTTTALFASNLPGDIVEQITLLSNEEVM  199

Query  645  KLKSVLG  665
            +LK + G
Sbjct  200  RLKRIFG  206



>ref|XP_010666282.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=218

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 130/187 (70%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+ SLP GP GY CK   ++T +DFVY+G      TTNI +  VT AF   FP +N
Sbjct  33   DFCVGDPSLPRGPQGYACKNPATITTDDFVYTGFRGERTTTNIFRNNVTLAFANAFPALN  92

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SMARLD  +GGV+PLH+H   SE+++V  GT+ AGF+ +  N  YY K L+ GDVM
Sbjct  93   GLGISMARLDFGIGGVIPLHSHR-TSEVIIVNHGTIIAGFIDT-SNTAYY-KRLEVGDVM  149

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQ +LHFQ+NVG T ATAFV+ +  NPGLQ+TT +LF  +LP DI + +T L   ++ 
Sbjct  150  VFPQAMLHFQVNVGNTPATAFVSLNGANPGLQLTTPSLFAGNLPADIAEQITLLSHNEVM  209

Query  645  KLKSVLG  665
            +LK V G
Sbjct  210  RLKGVFG  216



>ref|XP_004973625.1| PREDICTED: germin-like protein 8-14-like [Setaria italica]
Length=222

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCV NL LP  P+GYPCK    V  NDF    L+ +G   +     + PA   Q PG+N
Sbjct  31   DFCVANLLLPNTPSGYPCKPKALVNANDFYTDDLSRSGPVFSPFNTGLAPANVKQVPGLN  90

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S  R+DI VGGVVPLHTHP GSE++ V EGT+S GF+S+  N   Y+KTL +GD+ 
Sbjct  91   GLGISATRVDIGVGGVVPLHTHPEGSELIFVVEGTISVGFISAETNTA-YTKTLNKGDLF  149

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQIN+G T A A   +SS NPGLQIT +ALF + L  D+V  VTF++EA+++
Sbjct  150  VFPQGLLHFQINIGNTTAVAINAYSSSNPGLQITPYALFGDTLRADVVSKVTFINEAEVR  209

Query  645  KLKSVLG  665
            K K+  G
Sbjct  210  KEKAEFG  216



>ref|XP_010666313.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 130/187 (70%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   ++T +DFVY+G      TTNI +  VT A  + +P +N
Sbjct  23   DFCVGDLSLPRGPEGYACKNPATITTDDFVYTGFRGEKATTNIFRNNVTLASASAYPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SM RL+  VGGV+PLH+H   SE+++V  GT+ AGF+ + +N+ YY K LK GDVM
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYY-KRLKVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVG+T ATAFV+ +  NPG Q+TT +LF  +LP  I + +T L   ++ 
Sbjct  140  IFPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHNEVM  199

Query  645  KLKSVLG  665
            +LK   G
Sbjct  200  RLKRAFG  206



>ref|XP_006837025.1| hypothetical protein AMTR_s00110p00020470 [Amborella trichopoda]
 gb|ERM99878.1| hypothetical protein AMTR_s00110p00020470 [Amborella trichopoda]
Length=210

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 142/190 (75%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            D+CV + SLP   +G+PCK  +++T +DF YSGLA  GNT+N IKA VTPAF  +FP +N
Sbjct  23   DYCVADTSLPQTFSGFPCKNPSNLTADDFSYSGLANPGNTSNTIKATVTPAFLTEFPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLGL++ R+D+  GGV+PLHTHP  +E LV+ +GTL  GFV +  NK Y  K+LK GDV 
Sbjct  83   GLGLAVGRVDVAPGGVIPLHTHPDANEALVLIQGTLIVGFVDT-SNKAYI-KSLKTGDVF  140

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            VFPQGLLHFQ+N G T A A +T +S  PG Q+T+F+LF +D  + +++T TFL EA++K
Sbjct  141  VFPQGLLHFQVNSGTTPAFAIITLNSAAPGAQLTSFSLFSSDFSSKLIETTTFLSEAEVK  200

Query  645  KLKSVLGGTN  674
            +LK++LGG+N
Sbjct  201  RLKTLLGGSN  210



>ref|XP_010666317.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 130/187 (70%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+LP GP GY CK  T++T +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLNLPRGPQGYACKNPTTITTDDFVYTGFRGEKATTNIFRNNVTLASAEAYPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SM RL+  VGGV+PLH+H   SE+++V  GT+ AGF+ + +N+ YY K L+ GDVM
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYY-KRLEVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQINVG+T ATAFV+ +  NPG Q+TT +LF  +LP  I + +T L   ++ 
Sbjct  140  IFPQAMLHFQINVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHNEVM  199

Query  645  KLKSVLG  665
            +LK   G
Sbjct  200  RLKRAFG  206



>gb|EAZ07239.1| hypothetical protein OsI_29483 [Oryza sativa Indica Group]
Length=219

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSL-PPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCV NL L    P+GY C+ + +VT  DF    LA  G        ++  AF  Q+P V
Sbjct  30   DFCVANLPLGADTPSGYQCRPAATVTAADFYSGALARPGILIRPFNTSLASAFVRQYPAV  89

Query  282  NGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDV  461
            NGLG+S +R+DI  GGVVPLHTHP GSE+L V +G L AGF+SS DNKVYY K + +G +
Sbjct  90   NGLGISASRVDILPGGVVPLHTHPAGSELLYVLDGALVAGFISSSDNKVYY-KEVSKGGM  148

Query  462  MVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
             VFPQGLLHFQ N G T A AF  +SS NPGLQI  +ALF N+LPT  V   TFL EA++
Sbjct  149  FVFPQGLLHFQYNTGDTTAVAFAAYSSSNPGLQILDYALFANNLPTSYVVKGTFLAEAEV  208

Query  642  KKLKSVLGGT  671
            ++LKS  GG+
Sbjct  209  RRLKSKFGGS  218



>ref|NP_001175609.1| Os08g0459700 [Oryza sativa Japonica Group]
 sp|Q6Z964.1|GL813_ORYSJ RecName: Full=Germin-like protein 8-13; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD09600.1| putative adenosine diphosphate glucose pyrophosphatase [Oryza 
sativa Japonica Group]
 dbj|BAD09955.1| putative adenosine diphosphate glucose pyrophosphatase [Oryza 
sativa Japonica Group]
 gb|EAZ42985.1| hypothetical protein OsJ_27574 [Oryza sativa Japonica Group]
 dbj|BAH94337.1| Os08g0459700 [Oryza sativa Japonica Group]
Length=219

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = +3

Query  105  DFCVGNLSL-PPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGV  281
            DFCV NL L    P+GY C+ + +VT  DF    LA  G        ++  AF  Q+P V
Sbjct  30   DFCVANLPLGADTPSGYQCRPAATVTAADFYSGALARPGILIRPFNTSLASAFVQQYPAV  89

Query  282  NGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDV  461
            NGLG+S +R+DI  GGVVPLHTHP GSE+L V +G L AGF+SS DNKVYY K + +G +
Sbjct  90   NGLGISASRVDILPGGVVPLHTHPAGSELLYVLDGALVAGFISSSDNKVYY-KEVSKGGM  148

Query  462  MVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQI  641
             VFPQGLLHFQ N G T A AF  +SS NPGLQI  +ALF N+LPT  V   TFL EA++
Sbjct  149  FVFPQGLLHFQYNTGDTTAVAFAAYSSSNPGLQILDYALFANNLPTSYVVKGTFLAEAEV  208

Query  642  KKLKSVLGGT  671
            ++LKS  GG+
Sbjct  209  RRLKSKFGGS  218



>ref|XP_010666297.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP GY CK   +VT +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLSLPRGPQGYACKNPATVTTDDFVYTGFRGEKATTNIFRNNVTLASANAYPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SM RL+  VGGV+PLH+H   SE+++V  GT+ AGF+ + +N+ YY K L+ GDVM
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYY-KRLEVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVG+T ATAFV+ +  NPG Q+TT +LF  +LP  I + +T L   ++ 
Sbjct  140  IFPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHDEVM  199

Query  645  KLKSVLG  665
            +LK   G
Sbjct  200  RLKRAFG  206



>ref|XP_010666316.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   199 bits (506),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+LSLP GP  Y CK  T++T +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLSLPRGPQAYTCKNPTTITTDDFVYTGFRGEKATTNIFRNNVTLASANAYPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SM RL+  VGGV+PLH+H   SE+++V  GT+ AGF+ + +N+ YY K L+ GDVM
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYY-KRLEVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVG+T ATAFV+ +  NPG Q+TT +LF  +LP  I + +T L   ++ 
Sbjct  140  IFPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHNEVM  199

Query  645  KLKSVLG  665
            +LK   G
Sbjct  200  RLKRAFG  206



>gb|AFK33656.1| unknown [Lotus japonicus]
Length=209

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 136/207 (66%), Gaps = 4/207 (2%)
 Frame = +3

Query  48   MFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTT  227
            +++  LF     ++ +   D CV +   P  P+GY C    ++T +DFV+ GL A GNTT
Sbjct  4    IYILFLFTFLSTTSYASVNDLCVADFKGPSTPSGYHCMPLANLTSDDFVFHGLVA-GNTT  62

Query  228  NIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFV  407
            N   AA+T AF   FP +NGLG+S ARLDI  GG +P+HTHPG +E+L++ +G ++AGF+
Sbjct  63   NSFNAALTSAFVTDFPALNGLGVSAARLDIAKGGSIPMHTHPGATELLMMVKGKITAGFM  122

Query  408  SSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKN  587
            +       YSKT+K GD+MVFPQG+LHFQ+N G   A AF+ FSS+NPG Q+    LF N
Sbjct  123  TP---TALYSKTVKPGDIMVFPQGMLHFQVNSGVGTANAFLAFSSENPGAQLLDLLLFAN  179

Query  588  DLPTDIVKTVTFLDEAQIKKLKSVLGG  668
             L +DIV   TFLD AQ+KKLK+   G
Sbjct  180  GLDSDIVAKTTFLDLAQVKKLKARFNG  206



>ref|XP_010666311.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFCVG+L+LP GP GY CK   ++T +DFVY+G      TTNI +  VT A    +P +N
Sbjct  23   DFCVGDLTLPRGPEGYACKNPATITTDDFVYTGFRGEKATTNIFRNNVTLASANAYPALN  82

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+SM RL+  VGGV+PLH+H   SE+++V  GT+ AGF+ + +N+ YY K L+ GDVM
Sbjct  83   GLGISMGRLEFGVGGVIPLHSHR-TSEVIIVIRGTIIAGFIDT-NNRAYY-KRLEVGDVM  139

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            +FPQ +LHFQ+NVG+T ATAFV+ +  NPG Q+TT +LF  +LP  I + +T L   ++ 
Sbjct  140  IFPQAMLHFQVNVGRTSATAFVSLNGANPGFQLTTPSLFAGNLPAQIAEQITLLSHDEVM  199

Query  645  KLKSVLG  665
            +LK   G
Sbjct  200  RLKRAFG  206



>ref|NP_001266709.1| auxin-binding protein ABP20 precursor [Zea mays]
 gb|ACG44908.1| auxin-binding protein ABP20 precursor [Zea mays]
Length=221

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS    P GYPCK    VT +DF Y GLA  G      K ++  A    FPG+N
Sbjct  33   DFCIADLSAAATPGGYPCKPPKDVTADDFHYGGLATPGTALKPFKISLGSAVVTTFPGLN  92

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+ +  GGV PLH+HPGG+E++ V EG++  GF+S+  N+V Y+KTL  GD+M
Sbjct  93   GLGISAARMVMVPGGVAPLHSHPGGTELIFVIEGSVVCGFISATLNRV-YTKTLYAGDLM  151

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQG LHFQ + G T A    +FSS NPGLQI  FALF NDLPT++V  VT LDE QI 
Sbjct  152  VLPQGQLHFQYSHGNTTAVTLSSFSSDNPGLQILDFALFANDLPTEVVNKVTNLDELQIV  211

Query  645  KLKSVLGG  668
            KLK++ GG
Sbjct  212  KLKALFGG  219



>ref|NP_001130872.1| uncharacterized protein LOC100191976 precursor [Zea mays]
 gb|ACF79244.1| unknown [Zea mays]
Length=220

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS    P GYPCK    VT +DF Y GLA  G      K ++  A    FPG+N
Sbjct  32   DFCIADLSAAATPGGYPCKPPKDVTADDFHYGGLATPGTALKPFKISLGSAVVTTFPGLN  91

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+ +  GGV PLH+HPGG+E++ V EG++  GF+S+  N+V Y+KTL  GD+M
Sbjct  92   GLGISAARMVMVPGGVAPLHSHPGGTELIFVIEGSVVCGFISATLNRV-YTKTLYAGDLM  150

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQG LHFQ + G T A    +FSS NPGLQI  FALF NDLPT++V  VT LDE QI 
Sbjct  151  VLPQGHLHFQYSHGNTTAVTLSSFSSDNPGLQILDFALFANDLPTEVVNKVTNLDELQIV  210

Query  645  KLKSVLGG  668
            KLK++ GG
Sbjct  211  KLKALFGG  218



>gb|AFW78895.1| auxin-binding protein ABP20 [Zea mays]
Length=220

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = +3

Query  105  DFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVN  284
            DFC+ +LS    P GYPCK    VT +DF Y GLA  G      K ++  A    FPG+N
Sbjct  32   DFCIADLSAAATPGGYPCKPPKDVTADDFHYGGLATPGTALKPFKISLGSAVVTTFPGLN  91

Query  285  GLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVM  464
            GLG+S AR+ +  GGV PLH+HPGG+E++ V EG++  GF+S+  N+V Y+KTL  GD+M
Sbjct  92   GLGISAARMVMVPGGVAPLHSHPGGTELIFVIEGSVVCGFISATLNRV-YTKTLYAGDLM  150

Query  465  VFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIK  644
            V PQG LHFQ + G T A    +FSS NPGLQI  FALF NDLPT++V  VT LDE QI 
Sbjct  151  VLPQGQLHFQYSHGNTTAVTLSSFSSDNPGLQILDFALFANDLPTEVVNKVTNLDELQIV  210

Query  645  KLKSVLGG  668
            KLK++ GG
Sbjct  211  KLKALFGG  218



>ref|XP_010495333.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=182

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 122/174 (70%), Gaps = 5/174 (3%)
 Frame = +3

Query  30   KKITLIMFLQTLFIlsllsasshalDFCVGNLSLPPGPAGYPCKKSTSVTENDFVYSGLA  209
            K I  + F+ +LF      A +   DFCV +   P  P+GY CK    V ENDFV+SGL 
Sbjct  2    KMIIHVFFIISLF---SSIAFASVQDFCVADPKGPQSPSGYSCKNPDQVNENDFVFSGLG  58

Query  210  AAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGT  389
             AGNT+NIIKAAVTPAF   F G+NGLG+SMARLD+  GGV+PLHTHPG SE+LVV +GT
Sbjct  59   KAGNTSNIIKAAVTPAFAPAFAGINGLGISMARLDLAGGGVIPLHTHPGASEVLVVIQGT  118

Query  390  LSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATAFVTFSSQNP  551
            + AGF+SS  NKVY  KTL  GD MVFPQGLLHFQ+N GK  A AFV F S +P
Sbjct  119  ICAGFISS-ANKVYL-KTLNRGDTMVFPQGLLHFQLNSGKGPALAFVAFGSPSP  170



>sp|P45853.1|GLP1_IPONI RecName: Full=Germin-like protein; Flags: Precursor [Ipomoea 
nil]
 dbj|BAA08266.1| germin-like protein precursor [Ipomoea nil]
Length=214

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 128/195 (66%), Gaps = 11/195 (6%)
 Frame = +3

Query  105  DFCVGNLSLPPG----PAGYPCKKSTSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQF  272
            DFCV N    PG    P+G+ CK +  VT  DFVYSGLA  GNTTNII AAVTPAF  QF
Sbjct  26   DFCVAN---GPGARDTPSGFVCKNTAKVTAADFVYSGLAKPGNTTNIINAAVTPAFVGQF  82

Query  273  PGVNGLGLSMARLDIDVGGVVPLHTHPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKE  452
            PGV GLG+++ARLD+  GGV+P+HTHPG SEIL V EGT+ A F+SS  NKV Y K L  
Sbjct  83   PGVIGLGVTLARLDLAPGGVIPMHTHPGASEILNVVEGTILAAFISS-GNKV-YEKALYP  140

Query  453  GDVMVFPQGLLHFQINVGKTKATAFVTFSSQNPGLQITTFA-LFKNDLPTDIVKTVTFLD  629
            GDVMVFPQGLL FQ   GK  A        +NPGLQI  F   F    P   +   T LD
Sbjct  141  GDVMVFPQGLLDFQEITGKI-APGLCELRQRNPGLQILEFQHCFPTIFPPKTIAGTTCLD  199

Query  630  EAQIKKLKSVLGGTN  674
            EA IKKLKS LGGTN
Sbjct  200  EATIKKLKSGLGGTN  214



>ref|XP_010665051.1| PREDICTED: uncharacterized protein LOC100266509 [Vitis vinifera]
Length=456

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = +3

Query  165  STSVTENDFVYSGLAAAGNTTNIIKAAVTPAFDAQFPGVNGLGLSMARLDIDVGGVVPLH  344
            +T+VT +DFVYSGL+  GNT+ I  AA+  AF  +FPG+NGLG+SMAR DI  GGV+P+H
Sbjct  10   ATTVTVDDFVYSGLSVPGNTSTIFNAAINTAFVDKFPGLNGLGVSMARADIAPGGVIPMH  69

Query  345  THPGGSEILVVAEGTLSAGFVSSFDNKVYYSKTLKEGDVMVFPQGLLHFQINVGKTKATA  524
            THPG SE++++A+G+++AG +SS DN VY  KTLKEGD+MVFPQGLLHFQ+N G T+A  
Sbjct  70   THPGASEMILIAKGSITAGLISS-DNTVYL-KTLKEGDIMVFPQGLLHFQVNTGWTQALL  127

Query  525  FVTFSSQNPGLQITTFALFKNDLPTDIVKTVTFLDEAQIKKLKSVLGGT  671
            +V+F S + GLQI + ALF N+LP+++++  TFL + ++K+LK++LGG+
Sbjct  128  WVSFGSSSLGLQILSNALFSNNLPSELIEKTTFLYDDEVKRLKALLGGS  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104441609276