BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24755_g1_i2 len=1446 path=[4506:0-186 4693:187-198 2097:199-225
5026:226-499 5300:500-500 2399:501-530 7534:531-542 6051:543-552
2451:553-617 3931:618-799 4113:800-834 4148:835-885 4199:886-993
2892:994-1025 6770:1026-1445]

Length=1446
                                                                      Score     E

dbj|BAC02435.1|  alpha-amylase                                          761   0.0      Ipomoea nil [qian niu]
gb|AAA16513.1|  alpha amylase precursor                                 699   0.0      Cuscuta reflexa [giant dodder]
ref|XP_009758535.1|  PREDICTED: alpha-amylase                           663   0.0      
ref|XP_009586775.1|  PREDICTED: alpha-amylase                           662   0.0      
ref|XP_004235226.1|  PREDICTED: alpha-amylase                           645   0.0      
ref|XP_006354888.1|  PREDICTED: alpha-amylase-like                      643   0.0      
emb|CDP01359.1|  unnamed protein product                                643   0.0      
ref|XP_004238157.1|  PREDICTED: alpha-amylase isoform X1                636   0.0      
ref|XP_011083843.1|  PREDICTED: alpha-amylase                           624   0.0      
gb|AFO84070.1|  alpha-amylase                                           622   0.0      
ref|XP_006387871.1|  hypothetical protein POPTR_0515s00220g             616   0.0      
ref|XP_002301186.2|  hypothetical protein POPTR_0002s12790g             612   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011017206.1|  PREDICTED: alpha-amylase isoform X2                610   0.0      
prf||1803517A  alpha amylase                                            610   0.0   
sp|P17859.1|AMYA_VIGMU  RecName: Full=Alpha-amylase; AltName: Ful...    608   0.0      Vigna mungo [urad dal]
ref|XP_003589186.1|  Alpha-amylase                                      608   0.0      
gb|AFK42146.1|  unknown                                                 608   0.0      
dbj|BAC76729.1|  alpha-amylase                                          608   0.0      Vigna angularis [azuki bean]
gb|EYU25422.1|  hypothetical protein MIMGU_mgv1a006910mg                607   0.0      
ref|XP_006387870.1|  alpha amylase family protein                       603   0.0      
ref|XP_006434774.1|  hypothetical protein CICLE_v10001266mg             602   0.0      
ref|XP_011017205.1|  PREDICTED: alpha-amylase isoform X1                601   0.0      
ref|XP_007134076.1|  hypothetical protein PHAVU_010G017600g             600   0.0      
ref|XP_007199844.1|  hypothetical protein PRUPE_ppa006152mg             596   0.0      
ref|XP_004294806.1|  PREDICTED: alpha-amylase-like                      596   0.0      
ref|XP_010061754.1|  PREDICTED: alpha-amylase-like isoform X1           593   0.0      
ref|XP_010061756.1|  PREDICTED: alpha-amylase-like isoform X3           593   0.0      
ref|XP_004499059.1|  PREDICTED: alpha-amylase-like                      593   0.0      
ref|XP_010061752.1|  PREDICTED: alpha-amylase-like                      592   0.0      
ref|XP_010690292.1|  PREDICTED: alpha-amylase-like                      589   0.0      
ref|XP_010690299.1|  PREDICTED: alpha-amylase-like                      587   0.0      
ref|XP_002285213.1|  PREDICTED: alpha-amylase                           585   0.0      Vitis vinifera
ref|XP_009410104.1|  PREDICTED: alpha-amylase isozyme 3D-like           584   0.0      
gb|AHL44839.1|  alpha-amylase-like protein                              583   0.0      
ref|XP_008373148.1|  PREDICTED: alpha-amylase-like                      581   0.0      
ref|XP_002282184.1|  PREDICTED: alpha-amylase                           580   0.0      Vitis vinifera
gb|KHG27234.1|  Uncharacterized protein F383_11580                      580   0.0      
ref|XP_010061755.1|  PREDICTED: alpha-amylase-like isoform X2           580   0.0      
ref|XP_010690291.1|  PREDICTED: alpha-amylase-like                      580   0.0      
ref|XP_010108609.1|  hypothetical protein L484_006340                   579   0.0      
ref|XP_009349497.1|  PREDICTED: alpha-amylase-like                      579   0.0      
ref|XP_002510218.1|  alpha-amylase, putative                            578   0.0      Ricinus communis
ref|XP_006374943.1|  alpha amylase family protein                       578   0.0      
ref|XP_007017240.1|  Alpha-amylase-like isoform 1                       577   0.0      
ref|XP_008236504.1|  PREDICTED: alpha-amylase-like                      577   0.0      
ref|XP_004499063.1|  PREDICTED: alpha-amylase-like isoform X1           576   0.0      
ref|XP_003550340.1|  PREDICTED: alpha-amylase-like                      574   0.0      
ref|XP_009350378.1|  PREDICTED: alpha-amylase-like                      574   0.0      
ref|XP_010690290.1|  PREDICTED: alpha-amylase-like                      573   0.0      
gb|KDP38338.1|  hypothetical protein JCGZ_04263                         571   0.0      
ref|XP_004960025.1|  PREDICTED: alpha-amylase type A isozyme-like       570   0.0      
emb|CAN77038.1|  hypothetical protein VITISV_004485                     570   0.0      Vitis vinifera
ref|XP_008236505.1|  PREDICTED: alpha-amylase-like                      569   0.0      
ref|XP_006660698.1|  PREDICTED: alpha-amylase isozyme 3B-like iso...    569   0.0      
ref|XP_004973671.1|  PREDICTED: alpha-amylase isozyme 3D-like           568   0.0      
ref|XP_009399983.1|  PREDICTED: alpha-amylase isozyme 3C-like           568   0.0      
gb|AEO09337.4|  alpha-amylase                                           567   0.0      
ref|XP_004965680.1|  PREDICTED: alpha-amylase type A isozyme-like       568   0.0      
ref|XP_004973672.1|  PREDICTED: alpha-amylase isozyme 3D-like           567   0.0      
gb|ADC54359.1|  alpha amylase                                           567   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_002460331.1|  hypothetical protein SORBIDRAFT_02g026610          568   0.0      Sorghum bicolor [broomcorn]
ref|XP_008373147.1|  PREDICTED: alpha-amylase-like                      567   0.0      
gb|AAO11776.1|  alpha-amylase precursor                                 566   0.0      Musa acuminata [banana]
gb|ADC54351.1|  alpha amylase                                           566   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001105539.1|  alpha-amylase precursor                            567   0.0      Zea mays [maize]
gb|ADC54357.1|  alpha amylase                                           566   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54362.1|  alpha amylase                                           566   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|AAN01149.1|  alpha-amylase precursor                                 566   0.0      Musa acuminata [banana]
gb|ADC54353.1|  alpha amylase                                           565   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_010274277.1|  PREDICTED: pentatricopeptide repeat-containi...    592   0.0      
gb|ADH43281.1|  alpha amylase                                           566   0.0      
gb|ACF88424.1|  unknown                                                 566   0.0      Zea mays [maize]
gb|ADC54365.1|  alpha amylase                                           565   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|3BSG|A  Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a ...    564   0.0      
gb|ADC54358.1|  alpha amylase                                           564   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54282.1|  alpha amylase                                           564   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001175871.1|  Os09g0457500                                       565   0.0      
gb|ADC54339.1|  alpha amylase                                           564   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_004957016.1|  PREDICTED: alpha-amylase isozyme 3C-like           565   0.0      
ref|XP_004957017.1|  PREDICTED: alpha-amylase isozyme 3C-like           564   0.0      
gb|ADC54352.1|  alpha amylase                                           563   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|EAZ09376.1|  hypothetical protein OsI_31649                          564   0.0      Oryza sativa Indica Group [Indian rice]
gb|ADC54330.1|  alpha amylase                                           563   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54367.1|  alpha amylase                                           563   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54286.1|  alpha amylase                                           563   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54283.1|  alpha amylase                                           562   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|1HT6|A  Chain A, Crystal Structure At 1.5a Resolution Of The ...    562   0.0      
gb|ADC54277.1|  alpha amylase                                           562   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAX51372.1|  alpha-amylase                                          563   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_004957015.1|  PREDICTED: alpha-amylase isozyme 3C-like           563   0.0      
gb|AAA98615.1|  alpha-amylase                                           563   0.0      Hordeum vulgare [barley]
gb|ADC54344.1|  alpha amylase                                           562   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54281.1|  alpha amylase                                           562   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001063369.1|  Os09g0457800                                       563   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAA72144.1|  alpha-amylase                                          563   0.0      Hordeum vulgare [barley]
gb|ADC54307.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|2QPS|A  Chain A, "sugar Tongs" Mutant Y380a In Complex With A...    561   0.0      
gb|ADC54316.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54356.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54349.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|AAA33894.1|  alpha-amylase                                           563   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADC54296.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAX51374.1|  alpha-amylase                                          562   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|ADC54332.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54320.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54308.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|1AVA|A  Chain A, Amy2BASI PROTEIN-Protein Complex From Barley...    561   0.0      
sp|P04063.3|AMY2_HORVU  RecName: Full=Alpha-amylase type B isozym...    561   0.0      Hordeum vulgare [barley]
gb|ADC54366.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54338.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
sp|P00693.1|AMY1_HORVU  RecName: Full=Alpha-amylase type A isozym...    562   0.0      Hordeum vulgare [barley]
gb|ADC54301.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54306.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54313.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54340.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54337.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54323.1|  alpha amylase                                           561   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54327.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54285.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|2QPU|A  Chain A, Sugar Tongs Mutant S378p In Complex With Aca...    560   0.0      
gb|ADC54324.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|1RP8|A  Chain A, Crystal Structure Of Barley Alpha-Amylase Is...    560   0.0      
gb|ADC54276.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54363.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54321.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54361.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54326.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54319.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54314.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54284.1|  alpha amylase                                           560   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
pdb|3BSH|A  Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double...    559   0.0      
gb|ADC54334.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54364.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54322.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54350.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAA72143.1|  alpha-amylase                                          560   0.0      Hordeum vulgare [barley]
gb|AAA32927.1|  alpha-amylase 2                                         560   0.0      Hordeum vulgare [barley]
gb|ADC54318.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54371.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54347.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54348.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54346.1|  alpha amylase                                           559   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_004966428.1|  PREDICTED: alpha-amylase type A isozyme-like       560   0.0      
ref|NP_001058568.1|  Os06g0713800                                       560   0.0      Oryza sativa Japonica Group [Japonica rice]
sp|A2YGY2.1|AMY2A_ORYSI  RecName: Full=Alpha-amylase isozyme 2A; ...    560   0.0      Oryza sativa Indica Group [Indian rice]
gb|ADC54328.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54278.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54329.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_006659494.1|  PREDICTED: alpha-amylase isozyme 3D-like           559   0.0      
gb|ADC54373.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
sp|P27933.2|AMY3D_ORYSJ  RecName: Full=Alpha-amylase isozyme 3D; ...    559   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADC54369.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_003563559.1|  PREDICTED: alpha-amylase type A isozyme            559   0.0      
gb|ADP88919.1|  alpha-amylase                                           558   0.0      
gb|ADC54370.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54372.1|  alpha amylase                                           558   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAA33298.1|  alpha-amylase                                          558   0.0      Hordeum vulgare [barley]
ref|XP_008651084.1|  PREDICTED: uncharacterized protein LOC100273...    558   0.0      
gb|ADC54333.1|  alpha amylase                                           557   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAA09323.1|  alpha amylase                                          558   0.0      Avena fatua
ref|XP_008811408.1|  PREDICTED: alpha-amylase isozyme 3D-like           557   0.0      
ref|NP_001062024.1|  Os08g0473900                                       559   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAX51373.1|  alpha-amylase                                          557   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|ADC54336.1|  alpha amylase                                           555   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|AAA33895.1|  alpha-amylase                                           555   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT32633.1|  Alpha-amylase type B isozyme                            555   0.0      
gb|ACZ72923.1|  alpha-amylase isoform                                   555   0.0      Dactylis glomerata [cocksfoot]
gb|ADC54368.1|  alpha amylase                                           554   0.0      Hordeum vulgare subsp. spontaneum [wild barley]
gb|AHY18982.1|  high PI alpha-amylase 1                                 555   0.0      
ref|XP_007017239.1|  Alpha-amylase-like                                 555   0.0      
emb|CAA39778.1|  alpha-amylase                                          555   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMS50638.1|  Alpha-amylase type B isozyme                            554   0.0      
pir||JC7137  alpha-amylase (EC 3.2.1.1) isozyme I - rice                554   0.0   
emb|CAA09324.1|  alpha-amylase                                          554   0.0      Avena fatua
ref|NP_001062023.1|  Os08g0473600                                       553   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009381896.1|  PREDICTED: alpha-amylase isozyme 3D-like           553   0.0      
pir||JC7138  alpha-amylase (EC 3.2.1.1) isozyme III - rice              553   0.0   
gb|EMT10056.1|  Alpha-amylase type A isozyme                            553   0.0      
gb|ADO63831.1|  alpha amylase                                           553   0.0      
ref|XP_010943052.1|  PREDICTED: alpha-amylase isozyme 3D-like           552   0.0      
ref|XP_011042248.1|  PREDICTED: pentatricopeptide repeat-containi...    579   0.0      
gb|KHG00963.1|  Uncharacterized protein F383_22263                      551   0.0      
ref|XP_003578230.1|  PREDICTED: alpha-amylase isozyme 3A-like           551   0.0      
ref|XP_006659493.1|  PREDICTED: alpha-amylase isozyme 3E-like           551   0.0      
ref|XP_010236079.1|  PREDICTED: alpha-amylase type B isozyme-like       550   0.0      
gb|KHG23972.1|  Uncharacterized protein F383_31428                      550   0.0      
gb|KHG14183.1|  Uncharacterized protein F383_17328                      549   0.0      
ref|XP_006660697.1|  PREDICTED: alpha-amylase isozyme 3A-like           549   0.0      
emb|CAA28803.1|  alpha-amylase type A                                   548   0.0      Hordeum vulgare [barley]
ref|NP_001063367.1|  Os09g0457400                                       549   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010061758.1|  PREDICTED: alpha-amylase-like                      548   0.0      
emb|CAA45903.1|  alpha-amylase                                          549   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEC84703.1|  hypothetical protein OsI_31647                          548   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAA33886.1|  alpha-amylase (EC 3.2.1.1)                              547   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002867631.1|  hypothetical protein ARALYDRAFT_492338             546   0.0      
ref|NP_001169611.1|  uncharacterized protein LOC100383492 precursor     546   0.0      Zea mays [maize]
gb|AAA32925.1|  alpha-amylase 1                                         545   0.0      Hordeum vulgare [barley]
emb|CAA39776.1|  alpha-amylase                                          545   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647962.1|  PREDICTED: alpha-amylase-like                      545   0.0      
sp|P04750.2|AMY6_HORVU  RecName: Full=Alpha-amylase type B isozym...    545   0.0      Hordeum vulgare [barley]
ref|XP_002510219.1|  pentatricopeptide repeat-containing protein,...    567   0.0      Ricinus communis
ref|NP_567714.1|  alpha-amylase 1                                       544   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAM64582.1|  alpha-amylase-like protein                              543   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010320333.1|  PREDICTED: alpha-amylase isoform X2                540   0.0      
gb|AAM09952.1|  alpha-amylase                                           542   0.0      Eleusine coracana subsp. coracana [caracan millet]
ref|XP_002452881.1|  hypothetical protein SORBIDRAFT_04g034150          542   0.0      Sorghum bicolor [broomcorn]
ref|XP_002454601.1|  hypothetical protein SORBIDRAFT_04g034140          542   0.0      Sorghum bicolor [broomcorn]
ref|NP_001150278.1|  alpha-amylase precursor                            541   0.0      Zea mays [maize]
ref|XP_010108610.1|  hypothetical protein L484_006341                   541   0.0      
ref|XP_004954023.1|  PREDICTED: alpha-amylase-like                      541   0.0      
gb|AFW73583.1|  putative alpha-amylase family protein                   541   0.0      
emb|CAB36742.1|  alpha-amylase-like protein                             539   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413356.1|  hypothetical protein EUTSA_v10025232mg             537   0.0      
gb|AAA32926.1|  alpha-amylase 1                                         536   0.0      Hordeum vulgare [barley]
gb|EMS54110.1|  Alpha-amylase type B isozyme                            535   0.0      
ref|XP_009148429.1|  PREDICTED: alpha-amylase 1                         534   0.0      
ref|XP_004294808.1|  PREDICTED: alpha-amylase-like                      533   0.0      
gb|AAA32928.1|  alpha-amylase 2                                         534   0.0      Hordeum vulgare [barley]
gb|AAX33232.1|  secreted alpha-amylase                                  531   0.0      Malus domestica [apple tree]
pdb|3WN6|A  Chain A, Crystal Structure Of Alpha-amylase Amyi-1 Fr...    531   0.0      
ref|NP_001048220.1|  Os02g0765600                                       532   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAA33885.1|  alpha-amylase (EC 3.2.1.1)                              531   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAA34516.1|  alpha-amylase                                          531   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY87654.1|  hypothetical protein OsI_09066                          531   0.0      Oryza sativa Indica Group [Indian rice]
emb|CDY29753.1|  BnaA01g19130D                                          530   0.0      
dbj|BAE47517.2|  alpha-amylase                                          529   0.0      Hyacinthus orientalis [common hyacinth]
dbj|BAD17123.1|  putative alpha-amylase precursor                       528   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462321.1|  hypothetical protein SORBIDRAFT_02g023790          527   0.0      Sorghum bicolor [broomcorn]
ref|XP_010448491.1|  PREDICTED: alpha-amylase 1-like                    526   0.0      
ref|XP_006282624.1|  hypothetical protein CARUB_v10004897mg             524   2e-180   
ref|XP_004499064.1|  PREDICTED: alpha-amylase-like isoform X2           523   2e-180   
gb|KFK29029.1|  hypothetical protein AALP_AA7G079500                    524   3e-180   
ref|XP_006657340.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-amylas...    525   3e-180   
ref|XP_010438943.1|  PREDICTED: alpha-amylase 1                         523   6e-180   
gb|AAA91883.1|  alpha-amylase                                           520   1e-179   Solanum tuberosum [potatoes]
ref|XP_004973670.1|  PREDICTED: alpha-amylase isozyme 3B-like           522   2e-179   
emb|CDY16261.1|  BnaC01g22960D                                          521   5e-179   
gb|KDP29720.1|  hypothetical protein JCGZ_18655                         520   7e-179   
emb|CAN74301.1|  hypothetical protein VITISV_028383                     526   1e-178   Vitis vinifera
ref|NP_001276156.1|  alpha-amylase-like precursor                       516   3e-177   
ref|XP_006446537.1|  hypothetical protein CICLE_v10018086mg             511   2e-175   
gb|EAZ07323.1|  hypothetical protein OsI_29572                          511   3e-175   Oryza sativa Indica Group [Indian rice]
gb|EPS57430.1|  hypothetical protein M569_17388                         511   8e-175   
gb|ACY38052.1|  alpha-amylase precursor                                 509   1e-174   Dactylis glomerata [cocksfoot]
ref|XP_009348705.1|  PREDICTED: alpha-amylase-like                      509   1e-174   
ref|XP_002444507.1|  hypothetical protein SORBIDRAFT_07g023010          509   4e-174   Sorghum bicolor [broomcorn]
gb|EMT15942.1|  Alpha-amylase isozyme 3D                                508   6e-174   
ref|XP_008347138.1|  PREDICTED: alpha-amylase-like                      507   1e-173   
ref|XP_004499060.1|  PREDICTED: alpha-amylase-like                      506   3e-173   
gb|KDO84181.1|  hypothetical protein CISIN_1g014447mg                   503   3e-173   
ref|XP_010943051.1|  PREDICTED: alpha-amylase isozyme 3D-like           504   2e-172   
ref|XP_006826844.1|  hypothetical protein AMTR_s00010p00102390          502   8e-172   
ref|XP_007222445.1|  hypothetical protein PRUPE_ppa006160mg             501   2e-171   
gb|KDO84180.1|  hypothetical protein CISIN_1g014447mg                   499   2e-171   
sp|P04747.1|AMY3_HORVU  RecName: Full=Alpha-amylase type B isozym...    498   1e-170   Hordeum vulgare [barley]
ref|XP_002984168.1|  hypothetical protein SELMODRAFT_119619             499   1e-170   
ref|XP_002972254.1|  hypothetical protein SELMODRAFT_97625              498   3e-170   
ref|XP_009783973.1|  PREDICTED: alpha-amylase-like                      497   2e-169   
ref|XP_004980703.1|  PREDICTED: alpha-amylase type B isozyme-like       496   2e-168   
gb|EMT14206.1|  Alpha-amylase AMY3                                      490   5e-167   
gb|EPS60632.1|  alpha-amylase                                           486   1e-166   
gb|KDO66103.1|  hypothetical protein CISIN_1g045962mg                   488   5e-166   
sp|P08117.1|AMY3_WHEAT  RecName: Full=Alpha-amylase AMY3; AltName...    486   2e-165   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008220223.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    509   2e-165   
gb|ABK24434.1|  unknown                                                 486   6e-165   Picea sitchensis
ref|XP_007017241.1|  Alpha-amylase-like isoform 2                       473   2e-161   
gb|EMT33741.1|  Alpha-amylase isozyme 3A                                476   3e-161   
ref|XP_001754460.1|  predicted protein                                  474   3e-161   
gb|EMS49001.1|  Alpha-amylase isozyme 3A                                476   8e-159   
gb|KCW68751.1|  hypothetical protein EUGRSUZ_F02347                     465   4e-158   
gb|KCW68749.1|  hypothetical protein EUGRSUZ_F02347                     464   1e-157   
ref|XP_001777583.1|  predicted protein                                  465   2e-157   
dbj|BAD73797.1|  putative alpha-amylase isozyme 3E precursor            463   2e-157   Oryza sativa Japonica Group [Japonica rice]
gb|ABK24287.1|  unknown                                                 465   1e-156   Picea sitchensis
gb|ABR16554.1|  unknown                                                 464   2e-156   Picea sitchensis
gb|EEC83728.1|  hypothetical protein OsI_29570                          460   2e-156   Oryza sativa Indica Group [Indian rice]
gb|AFV30573.1|  alpha-amylase 1                                         454   2e-154   
gb|AFV30588.1|  alpha-amylase 1                                         454   3e-154   
gb|AFV30575.1|  alpha-amylase 1                                         453   5e-154   
gb|AFV30577.1|  alpha-amylase 1                                         453   6e-154   
ref|XP_002460139.1|  hypothetical protein SORBIDRAFT_02g023250          470   1e-153   
gb|AFV30516.1|  alpha-amylase 1                                         452   2e-153   
gb|AFV30448.1|  alpha-amylase 1                                         452   2e-153   
gb|AFV30576.1|  alpha-amylase 1                                         451   3e-153   
gb|AFV30579.1|  alpha-amylase 1                                         451   4e-153   
gb|AFV30444.1|  alpha-amylase 1                                         451   5e-153   
gb|AFV30478.1|  alpha-amylase 1                                         451   5e-153   
gb|AFV30439.1|  alpha-amylase 1                                         451   6e-153   
gb|AFV30450.1|  alpha-amylase 1                                         451   6e-153   
gb|AFV30447.1|  alpha-amylase 1                                         450   1e-152   
gb|AFV30562.1|  alpha-amylase 1                                         450   1e-152   
gb|AFV30453.1|  alpha-amylase 1                                         450   1e-152   
gb|AFV30582.1|  alpha-amylase 1                                         450   1e-152   
gb|AFV30484.1|  alpha-amylase 1                                         449   2e-152   
gb|AFV30571.1|  alpha-amylase 1                                         449   2e-152   
gb|AFV30492.1|  alpha-amylase 1                                         449   2e-152   
gb|AFV30570.1|  alpha-amylase 1                                         449   2e-152   
gb|AFV30527.1|  alpha-amylase 1                                         449   2e-152   
gb|AFV30554.1|  alpha-amylase 1                                         449   3e-152   
gb|AFV30465.1|  alpha-amylase 1                                         449   3e-152   
gb|AFV30512.1|  alpha-amylase 1                                         449   3e-152   
gb|AFV30514.1|  alpha-amylase 1                                         449   3e-152   
gb|AFV30458.1|  alpha-amylase 1                                         449   3e-152   
gb|AFV30442.1|  alpha-amylase 1                                         449   3e-152   
gb|AFV30560.1|  alpha-amylase 1                                         449   4e-152   
gb|AFV30548.1|  alpha-amylase 1                                         449   4e-152   
gb|AFV30506.1|  alpha-amylase 1                                         449   4e-152   
gb|AFV30431.1|  alpha-amylase 1                                         449   4e-152   
gb|AFV30572.1|  alpha-amylase 1                                         448   4e-152   
gb|AFV30585.1|  alpha-amylase 1                                         449   5e-152   
gb|AFV30430.1|  alpha-amylase 1                                         449   5e-152   
gb|AFV30434.1|  alpha-amylase 1                                         449   6e-152   
gb|AFV30540.1|  alpha-amylase 1                                         448   6e-152   
gb|AFV30587.1|  alpha-amylase 1                                         448   7e-152   
gb|AFV30480.1|  alpha-amylase 1                                         448   7e-152   
gb|AFV30466.1|  alpha-amylase 1                                         448   9e-152   
ref|XP_007017242.1|  Alpha-amylase-like                                 451   9e-152   
gb|AFV30452.1|  alpha-amylase 1                                         447   9e-152   
gb|AFV30520.1|  alpha-amylase 1                                         447   9e-152   
gb|AFV30542.1|  alpha-amylase 1                                         447   1e-151   
gb|AFV30538.1|  alpha-amylase 1                                         447   1e-151   
gb|AFV30476.1|  alpha-amylase 1                                         447   1e-151   
gb|AFV30488.1|  alpha-amylase 1                                         447   2e-151   
gb|AFV30438.1|  alpha-amylase 1                                         447   2e-151   
gb|AFV30500.1|  alpha-amylase 1                                         447   2e-151   
gb|AFV30449.1|  alpha-amylase 1                                         446   3e-151   
gb|AFV30566.1|  alpha-amylase 1                                         446   3e-151   
gb|AFV30529.1|  alpha-amylase 1                                         446   3e-151   
gb|AFV30436.1|  alpha-amylase 1                                         447   3e-151   
gb|AFV30586.1|  alpha-amylase 1                                         446   4e-151   
gb|AFV30546.1|  alpha-amylase 1                                         445   1e-150   
gb|AFV30435.1|  alpha-amylase 1                                         442   3e-149   
ref|XP_003589191.1|  Alpha amylase                                      441   7e-148   
ref|XP_002962512.1|  hypothetical protein SELMODRAFT_79072              430   3e-142   
ref|XP_002962777.1|  hypothetical protein SELMODRAFT_404058             428   1e-141   
gb|EMT32632.1|  hypothetical protein F775_52311                         430   1e-140   
gb|AHO49118.1|  alpha amylase                                           413   1e-138   
ref|XP_002980855.1|  hypothetical protein SELMODRAFT_33940              417   2e-138   
ref|XP_008393808.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    439   2e-138   
ref|XP_008351999.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    439   2e-138   
ref|XP_002989346.1|  hypothetical protein SELMODRAFT_129632             420   9e-138   
ref|XP_001772280.1|  predicted protein                                  393   1e-129   
ref|XP_009391375.1|  PREDICTED: alpha-amylase isozyme 3C-like           379   1e-125   
ref|XP_010667402.1|  PREDICTED: alpha-amylase-like                      373   4e-122   
ref|XP_001768202.1|  predicted protein                                  371   5e-121   
ref|XP_005649456.1|  glycoside hydrolase                                375   7e-121   
ref|XP_001782830.1|  predicted protein                                  372   8e-121   
gb|KFM28969.1|  Alpha-amylase type B isozyme                            372   5e-120   
emb|CAX51375.1|  alpha-amylase                                          368   2e-119   
ref|XP_002446386.1|  hypothetical protein SORBIDRAFT_06g015110          368   3e-119   
ref|XP_003579659.1|  PREDICTED: probable alpha-amylase 2                367   3e-119   
ref|XP_004291317.1|  PREDICTED: probable alpha-amylase 2-like           367   9e-119   
ref|XP_007160611.1|  hypothetical protein PHAVU_001G001900g             366   1e-118   
ref|NP_001241207.1|  uncharacterized protein LOC100813490               365   3e-118   
ref|XP_002991426.1|  hypothetical protein SELMODRAFT_133553             364   4e-118   
ref|XP_010918172.1|  PREDICTED: probable alpha-amylase 2                363   2e-117   
ref|XP_002988323.1|  hypothetical protein SELMODRAFT_127605             362   2e-117   
ref|XP_005850743.1|  hypothetical protein CHLNCDRAFT_29945              365   2e-117   
ref|XP_011099800.1|  PREDICTED: probable alpha-amylase 2                362   8e-117   
ref|XP_010551510.1|  PREDICTED: alpha-amylase 3, chloroplastic          376   2e-116   
ref|XP_004975500.1|  PREDICTED: probable alpha-amylase 2-like           360   2e-116   
gb|KCW65004.1|  hypothetical protein EUGRSUZ_G02543                     374   1e-115   
ref|XP_002954444.1|  hypothetical protein VOLCADRAFT_82772              360   1e-115   
ref|XP_001696014.1|  alpha-amylase                                      358   2e-115   
ref|XP_008350481.1|  PREDICTED: probable alpha-amylase 2                357   3e-115   
gb|EYU22438.1|  hypothetical protein MIMGU_mgv1a001104mg                371   5e-115   
gb|EPS66762.1|  alpha-amylase                                           356   8e-115   
ref|XP_001694202.1|  alpha-amylase                                      356   8e-115   
ref|XP_006435281.1|  hypothetical protein CICLE_v100013481mg            355   1e-114   
ref|XP_002276872.2|  PREDICTED: uncharacterized protein LOC100254959    372   2e-114   
ref|XP_010066950.1|  PREDICTED: alpha-amylase 3, chloroplastic          370   2e-114   
gb|KDO84996.1|  hypothetical protein CISIN_1g014892mg                   355   2e-114   
ref|XP_006473736.1|  PREDICTED: probable alpha-amylase 2-like           355   2e-114   
ref|NP_001141482.1|  uncharacterized protein LOC100273593               355   2e-114   
ref|XP_002504668.1|  glycoside hydrolase family 13 protein              354   3e-114   
gb|KDP21224.1|  hypothetical protein JCGZ_21695                         369   3e-114   
ref|XP_006837124.1|  hypothetical protein AMTR_s00110p00125590          371   3e-114   
ref|NP_001044062.2|  Os01g0715400                                       360   4e-114   
ref|XP_006652241.1|  PREDICTED: probable alpha-amylase 2-like           354   5e-114   
ref|XP_002526120.1|  alpha-amylase, putative                            370   5e-114   
gb|AFO84071.1|  alpha-amylase                                           354   6e-114   
gb|KDO82806.1|  hypothetical protein CISIN_1g002585mg                   362   9e-114   
ref|XP_007225700.1|  hypothetical protein PRUPE_ppa006402mg             353   1e-113   
emb|CAE02023.2|  OSJNBb0118P14.5                                        353   2e-113   
ref|XP_008808375.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    368   2e-113   
emb|CDP10408.1|  unnamed protein product                                353   2e-113   
ref|XP_006842120.1|  hypothetical protein AMTR_s00078p00105470          369   2e-113   
ref|XP_008377111.1|  PREDICTED: probable alpha-amylase 2                352   4e-113   
ref|XP_004489509.1|  PREDICTED: rootletin-like isoform X2               365   7e-113   
ref|XP_010939367.1|  PREDICTED: uncharacterized protein LOC105058203    367   8e-113   
ref|XP_003081461.1|  alpha amylase 2 (IC)                               353   8e-113   
tpg|DAA57879.1|  TPA: hypothetical protein ZEAMMB73_547031              362   8e-113   
ref|XP_005644225.1|  alpha-amylase                                      352   8e-113   
ref|XP_008807825.1|  PREDICTED: uncharacterized protein LOC103720069    367   9e-113   
ref|XP_004238402.1|  PREDICTED: probable alpha-amylase 2                351   1e-112   
ref|NP_001052697.1|  Os04g0403300                                       353   1e-112   
emb|CAH58639.1|  alpha-amylase                                          351   1e-112   
ref|XP_004490000.1|  PREDICTED: alpha-amylase 3, chloroplastic-li...    362   2e-112   
ref|XP_006438621.1|  hypothetical protein CICLE_v10030661mg             361   2e-112   
ref|XP_009412382.1|  PREDICTED: alpha-amylase 3, chloroplastic          366   2e-112   
ref|XP_010266078.1|  PREDICTED: probable alpha-amylase 2                350   2e-112   
ref|NP_001274982.1|  alpha-amylase                                      350   2e-112   
ref|XP_007153841.1|  hypothetical protein PHAVU_003G069200g             365   2e-112   
gb|ACV30014.1|  alpha-amylase                                           350   2e-112   
ref|XP_008455663.1|  PREDICTED: uncharacterized protein LOC103495777    366   2e-112   
ref|XP_008791968.1|  PREDICTED: probable alpha-amylase 2                350   3e-112   
ref|XP_004969746.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     363   3e-112   
emb|CDX73233.1|  BnaC06g36810D                                          350   3e-112   
gb|AFO84072.1|  alpha-amylase                                           364   3e-112   
emb|CDP00291.1|  unnamed protein product                                364   3e-112   
ref|XP_004489508.1|  PREDICTED: rootletin-like isoform X1               365   3e-112   
gb|EPS68543.1|  plastid alpha-amylase                                   363   3e-112   
ref|XP_008221185.1|  PREDICTED: probable alpha-amylase 2                350   3e-112   
ref|XP_002456247.1|  hypothetical protein SORBIDRAFT_03g032830          362   4e-112   
ref|XP_006378407.1|  alpha-amylase family protein                       364   4e-112   
ref|XP_011086391.1|  PREDICTED: alpha-amylase 3, chloroplastic          364   5e-112   
ref|XP_009334433.1|  PREDICTED: probable alpha-amylase 2                349   6e-112   
ref|XP_011021596.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    363   6e-112   
gb|KDO82805.1|  hypothetical protein CISIN_1g002585mg                   361   6e-112   
ref|XP_010925057.1|  PREDICTED: alpha-amylase 3, chloroplastic          364   6e-112   
gb|KHG19882.1|  Alpha-amylase isozyme 3E                                363   7e-112   
gb|AES59822.2|  alpha amylase domain protein                            349   7e-112   
ref|XP_011021595.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    363   8e-112   
ref|XP_003569677.1|  PREDICTED: alpha-amylase 3, chloroplastic          362   8e-112   
ref|NP_001281020.1|  alpha-amylase 3, chloroplastic-like                363   9e-112   
ref|XP_004306075.1|  PREDICTED: uncharacterized protein LOC101298534    364   9e-112   
ref|XP_010101291.1|  Alpha-amylase isozyme 3E                           353   1e-111   
ref|XP_004137176.1|  PREDICTED: uncharacterized protein LOC101217339    364   1e-111   
ref|XP_003589187.1|  Alpha-amylase                                      342   1e-111   
gb|AES77651.2|  alpha amylase domain protein                            364   1e-111   
emb|CDP02311.1|  unnamed protein product                                364   1e-111   
gb|KDP27239.1|  hypothetical protein JCGZ_19938                         362   1e-111   
ref|XP_006342097.1|  PREDICTED: probable alpha-amylase 2 isoform X2     348   2e-111   
emb|CDY11651.1|  BnaC06g30880D                                          362   2e-111   
gb|AAA91884.1|  alpha-amylase                                           347   2e-111   
emb|CDY38763.1|  BnaA07g28350D                                          362   2e-111   
ref|XP_006390233.1|  hypothetical protein EUTSA_v10018631mg             348   2e-111   
ref|XP_009796197.1|  PREDICTED: uncharacterized protein LOC104242...    363   2e-111   
ref|XP_007221942.1|  hypothetical protein PRUPE_ppa001575mg             359   2e-111   
ref|XP_009796199.1|  PREDICTED: uncharacterized protein LOC104242...    363   2e-111   
ref|XP_010683252.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    362   2e-111   
ref|XP_008667532.1|  PREDICTED: uncharacterized protein LOC100273...    348   2e-111   
ref|XP_009106267.1|  PREDICTED: probable alpha-amylase 2                347   3e-111   
ref|XP_010683251.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    362   3e-111   
ref|XP_009105650.1|  PREDICTED: alpha-amylase 3, chloroplastic          362   3e-111   
gb|KDD74952.1|  hypothetical protein H632_c966p0                        348   3e-111   
ref|XP_010539817.1|  PREDICTED: probable alpha-amylase 2                347   3e-111   
ref|XP_002324108.2|  hypothetical protein POPTR_0017s12870g             363   4e-111   
gb|AIU94748.1|  alpha-amylase                                           363   4e-111   
ref|XP_008675104.1|  PREDICTED: alpha-amylase 3, chloroplastic          361   4e-111   
ref|XP_009587654.1|  PREDICTED: uncharacterized protein LOC104085...    363   4e-111   
gb|EYU44190.1|  hypothetical protein MIMGU_mgv1a001047mg                361   4e-111   
ref|XP_004489999.1|  PREDICTED: alpha-amylase 3, chloroplastic-li...    362   4e-111   
ref|XP_006646263.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     358   4e-111   
ref|XP_009589242.1|  PREDICTED: probable alpha-amylase 2                347   4e-111   
ref|XP_002301935.2|  hypothetical protein POPTR_0002s01570g             347   5e-111   
ref|XP_009587655.1|  PREDICTED: uncharacterized protein LOC104085...    363   5e-111   
gb|AAX33233.1|  plastid alpha-amylase                                   360   6e-111   
emb|CDX87637.1|  BnaA07g32360D                                          346   7e-111   
ref|XP_010089625.1|  Alpha-amylase isozyme 2A                           361   7e-111   
ref|XP_004499317.1|  PREDICTED: probable alpha-amylase 2-like iso...    346   8e-111   
ref|XP_004499314.1|  PREDICTED: probable alpha-amylase 2-like iso...    346   8e-111   
gb|KDO82801.1|  hypothetical protein CISIN_1g002585mg                   360   8e-111   
ref|XP_008221657.1|  PREDICTED: alpha-amylase 3, chloroplastic          360   8e-111   
ref|XP_006363428.1|  PREDICTED: uncharacterized protein LOC102579717    362   8e-111   
ref|XP_004499315.1|  PREDICTED: probable alpha-amylase 2-like iso...    346   9e-111   
ref|XP_004499316.1|  PREDICTED: probable alpha-amylase 2-like iso...    346   1e-110   
emb|CBI32016.3|  unnamed protein product                                360   1e-110   
ref|XP_007217072.1|  hypothetical protein PRUPE_ppa000951mg             361   1e-110   
ref|XP_006438622.1|  hypothetical protein CICLE_v10030661mg             360   1e-110   
ref|XP_002270049.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    360   1e-110   
ref|XP_008230873.1|  PREDICTED: uncharacterized protein LOC103330100    362   1e-110   
ref|XP_010652415.1|  PREDICTED: alpha-amylase 3, chloroplastic is...    360   1e-110   
ref|XP_011000093.1|  PREDICTED: uncharacterized protein LOC105107752    362   1e-110   
gb|KFK41403.1|  hypothetical protein AALP_AA2G126100                    360   1e-110   
ref|XP_003531852.1|  PREDICTED: uncharacterized protein LOC100817...    361   1e-110   
ref|XP_010416524.1|  PREDICTED: probable alpha-amylase 2                345   1e-110   
ref|XP_010096344.1|  Alpha-amylase isozyme 3A                           360   1e-110   
ref|XP_010415645.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     360   1e-110   
ref|XP_002520134.1|  alpha-amylase, putative                            360   2e-110   
gb|AAG52558.1|AC010675_6  putative alpha-amylase; 60344-64829           358   2e-110   
ref|XP_006483229.1|  PREDICTED: alpha-amylase 3, chloroplastic          359   2e-110   
ref|XP_006300708.1|  hypothetical protein CARUB_v10019759mg             359   2e-110   
ref|XP_009778085.1|  PREDICTED: probable alpha-amylase 2                345   2e-110   
gb|EMS45313.1|  Alpha-amylase                                           369   2e-110   
ref|XP_010512041.1|  PREDICTED: alpha-amylase 3, chloroplastic          359   3e-110   
gb|EEE55295.1|  hypothetical protein OsJ_03246                          358   3e-110   
ref|XP_005646996.1|  glycoside hydrolase                                360   3e-110   
ref|XP_007139489.1|  hypothetical protein PHAVU_008G033800g             360   3e-110   
ref|XP_008357776.1|  PREDICTED: uncharacterized protein LOC103421512    360   3e-110   
gb|EEC71386.1|  hypothetical protein OsI_03507                          358   3e-110   
emb|CAN69120.1|  hypothetical protein VITISV_031847                     344   4e-110   
ref|XP_002510621.1|  alpha-amylase, putative                            344   4e-110   
gb|KHN13489.1|  Alpha-amylase                                           359   4e-110   
ref|XP_002284805.2|  PREDICTED: probable alpha-amylase 2 isoform X1     344   5e-110   
ref|XP_002887626.1|  hypothetical protein ARALYDRAFT_316534             344   5e-110   
ref|XP_003532050.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     358   5e-110   
ref|XP_009411975.1|  PREDICTED: probable alpha-amylase 2                344   6e-110   
ref|XP_004233383.1|  PREDICTED: uncharacterized protein LOC101249...    359   7e-110   
ref|XP_004297334.1|  PREDICTED: alpha-amylase 3, chloroplastic-like     358   7e-110   



>dbj|BAC02435.1| alpha-amylase [Ipomoea nil]
Length=424

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/422 (88%), Positives = 394/422 (93%), Gaps = 1/422 (0%)
 Frame = +2

Query  50    LFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWL  229
             LFQFLS CFCLAC FVPA GST+LFQGFNWESNK QGGWYNSLIN IPDLANAGITHVWL
Sbjct  3     LFQFLS-CFCLACIFVPAIGSTLLFQGFNWESNKQQGGWYNSLINSIPDLANAGITHVWL  61

Query  230   PPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKD  409
             PPPSHSV+PQGYMPGRLYDLDASKYG KQQLQALVAALHD GIK VADIVINHRCADYKD
Sbjct  62    PPPSHSVAPQGYMPGRLYDLDASKYGNKQQLQALVAALHDKGIKAVADIVINHRCADYKD  121

Query  410   SRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKE  589
             SRGIYCIFEGGT DDRLDWGPGLICKDDT++SDGTGNADTG DF GAPDIDHLNPRVQKE
Sbjct  122   SRGIYCIFEGGTPDDRLDWGPGLICKDDTQYSDGTGNADTGMDFGGAPDIDHLNPRVQKE  181

Query  590   LSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDY  769
             LSEWMNWLKSEIGFDGWRFDFVRGYAAS++KIYMENTSPE AVGE W+ MAYGSDGKPDY
Sbjct  182   LSEWMNWLKSEIGFDGWRFDFVRGYAASLTKIYMENTSPEFAVGEFWDSMAYGSDGKPDY  241

Query  770   NQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNA  949
             NQDNHRNELS+WVQN GGA TAFDFTTKGILQ AVL ELWRLKDP+GKPPGL+GISP+NA
Sbjct  242   NQDNHRNELSQWVQNGGGAVTAFDFTTKGILQAAVLDELWRLKDPNGKPPGLIGISPKNA  301

Query  950   VTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVR  1129
             VTF+DNHDTGSTQS WPF KDKVIQGYAYILTHPG+PC+FYDHFFDWGLKDEI+KL S+R
Sbjct  302   VTFIDNHDTGSTQSMWPFSKDKVIQGYAYILTHPGVPCVFYDHFFDWGLKDEISKLTSIR  361

Query  1130  TSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
             + N ISETS+VEIL  DA+AYVAKIDDKVI+KIGSK+DVGNLIP NFN+V SGQDY VWE
Sbjct  362   SRNGISETSNVEILAADADAYVAKIDDKVIMKIGSKYDVGNLIPPNFNLVTSGQDYAVWE  421

Query  1310  KK  1315
             KK
Sbjct  422   KK  423



>gb|AAA16513.1| alpha amylase precursor, partial [Cuscuta reflexa]
Length=423

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/424 (82%), Positives = 372/424 (88%), Gaps = 2/424 (0%)
 Frame = +2

Query  53    FQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLP  232
             FQFLS C C+A  FVPA GSTVLFQGFNWESNK QGGWYNSLINLIPDLANAGITHVWLP
Sbjct  1     FQFLS-CICIAFFFVPAIGSTVLFQGFNWESNKQQGGWYNSLINLIPDLANAGITHVWLP  59

Query  233   PPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDS  412
             P SHSVSPQGYMPGRLYDLDASKYG KQQLQ+LV ALH  GIK VADIVINHRCADYKDS
Sbjct  60    PSSHSVSPQGYMPGRLYDLDASKYGNKQQLQSLVQALHAKGIKAVADIVINHRCADYKDS  119

Query  413   RGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKEL  592
             RGIYC+FEGGTSD RLDWGP  ICKDDT++SDGTGN DTG DFA APDIDHLN RVQKEL
Sbjct  120   RGIYCLFEGGTSDGRLDWGPSHICKDDTQYSDGTGNPDTGMDFAAAPDIDHLNSRVQKEL  179

Query  593   SEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYN  772
             SEWMNWLKSEIGFDGWRFDFVRGYA SI+KIYM NTSP+ AVGE WN +AYGSDGKP+YN
Sbjct  180   SEWMNWLKSEIGFDGWRFDFVRGYAPSITKIYMGNTSPDFAVGEFWNSLAYGSDGKPNYN  239

Query  773   QDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAV  952
             QDNHRNELS+WVQN GG+ TAFDFTTKGILQ AV GELWRLKD +GKPPGL+GISP+NAV
Sbjct  240   QDNHRNELSQWVQNGGGSVTAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGISPKNAV  299

Query  953   TFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRT  1132
             TFVDNHDTGSTQ  WPFP DKV+QGYAYI+THPG+P +FYDHFFDWGLK +I  LIS R 
Sbjct  300   TFVDNHDTGSTQKLWPFPNDKVMQGYAYIITHPGVPSVFYDHFFDWGLKAQIL-LISSRN  358

Query  1133  SNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              N I+ETSSV IL  D + YVAK+DDKVIVKIG++ D+GNLIP  F VV SGQDY VWEK
Sbjct  359   RNGITETSSVNILAADHDLYVAKVDDKVIVKIGTRMDLGNLIPPGFKVVASGQDYAVWEK  418

Query  1313  KA*I  1324
             KA I
Sbjct  419   KAYI  422



>ref|XP_009758535.1| PREDICTED: alpha-amylase [Nicotiana sylvestris]
Length=422

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/418 (77%), Positives = 361/418 (86%), Gaps = 1/418 (0%)
 Frame = +2

Query  68    YCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSH  244
             +  CL  +  P F + T+LFQGFNWES+  QGGWYNSLINL+PDLA AGITHVWLPP S+
Sbjct  5     FPLCLILSLFPIFATPTLLFQGFNWESSNQQGGWYNSLINLVPDLAKAGITHVWLPPSSN  64

Query  245   SVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIY  424
             SVSPQGYMPGRLYDLD SKYG +QQLQAL+ ALHD GIK VADIVINHRCAD KDSRGIY
Sbjct  65    SVSPQGYMPGRLYDLDTSKYGNQQQLQALIKALHDQGIKAVADIVINHRCADKKDSRGIY  124

Query  425   CIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWM  604
             CIFEGGTSDDRLDWGP +ICK D+++SDGTGN DTG DFA APDIDHLNP+VQKELS+WM
Sbjct  125   CIFEGGTSDDRLDWGPHMICKGDSQYSDGTGNDDTGLDFAAAPDIDHLNPQVQKELSDWM  184

Query  605   NWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNH  784
             NWLK+EIGFDGWRFDFVRGYA SI+KIYMENTSP+ AVGE WN +AYG DGKPDYNQDNH
Sbjct  185   NWLKTEIGFDGWRFDFVRGYAPSITKIYMENTSPDFAVGEFWNSIAYGGDGKPDYNQDNH  244

Query  785   RNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVD  964
             RNEL+ WVQN GGA TAFDFTTKGILQ AV GELWRLKD +GKPPGL+GI P+NAVTF+D
Sbjct  245   RNELAGWVQNGGGAVTAFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGILPQNAVTFID  304

Query  965   NHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEI  1144
             NHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLKD I+ L+S+R  N I
Sbjct  305   NHDTGSTQKLWPFPSDKVMQGYAYILTHPGIPSVFYDHFFDWGLKDGISTLVSIRNRNGI  364

Query  1145  SETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             S TS+V+I+  DA+ YVA +D K++VKIG K D+G+LIP N+ V  SGQDYVVWE+K+
Sbjct  365   SATSNVQIMAADADLYVAMVDQKIVVKIGPKTDLGSLIPPNYQVATSGQDYVVWEQKS  422



>ref|XP_009586775.1| PREDICTED: alpha-amylase [Nicotiana tomentosiformis]
Length=422

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/418 (76%), Positives = 360/418 (86%), Gaps = 1/418 (0%)
 Frame = +2

Query  68    YCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSH  244
             +  CL  +  P F + T+LFQGFNWES+  QGGWYNSLINL+PDLA AG+THVWLPP S+
Sbjct  5     FPLCLILSLFPIFATPTLLFQGFNWESSNQQGGWYNSLINLVPDLAKAGVTHVWLPPSSN  64

Query  245   SVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIY  424
             SVSPQGYMPGRLYDLD SKYG +QQLQAL+ ALHD GIKVVADIVINHRCAD KDSRGIY
Sbjct  65    SVSPQGYMPGRLYDLDTSKYGNQQQLQALIKALHDQGIKVVADIVINHRCADKKDSRGIY  124

Query  425   CIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWM  604
             CIFEGGTSDDRLDWGP +ICK DT++SDGTGN DTG DFA APDIDHLNP+VQKELS+WM
Sbjct  125   CIFEGGTSDDRLDWGPHMICKGDTQYSDGTGNDDTGLDFAAAPDIDHLNPQVQKELSDWM  184

Query  605   NWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNH  784
             NWLK+EIGFDGWRFDFVRGYA SI+KIYMENTSP+ AVGE WN +AYG DGKPDYNQDNH
Sbjct  185   NWLKTEIGFDGWRFDFVRGYAPSITKIYMENTSPDFAVGEFWNSIAYGGDGKPDYNQDNH  244

Query  785   RNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVD  964
             RNEL+ WVQN GGA T FDFTTKGILQ AV GELWRLKD +GKPPGL+GI P+NAVTF+D
Sbjct  245   RNELAGWVQNGGGAVTTFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGILPQNAVTFID  304

Query  965   NHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEI  1144
             NHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLKD I+ L+S+R  N I
Sbjct  305   NHDTGSTQKLWPFPSDKVMQGYAYILTHPGIPSVFYDHFFDWGLKDGISTLVSIRNRNGI  364

Query  1145  SETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             S TS+V+I+  +A+ YVA +D K+IVKIG K D+G+LIP N+ V  SGQDY VWE+K+
Sbjct  365   SATSNVQIMAANADLYVAMVDKKIIVKIGPKTDLGSLIPPNYQVATSGQDYAVWEQKS  422



>ref|XP_004235226.1| PREDICTED: alpha-amylase [Solanum lycopersicum]
Length=453

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/429 (75%), Positives = 361/429 (84%), Gaps = 7/429 (2%)
 Frame = +2

Query  38    KMSTLFQFLSYCFCLACAF-VPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAG  211
             KM++LF       CL  +F +P F S TVLFQGFNWES+  Q GWYNSLINL+PDLA+AG
Sbjct  9     KMNSLFPL-----CLIFSFFLPMFASSTVLFQGFNWESSNKQSGWYNSLINLVPDLAHAG  63

Query  212   ITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHR  391
             +THVWLPP SHSVSPQGYMPGRLYDLDASK+G +Q+L+AL+ AL D GIK VADIVINHR
Sbjct  64    VTHVWLPPSSHSVSPQGYMPGRLYDLDASKFGNQQELKALIKALRDYGIKSVADIVINHR  123

Query  392   CADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLN  571
             CAD KDSRGIYCIFEGGT+DDRLDWGP  ICKDD ++SDGTGN DTG DF  APDIDHLN
Sbjct  124   CADKKDSRGIYCIFEGGTTDDRLDWGPSFICKDDIQYSDGTGNLDTGLDFEPAPDIDHLN  183

Query  572   PRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGS  751
              RVQKELS+WMNWLKSEIGFDGWRFDFVRGYA +I+KIYM NTSP+ AVGE WN +AYG 
Sbjct  184   IRVQKELSDWMNWLKSEIGFDGWRFDFVRGYAPNITKIYMGNTSPDFAVGEFWNSLAYGQ  243

Query  752   DGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVG  931
             DGKPDYNQDNHRNEL  WVQN GGA TAFDFTTKGILQ AV GELWRLKD  GKPPG++G
Sbjct  244   DGKPDYNQDNHRNELVGWVQNGGGAVTAFDFTTKGILQAAVEGELWRLKDSHGKPPGMIG  303

Query  932   ISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEIT  1111
             + P+NAVTF+DNHDTGSTQ+ WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLKD I+
Sbjct  304   VLPQNAVTFIDNHDTGSTQNMWPFPSDKVMQGYAYILTHPGIPLVFYDHFFDWGLKDGIS  363

Query  1112  KLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQ  1291
              LIS+R  + I  TS+V+IL  D++ Y+A ID K+IVKIG K D+GNLIP ++ V  SGQ
Sbjct  364   ALISIRKRSGICATSNVQILASDSDLYIAMIDQKIIVKIGPKLDLGNLIPPSYQVATSGQ  423

Query  1292  DYVVWEKKA  1318
             DY VWEKKA
Sbjct  424   DYAVWEKKA  432



>ref|XP_006354888.1| PREDICTED: alpha-amylase-like [Solanum tuberosum]
Length=423

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/427 (74%), Positives = 358/427 (84%), Gaps = 5/427 (1%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             M+++F     C  L+  F+P F S TVLFQGFNWES+  QGGWYNSLINL+PDLA AG+T
Sbjct  1     MNSIFPL---CLILSL-FLPMFASSTVLFQGFNWESSNKQGGWYNSLINLVPDLAKAGVT  56

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             HVWLPP SHSV+PQGYMPGRLYDLDASK+G +QQL+ L+ ALHD+GIK VADIVINHR A
Sbjct  57    HVWLPPSSHSVAPQGYMPGRLYDLDASKFGNQQQLKTLIKALHDHGIKSVADIVINHRTA  116

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             D KDSRGIY IFEGGTSDDRLDWGP  ICK+DT++SDGTGN DTG DF  APDIDHLN R
Sbjct  117   DNKDSRGIYSIFEGGTSDDRLDWGPSFICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTR  176

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQKELS+WMNWLKSEIGFDGWRFDFVRGYA  I+KIYM NTSP+ AVGE WN +AYG DG
Sbjct  177   VQKELSDWMNWLKSEIGFDGWRFDFVRGYAPCITKIYMRNTSPDFAVGEFWNSLAYGQDG  236

Query  758   KPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
             KP+YNQDNHRNEL  WV+NAG A TAFDFTTKGILQ AV GELWRLKDP+GKPPG++G+ 
Sbjct  237   KPEYNQDNHRNELVDWVKNAGWAVTAFDFTTKGILQAAVQGELWRLKDPNGKPPGMIGVL  296

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             PR AVTF+DNHDTGSTQ+ WPFP DKV+QGYAYILTHPGIP +FYDHFFDWG KD I+ L
Sbjct  297   PRKAVTFIDNHDTGSTQNMWPFPSDKVMQGYAYILTHPGIPSVFYDHFFDWGFKDGISAL  356

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
             IS+R  N I  TS+V+I+  D++ Y+A I  K+IVKIG K D+GNLIP N+ V  SGQDY
Sbjct  357   ISIRKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDY  416

Query  1298  VVWEKKA  1318
              VWE+KA
Sbjct  417   AVWEQKA  423



>emb|CDP01359.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/428 (74%), Positives = 354/428 (83%), Gaps = 2/428 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLA--CAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGI  214
             M  L   L+Y F +A  C F      T+LFQGFNWES+  QGGWYN L+N I DLA+AG+
Sbjct  1     MKNLMISLAYFFLIAGVCFFPNVAAQTLLFQGFNWESSNKQGGWYNFLLNEISDLASAGV  60

Query  215   THVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRC  394
             THVWLPPPSHSV+PQGYMPGRLYDLDASKYG KQQL+ L+ A HD GIK VADIVINHRC
Sbjct  61    THVWLPPPSHSVAPQGYMPGRLYDLDASKYGNKQQLKTLIKAFHDKGIKCVADIVINHRC  120

Query  395   ADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNP  574
             AD +DSRGIYCIFEGGT DDRLDWGP  ICKDD ++SDGTGN DTG  F GAPDIDHLN 
Sbjct  121   ADKQDSRGIYCIFEGGTPDDRLDWGPSCICKDDVQYSDGTGNPDTGDGFGGAPDIDHLNS  180

Query  575   RVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSD  754
             RVQ+ELS+WMNWLKS+IGFDGWRFDFVRGYA SI+KIYM+NT P  AVGELW+ ++YG D
Sbjct  181   RVQRELSDWMNWLKSDIGFDGWRFDFVRGYAPSITKIYMQNTKPGFAVGELWDSLSYGQD  240

Query  755   GKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             GKPDYNQD HRN L++WVQN GGA TAFDFTTKGILQVAV GELWRLKD +G PPGL+GI
Sbjct  241   GKPDYNQDGHRNRLAQWVQNGGGAVTAFDFTTKGILQVAVQGELWRLKDSNGNPPGLIGI  300

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P+NAVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPGIP LFYDH FDWGLKD ITK
Sbjct  301   LPQNAVTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGIPSLFYDHLFDWGLKDGITK  360

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L ++R  N I+ TS V+IL  D++ YVAKIDDK+IVKIG K D+GNLIP N+ V  SG D
Sbjct  361   LSTLRIRNGITATSKVQILASDSDLYVAKIDDKIIVKIGPKLDLGNLIPPNYQVSTSGND  420

Query  1295  YVVWEKKA  1318
             Y VWE+KA
Sbjct  421   YAVWERKA  428



>ref|XP_004238157.1| PREDICTED: alpha-amylase isoform X1 [Solanum lycopersicum]
Length=407

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/403 (76%), Positives = 346/403 (86%), Gaps = 0/403 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             STVLFQGFNW+S+  QGGWYNSLINL+PDLA AG+THVWLPP SHSVSPQGYMPGRLYDL
Sbjct  5     STVLFQGFNWDSSNKQGGWYNSLINLVPDLAKAGVTHVWLPPSSHSVSPQGYMPGRLYDL  64

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASK+G +QQL+ L+ ALHD+GIK VADIVINHR AD KDSRGIY IFEGGTSDDRLDWG
Sbjct  65    DASKFGNQQQLKTLIKALHDHGIKSVADIVINHRTADNKDSRGIYSIFEGGTSDDRLDWG  124

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P  ICK+DT++SDGTGN DTG DF  APDIDHLN RVQKELS+WMNWLKSEIGFDGWRFD
Sbjct  125   PSFICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTRVQKELSDWMNWLKSEIGFDGWRFD  184

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             FVRGYA  I+KIYM NTSP+ AVGELWN +AYG DGKP+YNQDNHRNEL  WV+NAG A 
Sbjct  185   FVRGYAPCITKIYMGNTSPDFAVGELWNSLAYGQDGKPEYNQDNHRNELVGWVKNAGRAV  244

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             TAFDFTTKGILQ AV  ELWRLKDP+GKPPG++G+ PR AVTF+DNHDTGSTQ+ WPFP 
Sbjct  245   TAFDFTTKGILQAAVQEELWRLKDPNGKPPGMIGVLPRKAVTFIDNHDTGSTQNMWPFPS  304

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPGIP +FYDHFFDWG KD I+ LIS+R  N I  TS+V+I+  D++ 
Sbjct  305   DKVMQGYAYILTHPGIPSVFYDHFFDWGFKDGISALISIRKRNRICATSNVQIMASDSDL  364

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             Y+A I  K+IVKIG K D+GNLIP N+ V  SGQDY VWE+KA
Sbjct  365   YIAMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDYAVWEQKA  407



>ref|XP_011083843.1| PREDICTED: alpha-amylase [Sesamum indicum]
 ref|XP_011083844.1| PREDICTED: alpha-amylase [Sesamum indicum]
Length=449

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/427 (70%), Positives = 353/427 (83%), Gaps = 1/427 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             M+T    L+ C  LA A  P+  + T+LFQGFNWES+  +GGWYNSL+N++PD+A+A +T
Sbjct  23    MTTFLAPLASCLYLAFALFPSLAAPTLLFQGFNWESSGRKGGWYNSLLNVVPDIASARVT  82

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             HVWLPPPS S +PQGY+PGRLYDLDASKYG   +L+ L+ ALHDNGIK VADIVINHR A
Sbjct  83    HVWLPPPSQSAAPQGYLPGRLYDLDASKYGNGAELKTLIKALHDNGIKAVADIVINHRTA  142

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             +  D+RGIYCIFEGGT DDRLDWGP  ICKDD ++SDGTGN D+G  +  APDIDHLNPR
Sbjct  143   EKMDARGIYCIFEGGTPDDRLDWGPSFICKDDIKYSDGTGNPDSGDGYDAAPDIDHLNPR  202

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQKELS+W+NWLK+EIGFDGWR DFV+GY+ SI+KIYMEN++P+ AVGELWN +AYGSDG
Sbjct  203   VQKELSDWLNWLKNEIGFDGWRLDFVKGYSPSITKIYMENSNPDFAVGELWNSLAYGSDG  262

Query  758   KPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
             K +YNQD HRNEL++W Q+ GG  TAFDFTTKGILQ AV GE WRLKD +G PPGL+GI 
Sbjct  263   KLEYNQDRHRNELAQWTQSGGGKVTAFDFTTKGILQAAVGGEFWRLKDSNGNPPGLIGIL  322

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             P+NAVTF+DNHDTGSTQ+ WPFP DKV QGYAYILTHPGIP +FYDHFFDWG KDEI+KL
Sbjct  323   PKNAVTFIDNHDTGSTQNIWPFPADKVSQGYAYILTHPGIPSVFYDHFFDWGKKDEISKL  382

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
              ++R  N I+ETS VEIL  DA+ YVAKID+++I KIG K D+GNLIP +F V  SG DY
Sbjct  383   SAIRARNGITETSKVEILAADADLYVAKIDNRIITKIGPKMDLGNLIPPDFQVAASGIDY  442

Query  1298  VVWEKKA  1318
              VWEK+A
Sbjct  443   AVWEKQA  449



>gb|AFO84070.1| alpha-amylase [Actinidia chinensis]
Length=427

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/427 (71%), Positives = 351/427 (82%), Gaps = 3/427 (1%)
 Frame = +2

Query  41    MSTLF-QFLSYCFCLACAFVPAF--GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAG  211
             M+T F  F+S+       F  A     T+L QGFNWES+  Q GWYNSL+N IPDLA+AG
Sbjct  1     MTTNFLSFVSFVSLALLIFPTALLAAPTLLIQGFNWESSNKQEGWYNSLLNSIPDLASAG  60

Query  212   ITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHR  391
             ITHVWLPPPS SVS QGYMPGRLYDL+ASKYG + +L+ LV A  D GIK VADIVINHR
Sbjct  61    ITHVWLPPPSQSVSSQGYMPGRLYDLNASKYGNQAELKTLVKAFRDKGIKCVADIVINHR  120

Query  392   CADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLN  571
             CA+ +DSRGI+CIFEGGTSDDRLDWGP  ICKDDT++SDGTGN DTG DF  APDIDHLN
Sbjct  121   CAEKQDSRGIWCIFEGGTSDDRLDWGPSFICKDDTQYSDGTGNPDTGGDFEPAPDIDHLN  180

Query  572   PRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGS  751
             PRVQ+ELS+WMNWLKSEIGFDGWRFDFV+GYA SI+K YM+NTSP+ AVGE WN ++YG 
Sbjct  181   PRVQRELSDWMNWLKSEIGFDGWRFDFVKGYAPSITKNYMQNTSPDFAVGEYWNSLSYGQ  240

Query  752   DGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVG  931
             DGKP+YNQD HRN+L +WVQ AGGA TAFDFTTKGILQ AV GELWR+KD +GKPPG++G
Sbjct  241   DGKPNYNQDQHRNDLVQWVQAAGGAVTAFDFTTKGILQAAVQGELWRMKDSNGKPPGMIG  300

Query  932   ISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEIT  1111
             + P+NAVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLKD+I 
Sbjct  301   VLPQNAVTFIDNHDTGSTQKIWPFPSDKVMQGYAYILTHPGIPSVFYDHFFDWGLKDQIA  360

Query  1112  KLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQ  1291
             +L ++RT N I  TS V+I+  D + YVA +DDK+IVKIG K D+GNLIP NF+V  SG 
Sbjct  361   RLTAIRTRNSIGATSKVQIMASDPDLYVAMVDDKIIVKIGPKLDLGNLIPPNFHVSTSGN  420

Query  1292  DYVVWEK  1312
             DY VWEK
Sbjct  421   DYAVWEK  427



>ref|XP_006387871.1| hypothetical protein POPTR_0515s00220g [Populus trichocarpa]
 gb|ERP46785.1| hypothetical protein POPTR_0515s00220g [Populus trichocarpa]
Length=423

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 345/423 (82%), Gaps = 2/423 (0%)
 Frame = +2

Query  53    FQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
              +FL++CF  L  +  P F S+ +LFQGFNWES    GGWYNSL NL+PDLANAGITHVW
Sbjct  1     MRFLTFCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNSLKNLVPDLANAGITHVW  60

Query  227   LPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYK  406
             LPP S SV+PQGYMPGRLYDL ASKYG++ +L++L+ A H  GIK +ADIVINHR A+ +
Sbjct  61    LPPASQSVAPQGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQ  120

Query  407   DSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQK  586
             D RGI+CIFEGGTSDDRLDWGP LIC DDT +SDG GN DTG DF GAPDIDHLNPRVQK
Sbjct  121   DGRGIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDHLNPRVQK  180

Query  587   ELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPD  766
             ELS+WMNWLKSEIGFDGWRFDFV+GYA SI+KIYMENTSP+ AVGE W+ +AYG DGKPD
Sbjct  181   ELSDWMNWLKSEIGFDGWRFDFVKGYAPSITKIYMENTSPDFAVGEKWDSLAYGQDGKPD  240

Query  767   YNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRN  946
             YNQD HR  L  W+Q AGGA TAFDFTTKGILQ AV GELWRLKD +GKPPGL+G+ P+N
Sbjct  241   YNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGLLPQN  300

Query  947   AVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISV  1126
             AVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI KL ++
Sbjct  301   AVTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEEIGKLATI  360

Query  1127  RTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
             R ++ I   S+V IL  DA+ YVA ID  +I+KIG K D+GNLIP NF V  SG DY VW
Sbjct  361   RKTSGIGSASTVNILASDADLYVAAIDGNMIMKIGPKMDLGNLIPSNFQVAASGTDYCVW  420

Query  1307  EKK  1315
              KK
Sbjct  421   VKK  423



>ref|XP_002301186.2| hypothetical protein POPTR_0002s12790g, partial [Populus trichocarpa]
 gb|EEE80459.2| hypothetical protein POPTR_0002s12790g, partial [Populus trichocarpa]
Length=422

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 344/422 (82%), Gaps = 2/422 (0%)
 Frame = +2

Query  53    FQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
              +FL++CF  L  +  P F S+ +LFQGFNWES    GGWYNSL NL+PDLANAGITHVW
Sbjct  1     MRFLTFCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNSLKNLVPDLANAGITHVW  60

Query  227   LPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYK  406
             LPP S SV+PQGYMPGRLYDL ASKYG++ +L++L+ A H  GIK +ADIVINHR A+ +
Sbjct  61    LPPASQSVAPQGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQ  120

Query  407   DSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQK  586
             D RGI+CIFEGGTSDDRLDWGP LIC DDT +SDG GN DTG +F GAPDIDHLNPRVQK
Sbjct  121   DGRGIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGDNFRGAPDIDHLNPRVQK  180

Query  587   ELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPD  766
             ELS+WMNWLKSEIGFDGWRFDFVRGYA SI+KIYMENTSP+ AVGE W+ +AYG DGKPD
Sbjct  181   ELSDWMNWLKSEIGFDGWRFDFVRGYAPSITKIYMENTSPDFAVGEKWDSLAYGQDGKPD  240

Query  767   YNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRN  946
             YNQD HR  L  W+Q AGGA TAFDFTTKGILQ AV GELWRLKD +GKPPGL+G+ P+N
Sbjct  241   YNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGLLPQN  300

Query  947   AVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISV  1126
             AVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI KL ++
Sbjct  301   AVTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEEIGKLATI  360

Query  1127  RTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
             R ++ I   S+V IL  DA+ YVA ID  +I+KIG K D+GNLIP NF V  SG DY VW
Sbjct  361   RKTSGIGSASTVNILASDADLYVAAIDGNMIMKIGPKMDLGNLIPSNFQVATSGADYCVW  420

Query  1307  EK  1312
              K
Sbjct  421   VK  422



>ref|XP_011017206.1| PREDICTED: alpha-amylase isoform X2 [Populus euphratica]
Length=423

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 343/423 (81%), Gaps = 2/423 (0%)
 Frame = +2

Query  53    FQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
              +FL++CF  L  +  P F S+ +LFQGFNWES    GGWYN+L NL+PDLANAGITHVW
Sbjct  1     MRFLTFCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNTLKNLVPDLANAGITHVW  60

Query  227   LPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYK  406
             LPP S SV+PQGYMPGRLYDL ASKYG++ +L++L+ A H  GIK +ADIVINHR A+ +
Sbjct  61    LPPASQSVAPQGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQ  120

Query  407   DSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQK  586
             D RGI+CIFEGGTSDDRLDWGP LIC DDT +SDG GN DTG DF GAPDIDHLNPRVQK
Sbjct  121   DGRGIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDHLNPRVQK  180

Query  587   ELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPD  766
             ELS+WMNWLKSEIGFDGWRFDFVRGYA SI+KIYM+NTSP+ AVGE W+ +AYG DGKP 
Sbjct  181   ELSDWMNWLKSEIGFDGWRFDFVRGYAPSITKIYMKNTSPDFAVGEKWDSLAYGQDGKPV  240

Query  767   YNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRN  946
             YNQD HR  L  W+Q AGGA TAFDFTTKGILQ AV GELWRLKD +GKPPGL+G+ P+N
Sbjct  241   YNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGLLPQN  300

Query  947   AVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISV  1126
             AVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK EI KL ++
Sbjct  301   AVTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKTEIGKLTTI  360

Query  1127  RTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
             R ++ I   S+V IL  DA+ YVA ID  VI+KIG K D+GNLIP NF V  SG DY VW
Sbjct  361   RRTSGIGSASTVNILASDADLYVAAIDGNVIMKIGPKMDLGNLIPSNFQVAASGADYCVW  420

Query  1307  EKK  1315
              K+
Sbjct  421   VKQ  423



>prf||1803517A alpha amylase
Length=421

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/420 (71%), Positives = 349/420 (83%), Gaps = 3/420 (1%)
 Frame = +2

Query  53    FQFLSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWL  229
             F  LS  FCL  + +P F S  +LFQGFNWES+K +GGWYNSL N IPDLANAGITHVWL
Sbjct  4     FSRLS-IFCLFISLLPLFSSPALLFQGFNWESSK-KGGWYNSLKNSIPDLANAGITHVWL  61

Query  230   PPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKD  409
             PPPS SVSP+GY+PGRLYDLDAS+YG+K +L++L+AA H+ GIK +ADIVINHR A+ KD
Sbjct  62    PPPSQSVSPEGYLPGRLYDLDASRYGSKNELKSLIAAFHEKGIKCLADIVINHRTAERKD  121

Query  410   SRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKE  589
              RGIYCIFEGGT D RLDWGP  IC+DDT +SDGTGN D+G  +  APDIDHLNP+VQ+E
Sbjct  122   GRGIYCIFEGGTPDSRLDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQVQRE  181

Query  590   LSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDY  769
             LSEWMNWLK+EIGFDGWRFDFV+GYA SISKIYME T P+ AVGE W+ ++YG DGKP+Y
Sbjct  182   LSEWMNWLKTEIGFDGWRFDFVKGYAPSISKIYMEQTRPDFAVGEKWDAISYGQDGKPNY  241

Query  770   NQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNA  949
             NQD+HR  L  WV++AGGA TAFDFTTKGILQ AV GELWRL DP+GKPPG++G+ P NA
Sbjct  242   NQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPPGMIGVKPENA  301

Query  950   VTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVR  1129
             VTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK++I KL S+R
Sbjct  302   VTFIDNHDTGSTQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIR  361

Query  1130  TSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
               N I+E SSV+I+  + + YVAKID+K++VKIG K D+GNLIP N +V  SGQDY VWE
Sbjct  362   LRNGINEKSSVKIMASEGDLYVAKIDNKIMVKIGPKMDLGNLIPSNLHVATSGQDYAVWE  421



>sp|P17859.1|AMYA_VIGMU RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Vigna mungo]
 emb|CAA37217.1| unnamed protein product [Vigna mungo]
 emb|CAA51734.1| alpha-amylase [Vigna mungo]
 prf||2016476A alpha amylase
Length=421

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/413 (71%), Positives = 345/413 (84%), Gaps = 2/413 (0%)
 Frame = +2

Query  74    FCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
             FCL  + +P F S  +LFQGFNWES+K +GGWYNSL N IPDLANAGITHVWLPPPS SV
Sbjct  10    FCLFISLLPLFSSPALLFQGFNWESSK-KGGWYNSLKNSIPDLANAGITHVWLPPPSQSV  68

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
             SP+GY+PGRLYDLDASKYG+K +L++L+AA H+ GIK +ADIVINHR A+ KD RGIYCI
Sbjct  69    SPEGYLPGRLYDLDASKYGSKNELKSLIAAFHEKGIKCLADIVINHRTAERKDGRGIYCI  128

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT D R DWGP  IC+DDT +SDGTGN D+G  +  APDIDHLNP+VQ+ELSEWMNW
Sbjct  129   FEGGTPDSRQDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQVQRELSEWMNW  188

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LK+EIGFDGWRFDFV+GYA SISKIYME T P+ AVGE W+ ++YG DGKP+YNQD+HR 
Sbjct  189   LKTEIGFDGWRFDFVKGYAPSISKIYMEQTKPDFAVGEKWDSISYGQDGKPNYNQDSHRG  248

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
              L  WV++AGGA TAFDFTTKGILQ AV GELWRL DP+GKPPG++G+ P NAVTF+DNH
Sbjct  249   ALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPPGMIGVKPENAVTFIDNH  308

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK++I KL S+R  N I+E
Sbjct  309   DTGSTQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIRLRNGINE  368

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
              S+V+I+  + + YVAKID+K++VKIG K D+GNLIP N +V  SGQDY VWE
Sbjct  369   KSTVKIMASEGDLYVAKIDNKIMVKIGPKMDLGNLIPSNLHVATSGQDYAVWE  421



>ref|XP_003589186.1| Alpha-amylase [Medicago truncatula]
 gb|AES59437.1| alpha amylase domain protein [Medicago truncatula]
Length=421

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 342/423 (81%), Gaps = 2/423 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             M++L     +CFCL+  F     ST+LFQGFNWES+ ++GGWYNSL NLIPDLANAGITH
Sbjct  1     MNSLPWLSLFCFCLSI-FPLLASSTLLFQGFNWESS-NKGGWYNSLKNLIPDLANAGITH  58

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             VWLPPPS SV PQGY+PGRLYDLDASKYG+K  L++L+AA  D GI  +ADIVINHR A+
Sbjct  59    VWLPPPSQSVGPQGYLPGRLYDLDASKYGSKDDLKSLIAAFKDKGINCLADIVINHRTAE  118

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
              KD RGIYC+FEGGT D +LDWGP  ICKDDT +SDGTGN D+G  +  APDIDHLNP+V
Sbjct  119   RKDDRGIYCLFEGGTPDSKLDWGPSFICKDDTAYSDGTGNLDSGEGYQAAPDIDHLNPQV  178

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             QKELSEWMNWLK+EIGF GWRFDFV+GYA SI+KIYMENTSP+ AVGE WN ++YG DGK
Sbjct  179   QKELSEWMNWLKTEIGFSGWRFDFVKGYAPSITKIYMENTSPDFAVGEYWNSLSYGQDGK  238

Query  761   PDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
              +YNQD  R EL  WV+N GG   AFDFTTKGILQ AV GELWRLKD +GKPPGL+GI P
Sbjct  239   LNYNQDAARGELVNWVENGGGVVNAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGIKP  298

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
              N  TF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLKD+I KL 
Sbjct  299   ENGATFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKDQIAKLT  358

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             ++R  N I+  S+V IL  DA+ YVAKID+K+IVKIG + D+GNLIP NF+V  SGQDY 
Sbjct  359   AIRQRNGINMKSTVNILAADADLYVAKIDNKIIVKIGPRMDLGNLIPSNFHVATSGQDYA  418

Query  1301  VWE  1309
             VWE
Sbjct  419   VWE  421



>gb|AFK42146.1| unknown [Medicago truncatula]
Length=421

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 342/423 (81%), Gaps = 2/423 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             M++L     +CFCL+  F     ST+LFQGFNWES+ ++GGWYNSL NLIPDLANAGITH
Sbjct  1     MNSLPWLSLFCFCLSI-FPLLASSTLLFQGFNWESS-NKGGWYNSLKNLIPDLANAGITH  58

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             VWLPPPS SV PQGY+PGRLYDLDASKYG+K  L++L+AA  D GI  +ADIVINHR A+
Sbjct  59    VWLPPPSQSVGPQGYLPGRLYDLDASKYGSKDDLKSLIAAFKDKGINCLADIVINHRTAE  118

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
              KD RGIYC+FEGGT D +LDWGP  ICKDDT +SDGTGN D+G  +  APDIDHLNP+V
Sbjct  119   RKDDRGIYCLFEGGTPDSKLDWGPSFICKDDTAYSDGTGNLDSGEGYQAAPDIDHLNPQV  178

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             QKELSEWMNWLK+EIGF GWRFDFV+GYA SI+KIYMENTSP+ AVGE WN ++YG DGK
Sbjct  179   QKELSEWMNWLKTEIGFSGWRFDFVKGYAPSITKIYMENTSPDFAVGEYWNSLSYGQDGK  238

Query  761   PDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
              +YNQD  R EL  WV+N GG   AFDFTTKGILQ AV GELWRLKD +GKPPGL+GI P
Sbjct  239   LNYNQDAARGELVNWVENGGGVVNAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGIKP  298

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
              N  TF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLKD+I KL 
Sbjct  299   ENGATFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKDQIVKLT  358

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             ++R  N I+  S+V IL  DA+ YVAKID+K+IVKIG + D+GNLIP NF+V  SGQDY 
Sbjct  359   AIRQRNGINMKSTVNILAADADLYVAKIDNKIIVKIGPRMDLGNLIPSNFHVATSGQDYA  418

Query  1301  VWE  1309
             VWE
Sbjct  419   VWE  421



>dbj|BAC76729.1| alpha-amylase [Vigna angularis]
Length=421

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/413 (71%), Positives = 346/413 (84%), Gaps = 2/413 (0%)
 Frame = +2

Query  74    FCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
             FCL  + +P F S  +LFQGFNWES+K +GGWYNSL N IPDLANAGITHVWLPPPS SV
Sbjct  10    FCLFISLLPLFSSPALLFQGFNWESSK-KGGWYNSLKNSIPDLANAGITHVWLPPPSQSV  68

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
             SP+GY+PGRLYDLDAS+YG+K +L++L+AA ++ GIK +ADIVINHR A+ KD RGIYCI
Sbjct  69    SPEGYLPGRLYDLDASRYGSKNELKSLIAAFYEKGIKCLADIVINHRTAERKDGRGIYCI  128

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT D RLDWGP  IC+DDT +SDGTGN D+G  +  APDIDHLNP+VQ+ELSEWMNW
Sbjct  129   FEGGTPDSRLDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQVQRELSEWMNW  188

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LK+EIGFDGWRFDFV+GYA SISKIYME T P+ AVGE W+ ++ G DGKP+YNQD+HR 
Sbjct  189   LKTEIGFDGWRFDFVKGYAPSISKIYMEQTRPDFAVGEKWDSLSSGQDGKPNYNQDSHRG  248

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
              L  WV++AGGA TAFDFTTKGILQ AV GELWRL DP+GKPPG++G+ P NAVTF+DNH
Sbjct  249   ALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPPGMIGVKPENAVTFIDNH  308

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK++I KL S+R  N I+E
Sbjct  309   DTGSTQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIRVRNGINE  368

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
              S+V+IL  + + YVAKID+K++VKIG K D+GNLIP NF+V  SGQDY VWE
Sbjct  369   KSTVKILASEGDLYVAKIDNKIMVKIGPKMDLGNLIPSNFHVATSGQDYAVWE  421



>gb|EYU25422.1| hypothetical protein MIMGU_mgv1a006910mg [Erythranthe guttata]
Length=426

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/425 (69%), Positives = 339/425 (80%), Gaps = 4/425 (1%)
 Frame = +2

Query  50    LFQFLSYC---FCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             + +FL  C   F +   F PA   ST+L QGFNWES+  +GGWYN+L N++PD+A+AG T
Sbjct  1     MTKFLITCLSSFLIVFGFFPALTRSTILLQGFNWESSNKRGGWYNTLQNVVPDIASAGFT  60

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             HVWLPPPSHSVSPQGY+PGRLYDLDASKYG   +L+AL+ +LHD GIK VADIVINHR A
Sbjct  61    HVWLPPPSHSVSPQGYLPGRLYDLDASKYGNSNELKALIQSLHDKGIKAVADIVINHRTA  120

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             + KD RGIYC+FEGGT D RLDWGP  ICKDDT++SDGTGN D+GA +  APDIDHLNP 
Sbjct  121   ERKDGRGIYCLFEGGTPDARLDWGPSFICKDDTQYSDGTGNPDSGAAYDAAPDIDHLNPT  180

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQ ELS+W+NWLK EIGFDGWRFDFV+GY+  I+KIYM+NT P+ AVGELWN + Y  +G
Sbjct  181   VQNELSDWLNWLKKEIGFDGWRFDFVKGYSPRITKIYMDNTRPDFAVGELWNSIDYDGNG  240

Query  758   KPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
             KP YNQD HRNEL+RW  +AGG   AFDFTTKGILQ AV GELWRL+D  G PPGL+GI 
Sbjct  241   KPAYNQDRHRNELARWAGDAGGNVAAFDFTTKGILQAAVQGELWRLRDSGGNPPGLIGIM  300

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             P NAVTF+DNHDTGSTQ+ WPFP DKV+QGYAYILTHPG P +FYDH FDWG KDEI+KL
Sbjct  301   PGNAVTFIDNHDTGSTQNMWPFPSDKVVQGYAYILTHPGTPSVFYDHLFDWGKKDEISKL  360

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
             I +R  N I  TS VEIL  DA+ YVAKID+KVI KIG K D+GNLIP +F V  SG DY
Sbjct  361   IGIRGRNGIGATSKVEILAADADLYVAKIDNKVITKIGPKADLGNLIPADFKVSASGTDY  420

Query  1298  VVWEK  1312
              VWEK
Sbjct  421   AVWEK  425



>ref|XP_006387870.1| alpha amylase family protein [Populus trichocarpa]
 gb|ERP46784.1| alpha amylase family protein [Populus trichocarpa]
Length=404

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/404 (73%), Positives = 333/404 (82%), Gaps = 0/404 (0%)
 Frame = +2

Query  104   FGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLY  283
              G  +++QGFNWES    GGWYNSL NL+PDLANAGITHVWLPP S SV+PQGYMPGRLY
Sbjct  1     MGLVIVWQGFNWESCNQAGGWYNSLKNLVPDLANAGITHVWLPPASQSVAPQGYMPGRLY  60

Query  284   DLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLD  463
             DL ASKYG++ +L++L+ A H  GIK +ADIVINHR A+ +D RGI+CIFEGGTSDDRLD
Sbjct  61    DLSASKYGSQGELKSLIGAFHQKGIKCLADIVINHRTAEKQDGRGIWCIFEGGTSDDRLD  120

Query  464   WGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWR  643
             WGP LIC DDT +SDG GN DTG DF GAPDIDHLNPRVQKELS+WMNWLKSEIGFDGWR
Sbjct  121   WGPSLICSDDTAYSDGKGNPDTGGDFGGAPDIDHLNPRVQKELSDWMNWLKSEIGFDGWR  180

Query  644   FDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagg  823
             FDFV+GYA SI+KIYMENTSP+ AVGE W+ +AYG DGKPDYNQD HR  L  W+Q AGG
Sbjct  181   FDFVKGYAPSITKIYMENTSPDFAVGEKWDSLAYGQDGKPDYNQDAHRGGLKDWIQAAGG  240

Query  824   aatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPF  1003
             A TAFDFTTKGILQ AV GELWRLKD +GKPPGL+G+ P+NAVTF+DNHDTGSTQ  WPF
Sbjct  241   AVTAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGLLPQNAVTFIDNHDTGSTQKLWPF  300

Query  1004  PKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDA  1183
             P DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI KL ++R ++ I   S+V IL  DA
Sbjct  301   PSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEEIGKLATIRKTSGIGSASTVNILASDA  360

Query  1184  NAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             + YVA ID  +I+KIG K D+GNLIP NF V  SG DY VW KK
Sbjct  361   DLYVAAIDGNMIMKIGPKMDLGNLIPSNFQVAASGTDYCVWVKK  404



>ref|XP_006434774.1| hypothetical protein CICLE_v10001266mg [Citrus clementina]
 ref|XP_006473327.1| PREDICTED: alpha-amylase-like [Citrus sinensis]
 gb|ESR48014.1| hypothetical protein CICLE_v10001266mg [Citrus clementina]
 gb|KDO84179.1| hypothetical protein CISIN_1g014447mg [Citrus sinensis]
Length=424

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/424 (70%), Positives = 337/424 (79%), Gaps = 1/424 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             MSTL  F    F LA  F+P     +LFQGFNWES+   GGWYNSL N IPDL+NAGITH
Sbjct  1     MSTLKSFCFLSFLLAI-FLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITH  59

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             VWLPPPS SV+PQGYMPGRLYDLDASKYG++  L++L+ A    GIK +AD+VINHR A+
Sbjct  60    VWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAE  119

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
              KD RGIYCIFEGGTSDDRLDWGP  IC+ D E+SDG GN DTG DF  APDIDHLNPRV
Sbjct  120   RKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRV  179

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             QKELS+WMNWLK+EIGFDGWRFDFV+GYA SI+K+YMENTSP+ AVGE W+ ++YG DGK
Sbjct  180   QKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGK  239

Query  761   PDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
             PD NQD HR  L  WVQ AGGA  AFDFTTKGILQ AV GELWRLKD +GKPPG +GI P
Sbjct  240   PDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILP  299

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
             +NAVTF+DNHDTGSTQ  WPFP DKV+ GYAYILTHPG PC+FYDHFFDWGLK+ I+KL 
Sbjct  300   QNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIFYDHFFDWGLKEAISKLA  359

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             +VR  N I+  S V IL  DA+ Y+A I D+VI+KIG K D+GNLIP +F V   G DY 
Sbjct  360   AVRNRNGINTASRVNILASDADVYIAAIGDRVIMKIGPKMDIGNLIPSDFKVAADGTDYA  419

Query  1301  VWEK  1312
             VWEK
Sbjct  420   VWEK  423



>ref|XP_011017205.1| PREDICTED: alpha-amylase isoform X1 [Populus euphratica]
Length=435

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/435 (69%), Positives = 343/435 (79%), Gaps = 14/435 (3%)
 Frame = +2

Query  53    FQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
              +FL++CF  L  +  P F S+ +LFQGFNWES    GGWYN+L NL+PDLANAGITHVW
Sbjct  1     MRFLTFCFFSLFLSVFPLFTSSALLFQGFNWESCNQAGGWYNTLKNLVPDLANAGITHVW  60

Query  227   LPPPSHSVSPQ------------GYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVA  370
             LPP S SV+PQ            GYMPGRLYDL ASKYG++ +L++L+ A H  GIK +A
Sbjct  61    LPPASQSVAPQEDIIHPLLKFLLGYMPGRLYDLSASKYGSQGELKSLIGAFHQKGIKCLA  120

Query  371   DIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGA  550
             DIVINHR A+ +D RGI+CIFEGGTSDDRLDWGP LIC DDT +SDG GN DTG DF GA
Sbjct  121   DIVINHRTAEKQDGRGIWCIFEGGTSDDRLDWGPSLICSDDTAYSDGKGNPDTGGDFGGA  180

Query  551   PDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELW  730
             PDIDHLNPRVQKELS+WMNWLKSEIGFDGWRFDFVRGYA SI+KIYM+NTSP+ AVGE W
Sbjct  181   PDIDHLNPRVQKELSDWMNWLKSEIGFDGWRFDFVRGYAPSITKIYMKNTSPDFAVGEKW  240

Query  731   NDMAYGSDGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDG  910
             + +AYG DGKP YNQD HR  L  W+Q AGGA TAFDFTTKGILQ AV GELWRLKD +G
Sbjct  241   DSLAYGQDGKPVYNQDAHRGGLKDWIQAAGGAVTAFDFTTKGILQAAVQGELWRLKDSNG  300

Query  911   KPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDW  1090
             KPPGL+G+ P+NAVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDW
Sbjct  301   KPPGLIGLLPQNAVTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDW  360

Query  1091  GLKDEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNF  1270
             GLK EI KL ++R ++ I   S+V IL  DA+ YVA ID  VI+KIG K D+GNLIP NF
Sbjct  361   GLKTEIGKLTTIRRTSGIGSASTVNILASDADLYVAAIDGNVIMKIGPKMDLGNLIPSNF  420

Query  1271  NVVVSGQDYVVWEKK  1315
              V  SG DY VW K+
Sbjct  421   QVAASGADYCVWVKQ  435



>ref|XP_007134076.1| hypothetical protein PHAVU_010G017600g [Phaseolus vulgaris]
 dbj|BAA33879.1| alpha-amylase [Phaseolus vulgaris]
 gb|ESW06070.1| hypothetical protein PHAVU_010G017600g [Phaseolus vulgaris]
Length=420

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/413 (70%), Positives = 343/413 (83%), Gaps = 3/413 (1%)
 Frame = +2

Query  74    FCLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
             FCL  +  P F S+ +LFQGFNWES+K +GGWYNSL N +PD+ANAGITHVWLPPPS SV
Sbjct  10    FCLFISLSPLFSSSALLFQGFNWESSK-KGGWYNSLKNSVPDIANAGITHVWLPPPSQSV  68

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
             SP+GY+PGRLYDLDAS+YG+K +L++L+AA H+ GIK +ADIVINHR A+ KD RGIYCI
Sbjct  69    SPEGYLPGRLYDLDASRYGSKDELKSLIAAFHEKGIKCLADIVINHRTAERKDGRGIYCI  128

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT D RLDWGP  ICKDDT +SDGTGN D+G  +  APDIDHLNP+VQ+ELSEWMNW
Sbjct  129   FEGGTPDARLDWGPSFICKDDTTYSDGTGNNDSGESYDAAPDIDHLNPQVQRELSEWMNW  188

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LK+E+GFDGWRFDFV+GYA SISKIYME T P+ AVGE W+ ++Y  +GKP YNQD+HR 
Sbjct  189   LKTEVGFDGWRFDFVKGYAPSISKIYMEQTRPDFAVGEKWDPLSY-ENGKPTYNQDSHRG  247

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
              L  WV++AGGA TAFDFTTKGILQ AV GELWRL DP+GKP G++G+ P NAVTF+DNH
Sbjct  248   ALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPSGMIGVKPENAVTFIDNH  307

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK++I KL S+R  N I+E
Sbjct  308   DTGSTQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIRVRNGINE  367

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
              S+VEI+  + + YVAKID+K++VKIG K D+G LIP NF+V  SGQDY VWE
Sbjct  368   KSTVEIMAAEGDLYVAKIDNKIMVKIGPKMDLGKLIPSNFHVATSGQDYAVWE  420



>ref|XP_007199844.1| hypothetical protein PRUPE_ppa006152mg [Prunus persica]
 gb|EMJ01043.1| hypothetical protein PRUPE_ppa006152mg [Prunus persica]
Length=425

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/429 (67%), Positives = 347/429 (81%), Gaps = 6/429 (1%)
 Frame = +2

Query  35    QKMSTLFQFLSYCFCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAG  211
             + ++TLF     C  L    +P F  S +LFQGFNWES K +GGWYNSL   +P+LA++G
Sbjct  2     KSLTTLF-----CVLLCINLLPNFAASQILFQGFNWESWKTEGGWYNSLRKSVPELASSG  56

Query  212   ITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHR  391
             ITHVWLPPPS + S +GY+PGRLYDL ASKYG++ +L++L++A HD+GI+ VADIVINHR
Sbjct  57    ITHVWLPPPSQAASSEGYLPGRLYDLSASKYGSQDELKSLISAFHDSGIQAVADIVINHR  116

Query  392   CADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLN  571
              A+ +D RGI+CIFEGGT D+RLDWGP LIC DDT++SDG GN DTGA +  APDIDH N
Sbjct  117   TAEKQDERGIWCIFEGGTPDNRLDWGPSLICSDDTQYSDGKGNPDTGAGYDAAPDIDHKN  176

Query  572   PRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGS  751
              RVQKELS+WMNWLK+EIGF GWRFDFVRGY+  I+K+YM NTSP  AVGELWN +A GS
Sbjct  177   TRVQKELSDWMNWLKTEIGFSGWRFDFVRGYSPEITKLYMTNTSPNFAVGELWNSLAIGS  236

Query  752   DGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVG  931
             DGKP+YNQD HR EL+ WV+ AGGA TAFDFTTKGILQ AV GEL RLKDP+G+ PG++G
Sbjct  237   DGKPEYNQDAHRQELAGWVEGAGGAVTAFDFTTKGILQAAVQGELSRLKDPNGRAPGMIG  296

Query  932   ISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEIT  1111
             + P  +VTF+DNHDTGSTQ  WPFP DKVIQGYAYILTHPGIP +FYDHFFDWGLKDEIT
Sbjct  297   LLPGKSVTFIDNHDTGSTQKIWPFPSDKVIQGYAYILTHPGIPSIFYDHFFDWGLKDEIT  356

Query  1112  KLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQ  1291
             KLI++R+ N I   S++ IL  DA+ YVA ID+K+I KIGS++DVGNL+P  + V  SG+
Sbjct  357   KLIAIRSRNGIKPDSALRILASDADLYVAAIDEKIIAKIGSRYDVGNLVPPTYQVATSGK  416

Query  1292  DYVVWEKKA  1318
             DY VWEKKA
Sbjct  417   DYAVWEKKA  425



>ref|XP_004294806.1| PREDICTED: alpha-amylase-like [Fragaria vesca subsp. vesca]
Length=461

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/431 (68%), Positives = 340/431 (79%), Gaps = 9/431 (2%)
 Frame = +2

Query  29    NPQKMSTLFQFLSYCFCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLAN  205
             N  K+STL      CF L+   +P F  S +LFQGFNWES K +GGWYN L     +LA+
Sbjct  39    NSLKISTL------CFLLSIISIPNFTVSQILFQGFNWESAK-KGGWYNILEQSAAELAS  91

Query  206   AGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVIN  385
             +GITHVWLPPPS ++S +GYMPGRLYDL  SKYG +  L+ALV A  DNGIK VADIVIN
Sbjct  92    SGITHVWLPPPSQAISDEGYMPGRLYDL-TSKYGNQDGLKALVKAYQDNGIKSVADIVIN  150

Query  386   HRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDH  565
             HRCA+ +D RGI+CIFEGGT DDRLDWGP LIC DDT++SDG GN DTGADF GAPDIDH
Sbjct  151   HRCAEKQDERGIWCIFEGGTPDDRLDWGPSLICSDDTKYSDGKGNPDTGADFGGAPDIDH  210

Query  566   LNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAY  745
              N RVQ ELS+WMNWLK+EIGF GWRFDFVRGYA   +K+Y+ NT P  +VGE WN +AY
Sbjct  211   KNTRVQSELSDWMNWLKTEIGFSGWRFDFVRGYAPEFTKLYVANTKPSFSVGEYWNSIAY  270

Query  746   GSDGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGL  925
             GSDGKP+YNQDNHRNEL+ W+ NAGG  TAFDFTTKGILQ AV GELWRLKD +G PPGL
Sbjct  271   GSDGKPEYNQDNHRNELAGWIGNAGGEVTAFDFTTKGILQAAVQGELWRLKDSNGGPPGL  330

Query  926   VGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDE  1105
             +GISPRN+VTF+DNHDTGSTQ  WPFP DKV+QGYAY LTHPGIP +FYDHFFDWGLK E
Sbjct  331   IGISPRNSVTFIDNHDTGSTQKLWPFPSDKVMQGYAYTLTHPGIPSIFYDHFFDWGLKGE  390

Query  1106  ITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVS  1285
             I+KL ++R+ N I   S+V IL  DA+ YVA IDDK+I KIG + DVGNL+P  F +  S
Sbjct  391   ISKLTAIRSRNGIKPDSAVRILAADADLYVASIDDKIITKIGPRFDVGNLVPPTFKIATS  450

Query  1286  GQDYVVWEKKA  1318
             G+DY VWEK A
Sbjct  451   GKDYSVWEKSA  461



>ref|XP_010061754.1| PREDICTED: alpha-amylase-like isoform X1 [Eucalyptus grandis]
 gb|KCW68752.1| hypothetical protein EUGRSUZ_F02349 [Eucalyptus grandis]
Length=425

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/424 (68%), Positives = 342/424 (81%), Gaps = 4/424 (1%)
 Frame = +2

Query  44    STLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHV  223
             S  + F+   F LA +  PA    +LFQGFNWES+K +GGWYNSL NL+PDLANAGITHV
Sbjct  6     SLFWLFVLLVFYLAASASPA----LLFQGFNWESSKKEGGWYNSLKNLVPDLANAGITHV  61

Query  224   WLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADY  403
             WLPPPS S + QGY+PGRLYDL+AS YG + +L+ L+ A H  GIK +ADIVINHR A+ 
Sbjct  62    WLPPPSQSAAQQGYLPGRLYDLNASSYGNQDELKHLIDAFHQKGIKCLADIVINHRTAEK  121

Query  404   KDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQ  583
             +DSRGI+CIFEGGT D+RLDWGP  IC+DDTEFSDG GN DTG DF   PDIDHLNPRVQ
Sbjct  122   QDSRGIWCIFEGGTPDERLDWGPSFICRDDTEFSDGMGNLDTGGDFNNTPDIDHLNPRVQ  181

Query  584   KELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKP  763
             KELS+WMNWLKS+IGFDGWRFDFV GY  SI+KIYM+ T P  AVGE W+ ++YG D KP
Sbjct  182   KELSDWMNWLKSDIGFDGWRFDFVLGYDPSITKIYMDRTLPNFAVGENWDSLSYGQDKKP  241

Query  764   DYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPR  943
             + NQD HR++L+ WV  AGGA TAFDFTTKGILQ AV GELWRLKD +G PPGL+G+ P 
Sbjct  242   NPNQDAHRHKLAEWVNAAGGAVTAFDFTTKGILQAAVEGELWRLKDSNGMPPGLIGLQPS  301

Query  944   NAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLIS  1123
             +AVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG+P +FYDHFFDWGLK+EI KL +
Sbjct  302   SAVTFIDNHDTGSTQKIWPFPSDKVMQGYAYILTHPGVPSIFYDHFFDWGLKEEIGKLTA  361

Query  1124  VRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVV  1303
             +R  N+I+E SSVEIL  D++ YVAKIDD VI+KIG + +VGNL+P N+ +  SGQDY V
Sbjct  362   IRARNQINEKSSVEILASDSDLYVAKIDDGVIMKIGPRFEVGNLVPPNYQIATSGQDYCV  421

Query  1304  WEKK  1315
             WEKK
Sbjct  422   WEKK  425



>ref|XP_010061756.1| PREDICTED: alpha-amylase-like isoform X3 [Eucalyptus grandis]
Length=425

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/419 (69%), Positives = 342/419 (82%), Gaps = 1/419 (0%)
 Frame = +2

Query  62    LSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             L + F L+ +++ A  S  +LFQGFNWES+K +GGWYNSL NL+PDLANAGITHVWLPPP
Sbjct  7     LFWLFVLSVSYLAASASPALLFQGFNWESSKKEGGWYNSLKNLVPDLANAGITHVWLPPP  66

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S S + QGY+PGRLYDL+AS YG + +L+ L+ A H  GIK +ADIVINHR A+ +DSRG
Sbjct  67    SQSAAQQGYLPGRLYDLNASSYGNQDELKHLIDAFHQKGIKCLADIVINHRTAEKQDSRG  126

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             I+CIFEGGT D+RLDWGP  IC+DDTEFSDG GN DTG DF   PDIDHLNPRVQKELS+
Sbjct  127   IWCIFEGGTPDERLDWGPSFICRDDTEFSDGMGNLDTGGDFNNTPDIDHLNPRVQKELSD  186

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             WMNWLKS+IGFDGWRFDFV GY  SI+KIYM+ T P  AVGE W+ ++YG D KP+ NQD
Sbjct  187   WMNWLKSDIGFDGWRFDFVLGYDPSITKIYMDRTLPNFAVGENWDSLSYGQDKKPNPNQD  246

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
              HR++L+ WV  AGGA TAFDFTTKGILQ AV GELWRLKD +G PPGL+G+ P +AVTF
Sbjct  247   AHRHKLAEWVNAAGGAVTAFDFTTKGILQAAVEGELWRLKDSNGMPPGLIGLQPSSAVTF  306

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKV+QGYAYILTHPG+P +FYDHFFDWGLK+EI KL ++R  N
Sbjct  307   IDNHDTGSTQKIWPFPSDKVMQGYAYILTHPGVPSIFYDHFFDWGLKEEIGKLTAIRARN  366

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             +I+E SSVEIL  D++ YVAKIDD VI+KIG + +VGNL+P N+ +  SGQDY VWEKK
Sbjct  367   QINEKSSVEILASDSDLYVAKIDDGVIMKIGPRFEVGNLVPPNYQIATSGQDYCVWEKK  425



>ref|XP_004499059.1| PREDICTED: alpha-amylase-like [Cicer arietinum]
Length=420

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/413 (70%), Positives = 336/413 (81%), Gaps = 3/413 (1%)
 Frame = +2

Query  74    FCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVS  253
             FCL+  F     ST+LFQGFNWES+  +GGWYN L N IPDLANAGITHVWLPPPS SV 
Sbjct  10    FCLSI-FPLLASSTLLFQGFNWESSS-KGGWYNLLKNSIPDLANAGITHVWLPPPSQSVG  67

Query  254   PQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIF  433
              QGY+PGRLYDLDASKYG+K +L++L+ A +D GIK +ADIVINHR A+ KD RGIYC+F
Sbjct  68    SQGYLPGRLYDLDASKYGSKDELKSLIKAFNDKGIKSLADIVINHRTAERKDGRGIYCLF  127

Query  434   EGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWL  613
             EGGT D +LDWGP  ICKDDT +SDGTGN DTG D+  APDIDHLNP+VQ+ELSEWMNWL
Sbjct  128   EGGTPDTKLDWGPSFICKDDTTYSDGTGNLDTGEDYNAAPDIDHLNPQVQRELSEWMNWL  187

Query  614   KSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNE  793
             K+EIGF GWRFDFV+GYA SI+KIY+ENTSP+ AVGE WN ++YG DGK DYNQD  R E
Sbjct  188   KTEIGFSGWRFDFVKGYAPSITKIYVENTSPDFAVGEYWNSLSYGQDGKCDYNQDKARGE  247

Query  794   LSRWVQNa-ggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
             L  WV+++  G   AFDFTTKGILQ AV GELWRLKD +GKPPGL+G+ P NAVTF+DNH
Sbjct  248   LVNWVESSGAGVVNAFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGLKPENAVTFIDNH  307

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDH FDWGLK++ITKL ++R  N I+ 
Sbjct  308   DTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHLFDWGLKEQITKLTAIRVRNGINM  367

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
              S+V IL  D + YVAKID+K+IVKIG K D+GNL+P NF+V  SGQDY VWE
Sbjct  368   KSTVNILAADGDIYVAKIDNKIIVKIGPKMDLGNLVPSNFHVATSGQDYAVWE  420



>ref|XP_010061752.1| PREDICTED: alpha-amylase-like [Eucalyptus grandis]
 gb|KCW68748.1| hypothetical protein EUGRSUZ_F02347 [Eucalyptus grandis]
 gb|KCW68750.1| hypothetical protein EUGRSUZ_F02347 [Eucalyptus grandis]
Length=425

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 344/419 (82%), Gaps = 1/419 (0%)
 Frame = +2

Query  62    LSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             L + F ++ +++ A  S  +LFQGFNWES K +GGWYNSL NL+PDLANAGITHVWLPPP
Sbjct  7     LFWLFVISVSYLAASASPALLFQGFNWESWKKEGGWYNSLKNLVPDLANAGITHVWLPPP  66

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S S + QGY+PGRLYDL+AS YG + +L+ L+ A H  GIK +ADIVINHR A+ +DSRG
Sbjct  67    SQSAAQQGYLPGRLYDLNASSYGNQVELKHLIDAFHQKGIKCLADIVINHRTAEKQDSRG  126

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             I+CIFEGGT DDRLDWGP LIC+DDTE+SDG GN D+G DF  APDIDHLNPRVQKELS+
Sbjct  127   IWCIFEGGTPDDRLDWGPSLICRDDTEYSDGRGNLDSGEDFKPAPDIDHLNPRVQKELSD  186

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             WMNWLKS+IGFDGWRFDFV+GYA SI+KIYM+ T P  AVGE W+ ++YG DGK + NQD
Sbjct  187   WMNWLKSDIGFDGWRFDFVKGYAPSITKIYMDRTLPNFAVGEKWDSLSYGQDGKLNPNQD  246

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
              HR+ L+ WV  AGGA TAFDFTTKGILQ A+ GELWRL+D +G PPGL+G+ PR+AVTF
Sbjct  247   AHRHALADWVNAAGGAVTAFDFTTKGILQAAIEGELWRLRDSNGMPPGLIGLQPRSAVTF  306

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKV+QGYAYILTHPG+P +FYDHFFDWGLK+EI KL ++R  N
Sbjct  307   IDNHDTGSTQKVWPFPSDKVMQGYAYILTHPGVPSIFYDHFFDWGLKEEIGKLTAIRARN  366

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              I+E SSV+IL  D++ YVAKIDD VI+KIG + +VGNL+P N+ +  SGQDY VWEKK
Sbjct  367   RINEKSSVKILASDSDLYVAKIDDGVIMKIGPRFEVGNLVPPNYQIATSGQDYCVWEKK  425



>ref|XP_010690292.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=430

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/426 (68%), Positives = 337/426 (79%), Gaps = 5/426 (1%)
 Frame = +2

Query  53    FQFLSYCFCLACAFVPAFG---STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHV  223
               F + C CL+ ++   F     T+LFQGFNWES+   GG YNSL N I DLA AG+THV
Sbjct  6     INFATLC-CLSLSYFLLFSFVTPTLLFQGFNWESSNKPGGLYNSLKNSIDDLARAGVTHV  64

Query  224   WLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADY  403
             WLPPP+HSVSPQGYMPGRLYDLD+S+YG +  L++L+ A H  GIK VADIVINHRCAD 
Sbjct  65    WLPPPTHSVSPQGYMPGRLYDLDSSRYGNEADLKSLINAFHQKGIKCVADIVINHRCADK  124

Query  404   KDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQ  583
             KD RGIYCIFEGGT DDRLDWGP  IC+DDT++SDG+GN DTGA +  APDIDHLNPRVQ
Sbjct  125   KDGRGIYCIFEGGTPDDRLDWGPWAICRDDTQYSDGSGNLDTGAGYGAAPDIDHLNPRVQ  184

Query  584   KELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKP  763
             KEL +WMNWLK+EIGFDGWRFDFV+GYA SI+KIYME T P+ AVGELW+ + Y  DGKP
Sbjct  185   KELVDWMNWLKTEIGFDGWRFDFVKGYAPSITKIYMEKTRPDFAVGELWDSITYDPDGKP  244

Query  764   DYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
             DYNQD  RNEL+ WVQ AGG   A   FTTKG+LQ AV GE WR+KD +G+P GL+GI P
Sbjct  245   DYNQDGPRNELAGWVQAAGGGVIAAFDFTTKGVLQAAVQGEWWRMKDSNGRPSGLIGIMP  304

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
             +NAVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHF +WGLK+EI KL 
Sbjct  305   KNAVTFIDNHDTGSTQRLWPFPADKVMQGYAYILTHPGIPSIFYDHFLEWGLKEEIDKLT  364

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             S+R  N ISE+S+V I+  DA+ YVA ID KVIVK+G ++D+GNLIP NF     G+DY 
Sbjct  365   SIRLRNGISESSNVNIMASDADLYVAMIDGKVIVKLGPRYDLGNLIPSNFKASTFGKDYC  424

Query  1301  VWEKKA  1318
             VWEK+ 
Sbjct  425   VWEKQG  430



>ref|XP_010690299.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 334/422 (79%), Gaps = 8/422 (2%)
 Frame = +2

Query  77    CLACAFVPAF---GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
             CL  +F   F    ST+LFQGFNWES   QGG YNSL+N I DLA AGITH+WLPPPSHS
Sbjct  11    CLNLSFSILFNSVASTLLFQGFNWESCNKQGGLYNSLLNSIDDLARAGITHIWLPPPSHS  70

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
             V+PQGY+ GRLYDLDAS YG++ QL+ L+ A H  GIK VADIVINHRCAD KD RGIY 
Sbjct  71    VAPQGYLHGRLYDLDASTYGSETQLKTLINAFHKKGIKCVADIVINHRCADKKDKRGIYS  130

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGT+DDRLDWGP  IC+DDT++SDG+GN DTGAD+  APDIDHLNPRVQKEL +WM 
Sbjct  131   IFEGGTTDDRLDWGPWAICRDDTQYSDGSGNLDTGADYGAAPDIDHLNPRVQKELVDWMK  190

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHR  787
             WLKSEIGFDGWRFDFV+GYA SI KIYME T+P+ AV ELW+ +   SDG+PDY+QD HR
Sbjct  191   WLKSEIGFDGWRFDFVKGYAPSIMKIYMEKTTPDFAVVELWDSINSDSDGRPDYDQDGHR  250

Query  788   NELSRWVQNaggaatafdf-----ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAV  952
             N+L+RWV+ AGG   A        TTKG+LQ AV GE WR+KD +GKP GL+ I P+NAV
Sbjct  251   NKLARWVEAAGGGGGASAIAAFDFTTKGVLQAAVQGEWWRMKDSEGKPTGLIRIMPKNAV  310

Query  953   TFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRT  1132
             TF+DNHDTGSTQ  WPFP DKV QGYAYILTHPGIP +FYDHFF+WG+K+EI KL S+R 
Sbjct  311   TFIDNHDTGSTQQLWPFPSDKVTQGYAYILTHPGIPSIFYDHFFEWGIKEEIAKLASIRL  370

Query  1133  SNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              N I+ +S V I+  DA+ YVA ID+KVIVKIG +++VGNLIP NF +  SG+DY VWEK
Sbjct  371   RNMINGSSGVNIMASDADLYVAMIDEKVIVKIGPRYNVGNLIPSNFKISTSGKDYAVWEK  430

Query  1313  KA  1318
             + 
Sbjct  431   QG  432



>ref|XP_002285213.1| PREDICTED: alpha-amylase [Vitis vinifera]
 emb|CBI32409.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 330/418 (79%), Gaps = 0/418 (0%)
 Frame = +2

Query  62    LSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPS  241
             LSY             S +LFQGFNWES+K QGGWYN LIN IP+L+ +GITHVWLPPPS
Sbjct  7     LSYLLFFNIILPTLTASPILFQGFNWESSKKQGGWYNFLINSIPELSASGITHVWLPPPS  66

Query  242   HSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGI  421
              S + +GY+PGRLYDL+AS YGT+ +L+AL+ A   NGI+ +ADIVINHR A+ KDSRGI
Sbjct  67    QSAASEGYLPGRLYDLNASHYGTQYELKALIKAFRSNGIQCIADIVINHRTAEKKDSRGI  126

Query  422   YCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEW  601
             + IFEGGT DDRLDWGP  IC DDT FSDGTGN DTGA F  APDIDH+NPRVQ+ELS+W
Sbjct  127   WAIFEGGTPDDRLDWGPSFICSDDTLFSDGTGNPDTGAGFDPAPDIDHVNPRVQRELSDW  186

Query  602   MNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDN  781
             MNWLK EIGF GWRFDF RGY+   +K+YMENTSP  AVGE+WN ++YG+D KP+YNQD 
Sbjct  187   MNWLKIEIGFAGWRFDFARGYSPDFTKLYMENTSPNFAVGEIWNSLSYGNDSKPNYNQDA  246

Query  782   HRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFV  961
             HR EL  WV+ AGGA TAFDFTTKGILQ AV GELWRLKD +G PPG++G+ P NAVTF+
Sbjct  247   HRRELVDWVKAAGGAVTAFDFTTKGILQAAVEGELWRLKDSNGGPPGMIGLMPENAVTFI  306

Query  962   DNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNE  1141
             DNHDTGSTQ  WPFP DKV+QGY YILTHPGIP +FYDHFFDWGLK+EI+KLIS+RT N 
Sbjct  307   DNHDTGSTQKIWPFPSDKVMQGYVYILTHPGIPSIFYDHFFDWGLKEEISKLISIRTRNG  366

Query  1142  ISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             I   S V IL  D + YVA ID+K+I KIG ++DVGNL+P  F +  SG +Y VWEK+
Sbjct  367   IKPNSVVRILASDPDLYVAAIDEKIIAKIGPRYDVGNLVPSTFKLATSGNNYAVWEKQ  424



>ref|XP_009410104.1| PREDICTED: alpha-amylase isozyme 3D-like [Musa acuminata subsp. 
malaccensis]
Length=422

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/419 (66%), Positives = 336/419 (80%), Gaps = 1/419 (0%)
 Frame = +2

Query  59    FLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
              L++ F +  +   A  S +LFQGFNWES + QGGWYN L + +PD+A AG+THVWLPPP
Sbjct  5     LLAFVFLVVLSLTTA-QSQILFQGFNWESWRKQGGWYNFLRSQVPDIARAGVTHVWLPPP  63

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             SHSVS QGYMPGRLYDL+ASKYGT+ +L++L+AA HD GIK VADIVINHRCA+ KD+RG
Sbjct  64    SHSVSEQGYMPGRLYDLNASKYGTRDELKSLIAAFHDKGIKCVADIVINHRCAERKDARG  123

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             IYCIFEGGTSD RLDWGP +IC DDT++SDGTGN DTG DF  APDIDHLN +VQ+EL++
Sbjct  124   IYCIFEGGTSDSRLDWGPHMICSDDTQYSDGTGNRDTGGDFGAAPDIDHLNQQVQQELTD  183

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             W+NWL+++IGFDGWR DF RGY+ SI+KIY+ +TSP+  V ELW+ + YG DGKP Y+QD
Sbjct  184   WLNWLRTDIGFDGWRLDFARGYSPSIAKIYVSHTSPDFVVAELWSSLTYGGDGKPAYDQD  243

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
               R EL  WV + GG A AFDFTTKG+LQ AV GELWRL+DP GK  G++G  P  AVTF
Sbjct  244   GSRQELVNWVHDVGGPAAAFDFTTKGVLQAAVQGELWRLRDPQGKASGMIGWWPEKAVTF  303

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             VDNHDTGSTQ  WPFP DKV+QGYAYILTHPG+P +FYDH FDWGLKDEIT L ++RT N
Sbjct  304   VDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGVPTIFYDHLFDWGLKDEITGLAAIRTRN  363

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              I   S++ IL  DA+ Y+A ID+KV+VKIG ++DVGNL+P NF+VV SG  Y +WEK+
Sbjct  364   GILPGSTLRILVADADLYLAVIDEKVMVKIGQRYDVGNLVPANFHVVASGNGYCIWEKR  422



>gb|AHL44839.1| alpha-amylase-like protein [Vitis labrusca x Vitis vinifera]
Length=424

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 329/418 (79%), Gaps = 0/418 (0%)
 Frame = +2

Query  62    LSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPS  241
             LSY             S +LFQGFNWES+K QGGWYN LIN IP+L+ +GITHVWLPPPS
Sbjct  7     LSYLLFFNTILPTLTASPILFQGFNWESSKKQGGWYNFLINSIPELSASGITHVWLPPPS  66

Query  242   HSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGI  421
              S + +GY+PGRLYDL+AS YGT+ +L+AL+ A   NGI+ +ADIVINHR A+ KDSRGI
Sbjct  67    QSAASEGYLPGRLYDLNASHYGTQDELKALIKAFRSNGIQCIADIVINHRTAEKKDSRGI  126

Query  422   YCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEW  601
             + IFEGGT DDRLDWGP  IC DDT FSDG GN DTGA F  APDIDH+NPRVQ+ELS+W
Sbjct  127   WAIFEGGTPDDRLDWGPSFICSDDTLFSDGKGNPDTGAGFDPAPDIDHVNPRVQRELSDW  186

Query  602   MNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDN  781
             MNWLK EIGF GWRFDF RGY+   +K+YM+NTSP  AVGE+WN ++YG+D KP YNQD 
Sbjct  187   MNWLKIEIGFAGWRFDFARGYSPDFTKLYMKNTSPNFAVGEIWNSLSYGNDSKPAYNQDA  246

Query  782   HRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFV  961
             HR EL  WV+ AGGA TAFDFTTKGILQ AV GELWRLKD +G PPG++G+ P NAVTF+
Sbjct  247   HRRELVNWVKAAGGAVTAFDFTTKGILQAAVEGELWRLKDSNGGPPGMIGLMPENAVTFI  306

Query  962   DNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNE  1141
             DNHDTGSTQ  WPFP DKV+QGY YILTHPGIP +FYDHFFDWGLK+EI+KLIS+RT N 
Sbjct  307   DNHDTGSTQKIWPFPSDKVMQGYVYILTHPGIPSIFYDHFFDWGLKEEISKLISIRTRNG  366

Query  1142  ISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             I   S V IL  D + YVA ID+K+I KIGS++DVGNL+P  F +  SG +Y VWEK+
Sbjct  367   IKPNSVVRILASDPDLYVAAIDEKIIAKIGSRYDVGNLVPSTFKLATSGNNYAVWEKQ  424



>ref|XP_008373148.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=432

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 335/421 (80%), Gaps = 4/421 (1%)
 Frame = +2

Query  59    FLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPD-LANAGITHVWLPP  235
             FL +C  L           +LFQGFNWES K +GGWY SL   IP  LA++GITHVWLPP
Sbjct  10    FLLFCIPLLPNLT---APQILFQGFNWESWKEEGGWYKSLSQSIPQQLASSGITHVWLPP  66

Query  236   PSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSR  415
             PSHSVSPQGYMPGRLYDL+AS+YG + +L+AL+   HDNGI+ +ADIVINHRCA+ KD R
Sbjct  67    PSHSVSPQGYMPGRLYDLNASRYGNQDELKALINTFHDNGIQSIADIVINHRCAEKKDER  126

Query  416   GIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELS  595
             GI+CIFEGGT DDRLDWGP LIC DDT +S+G GN DTGADF+ APDIDH+N RVQ+ELS
Sbjct  127   GIWCIFEGGTPDDRLDWGPSLICSDDTAYSNGKGNPDTGADFSAAPDIDHINTRVQRELS  186

Query  596   EWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQ  775
             +WMNWLK+EIGF+GWRFDFV+GYA   +K+++ NT P  +VGELWN +AYGSDGK +YNQ
Sbjct  187   DWMNWLKTEIGFNGWRFDFVKGYAPEFTKLFVTNTRPSFSVGELWNSLAYGSDGKLEYNQ  246

Query  776   DNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVT  955
             D HR  L  WV+ AGG  TAFDFTTKGILQ AV GELWR+KD +G  PG++G+SP  +VT
Sbjct  247   DAHRRALVGWVEGAGGDVTAFDFTTKGILQAAVQGELWRMKDSNGGAPGMIGLSPGKSVT  306

Query  956   FVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTS  1135
             FVDNHDTGSTQ+ WPFP DKV+QGYAYILTHPGIP +FYDH+FDWGLK+EITKL+++R  
Sbjct  307   FVDNHDTGSTQNMWPFPSDKVMQGYAYILTHPGIPSIFYDHYFDWGLKEEITKLVAIRLR  366

Query  1136  NEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             N +   S++ IL  DA+ YVA  D+K+I KIG ++DVGNL+P  + +  SG DY VWEKK
Sbjct  367   NGVGPDSALRILASDADLYVAATDEKIIAKIGPRYDVGNLVPPTYQIATSGNDYCVWEKK  426

Query  1316  A  1318
             A
Sbjct  427   A  427



>ref|XP_002282184.1| PREDICTED: alpha-amylase [Vitis vinifera]
 emb|CBI32414.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/417 (66%), Positives = 332/417 (80%), Gaps = 2/417 (0%)
 Frame = +2

Query  71    CFCLACAFVPAF-GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
             C       +PA   S +LFQGFNWES+K +GGWYN LIN IP+LA +GITHVWLPPPS S
Sbjct  9     CLLFFITILPALTASPILFQGFNWESSKKEGGWYNFLINSIPELAASGITHVWLPPPSQS  68

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
             VSP+GYMPGRLYDL+ASKYGT+ +L+ L+   H  G++ +ADIVINHR A+ +D+RGI+ 
Sbjct  69    VSPEGYMPGRLYDLNASKYGTQDELKTLIKVFHSKGVQCIADIVINHRTAEKQDARGIWA  128

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGT DDRLDW P  ICKDDT +SDGTGN D+G D++ APDIDH+NPRVQ+EL +WMN
Sbjct  129   IFEGGTPDDRLDWTPSFICKDDTPYSDGTGNPDSGDDYSAAPDIDHINPRVQQELIDWMN  188

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHR  787
             WLK EIGFDGWRFDF RG++ + +K YM  T P+ AVGE+W  ++Y SDGKP YNQD+HR
Sbjct  189   WLKIEIGFDGWRFDFARGFSPAFTKFYMAKTRPKFAVGEIWKSLSYRSDGKPSYNQDSHR  248

Query  788   NELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDN  967
              EL  WV+ AGGA  AFDFTTKGILQ AV GELWR+KD +GKPPG++G+ P NAVTF+DN
Sbjct  249   RELVEWVRGAGGAVNAFDFTTKGILQAAVEGELWRMKDLNGKPPGMIGLMPGNAVTFIDN  308

Query  968   HDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEIS  1147
             HDTGST  HWPFP DKV+QGYAYILTHPGIP +FYDHFF+WGLK+EI KLI +R+ N I 
Sbjct  309   HDTGSTLQHWPFPSDKVMQGYAYILTHPGIPSIFYDHFFEWGLKEEIMKLIIIRSRNRIK  368

Query  1148  ETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNF-NVVVSGQDYVVWEKK  1315
               S+V IL  D++ YVA ID K+IVKIG + DVGNL+P +F  +  SG+DY VWEKK
Sbjct  369   PNSAVRILASDSDLYVAAIDGKIIVKIGPRFDVGNLVPKSFKKIATSGKDYCVWEKK  425



>gb|KHG27234.1| Uncharacterized protein F383_11580 [Gossypium arboreum]
Length=419

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/419 (68%), Positives = 331/419 (79%), Gaps = 7/419 (2%)
 Frame = +2

Query  65    SYCF-CLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             S CF  L     P+  S ++LFQGFNWES    GGWY+SL N IPD+ANAG+THVWLPPP
Sbjct  6     SLCFLSLFLYIFPSLTSPSLLFQGFNWESCNKAGGWYSSLKNSIPDIANAGVTHVWLPPP  65

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S SV PQGY+PGRLYDLDASKYG++ +L++L+ A H  GIK +ADIVINHR A+ KD RG
Sbjct  66    SQSVGPQGYLPGRLYDLDASKYGSQAELKSLIKAFHQKGIKCLADIVINHRTAERKDGRG  125

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             IYCIFEGGT DDRLDWGP  IC +D E+SDGTGN DTG D+  APDIDHLNPRVQKELS+
Sbjct  126   IYCIFEGGTPDDRLDWGPSFICGNDKEYSDGTGNPDTGLDYPPAPDIDHLNPRVQKELSD  185

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             WMNWLK+EIGFDGWRFDFVRGYA SI+KIYME TSP+ AVGE W D++ G D     +QD
Sbjct  186   WMNWLKTEIGFDGWRFDFVRGYAPSITKIYMERTSPDFAVGEKWEDLSLGQD-----SQD  240

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
              HR  L  WV+ AGG   AFDFTTKG+L  AV GELWRLKD +G+PPG++G+ P+ AVTF
Sbjct  241   AHRGALKDWVEAAGGVVKAFDFTTKGVLNAAVQGELWRLKDSNGEPPGMIGLLPQKAVTF  300

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKVIQGYAYILTHPG P +FYDHF DWGLKDEITKL ++R  N
Sbjct  301   IDNHDTGSTQKLWPFPSDKVIQGYAYILTHPGTPSIFYDHFVDWGLKDEITKLATIRRKN  360

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              ISETS V+IL  D++ YVA ID+K+I KIG K D+GNL+P N+ +  SG+DY VW KK
Sbjct  361   GISETSKVDILASDSDLYVAAIDEKIITKIGPKMDLGNLVPSNYQLATSGKDYAVWAKK  419



>ref|XP_010061755.1| PREDICTED: alpha-amylase-like isoform X2 [Eucalyptus grandis]
Length=425

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 339/419 (81%), Gaps = 1/419 (0%)
 Frame = +2

Query  62    LSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             L + F L+ +++ A  S  +LFQGFNWES K +GGWYNSL NL+PDLANAGITHVWLPPP
Sbjct  7     LFWLFVLSVSYLAASASPALLFQGFNWESWKKEGGWYNSLKNLVPDLANAGITHVWLPPP  66

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S S + QGY+PGRLYDL+AS YG + +L+ L+ A H  GIK +ADIVINHR A+ +DSRG
Sbjct  67    SQSAAQQGYLPGRLYDLNASSYGNQDELKHLIDAFHQKGIKCLADIVINHRTAEKQDSRG  126

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             I+CIFEGGT DDRLDWGP  IC++D  +SDG GN DTG D+  APDIDHLNPRVQKELS+
Sbjct  127   IWCIFEGGTPDDRLDWGPSFICRNDANYSDGMGNPDTGEDYEFAPDIDHLNPRVQKELSD  186

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             WMNWLKS+IGFDGWRFDFV+GY++SI+KIYM+ T P  AVGE W  ++YG DGK + NQD
Sbjct  187   WMNWLKSDIGFDGWRFDFVKGYSSSITKIYMDRTLPNFAVGENWESLSYGQDGKLNPNQD  246

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
              HR +L+ WV  AGGA TAFDFTTKGILQ A+  ELWRL+D +G PPGL+G+ PR+AVTF
Sbjct  247   AHRLKLADWVNAAGGAITAFDFTTKGILQAAIERELWRLRDSNGMPPGLIGLQPRSAVTF  306

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP  KV+QGYAYILTHPG+P +FYDHFFDWGLK+EI KL ++R  N
Sbjct  307   IDNHDTGSTQKMWPFPSYKVMQGYAYILTHPGVPSIFYDHFFDWGLKEEIGKLTAIRARN  366

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              I+E SSV+IL  D++ YVAKIDD VI+KIG + +VGNL+P N+ +  SGQDY VWEKK
Sbjct  367   RINEKSSVKILASDSDLYVAKIDDGVIMKIGPRFEVGNLVPPNYQIATSGQDYCVWEKK  425



>ref|XP_010690291.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/420 (68%), Positives = 330/420 (79%), Gaps = 4/420 (1%)
 Frame = +2

Query  62    LSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPS  241
             L   F L   FV     T+LFQGFNWES    GG YNSL N I DLA AG+THVWLPPP+
Sbjct  12    LYLSFSLVFNFV---APTILFQGFNWESCNKPGGLYNSLKNSIDDLARAGVTHVWLPPPT  68

Query  242   HSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGI  421
             HSVSPQGY+PGRLYDLDAS+YG    L++L+ A H  GIK VADIVINHRCAD +D RGI
Sbjct  69    HSVSPQGYLPGRLYDLDASRYGNGADLKSLINAFHQKGIKCVADIVINHRCADKQDGRGI  128

Query  422   YCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEW  601
             YCIFEGGT DDRLDWGP  IC+DDT++SDG+GN DTGA +  APDIDHLNPRVQ+EL +W
Sbjct  129   YCIFEGGTPDDRLDWGPWAICRDDTQYSDGSGNLDTGASYGVAPDIDHLNPRVQRELVDW  188

Query  602   MNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDN  781
             MNWLK+EIGFDGWRFDFV+GYA SI+KIYME T P+ AVGELW+ + Y  DGKPDYNQD 
Sbjct  189   MNWLKTEIGFDGWRFDFVKGYAPSITKIYMEKTRPDFAVGELWDSINYDPDGKPDYNQDG  248

Query  782   HRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
              RNEL+ WVQ AGG   A   FTTKG+LQ AV GE WR+KD  G+P GL+GI P+NAVTF
Sbjct  249   PRNELAGWVQAAGGGVIAAFDFTTKGVLQAAVQGEWWRMKDSSGRPSGLIGIMPKNAVTF  308

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHF +WGLK+E+ KL S+R  N
Sbjct  309   IDNHDTGSTQRLWPFPADKVMQGYAYILTHPGIPSIFYDHFLEWGLKEELVKLTSIRLRN  368

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
              ISE+S+V I+  DA+ YVA ID KVIVK+G ++++GNLIP NF     G+DY VWEK+ 
Sbjct  369   GISESSNVNIMASDADLYVAMIDGKVIVKLGPRYNLGNLIPSNFKASTFGKDYCVWEKQG  428



>ref|XP_010108609.1| hypothetical protein L484_006340 [Morus notabilis]
 gb|EXC19765.1| hypothetical protein L484_006340 [Morus notabilis]
Length=424

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/421 (67%), Positives = 336/421 (80%), Gaps = 3/421 (1%)
 Frame = +2

Query  59    FLSYC-FCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLP  232
              +S C FCL  +  P+F + T+LFQGFNW S+  +GGWYNSL N IPDLA AGITHVWLP
Sbjct  4     LISLCVFCLCISLFPSFTTPTILFQGFNWGSSD-KGGWYNSLKNTIPDLAAAGITHVWLP  62

Query  233   PPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDS  412
             P S SV+PQGYMPGRLYDLDASKYGTK +L++L+++L + GIK VADIVINHR A+ +DS
Sbjct  63    PSSQSVAPQGYMPGRLYDLDASKYGTKDELKSLISSLSEKGIKSVADIVINHRTAEKQDS  122

Query  413   RGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKEL  592
             RG++ IFEGGT D RLDWGP  IC DD  +SDGTGN DTG DF GAPDIDH+NP VQKEL
Sbjct  123   RGVWAIFEGGTPDSRLDWGPSFICSDDKTYSDGTGNPDTGDDFGGAPDIDHVNPTVQKEL  182

Query  593   SEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYN  772
             SEWMNWLK+EIGF GWRFD V+GYA   +KIYME T PE AVGE W+ +AYG D KP+ N
Sbjct  183   SEWMNWLKTEIGFVGWRFDMVKGYAPRFTKIYMEKTQPEFAVGEKWDSLAYGQDRKPEQN  242

Query  773   QDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAV  952
             QD HR  L+ WV  AGG+  AFDFTTKGILQ AV GELWRL+D +GKPPGL+G+ P NAV
Sbjct  243   QDAHRGALANWVDAAGGSVNAFDFTTKGILQAAVQGELWRLRDSNGKPPGLIGLKPENAV  302

Query  953   TFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRT  1132
             TF+DNHDTGS+Q+ WPFP DKV+ GY YILTHPG P +FYDH  +WGLKD+I+KL  +RT
Sbjct  303   TFIDNHDTGSSQNLWPFPGDKVMLGYVYILTHPGTPTIFYDHLIEWGLKDQISKLSGIRT  362

Query  1133  SNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             ++ I+  S+V IL  +A+ Y+A IDDKVI+KIG K D+GNL+P N+ +V SGQDY VWEK
Sbjct  363   THGINSGSTVRILAAEADIYMAGIDDKVIMKIGPKLDLGNLLPSNYQLVTSGQDYAVWEK  422

Query  1313  K  1315
             K
Sbjct  423   K  423



>ref|XP_009349497.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=432

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/426 (65%), Positives = 335/426 (79%), Gaps = 4/426 (1%)
 Frame = +2

Query  44    STLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPD-LANAGITH  220
             +T   FL +C  L   F       +LFQGFNWES K +GGWY SL    P  LA++GITH
Sbjct  5     TTSLFFLLFCIPLLPNFT---APQILFQGFNWESWKEEGGWYKSLSKCTPQQLASSGITH  61

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             VWLPPPSHSVSPQGYMPGRLYDL+AS+YG + +L+AL+   HDNGI+ +ADIVINHRCA+
Sbjct  62    VWLPPPSHSVSPQGYMPGRLYDLNASRYGNQDELKALINTFHDNGIQSIADIVINHRCAE  121

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
              KD RGI+CIFEGGT DDRLDWGP LIC DD  +S+G GN DTGADF+ APDID++N RV
Sbjct  122   KKDERGIWCIFEGGTPDDRLDWGPSLICSDDIAYSNGKGNPDTGADFSAAPDIDYINTRV  181

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             Q+ELS+WMNWLK+EIGF GWRFDFV+GYA   +K+++ NT P  +VGELWN +AYGSDGK
Sbjct  182   QRELSDWMNWLKTEIGFSGWRFDFVKGYAPEFTKLFVINTGPSFSVGELWNSLAYGSDGK  241

Query  761   PDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
              +YNQD HR  L  WV+ AGG  TAFDFTTKGILQ AV GELWR+KD +G  PG++G+SP
Sbjct  242   LEYNQDAHRRALVGWVEGAGGDVTAFDFTTKGILQAAVQGELWRMKDSNGGAPGMIGLSP  301

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
                VTF+DNHDTGSTQ+ WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLK+EITKL+
Sbjct  302   GKRVTFIDNHDTGSTQNMWPFPSDKVMQGYAYILTHPGIPSIFYDHFFDWGLKEEITKLV  361

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             ++R  N I   S++ IL  DA+ YVA ID+K+I KIG ++DVGNL+P  + +  SG DY 
Sbjct  362   AIRLRNRIGPDSALRILASDADLYVAAIDEKIIAKIGPRYDVGNLVPPTYQIATSGNDYC  421

Query  1301  VWEKKA  1318
             VWEKKA
Sbjct  422   VWEKKA  427



>ref|XP_002510218.1| alpha-amylase, putative [Ricinus communis]
 gb|EEF52405.1| alpha-amylase, putative [Ricinus communis]
Length=422

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/420 (67%), Positives = 334/420 (80%), Gaps = 2/420 (0%)
 Frame = +2

Query  59    FLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             FLS+ + L+  F     + VLFQGFNWES   +GGWYNSL N +PD+A+AGITHVWLPP 
Sbjct  3     FLSWFYLLSI-FPLYTSAAVLFQGFNWESCNKEGGWYNSLKNFVPDIASAGITHVWLPPS  61

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S SV+PQGYMPGRLYDL  SKYG + +L++L+ ALH  GIK +ADIVINHR A+ +D RG
Sbjct  62    SQSVAPQGYMPGRLYDLSVSKYGNQDELKSLIQALHQKGIKCLADIVINHRTAEKQDERG  121

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             I+CIFEGGT+DDRLDWGP  IC+DDT +SDG GN DTG DF  APDIDHLNPRVQ+ELS+
Sbjct  122   IWCIFEGGTADDRLDWGPSFICRDDTAYSDGKGNPDTGGDFEPAPDIDHLNPRVQQELSD  181

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             WMNWLKSEIGFDGWRFD+V+GYA SI+KIYM  T+P+ AVGE W+ ++YG D KPDYNQD
Sbjct  182   WMNWLKSEIGFDGWRFDYVKGYAPSITKIYMGKTTPDFAVGEKWDSLSYGQDRKPDYNQD  241

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
              HRN L  W+Q AGG  TAFDFTTKGILQ AV GELWRLKD +G PPGL+G  P+NAVTF
Sbjct  242   GHRNALKDWIQAAGGVITAFDFTTKGILQAAVQGELWRLKDSNGNPPGLIGTMPQNAVTF  301

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLK+ I++L S+R S 
Sbjct  302   IDNHDTGSTQQLWPFPSDKVMQGYAYILTHPGIPSIFYDHFFDWGLKEPISRLASIRKSY  361

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIP-YNFNVVVSGQDYVVWEKK  1315
              I   S V+I+  +++ Y+A I+D VI+KIG K D+GNL+P   F V  SG+ Y VW KK
Sbjct  362   GIDSKSRVKIVAAESDLYMAAINDNVIMKIGPKMDLGNLLPSKEFQVATSGESYAVWVKK  421



>ref|XP_006374943.1| alpha amylase family protein [Populus trichocarpa]
 gb|ERP52740.1| alpha amylase family protein [Populus trichocarpa]
Length=423

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/423 (67%), Positives = 335/423 (79%), Gaps = 3/423 (1%)
 Frame = +2

Query  53    FQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
               FL++CF  L  +  P   S+ +LFQGFNWES    GGWYNSL N +PDLANAGITHVW
Sbjct  1     MSFLTFCFFSLFLSVFPLLTSSYLLFQGFNWESCNKAGGWYNSLKNSVPDLANAGITHVW  60

Query  227   LPPPSHSVSPQG-YMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADY  403
             LPP S SV+PQG YMPGRLYDL AS+YG++ +L++L+   +  GIK +ADIVINHR A+ 
Sbjct  61    LPPSSQSVAPQGRYMPGRLYDLSASRYGSQDELKSLIGDFNQKGIKCLADIVINHRTAEK  120

Query  404   KDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQ  583
             +D RGI+ +FEGGTSD RLDWGP  IC DDT +SDG GN D+G DF  APDIDHLNPRVQ
Sbjct  121   QDERGIWSVFEGGTSDGRLDWGPSFICGDDTAYSDGKGNPDSGDDFEPAPDIDHLNPRVQ  180

Query  584   KELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKP  763
             +ELS+WMNWLKSEIGFDGWRFDFV+GYA S++KIYMENTSP+ AVGE W+ +AYG DGK 
Sbjct  181   RELSDWMNWLKSEIGFDGWRFDFVKGYAPSVTKIYMENTSPDFAVGEKWDSLAYGQDGKL  240

Query  764   DYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPR  943
             DYNQD HR  +  W+Q AGGA TAFDFT+KGILQ AV GELWRLKD +GKPPGL+G+ P+
Sbjct  241   DYNQDAHRGSIKDWIQAAGGAVTAFDFTSKGILQAAVQGELWRLKDSNGKPPGLIGLLPQ  300

Query  944   NAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLIS  1123
             NAVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI KL +
Sbjct  301   NAVTFIDNHDTGSTQQIWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEEIGKLAT  360

Query  1124  VRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVV  1303
             +R +  I   S+V IL  DA+ YVA I+D +I+KIG K D+GNLIP NF V  SG DY V
Sbjct  361   IRKNYGIGSASTVNILASDADLYVAAINDNIIMKIGPKTDLGNLIPSNFQVATSGTDYCV  420

Query  1304  WEK  1312
             W K
Sbjct  421   WVK  423



>ref|XP_007017240.1| Alpha-amylase-like isoform 1 [Theobroma cacao]
 gb|EOY14465.1| Alpha-amylase-like isoform 1 [Theobroma cacao]
Length=419

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/419 (68%), Positives = 331/419 (79%), Gaps = 7/419 (2%)
 Frame = +2

Query  65    SYCF-CLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             S CF  L     PA  S T+LFQGFNWES    GGWYNSL N IPD+ANAG+THVWLPPP
Sbjct  6     SLCFLSLFLYIFPALTSPTLLFQGFNWESCNKAGGWYNSLKNSIPDIANAGVTHVWLPPP  65

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S SV PQGY+PGRLYDLD+SKYG++ +L++L+ A H  GIK +ADIVINHR A+ KD RG
Sbjct  66    SQSVGPQGYLPGRLYDLDSSKYGSQAELKSLIEAFHRKGIKCLADIVINHRTAERKDGRG  125

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             IY IFEGGTSDDRLDWGP  IC +D E+SDGTGN DTG D+  APDIDHLNPRVQ ELS+
Sbjct  126   IYSIFEGGTSDDRLDWGPSFICGNDKEYSDGTGNPDTGLDYQPAPDIDHLNPRVQNELSD  185

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             WMNWLK+EIGFDGWRFDFVRGYA SI+KIYME TSP+ AVGE W D++ G +G     QD
Sbjct  186   WMNWLKTEIGFDGWRFDFVRGYAPSITKIYMERTSPDFAVGEKWEDLSLGQNG-----QD  240

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
             +HR  L  WVQ AGG   AFDFTTKG+LQ AV GELWRLKD +GKPPG++G+ P+NAVTF
Sbjct  241   SHRGALKDWVQAAGGVVKAFDFTTKGVLQAAVRGELWRLKDSNGKPPGMIGLLPQNAVTF  300

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGS Q  WPFP DKV+QGYAYILTHPG P +FYDHF  WGLK EITKL +VR+ N
Sbjct  301   IDNHDTGSPQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFVGWGLKGEITKLAAVRSKN  360

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              IS TS+V IL  D++ YVA ID+K+I+KIG K D+GNL+P ++ +  SG+DY VW KK
Sbjct  361   GISATSTVNILASDSDLYVAAIDEKIIMKIGPKLDLGNLVPSSYQLATSGKDYAVWAKK  419



>ref|XP_008236504.1| PREDICTED: alpha-amylase-like [Prunus mume]
Length=425

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/419 (67%), Positives = 340/419 (81%), Gaps = 4/419 (1%)
 Frame = +2

Query  68    YCFCLACAFVPAF-GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSH  244
             +   L    +P F  S +LFQGFNW S K +GGWYNSL   +P+LA++GITHVWLPPPS 
Sbjct  9     FYLLLCINLLPNFTASQILFQGFNWVSWKTEGGWYNSLRKSVPELASSGITHVWLPPPSQ  68

Query  245   SVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIY  424
             + S +GY+PGRLYDL ASKYG++ +L++L++A HD+GI+ VADIVINHR A+ +D RGI+
Sbjct  69    AASDEGYLPGRLYDLSASKYGSQDELKSLISAFHDSGIQAVADIVINHRTAEKQDERGIW  128

Query  425   CIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWM  604
             CIFEGGT DDRLDWGP LIC DDT++SDG GN DTGA +  APDIDH N RVQKELS+WM
Sbjct  129   CIFEGGTPDDRLDWGPSLICSDDTQYSDGKGNPDTGAKYEPAPDIDHKNTRVQKELSDWM  188

Query  605   NWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWND-MAYGSDGKPDYNQDN  781
             NWLK+EIGF GWRFDFVRGY+  I+K+Y+ NTSP  AVGELW+D  A GSDGKP+YNQD 
Sbjct  189   NWLKTEIGFSGWRFDFVRGYSPEITKLYVTNTSPNFAVGELWSDSFAKGSDGKPEYNQDA  248

Query  782   HRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFV  961
             +R EL+ WVQ AGG  TAFDFTTKGILQ AV GELWRLKDP+GK PG++G+ P   VTF+
Sbjct  249   NRQELAGWVQGAGGDVTAFDFTTKGILQAAVQGELWRLKDPNGKAPGMIGLLP--GVTFI  306

Query  962   DNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNE  1141
             DNHDTGSTQ+ WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLK+EITKLI++R+ N 
Sbjct  307   DNHDTGSTQNIWPFPSDKVMQGYAYILTHPGIPSIFYDHFFDWGLKEEITKLIAIRSRNG  366

Query  1142  ISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             I   S++ IL  DA+ YVA ID+K+I KIGS+++VGNL+P  + +  SG+DY VWEKKA
Sbjct  367   IKPDSALRILASDADLYVAAIDEKIIAKIGSRYEVGNLVPPTYQLATSGKDYAVWEKKA  425



>ref|XP_004499063.1| PREDICTED: alpha-amylase-like isoform X1 [Cicer arietinum]
Length=422

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/415 (67%), Positives = 330/415 (80%), Gaps = 3/415 (1%)
 Frame = +2

Query  74    FCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVS  253
             FCL+  F     ST+LFQGFNWES+  +GGWYN L N IPDLANAGITHVWLPPPS SV 
Sbjct  10    FCLSI-FPLLASSTLLFQGFNWESSS-KGGWYNLLKNSIPDLANAGITHVWLPPPSQSVG  67

Query  254   PQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIF  433
              QGY+PGRLYDLDASKYG+K +L++L+   +D GIK +ADIVINHR A+ KD RGIYC+F
Sbjct  68    SQGYLPGRLYDLDASKYGSKDELKSLIKEFNDKGIKSLADIVINHRTAERKDERGIYCLF  127

Query  434   EGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWL  613
             EGGT D +LDWGP  ICKDDT +SDGTGN DTG  +  APDIDHLNP+VQ+ELSEWMNWL
Sbjct  128   EGGTPDGKLDWGPSFICKDDTTYSDGTGNLDTGEGYNAAPDIDHLNPQVQRELSEWMNWL  187

Query  614   KSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNE  793
             K+EIGF GWRFDFV+GYA SI+KIY+ENTSP+ AVGE WN ++YG DGK DYNQD  R E
Sbjct  188   KTEIGFSGWRFDFVKGYAPSITKIYVENTSPDFAVGEYWNSLSYGQDGKCDYNQDKARGE  247

Query  794   LSRWVQNaggaataf-dfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
             L  WV+++G       DFTTKGILQVAV GELWRLKD +GKPPGL+G+ P NAVTF+DNH
Sbjct  248   LVNWVESSGAGVVNAFDFTTKGILQVAVEGELWRLKDSNGKPPGLIGLKPENAVTFIDNH  307

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGY YILTHPG P +FYDH+ +WGL + I KL ++R  N I+ 
Sbjct  308   DTGSTQKLWPFPSDKVMQGYGYILTHPGTPSIFYDHYIEWGLMEPIKKLTAIRKRNGITA  367

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             TSSV IL  +++ Y+A+ID+K+IVKIG K D+GNL+P N  V  +GQDY VWE K
Sbjct  368   TSSVNILAAESDLYMAEIDNKIIVKIGPKLDLGNLLPSNAQVATNGQDYAVWELK  422



>ref|XP_003550340.1| PREDICTED: alpha-amylase-like [Glycine max]
 gb|KHN12782.1| Alpha-amylase [Glycine soja]
Length=414

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/407 (70%), Positives = 330/407 (81%), Gaps = 9/407 (2%)
 Frame = +2

Query  92    FVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYM  268
             F P F S  +LFQGFNWES+K +GGWYNSL N IPDLANAGITHVWLPPPS SVSP+GY+
Sbjct  16    FFPLFASPALLFQGFNWESSK-KGGWYNSLKNTIPDLANAGITHVWLPPPSQSVSPEGYL  74

Query  269   PGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTS  448
             PGRLYDLDASKYGTK QL++L+AA HD GIK +ADIVINHR A+ KD RGIYCIFEGGT 
Sbjct  75    PGRLYDLDASKYGTKDQLKSLIAAFHDKGIKCLADIVINHRTAERKDGRGIYCIFEGGTP  134

Query  449   DDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIG  628
             D RLDWGP  ICKDD  +SDGTGN D+G  +  APDIDHLNP+VQ+ELSEWMNWLK+EIG
Sbjct  135   DARLDWGPSFICKDDNTYSDGTGNLDSGEPYDPAPDIDHLNPQVQRELSEWMNWLKTEIG  194

Query  629   FDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWV  808
             FDGWRFD+V+GYA SI+KIYME T P+ AVGE W+ ++         N D HR  L  WV
Sbjct  195   FDGWRFDYVKGYAPSITKIYMEQTRPDFAVGEKWDSLSID-------NYDGHRGALVNWV  247

Query  809   QNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQ  988
             ++AGGA TAFDFTTKGILQ AV G+LWRLKD +GKP G++G+ P NAVTF+DNHDTGSTQ
Sbjct  248   ESAGGAITAFDFTTKGILQAAVQGQLWRLKDSNGKPSGMIGVKPENAVTFIDNHDTGSTQ  307

Query  989   SHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEI  1168
               WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK++I KL S+R  + I+E SSV I
Sbjct  308   RIWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIRVKHGINEKSSVNI  367

Query  1169  LGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
             L  +A+ YVAKID+K+ +KIG K D+GNLIP NF+V  SGQDY VWE
Sbjct  368   LAAEADLYVAKIDNKIFLKIGPKMDLGNLIPPNFHVATSGQDYAVWE  414



>ref|XP_009350378.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=424

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/417 (66%), Positives = 333/417 (80%), Gaps = 3/417 (1%)
 Frame = +2

Query  71    CFCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
             CF L+    P F  S +LFQGFNWES++ +GGWYN L   + DLA++GITHVWLPP S +
Sbjct  10    CFLLSILLTPNFAASQILFQGFNWESSR-KGGWYNILKQSVKDLASSGITHVWLPPSSQA  68

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
              S +GYMPGRLYDL+ +KYG K +L++LV+A  D+GI+ VADIVINHR A+ +D RGI+C
Sbjct  69    ASDEGYMPGRLYDLN-TKYGNKDELKSLVSAYRDSGIQSVADIVINHRTAEKQDERGIWC  127

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGT DDRLDWGP LIC DDT++SDG GN DTG DF GAPDIDH N RVQKELS+WMN
Sbjct  128   IFEGGTDDDRLDWGPSLICSDDTKYSDGKGNPDTGEDFGGAPDIDHKNTRVQKELSDWMN  187

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHR  787
             WLK+EIGF GWRFDFV+GYA   +K+YM NTSP  AVGELWN ++YGSDGKP+ +QD HR
Sbjct  188   WLKTEIGFSGWRFDFVKGYAPEYTKLYMTNTSPNFAVGELWNSLSYGSDGKPNPDQDAHR  247

Query  788   NELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDN  967
               L RWV++AGG  TAFDFTTKGILQ AV GELWRLKD  G   G++G+ P N+VTF+DN
Sbjct  248   QALVRWVESAGGRVTAFDFTTKGILQAAVQGELWRLKDSKGGASGMIGVKPGNSVTFIDN  307

Query  968   HDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEIS  1147
             HDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDH+FDWGLK+EI+K+ ++R+ N I 
Sbjct  308   HDTGSTQRMWPFPSDKVMQGYAYILTHPGIPSIFYDHYFDWGLKEEISKITAIRSRNGIK  367

Query  1148  ETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
               S++ IL  DA+ YVA ID+K+IVKIG K D+G LIP NF V  SG+DY VWE+KA
Sbjct  368   PNSALRILAADADVYVASIDEKIIVKIGPKMDLGQLIPTNFQVSTSGKDYAVWERKA  424



>ref|XP_010690290.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=427

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/403 (69%), Positives = 332/403 (82%), Gaps = 2/403 (0%)
 Frame = +2

Query  113   TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLD  292
             T+LFQGFNW+S    GG YN L   + DLA AG+THVWLPPP+HSVSPQGY+PGRLYDL+
Sbjct  26    TLLFQGFNWDSWNKPGGLYNFLKGSVNDLARAGVTHVWLPPPTHSVSPQGYLPGRLYDLN  85

Query  293   ASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGP  472
             ASKYG + +L+ L+A+LH  GIK VADIVINHR A+YKD RGIYCIFEGGT D+RLDWGP
Sbjct  86    ASKYGNQMELKTLIASLHQKGIKSVADIVINHRTAEYKDGRGIYCIFEGGTPDNRLDWGP  145

Query  473   GLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDF  652
               IC+DDT++SDG+GN DTG  +A APDIDHLNPRVQKEL +WMNWLK+ IGFDGWR DF
Sbjct  146   WAICRDDTQYSDGSGNPDTGDGYAAAPDIDHLNPRVQKELIDWMNWLKTSIGFDGWRLDF  205

Query  653   VRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQ-Naggaa  829
             V+GY+ SI+K+YM+ T P+ AVGELW+ + Y  +G PDYNQD HRNEL+RWVQ + GG  
Sbjct  206   VKGYSPSITKLYMDQTKPDFAVGELWDSITY-LNGAPDYNQDGHRNELARWVQASGGGVV  264

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             TAFDFTTKGILQ AV G+ WR+KDP+G+P GL+GI P+NAVTF+DNHDTGS+Q  WPFP 
Sbjct  265   TAFDFTTKGILQYAVQGQWWRMKDPNGRPSGLIGILPKNAVTFLDNHDTGSSQKLWPFPP  324

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPGIP +FYDHFFDWGLK+EI +L SVRT N ISETS V I+  D + 
Sbjct  325   DKVMQGYAYILTHPGIPSIFYDHFFDWGLKEEIIRLTSVRTRNGISETSRVNIMACDPDL  384

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             Y+A ID+K+IVKIGSK+D GNLIP N+ VV  G  Y VWEK++
Sbjct  385   YMAMIDEKIIVKIGSKYDTGNLIPPNYKVVTYGSCYCVWEKQS  427



>gb|KDP38338.1| hypothetical protein JCGZ_04263 [Jatropha curcas]
Length=421

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/417 (67%), Positives = 329/417 (79%), Gaps = 2/417 (0%)
 Frame = +2

Query  71    CFCLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
             CF    +F P F S  +LFQGFNWES   +GG YNSL N IP+L  AGITH+WLPPPS S
Sbjct  6     CFHF-LSFFPLFTSAELLFQGFNWESCNKEGGLYNSLKNSIPELVGAGITHIWLPPPSQS  64

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
             V+PQGYMPGRLYDL+ASKYG + +L++LV A H  GIK +ADIVINHR A+ KD RGI+C
Sbjct  65    VAPQGYMPGRLYDLNASKYGNQNELKSLVNAFHGQGIKCLADIVINHRTAERKDERGIWC  124

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGT+DDRLDWGP  IC DDT +S+G GN DTG DF  APDIDHLN RVQKELS+WMN
Sbjct  125   IFEGGTADDRLDWGPSFICSDDTAYSNGKGNPDTGEDFPPAPDIDHLNLRVQKELSDWMN  184

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHR  787
             WLK+EIGFDGWRFDFV+GYA +I+KI M  TSP  AVGE W+ +AYG DGKP+ NQD HR
Sbjct  185   WLKNEIGFDGWRFDFVKGYAPTITKICMAQTSPNFAVGEKWDSLAYGQDGKPEANQDAHR  244

Query  788   NELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDN  967
               L  WV+ AGG  TAFDFTTKGILQ AV GELWRLKD +G PPGL+GI P+NAVTF+DN
Sbjct  245   GALRDWVEAAGGVVTAFDFTTKGILQAAVQGELWRLKDSNGNPPGLIGILPQNAVTFIDN  304

Query  968   HDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEIS  1147
             HDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFF+WGLKD+ITKL S+R +  I 
Sbjct  305   HDTGSTQKLWPFPSDKVMQGYAYILTHPGIPSIFYDHFFEWGLKDQITKLASIRKACRIH  364

Query  1148  ETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
               S+V+IL  +++ Y+A I+D VI+KIG K D+GNL+P N  +  SG+ Y VW KK 
Sbjct  365   NRSTVKILAAESDLYMAAINDNVIMKIGPKMDLGNLLPPNVQLATSGESYAVWIKKT  421



>ref|XP_004960025.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=427

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/404 (68%), Positives = 318/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AG+THVWLPPPSHSVS QGYMPGRLYDLDA
Sbjct  23    VLFQGFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPSHSVSTQGYMPGRLYDLDA  82

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYGT  +L++L+AA H  G++ VADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  83    SKYGTAAELKSLIAAFHAKGVQAVADIVINHRCADYKDSRGIYCIFEGGTSDSRLDWGPH  142

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL+EW+ WLKS+IGFD WR DF 
Sbjct  143   MICRDDTQYSDGTANLDTGADFAAAPDIDHLNDRVQRELTEWLLWLKSDIGFDAWRLDFA  202

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ T+P  AV E+WN+M  G DGKP Y+QD HR  L  WV N GGAA+ 
Sbjct  203   RGYSAEVAKVYVDGTAPSFAVAEIWNNMVPGDDGKPAYDQDPHRQTLVDWVDNVGGAASP  262

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL D  GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  263   ATVFDFTTKGILNAAVEGELWRLVDAQGKAPGVIGWWPAKAVTFVDNHDTGSTQAMWPFP  322

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWG KDEI  L++VR  N I+ TS + IL  D +
Sbjct  323   SDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRNGITPTSKLTILEHDGD  382

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KVI+KIGS+ DVG+LIP  F V   G DY VWE  A
Sbjct  383   AYVAEIDGKVIMKIGSRLDVGHLIPAGFEVAAHGNDYAVWENGA  426



>emb|CAN77038.1| hypothetical protein VITISV_004485 [Vitis vinifera]
Length=442

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/422 (66%), Positives = 328/422 (78%), Gaps = 5/422 (1%)
 Frame = +2

Query  50    LFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWL  229
             LFQ L        +      S  +  GFNWES+K QGGWYN LIN IP+L+ +GITHVWL
Sbjct  26    LFQVLHIILSHILSL-----SLPMCLGFNWESSKKQGGWYNFLINSIPELSASGITHVWL  80

Query  230   PPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKD  409
             PPPS S + +GY+PGRLYDL+AS YGT+ +L+AL+ A   NGI+ +ADIVINHR A+ KD
Sbjct  81    PPPSQSAASEGYLPGRLYDLNASHYGTQDELKALIKAFRSNGIQCIADIVINHRTAEKKD  140

Query  410   SRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKE  589
             SRGI+ IFEGGT DDRLDWGP  IC DDT FSDGTGN DTGA F  APDIDH+NPRVQ+E
Sbjct  141   SRGIWAIFEGGTPDDRLDWGPSFICSDDTLFSDGTGNPDTGAGFDPAPDIDHVNPRVQRE  200

Query  590   LSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDY  769
             LS+WMNWLK EIGF GWRFDF RGY+   +K+YMENTSP  AVGE+WN ++YG+D KP+Y
Sbjct  201   LSDWMNWLKIEIGFAGWRFDFARGYSPDFTKLYMENTSPNFAVGEIWNSLSYGNDSKPNY  260

Query  770   NQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNA  949
             NQD HR EL  WV+ AGGA TAFDFTTKGILQ AV GELWRLKD +G PPG++G+ P NA
Sbjct  261   NQDAHRRELVDWVKAAGGAVTAFDFTTKGILQAAVEGELWRLKDSNGGPPGMIGLMPENA  320

Query  950   VTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVR  1129
             VTF+DNHDTGSTQ  WPFP +KV+QGY YILTHPGIP +FYDHFFDWGLK+EI+KLI +R
Sbjct  321   VTFIDNHDTGSTQKIWPFPSEKVMQGYVYILTHPGIPSIFYDHFFDWGLKEEISKLIIIR  380

Query  1130  TSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
             T N I   S V IL  D + YVA ID+K+I KIG ++DVGNL+P  F +  SG +Y VWE
Sbjct  381   TRNGIKPNSGVRILASDPDLYVAAIDEKIIAKIGPRYDVGNLVPSTFKLATSGNNYAVWE  440

Query  1310  KK  1315
             K+
Sbjct  441   KQ  442



>ref|XP_008236505.1| PREDICTED: alpha-amylase-like [Prunus mume]
Length=419

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 334/418 (80%), Gaps = 8/418 (2%)
 Frame = +2

Query  68    YCFCLACAFVPAF-GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSH  244
             +   L    +P F  S +LFQGFNWES K +GGWYNSL   +P+LA++GITHVWLPPPS 
Sbjct  9     FYLLLCINLLPNFTASQILFQGFNWESWKKEGGWYNSLRKSVPELASSGITHVWLPPPSQ  68

Query  245   SVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIY  424
             + S +GY+PGRLYDL ASKYG++ +L++L++A H +GI+ VADIVINHR A+ +D RGI+
Sbjct  69    AASDEGYLPGRLYDLSASKYGSQDELKSLISAFHGSGIQAVADIVINHRTAEKQDERGIW  128

Query  425   CIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWM  604
             C+FEGGT D+RLDWGP LIC DDT++SDG GN DTGA +  APDIDH N RVQKELS+WM
Sbjct  129   CLFEGGTPDERLDWGPSLICSDDTKYSDGKGNPDTGAPYDAAPDIDHKNTRVQKELSDWM  188

Query  605   NWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNH  784
             NWLK+EIGF GWRFDFVRGY+  I+K+YM NTSP  AVGELWN +A+GS       +D H
Sbjct  189   NWLKTEIGFSGWRFDFVRGYSPEITKLYMTNTSPNFAVGELWNPLAFGS-------EDAH  241

Query  785   RNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVD  964
             R EL RWV+ AGG  TAFDFTTKGILQ AV GELWRLKDP+G+ PG++G+ P  +VTF+D
Sbjct  242   RQELVRWVEGAGGDVTAFDFTTKGILQQAVQGELWRLKDPNGRAPGMIGLLPGKSVTFID  301

Query  965   NHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEI  1144
             NHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLK+EITKLI++R+ N I
Sbjct  302   NHDTGSTQKIWPFPSDKVMQGYAYILTHPGIPSIFYDHFFDWGLKEEITKLIAIRSRNGI  361

Query  1145  SETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
                S++ IL  DA+ YVA ID+K+I KIGS++DVGNL+P  + +  SG+DY VWEKKA
Sbjct  362   QPNSALRILASDADLYVAAIDEKIIAKIGSRYDVGNLVPPTYQIATSGKDYAVWEKKA  419



>ref|XP_006660698.1| PREDICTED: alpha-amylase isozyme 3B-like isoform X1 [Oryza brachyantha]
Length=437

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/427 (63%), Positives = 334/427 (78%), Gaps = 4/427 (1%)
 Frame = +2

Query  35    QKMSTLFQFLSYC-FCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAG  211
             ++ + ++  L +  FCL+     A    VLFQGFNWES K QGGWYN L   + D+A  G
Sbjct  3     KRSAAVWSLLLFALFCLSSQLAHA---QVLFQGFNWESWKKQGGWYNFLHGRVDDIAATG  59

Query  212   ITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHR  391
             +THVWLPPPSHSV+PQGYMPGRLYDLDASKYGT+ +L++L+AA H  GIK VADIVINHR
Sbjct  60    VTHVWLPPPSHSVAPQGYMPGRLYDLDASKYGTEAELRSLIAAFHGRGIKCVADIVINHR  119

Query  392   CADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLN  571
             CADYKDSRGIYCIFEGGT D RLDWGP +IC DDT++S+G G+ DTGADFA APDIDHLN
Sbjct  120   CADYKDSRGIYCIFEGGTPDSRLDWGPDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLN  179

Query  572   PRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGS  751
              RVQ ELS+W+NWLK+++GFDGWR DF +GY+A+++K Y+++T P   V E+W++M Y  
Sbjct  180   TRVQSELSDWLNWLKNDLGFDGWRLDFAKGYSAAVAKTYVDSTDPSFVVAEIWSNMRYDG  239

Query  752   DGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVG  931
             +G+P +NQD  R EL  W Q  GG A+AFDFTTKG+LQ AV GELWR+KD +GK PG++G
Sbjct  240   NGEPSWNQDADRQELVNWAQTVGGPASAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIG  299

Query  932   ISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEIT  1111
               P  AVTF+DNHDTGSTQ+ WPFP DKV+QGYAYILTHPG+PC+FYDH FDW LK EI+
Sbjct  300   WLPEKAVTFIDNHDTGSTQNSWPFPSDKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEIS  359

Query  1112  KLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQ  1291
              L +VR+ N I   S + IL  D + YVA IDDKVI KIG+++DVGNLIP +F+VV  G 
Sbjct  360   TLAAVRSRNGIHPGSKLNILAADGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGS  419

Query  1292  DYVVWEK  1312
             +Y +WEK
Sbjct  420   NYCIWEK  426



>ref|XP_004973671.1| PREDICTED: alpha-amylase isozyme 3D-like [Setaria italica]
Length=432

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/401 (66%), Positives = 319/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYNSL   + D+A AG+THVWLPPPSHSVSPQGYMPGRLYDL
Sbjct  21    AQVLFQGFNWESCKKQGGWYNSLKAKVDDIAKAGVTHVWLPPPSHSVSPQGYMPGRLYDL  80

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  GI+ VADIVINHRCAD KD+RG+YCIFEGGT D+RLDWG
Sbjct  81    DASKYGTAAELKSLIAAFHRRGIQCVADIVINHRCADKKDARGVYCIFEGGTPDERLDWG  140

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             PG+IC DDT++SDGTG+ DTG  FA APDIDHLN RVQ+ELS W+NWLKS++GFDGWR D
Sbjct  141   PGMICSDDTQYSDGTGHRDTGEGFAAAPDIDHLNARVQRELSAWLNWLKSDVGFDGWRLD  200

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+ +I+K+Y++NT P   V E+WN ++Y  DGKP  NQD  R EL  WVQ  G  A
Sbjct  201   FAKGYSPAIAKMYVKNTRPSFVVAEIWNSLSYNGDGKPSPNQDQRRQELVNWVQAVGKPA  260

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ  V GELWRL+D  GK  GL+G +P  AVTF+DNHDTGSTQ  WPFP 
Sbjct  261   MAFDFTTKGLLQAGVQGELWRLRDSSGKAAGLIGWTPEKAVTFIDNHDTGSTQKLWPFPS  320

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EI+ L ++R  N I   S + IL  D +A
Sbjct  321   DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEISTLTAIRARNGIHAGSKLRILLADDDA  380

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D+KV+VKIG+++DVGN+IP +F+    G+DY VWEK
Sbjct  381   YVAVVDEKVMVKIGTRYDVGNVIPSDFHPAAHGKDYCVWEK  421



>ref|XP_009399983.1| PREDICTED: alpha-amylase isozyme 3C-like [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/415 (66%), Positives = 329/415 (79%), Gaps = 1/415 (0%)
 Frame = +2

Query  74    FCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
             F L    VP    S +LFQGFNWES + QGGWYN L + + D+ANAG+THVWLPPPSHSV
Sbjct  2     FLLLFLVVPNLAQSQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHSV  61

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
               QGYMPGRLYDL ASKYG + +L+AL+ A HD G+K VADIVINHRCAD +D RGI+CI
Sbjct  62    GVQGYMPGRLYDLGASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGIWCI  121

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT D RLDWGP +IC+DD ++SDGTGN DTG  FA APDIDHLN +VQ+EL++W+NW
Sbjct  122   FEGGTDDARLDWGPHMICRDDIQYSDGTGNLDTGEGFAAAPDIDHLNTQVQRELTDWLNW  181

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LK +IGFDGWR DF +GY++SI+KIY+E T P   V E+W+ +AYG+DGKP Y+Q+ +R 
Sbjct  182   LKIDIGFDGWRLDFAKGYSSSIAKIYVEQTQPNFVVAEIWSSLAYGNDGKPAYDQNGNRQ  241

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
              L  WVQ  GG ATAFDFTTKGILQVAV GELWR++DP GK PG++G  P  AVTFVDNH
Sbjct  242   GLVNWVQQVGGPATAFDFTTKGILQVAVEGELWRMRDPQGKAPGMMGWWPEKAVTFVDNH  301

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGYAYILTHPG+P +FYDH FDWGLK++IT+L   RT N I  
Sbjct  302   DTGSTQRSWPFPSDKVMQGYAYILTHPGVPSIFYDHMFDWGLKEKITRLAETRTRNGIHS  361

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              S++ IL  DA+ Y+A ID K++ K+GS++DVGNL+P NF+VV SG DY VWEK+
Sbjct  362   GSALNILASDADLYMAMIDGKILTKLGSRYDVGNLVPSNFHVVASGNDYCVWEKR  416



>gb|AEO09337.4| alpha-amylase [Musa acuminata AAA Group]
Length=416

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/402 (67%), Positives = 325/402 (81%), Gaps = 0/402 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S +LFQGFNWES + QGGWYN L + + D+ANAG+THVWLPPPSHSV  QGYMPGRLYDL
Sbjct  15    SQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHSVGVQGYMPGRLYDL  74

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
              ASKYG + +L+AL+ A HD G+K VADIVINHRCAD +D RGI+CIFEGGT D RLDWG
Sbjct  75    GASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGIWCIFEGGTDDARLDWG  134

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC+DDT++SDGTGN DTG  FA APDIDHLN +VQ+EL++W+NWLK++IGFDGWR D
Sbjct  135   PHMICRDDTQYSDGTGNLDTGEGFAAAPDIDHLNTQVQRELTDWLNWLKTDIGFDGWRLD  194

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY++SI+KIY+E T P   V E+W+ +AYG+DGKP Y+Q+ +R EL  WVQ  GG A
Sbjct  195   FAKGYSSSIAKIYVEQTQPNFVVAEIWSSLAYGNDGKPAYDQNGNRQELVNWVQQVGGPA  254

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             TAFDFTTKGILQ AV GELWR++D  GK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  255   TAFDFTTKGILQAAVEGELWRMRDSQGKAPGMMGWWPEKAVTFVDNHDTGSTQRLWPFPS  314

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+P +FYDH FDWGLK+ IT+L   RT N I   S++ IL  DA+ 
Sbjct  315   DKVMQGYAYILTHPGVPSIFYDHMFDWGLKEAITQLAETRTRNGIHSGSALNILASDADL  374

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             Y+A ID K++ K+GS++DVGNL+P NF+VV SG DY VWEK+
Sbjct  375   YMAMIDGKILTKLGSRYDVGNLVPSNFHVVASGNDYCVWEKR  416



>ref|XP_004965680.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=432

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/404 (66%), Positives = 319/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQ FNWES K  GGWYN L+  + D+A AG+THVWLPPP+HSVS QGYMPGRLYDLDA
Sbjct  22    VLFQAFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPAHSVSAQGYMPGRLYDLDA  81

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYGT  +L++L+AA H  G++ VADIVINHRCADYKDSRGIYC+FEGGT+D RLDWGP 
Sbjct  82    SKYGTAAELRSLIAAFHGKGVQAVADIVINHRCADYKDSRGIYCVFEGGTNDSRLDWGPH  141

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGTGN DTGA FA APDIDHLN RVQ+EL+EW+ WL+S++GFD WR DF 
Sbjct  142   MICRDDTQYSDGTGNLDTGASFAAAPDIDHLNDRVQRELAEWLLWLRSDLGFDAWRLDFA  201

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A +++ Y++ T+P  AV E+W+DMAYG DGKP+Y+QD HR  L  WV   GGAA+ 
Sbjct  202   KGYSAEVARAYIDATAPSFAVAEIWSDMAYGGDGKPEYDQDPHRQALVDWVDKVGGAASP  261

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  262   ATVFDFTTKGILNAAVEGELWRLIDPRGKAPGVIGWWPAKAVTFVDNHDTGSTQAVWPFP  321

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWG KDEI  L++VR  N I+ TS + IL  D +
Sbjct  322   SDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALMAVRKRNGITATSELTILVYDGD  381

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KVI+KIGS++DV   IP  + VV  G DY VWEK A
Sbjct  382   AYVAEIDGKVIMKIGSRYDVSAFIPAGYQVVAHGNDYAVWEKGA  425



>ref|XP_004973672.1| PREDICTED: alpha-amylase isozyme 3D-like [Setaria italica]
Length=432

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 326/418 (78%), Gaps = 4/418 (1%)
 Frame = +2

Query  62    LSYCFCLA-CAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
             L + F LA C+ V A    VLFQGFNWES K QG WYNSL   + D+A AG+THVWLPPP
Sbjct  7     LGFLFLLALCSLVQA---QVLFQGFNWESCKKQGSWYNSLNAQVDDIAKAGVTHVWLPPP  63

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             SHSVSPQGYMPGRLYDLDASKYGT  +L++L+AA H  GI+ VADIVINHRCAD KD+RG
Sbjct  64    SHSVSPQGYMPGRLYDLDASKYGTAVELKSLIAAFHRRGIQCVADIVINHRCADKKDARG  123

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
             +YCIFEGGT DDRLDWGPG+IC DDT++SDGTG+ DTG  FA APDIDHLN RVQ+EL +
Sbjct  124   VYCIFEGGTPDDRLDWGPGMICSDDTQYSDGTGHRDTGDGFAAAPDIDHLNARVQRELID  183

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             W+NWLKS++G+DGWR DF +GY+ +I+K+Y+EN+ P   V E+WN ++Y  DGKP  NQD
Sbjct  184   WLNWLKSDVGYDGWRLDFAKGYSPAITKMYVENSKPSFVVAEIWNSLSYNGDGKPSPNQD  243

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
               R EL  WVQ  G  A AFDFTTKG+LQ AV GELWRL+D  GK  GL+G +P  AVTF
Sbjct  244   QCRQELVDWVQAVGEPAMAFDFTTKGLLQAAVQGELWRLRDSSGKAAGLIGWTPEKAVTF  303

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKV+QGYAYILTHPG+PC+FYDH FD  LK EI+ L ++R  N
Sbjct  304   IDNHDTGSTQKMWPFPSDKVMQGYAYILTHPGVPCIFYDHMFDLNLKQEISTLAAIRARN  363

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              I   S + IL  DA+AYVA +D+KV+VKIG+++DVGN+IP +F     G+DY VWEK
Sbjct  364   GIHAGSKLRILLADADAYVAIVDEKVMVKIGTRYDVGNVIPSDFQPAAHGKDYCVWEK  421



>gb|ADC54359.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54360.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEMWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   SMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|XP_002460331.1| hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
 ref|XP_002460332.1| hypothetical protein SORBIDRAFT_02g026620 [Sorghum bicolor]
 gb|EER96852.1| hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
 gb|EER96853.1| hypothetical protein SORBIDRAFT_02g026620 [Sorghum bicolor]
Length=437

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/401 (67%), Positives = 320/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L   + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    SQVLFQGFNWESCKKQGGWYNYLRGQVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VAD+VINHRCADYKDSRGIYCIFEGGT D RLDWG
Sbjct  86    DASKYGTHAELKSLIAAFHAKGVQCVADVVINHRCADYKDSRGIYCIFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLNPRVQ+ELS W+NWLKS++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQEELSGWLNWLKSDLGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y++NT+P   V E+W+ + Y  +G+P  NQD  R EL  W Q  GG A
Sbjct  206   FAKGYSAAVAKVYVDNTAPTFVVAEIWSSLHYDGNGEPSNNQDADRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  266   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  326   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRNGIHPGSKLNILAADGDL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+ V  G +Y VWEK
Sbjct  386   YVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  426



>ref|XP_008373147.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=424

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/417 (66%), Positives = 334/417 (80%), Gaps = 3/417 (1%)
 Frame = +2

Query  71    CFCLACAFVPAF-GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
             CF L+    P F  S ++FQGFNWES++ +GGWYN L   + DLA++GITHVWLPP SH+
Sbjct  10    CFLLSILLTPNFTASQIIFQGFNWESSR-KGGWYNILKQSVQDLASSGITHVWLPPSSHA  68

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
              S +GYMPGRLYDL+ SK+G K +L++LV+A  ++GI+ VADIVINHR A+ +D RGI+C
Sbjct  69    ASDEGYMPGRLYDLN-SKFGNKDELKSLVSAYRNSGIQSVADIVINHRTAEKQDERGIWC  127

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGT DDRLDWGP LIC DDT++SDG GN DTG DF GAPDIDH N RVQKELS+WMN
Sbjct  128   IFEGGTDDDRLDWGPSLICGDDTKYSDGKGNPDTGEDFGGAPDIDHKNTRVQKELSDWMN  187

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHR  787
             WLK+EIGF GWRFDFV+GYA   +K+YM NTSP  AVGELWN ++YGSDGKP+ +QD HR
Sbjct  188   WLKTEIGFSGWRFDFVKGYAPEYTKLYMTNTSPNFAVGELWNSLSYGSDGKPNPDQDAHR  247

Query  788   NELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDN  967
               L  WV++AGG  TAFDFTTKGILQ AV GELWRLKD +G  PG++G+ P ++VTF+DN
Sbjct  248   QALVGWVESAGGGVTAFDFTTKGILQAAVQGELWRLKDSNGGAPGMIGLKPGSSVTFIDN  307

Query  968   HDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEIS  1147
             HDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLK EI+KL ++R+ N I 
Sbjct  308   HDTGSTQHLWPFPSDKVMQGYAYILTHPGIPSIFYDHFFDWGLKGEISKLTAIRSRNGIK  367

Query  1148  ETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
               S++ IL  DA+ YVA ID+K+IVKIG K D+G LIP NF V  SG+DY VWE+KA
Sbjct  368   PDSALRILAADADVYVASIDEKIIVKIGPKMDLGQLIPPNFQVSTSGKDYAVWERKA  424



>gb|AAO11776.1| alpha-amylase precursor [Musa acuminata]
Length=416

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/415 (65%), Positives = 328/415 (79%), Gaps = 1/415 (0%)
 Frame = +2

Query  74    FCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
             F L    +P    S +LFQGFNWES + QGGWYN L + + D+ANAG+THVWLPPPSHSV
Sbjct  2     FLLLFLVIPNLAQSQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHSV  61

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
               QGYMPGRLYDL ASKYG + +L+AL+ A HD G+K VADIVINHRCAD +D RGI+CI
Sbjct  62    GVQGYMPGRLYDLGASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGIWCI  121

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT D RLDWGP +IC+DDT++SDGTGN DTG  FA APDIDHLN +VQ+EL++W+NW
Sbjct  122   FEGGTDDARLDWGPHMICRDDTQYSDGTGNLDTGEGFAAAPDIDHLNTQVQRELTDWLNW  181

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LK++IGFDGWR DF  GY++SI+KIY+E T P   V E+WN +AYG+DGKP Y+Q+ +R 
Sbjct  182   LKTDIGFDGWRLDFAEGYSSSIAKIYVEQTQPNFVVAEIWNSLAYGNDGKPAYDQNGNRQ  241

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
              L  WVQ  GG ATAFDFTTKGILQ AV GELWR++DP GK PG++G  P  AVTFVDNH
Sbjct  242   GLVNWVQQVGGPATAFDFTTKGILQAAVEGELWRMRDPQGKAPGMMGWWPEKAVTFVDNH  301

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGYAYILTHPG+P +FYDH FDWGLK++IT+L   RT N I  
Sbjct  302   DTGSTQRLWPFPSDKVMQGYAYILTHPGVPSIFYDHMFDWGLKEKITRLAKTRTRNGIHS  361

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              S++ IL  DA+ Y+A ID K++ K+GS++DVGNL+P NF+V  SG DY VWEK+
Sbjct  362   GSALNILASDADLYMAMIDGKILTKLGSRYDVGNLVPSNFHVGSSGNDYCVWEKR  416



>gb|ADC54351.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSSEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|NP_001105539.1| alpha-amylase precursor [Zea mays]
 gb|AAA50161.1| alpha-amylase [Zea mays]
Length=439

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/401 (67%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L+  + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  28    SQVLFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  87

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L AA H  G+K VAD+VINHRCADYKD RGIYC+FEGGT D RLDWG
Sbjct  88    DASKYGTHAELKSLTAAFHAKGVKCVADVVINHRCADYKDGRGIYCVFEGGTPDSRLDWG  147

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADFA APDIDHLNPRVQ+ELS+W+NWLKS++GFDGWR D
Sbjct  148   PDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDGWRLD  207

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y+++T+P   V E+W+ + Y  +G+P  NQD  R EL  W Q  GG A
Sbjct  208   FAKGYSAAVAKVYVDSTAPTFVVAEIWSSLHYDGNGEPSSNQDADRQELVNWAQAVGGPA  267

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  268   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  327

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  328   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRNGIHPGSELNILAADGDL  387

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+ V  G +Y VWEK
Sbjct  388   YVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428



>gb|ADC54357.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEMWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54362.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 323/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|AAN01149.1| alpha-amylase precursor [Musa acuminata]
Length=416

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/402 (66%), Positives = 323/402 (80%), Gaps = 0/402 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S +LFQGFNWES + QGGWYN L + + D+ANAG+THVWLPPPSHSV  QGYMPGRLYDL
Sbjct  15    SQILFQGFNWESWRQQGGWYNFLKDKVSDIANAGVTHVWLPPPSHSVGVQGYMPGRLYDL  74

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
              ASKYG + +L+AL+ A HD G+K VADIVINHRCAD +D RGI+CIFEGGT D RLDWG
Sbjct  75    GASKYGNQDELKALIGAFHDKGVKCVADIVINHRCADKQDGRGIWCIFEGGTDDARLDWG  134

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC+DDT++SDGTGN DTG  FA APDIDHLN +VQ EL++W+NWLK++IGFDGWR D
Sbjct  135   PHMICRDDTQYSDGTGNLDTGEGFAAAPDIDHLNTQVQHELTDWLNWLKTDIGFDGWRLD  194

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY++SI+KIY+E T P   V E+W+ +AY +DGKP Y+Q+ +R  L  WVQ  GG  
Sbjct  195   FAKGYSSSIAKIYVEQTQPNFVVAEIWSSLAYRNDGKPTYDQNGNRQGLVNWVQQVGGPV  254

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             TAFDFTTKGILQ AV GELWR++DP GK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  255   TAFDFTTKGILQAAVEGELWRMRDPQGKAPGMMGWWPEKAVTFVDNHDTGSTQKLWPFPS  314

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+P +FYDH FDWGLK++IT+L   RT N I   SS+ IL  DA+ 
Sbjct  315   DKVMQGYAYILTHPGVPSIFYDHMFDWGLKEKITRLAKTRTRNRIHSGSSLNILASDADL  374

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             Y+A ID K++ K+GS++DVGNL+P NF+VV SG DY VWEK+
Sbjct  375   YMAMIDGKILTKLGSRYDVGNLVPSNFHVVASGNDYCVWEKR  416



>gb|ADC54353.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54354.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54355.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|XP_010274277.1| PREDICTED: pentatricopeptide repeat-containing protein At2g04860 
[Nelumbo nucifera]
Length=1179

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/415 (66%), Positives = 333/415 (80%), Gaps = 1/415 (0%)
 Frame = +2

Query  74    FCLACAFVP-AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
              CL  + +P +  + ++FQGFNWES K +GGWYNSL N IP+LANAG+THVWLPPPSHSV
Sbjct  10    LCLIVSLLPTSIFAQLVFQGFNWESWKKEGGWYNSLRNSIPELANAGVTHVWLPPPSHSV  69

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
             S +GY+PGRLYDLD+S+YG K +L+ L+ A H  GI+ +ADIVINHRCA+ +D+RGI+CI
Sbjct  70    SSEGYLPGRLYDLDSSRYGNKDELRTLINAFHKVGIQCIADIVINHRCAEKQDARGIWCI  129

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT DDRLDWGP  IC DD ++SDGTGN DTGA +  APDIDH NPRVQ+ELS+WMNW
Sbjct  130   FEGGTPDDRLDWGPSFICSDDKQYSDGTGNPDTGAGYDIAPDIDHANPRVQRELSDWMNW  189

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LKSEIGF+GWRFDF +GYA  I+KIYME T P  AV E+WN ++YG DGKP+YNQD HR 
Sbjct  190   LKSEIGFNGWRFDFAKGYAPYITKIYMEQTHPNFAVMEIWNSLSYGQDGKPEYNQDKHRY  249

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
             E+  WVQ AGGA  AFDFTTKGILQ AV GELWR+KD  G  PG++G+ P NAVTFVDNH
Sbjct  250   EMVEWVQAAGGAVKAFDFTTKGILQAAVQGELWRMKDSKGGAPGMIGVLPENAVTFVDNH  309

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGY YILTHPGIP +FYDHFF+WGLK+EI KL+++RT N I  
Sbjct  310   DTGSTQHLWPFPADKVMQGYVYILTHPGIPSIFYDHFFNWGLKEEIVKLVAIRTRNGIRP  369

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              S++ I+  + + Y+A ID+K+I KIGS++DVGNL+P  F +  SG DY VWEKK
Sbjct  370   NSTLRIIAFNPDLYLAAIDEKIIAKIGSRYDVGNLVPPTFQIATSGNDYCVWEKK  424



>gb|ADH43281.1| alpha amylase [Zea mays]
Length=439

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L+  + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  28    SQVLFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  87

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L AA H  G++ VAD+VINHRCADYKD RGIYC+FEGGT D RLDWG
Sbjct  88    DASKYGTHAELKSLTAAFHAKGVQCVADVVINHRCADYKDGRGIYCVFEGGTPDSRLDWG  147

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADFA APDIDHLNPRVQ+ELS+W+NWLKS++GFDGWR D
Sbjct  148   PDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDGWRLD  207

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y+++T+P   V E+W+ + Y  +G+P  NQD  R EL  W Q  GG A
Sbjct  208   FAKGYSAAVAKVYVDSTAPTFVVAEIWSSLHYDGNGEPSSNQDADRQELVNWAQAVGGPA  267

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  268   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  327

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  328   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRNGIHPGSELNILAADGDL  387

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+ V  G +Y VWEK
Sbjct  388   YVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428



>gb|ACF88424.1| unknown [Zea mays]
 tpg|DAA40237.1| TPA: alpha amylase3 [Zea mays]
Length=439

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L+  + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  28    SQVLFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  87

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L AA H  G++ VAD+VINHRCADYKD RGIYC+FEGGT D RLDWG
Sbjct  88    DASKYGTHAELKSLTAAFHAKGVQCVADVVINHRCADYKDGRGIYCVFEGGTPDSRLDWG  147

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADFA APDIDHLNPRVQ+ELS+W+NWLKS++GFDGWR D
Sbjct  148   PDMICSDDTQYSNGRGHRDTGADFAAAPDIDHLNPRVQQELSDWLNWLKSDLGFDGWRLD  207

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y+++T+P   V E+W+ + Y  +G+P  NQD  R EL  W Q  GG A
Sbjct  208   FAKGYSAAVAKVYVDSTAPTFVVAEIWSSLHYDGNGEPSSNQDADRQELVNWAQAVGGPA  267

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  268   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  327

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  328   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISALSAVRSRNGIHPGSELNILAADGDL  387

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+ V  G +Y VWEK
Sbjct  388   YVAKIDDKVIVKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428



>gb|ADC54365.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEKTA  406



>pdb|3BSG|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
Length=414

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/402 (66%), Positives = 322/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F    +G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAAGNDYAVWEK  404



>gb|ADC54358.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT + DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTASLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54282.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWRPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|NP_001175871.1| Os09g0457500 [Oryza sativa Japonica Group]
 sp|P27937.1|AMY3B_ORYSJ RecName: Full=Alpha-amylase isozyme 3B; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAA39777.1| alpha-amylase [Oryza sativa Japonica Group]
 gb|AAA33897.1| alpha-amylase precursor (EC 3.2.1.1) [Oryza sativa]
 dbj|BAD38368.1| Alpha-amylase isozyme 3B precursor (1,4-alpha-D-glucan glucanohydrolase) 
[Oryza sativa Japonica Group]
 gb|EAZ09375.1| hypothetical protein OsI_31648 [Oryza sativa Indica Group]
 gb|EAZ44988.1| hypothetical protein OsJ_29630 [Oryza sativa Japonica Group]
 dbj|BAH94599.1| Os09g0457500 [Oryza sativa Japonica Group]
Length=438

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 322/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A  G+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    AQVLFQGFNWESWKKQGGWYNFLHGHVDDIAATGVTHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  GIK VADIVINHRCADYKDSRGIYCIFEGGT D RLDWG
Sbjct  86    DASKYGTGAELRSLIAAFHSKGIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLN RVQ ELS+W+NWLKS++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K Y++NT P   V E+W++M Y  +G+P +NQD  R EL  W Q  GG A
Sbjct  206   FAKGYSAAVAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             +AFDFTTKG LQ AV GELWR+KD +GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP 
Sbjct  266   SAFDFTTKGELQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EI+ L +VR+ NEI   S ++IL  + + 
Sbjct  326   DKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRNEIHPGSKLKILAAEGDV  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA IDDKVI KIG+++DVGNLIP +F+VV  G +Y +WEK
Sbjct  386   YVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCIWEK  426



>gb|ADC54339.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A  G+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|XP_004957016.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/401 (66%), Positives = 322/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L   + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    SQVLFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  GI+ VADIVINHRCADYKDSRGIYC+FEGGT D RLDWG
Sbjct  86    DASKYGTHAELKSLIAAFHAKGIQCVADIVINHRCADYKDSRGIYCVFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLNPRVQ+EL++W+NWLK+++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQQELADWLNWLKTDLGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y++NT+P   V E+W+ + Y  +G+P   QD  R EL  W Q  GG A
Sbjct  206   FAKGYSAAVAKVYVDNTAPTFVVAEIWSSLQYDGNGEPSSIQDKDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  266   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S ++IL  D + 
Sbjct  326   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISTLSTVRSRNGIHAGSKLDILAADGDL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+++  G +Y VWEK
Sbjct  386   YVAKIDDKVIVKIGSRYDVGNLIPSDFHLIAHGNNYCVWEK  426



>ref|XP_004957017.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L   + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    SQVLFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  GI+ VADIVINHRCADYKDSRGIYC+FEGGT D RLDWG
Sbjct  86    DASKYGTHAELKSLIAAFHAKGIQCVADIVINHRCADYKDSRGIYCVFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLNPRVQ+ELS+W+NWLK+++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQQELSDWLNWLKTDLGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y++NT+P   V E+W+ + Y  +G+P   QD  R EL  W Q  GG A
Sbjct  206   FAKGYSAAVAKVYVDNTAPTFVVAEIWSSLQYDGNGEPSSIQDKDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  266   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S ++IL  D + 
Sbjct  326   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISTLSTVRSRNGIHAGSKLDILAADGDL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+ +  G +Y VWEK
Sbjct  386   YVAKIDDKVIVKIGSRYDVGNLIPSDFHPIAHGNNYCVWEK  426



>gb|ADC54352.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FY HFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYGHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|EAZ09376.1| hypothetical protein OsI_31649 [Oryza sativa Indica Group]
Length=437

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L + + D+A  G+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    AQVLFQGFNWESWKKQGGWYNFLHSHVDDIAATGVTHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H   IK VADIVINHRCADYKDSRGIYCIFEGGT D RLDWG
Sbjct  86    DASKYGTGAELRSLIAAFHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLN RVQ+ELS+W+NWLKS++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQRELSDWLNWLKSDVGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K Y++NT P   V E+W++M Y  +G+P +NQD  R EL  W Q  GG A
Sbjct  206   FAKGYSATVAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             +AFDFTTKG LQ AV GELWR+KD +GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP 
Sbjct  266   SAFDFTTKGELQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  326   DKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRNGIHPGSKLNILAADGDV  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA IDDKVI KIG+++DVGNLIP +F+VV  G +Y VWEK
Sbjct  386   YVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEK  426



>gb|ADC54330.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54331.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 323/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L++ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLISALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNTAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54367.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+ G KDEI  L+++R  N I+ TS+++IL  D +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMHDGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             +YVA+ID KV+VKIGS++DVG +IP  F     G+DY VWEK A
Sbjct  363   SYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEKIA  406



>gb|ADC54286.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54287.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54288.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54289.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54290.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54291.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54292.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54293.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54294.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54295.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54299.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54300.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54302.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54303.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54304.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54305.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54311.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54312.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54315.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54317.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54325.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54335.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54283.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNNRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>pdb|1HT6|A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- 
Amylase Isozyme 1
 pdb|1P6W|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 
(Amy1) In Complex With The Substrate Analogue, Methyl 4i,4ii,4iii- 
Tri-Thiomaltotetraoside (Thio-Dp4)
 pdb|1RPK|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 
(Amy1) In Complex With Acarbose
Length=405

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/402 (66%), Positives = 321/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54277.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54279.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54280.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>emb|CAX51372.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
 dbj|BAK07660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/402 (66%), Positives = 321/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  27    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  86

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  87    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  146

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  147   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  206

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  207   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  266

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  267   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  326

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  327   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  386

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  387   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  428



>ref|XP_004957015.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/401 (66%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VLFQGFNWES K QGGWYN L   + D+A  G THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    SQVLFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  GI+ VADIVINHRCADYKDSRGIYC+FEGGT D RLDWG
Sbjct  86    DASKYGTHAELKSLIAAFHAKGIQCVADIVINHRCADYKDSRGIYCVFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLNPRVQ+EL++W+NWLK+++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNPRVQQELADWLNWLKTDLGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K+Y++NT+P   V E+W+ + Y  +G+P   QD  R EL  W Q  GG A
Sbjct  206   FAKGYSAAVAKVYVDNTAPTFVVAEIWSSLQYDGNGEPSSIQDKDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
              AFDFTTKG+LQ AV GELWR+KD +GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP 
Sbjct  266   AAFDFTTKGVLQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDH FDW LK EI+ L +VR+ N I   S ++IL  D + 
Sbjct  326   DKVMQGYAYILTHPGTPCIFYDHVFDWNLKQEISTLSTVRSRNGIHAGSKLDILAADGDL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVAKIDDKVIVKIGS++DVGNLIP +F+ +  G +Y VWEK
Sbjct  386   YVAKIDDKVIVKIGSRYDVGNLIPSDFHPIAHGNNYCVWEK  426



>gb|AAA98615.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/432 (63%), Positives = 329/432 (76%), Gaps = 8/432 (2%)
 Frame = +2

Query  23    INNPQKMSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLA  202
             + N     +LF  L     L+C+        VLFQGFNWES KH GGWYN L+  + D+A
Sbjct  1     MANKHMSLSLFIVL---LGLSCSLASG---QVLFQGFNWESWKHNGGWYNFLMGKVDDIA  54

Query  203   NAGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVI  382
              AG+THVWLPP S SV+ QGYMPGRLYDLDASKYG K QL++L+ ALH  G+K +ADIVI
Sbjct  55    AAGVTHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVI  114

Query  383   NHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDID  562
             NHR A+ KD RGIYCIFEGGT D RLDWGP +IC+DD  ++DGTGN DTGADF  APDID
Sbjct  115   NHRTAERKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDID  174

Query  563   HLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMA  742
             HLNPRVQKEL EW+NWL++++GFDGWRFDF +GY+A ++KIY++ + P  AV E+W  +A
Sbjct  175   HLNPRVQKELVEWLNWLRTDVGFDGWRFDFAKGYSADVAKIYVDRSEPSFAVAEIWTSLA  234

Query  743   YGSDGKPDYNQDNHRNELSRWVQNagga--atafdfttKGILQVAVLGELWRLKDPDGKP  916
             YG DGKP+ NQD HR EL  WV   GG+  AT FDFTTKGIL VAV GELWRL+  DGK 
Sbjct  235   YGGDGKPNLNQDPHRQELVNWVNKVGGSGPATTFDFTTKGILNVAVEGELWRLRGTDGKA  294

Query  917   PGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGL  1096
             PG++G  P  AVTFVDNHDTGSTQ  WPFP D+V+QGYAYILTHPG PC+FYDHFFDWGL
Sbjct  295   PGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGL  354

Query  1097  KDEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNV  1276
             K+EI +L+S+RT   I   S ++I+  DA+ Y+A+ID KVIVK+G ++DVG+LIP  F V
Sbjct  355   KEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVIVKLGPRYDVGHLIPEGFKV  414

Query  1277  VVSGQDYVVWEK  1312
             V  G DY VWEK
Sbjct  415   VAHGNDYAVWEK  426



>gb|ADC54344.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 322/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY++ ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSSEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54281.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAVWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|NP_001063369.1| Os09g0457800 [Oryza sativa Japonica Group]
 sp|P27939.2|AMY3C_ORYSJ RecName: Full=Alpha-amylase isozyme 3C; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD38369.1| Alpha-amylase isozyme 3C precursor (1,4-alpha-D-glucan glucanohydrolase) 
[Oryza sativa Japonica Group]
 dbj|BAF25283.1| Os09g0457800 [Oryza sativa Japonica Group]
 gb|EAZ44990.1| hypothetical protein OsJ_29632 [Oryza sativa Japonica Group]
Length=437

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 320/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L + + D+A  G+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    AQVLFQGFNWESWKKQGGWYNFLHSHVDDIAATGVTHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H   IK VADIVINHRCADYKDSRGIYCIFEGGT D RLDWG
Sbjct  86    DASKYGTGAELRSLIAAFHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLN RVQ ELS+W+NWLKS++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K Y++NT P   V E+W++M Y  +G+P +NQD  R EL  W Q  GG A
Sbjct  206   FAKGYSATVAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             +AFDFTTKG LQ AV GELWR+KD +GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP 
Sbjct  266   SAFDFTTKGELQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  326   DKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRNGIHPGSKLNILAADGDV  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA IDDKVI KIG+++DVGNLIP +F+VV  G +Y VWEK
Sbjct  386   YVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEK  426



>emb|CAA72144.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  26    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ + DIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  86    SKYGNAAELKSLIGALHGKGVQAITDIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  146   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  206   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  266   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS++EIL  + +
Sbjct  326   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALEILMHEGD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  386   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  429



>gb|ADC54307.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES +  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWQQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>pdb|2QPS|A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarbose
Length=405

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/402 (66%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS+ DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54316.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             V+FQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VIFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54356.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVIN RCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINLRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54349.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/404 (66%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+ G KDEI  L+++R  N I+ TS+++IL  D +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMHDGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIGS++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEKIA  406



>gb|AAA33894.1| alpha-amylase [Oryza sativa Japonica Group]
Length=443

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/411 (65%), Positives = 324/411 (79%), Gaps = 5/411 (1%)
 Frame = +2

Query  101   AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRL  280
             A G  +LFQGFNWES +  GGWYN L+  + D+  AG+THVWLPPPSHSVS QGYMPGRL
Sbjct  19    ASGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQGYMPGRL  78

Query  281   YDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRL  460
             YDLDAS+YGT  +L++L++ALH  GI+ +AD+VINHRCADYKDSRGIYCIFEGGT D RL
Sbjct  79    YDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGRL  138

Query  461   DWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKS-EIGFDG  637
             DWGP +IC+DDT+FSDGTGN DTGADFA APDIDHLN  VQ+EL++W+ WLKS E+GFD 
Sbjct  139   DWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFDA  198

Query  638   WRFDFVRGYAASISKIYMENTSP-ELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQN  814
             WR DF RGY+  ++K+Y+E T+P  LAV ELW+ MAYG DGKP+YNQD HR  L  WV  
Sbjct  199   WRLDFARGYSPEVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALVDWVDR  258

Query  815   aggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
              GG A+A      TTKGI+  AV GELWRL D  GK PG++G  P  AVTFVDNHDTGST
Sbjct  259   VGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIGWWPAKAVTFVDNHDTGST  318

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q  WPFP DKV+QGYAYILTHPG PC+FYDHFFDWGLK++I  L++VR  N ++ TSS++
Sbjct  319   QQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVAVRQRNGVTATSSLK  378

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             I+  DA+AYVA+ID KV++KIGS++DV +LIP  F++   G  Y VWEK A
Sbjct  379   IMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAVWEKSA  429



>gb|ADC54296.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54297.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54298.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+V+IG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVEIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>emb|CAX51374.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
 dbj|BAK03603.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/401 (68%), Positives = 318/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AGITHVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A++KD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLN RVQKEL EW+NWLK++IGFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG   A
Sbjct  206   KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+SVRT + I   S ++I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVGNLIP  F V   G DY VWEK
Sbjct  386   YLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  426



>gb|ADC54332.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 323/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L++ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLISALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGST++ WPFP
Sbjct  243   GMVFDFTTKGILNTAVEGELWRLIDPQGKAPGVMGWWPTKAVTFVDNHDTGSTRAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54320.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES +  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWQQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANPDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILDAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54308.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54309.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54310.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES +  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWQQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVDWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AVA|B Chain B, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AMY|A Chain A, Crystal And Molecular Structure Of Barley Alpha-Amylase
 pdb|1BG9|A Chain A, Barley Alpha-Amylase With Substrate Analogue Acarbose
Length=403

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/401 (68%), Positives = 318/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AGITHVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  2     VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA  61

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A++KD RGIYCIFEGGT D RLDWGP 
Sbjct  62    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPH  121

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLN RVQKEL EW+NWLK++IGFDGWRFDF 
Sbjct  122   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFA  181

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG   A
Sbjct  182   KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPA  241

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  242   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  301

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+SVRT + I   S ++I+  DA+ 
Sbjct  302   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADL  361

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVGNLIP  F V   G DY VWEK
Sbjct  362   YLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  402



>sp|P04063.3|AMY2_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=AMY2-2; AltName: 
Full=High pI alpha-amylase; Flags: Precursor [Hordeum vulgare]
 gb|AAA98790.1| alpha-amylase type B isozyme precursor [Hordeum vulgare subsp. 
vulgare]
Length=427

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/401 (68%), Positives = 318/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AGITHVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A++KD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLN RVQKEL EW+NWLK++IGFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG   A
Sbjct  206   KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+SVRT + I   S ++I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVGNLIP  F V   G DY VWEK
Sbjct  386   YLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  426



>gb|ADC54366.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHS S +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSASNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54338.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR     WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNPVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>sp|P00693.1|AMY1_HORVU RecName: Full=Alpha-amylase type A isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=AMY1; AltName: 
Full=Low pI alpha-amylase; Flags: Precursor [Hordeum vulgare]
 gb|AAA32929.1| alpha-amylase type A, EC 3.2.1.1 [Hordeum vulgare]
Length=438

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/402 (66%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  27    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  86

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  87    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  146

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  147   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  206

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  207   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  266

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  A TFVDNHDTGSTQ+ WPFP
Sbjct  267   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGSTQAMWPFP  326

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  327   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  386

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  387   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  428



>gb|ADC54301.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT + DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTADLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54306.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++ L  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKTLMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54313.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WP P
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPLP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54340.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54341.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54342.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54343.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
 gb|ADC54345.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 321/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54337.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A  G+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54323.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A  G+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54327.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             S+YG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SEYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+D+T+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDETKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54285.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 322/404 (80%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++++Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMARVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG +DEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFEDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>pdb|2QPU|A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
 pdb|2QPU|B Chain B, Sugar Tongs Mutant S378p In Complex With Acarbose
 pdb|2QPU|C Chain C, Sugar Tongs Mutant S378p In Complex With Acarbose
Length=405

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/402 (66%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIG ++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGPRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54324.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICVDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPDGFATSAHGKDYAVWEKTA  406



>pdb|1RP8|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 
(Amy1) Inactive Mutant D180a In Complex With Maltoheptaose
 pdb|1RP9|A Chain A, Crystal Structure Of Barley Alpha-amylase Isozyme 1 
(amy1) Inactive Mutant D180a In Complex With Acarbose
Length=405

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/402 (66%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR  F 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLAFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54276.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYD FF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDRFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54363.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 319/402 (79%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A  G+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  A TFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54321.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+ HVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVAHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  A TFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54361.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+T VWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTRVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRPDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y + TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYTDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54326.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+ L EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRGLKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54319.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
              IC+DDT+++DGT N D GADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   TICRDDTKYADGTANLDAGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54314.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDW P 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWCPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54284.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEG TSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGSTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAGIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>pdb|3BSH|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant 
Y105aY380A IN COMPLEX WITH INHIBITOR ACARBOSE
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/402 (66%), Positives = 319/402 (79%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGI CIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS+ DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54334.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  I D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKIDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGG SD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGASDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLK ++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKGDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GVVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54364.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 319/402 (79%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N D GADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDAGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVT VDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTLVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54322.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADY D+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYTDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHL+ RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLDDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54350.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVT V+NHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTSVNNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L++ R  N I+ TS++++L  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVATRKRNGITATSALKVLMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>emb|CAA72143.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/407 (65%), Positives = 322/407 (79%), Gaps = 3/407 (1%)
 Frame = +2

Query  107   GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYD  286
             G  VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV+ +GYMPGRLYD
Sbjct  23    GHQVLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAAEGYMPGRLYD  82

Query  287   LDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDW  466
             +DASKYG   +L++L+ ALH NG++ +ADIVINHRCADYKDSRGIYCI+EGGTSD RLDW
Sbjct  83    IDASKYGNAAELKSLIGALHGNGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDW  142

Query  467   GPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRF  646
             GP +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR 
Sbjct  143   GPHMICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRL  202

Query  647   DFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga  826
             DF RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGA
Sbjct  203   DFARGYSAEMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGA  262

Query  827   atafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHW  997
             A+A      TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ W
Sbjct  263   ASAGMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKW  322

Query  998   PFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGV  1177
             PFP DK++QGYAYILTH GIPC+FYDHFF+ G KDEI  L+++R  N I+ TS+++IL  
Sbjct  323   PFPSDKIMQGYAYILTHSGIPCIFYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMH  382

Query  1178  DANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             D +AYVA+ID KV+VKIGS++DVG +IP  F     G+DY VWEK A
Sbjct  383   DGDAYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEKIA  429



>gb|AAA32927.1| alpha-amylase 2 [Hordeum vulgare]
Length=438

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 319/402 (79%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A  G+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  27    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAVGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  86

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  87    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH  146

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  147   MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  206

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  207   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  266

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  A TFVDNHDTGSTQ+ WPFP
Sbjct  267   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAATFVDNHDTGSTQAMWPFP  326

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  327   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  386

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  387   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  428



>gb|ADC54318.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
              GY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   GGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPRGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54371.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV+ +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAAEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYC +EGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCTYEGGTSDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSAEMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKIMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54347.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/402 (65%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT ++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTRYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   KGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54348.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/402 (65%), Positives = 321/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L++ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLISALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNTAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>gb|ADC54346.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/402 (65%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N  + TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGTTATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>ref|XP_004966428.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
 ref|XP_004966429.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=436

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/403 (67%), Positives = 317/403 (79%), Gaps = 4/403 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES+K  GGWYN+L+  + D+A AG+THVWLPPPSHSVS +GYMPGRLYDLDA
Sbjct  25    VLFQGFNWESSKQTGGWYNNLMGKVDDIAAAGVTHVWLPPPSHSVSSEGYMPGRLYDLDA  84

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYGT  +L++L+AA HD G++ VADIVINHRCADYKDSRGIYCIFEGGT D RLDW   
Sbjct  85    SKYGTAAELKSLIAAFHDKGVQAVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWRAH  144

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD ++SDGTGN DTGADF GAPDIDHLN RVQ+EL+EWM WLKS++GFD WR DF 
Sbjct  145   MICRDDAKYSDGTGNLDTGADFPGAPDIDHLNDRVQRELTEWMLWLKSDLGFDAWRLDFA  204

Query  656   RGYAASISKIYMENTSPELAVGELWNDMA-YGSDGKPDYNQDNHRNELSRWVQNaggaat  832
             RGY+A ++++Y+  T+P   V E+W+ M   G DGKP Y+QD HR  L  WV   GGAA+
Sbjct  205   RGYSAEVARVYINGTAPSFVVAEIWDKMVPAGDDGKPAYDQDPHRQALVDWVDKVGGAAS  264

Query  833   afdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPF  1003
                    TTKGIL  AV GELWRL D +GK PG++G  P  AVTFVDNHDTGSTQ+ WPF
Sbjct  265   PATVFDFTTKGILNAAVEGELWRLIDTEGKAPGVIGWWPAKAVTFVDNHDTGSTQAQWPF  324

Query  1004  PKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDA  1183
             P DKV+QGYAYILTHPG PC+FYDHFFDWG KDEI  L++VR  N I+ TS + IL  D 
Sbjct  325   PHDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDG  384

Query  1184  NAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             +AYVA+ID KVIVKIGS++D+G+LIP  F V   G+DY VWEK
Sbjct  385   DAYVAEIDGKVIVKIGSRYDLGHLIPVGFEVATHGKDYAVWEK  427



>ref|NP_001058568.1| Os06g0713800 [Oryza sativa Japonica Group]
 sp|Q0D9J1.1|AMY2A_ORYSJ RecName: Full=Alpha-amylase isozyme 2A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 
C2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD54103.1| alpha-amylase isozyme 2A precursor [Oryza sativa Japonica Group]
 dbj|BAF20482.1| Os06g0713800 [Oryza sativa Japonica Group]
 dbj|BAG94883.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87072.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66350.1| hypothetical protein OsJ_22644 [Oryza sativa Japonica Group]
Length=445

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/409 (66%), Positives = 323/409 (79%), Gaps = 5/409 (1%)
 Frame = +2

Query  101   AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRL  280
             A G  +LFQGFNWES +  GGWYN L+  + D+  AG+THVWLPPPSHSVS QGYMPGRL
Sbjct  19    ASGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQGYMPGRL  78

Query  281   YDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRL  460
             YDLDAS+YGT  +L++L++ALH  GI+ +AD+VINHRCADYKDSRGIYCIFEGGT D RL
Sbjct  79    YDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGRL  138

Query  461   DWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKS-EIGFDG  637
             DWGP +IC+DDT+FSDGTGN DTGADFA APDIDHLN  VQ+EL++W+ WLKS E+GFD 
Sbjct  139   DWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFDA  198

Query  638   WRFDFVRGYAASISKIYMENTSP-ELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQN  814
             WR DF RGY+  ++K+Y+E T+P  LAV ELW+ MAYG DGKP+YNQD HR  L  WV  
Sbjct  199   WRLDFARGYSPEVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALVDWVDR  258

Query  815   aggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
              GG A+A      TTKGI+  AV GELWRL D  GK PG++G  P  AVTFVDNHDTGST
Sbjct  259   VGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIGWWPAKAVTFVDNHDTGST  318

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q  WPFP DKV+QGYAYILTHPG PC+FYDHFFDWGLK++I  L++VR  N ++ TSS++
Sbjct  319   QQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVAVRQRNGVTATSSLK  378

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             I+  DA+AYVA+ID KV++KIGS++DV +LIP  F++   G  Y VWEK
Sbjct  379   IMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAVWEK  427



>sp|A2YGY2.1|AMY2A_ORYSI RecName: Full=Alpha-amylase isozyme 2A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 
C2; Flags: Precursor [Oryza sativa Indica Group]
 gb|EAZ02343.1| hypothetical protein OsI_24446 [Oryza sativa Indica Group]
Length=446

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/409 (66%), Positives = 323/409 (79%), Gaps = 5/409 (1%)
 Frame = +2

Query  101   AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRL  280
             A G  +LFQGFNWES +  GGWYN L+  + D+  AG+THVWLPPPSHSVS QGYMPGRL
Sbjct  19    ASGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQGYMPGRL  78

Query  281   YDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRL  460
             YDLDAS+YGT  +L++L++ALH  GI+ +AD+VINHRCADYKDSRGIYCIFEGGT D RL
Sbjct  79    YDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGRL  138

Query  461   DWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKS-EIGFDG  637
             DWGP +IC+DDT+FSDGTGN DTGADFA APDIDHLN  VQ+EL++W+ WLKS E+GFD 
Sbjct  139   DWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFDA  198

Query  638   WRFDFVRGYAASISKIYMENTSP-ELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQN  814
             WR DF RGY+  ++K+Y+E T+P  LAV ELW+ MAYG DGKP+YNQD HR  L  WV  
Sbjct  199   WRLDFARGYSPEVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALVDWVDR  258

Query  815   aggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
              GG A+A      TTKGI+  AV GELWRL D  GK PG++G  P  AVTFVDNHDTGST
Sbjct  259   VGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIGWWPAKAVTFVDNHDTGST  318

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q  WPFP DKV+QGYAYILTHPG PC+FYDHFFDWGLK++I  L++VR  N ++ TSS++
Sbjct  319   QQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVAVRQRNGVTATSSLK  378

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             I+  DA+AYVA+ID KV++KIGS++DV +LIP  F++   G  Y VWEK
Sbjct  379   IMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAVWEK  427



>gb|ADC54328.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG    L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAALKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV  ELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVESELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+I+ KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEINGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54278.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+  PFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMLPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54329.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K   GWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSSGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAMADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHD GSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDAGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>ref|XP_006659494.1| PREDICTED: alpha-amylase isozyme 3D-like [Oryza brachyantha]
Length=439

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/399 (65%), Positives = 316/399 (79%), Gaps = 0/399 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K QGGWYN+L   + D+ANAG+THVWLPPPSHSVSPQGYMPGRLYDLDA
Sbjct  30    VLFQGFNWESWKQQGGWYNTLKGQVDDIANAGVTHVWLPPPSHSVSPQGYMPGRLYDLDA  89

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             S+YGT  +L++L+AA    GI+ VAD+VINHRCA+ KD+RG+YC+FEGGT DDRLDWGP 
Sbjct  90    SRYGTAAELRSLIAAFRGRGIQCVADVVINHRCAEKKDARGVYCVFEGGTPDDRLDWGPS  149

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC DDTE+SDGTG+ DTG  FA APD+DHLNPRVQ+EL++W++WLKS++GFDGWR DF 
Sbjct  150   MICSDDTEYSDGTGHRDTGEGFAAAPDVDHLNPRVQRELTDWLDWLKSDVGFDGWRLDFA  209

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+ +I+K Y+EN  P   V E+WN ++Y  DGKP  NQD  R EL  WV   GG A  
Sbjct  210   KGYSTAITKTYVENCKPSFVVAEIWNSLSYNGDGKPSTNQDQGRQELVNWVNAVGGPAMT  269

Query  836   fdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDK  1015
             FDFTTKG+LQ  V GELWRL+D +GK  G++G  P  AVTFVDNHDTGSTQ  WPFP DK
Sbjct  270   FDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGSTQKLWPFPADK  329

Query  1016  VIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYV  1195
             V+QGYAYILTHPG+PC+FYDH FDW LK EI  L ++R  N I   S + IL  DA+AYV
Sbjct  330   VMQGYAYILTHPGVPCIFYDHMFDWNLKQEIIALATIRERNGIHAGSKLRILVADADAYV  389

Query  1196  AKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             A +D+KV+VKIG ++DVGN++P +F+  V G+DY VWEK
Sbjct  390   AVVDEKVMVKIGPRYDVGNVVPSDFHPTVHGKDYCVWEK  428



>gb|ADC54373.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/402 (65%), Positives = 320/402 (80%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCI+EGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSAEMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++QGYAYILTHPGIPC+FYDHFF+WG KD+I  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKIMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  404



>sp|P27933.2|AMY3D_ORYSJ RecName: Full=Alpha-amylase isozyme 3D; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD09375.1| alpha-amylase isozyme 3D precursor [Oryza sativa Japonica Group]
 dbj|BAD09335.1| alpha-amylase isozyme 3D precursor [Oryza sativa Japonica Group]
 gb|EAZ43060.1| hypothetical protein OsJ_27649 [Oryza sativa Japonica Group]
 gb|ACA50524.1| alpha amylase isozyme 3D [Oryza sativa Japonica Group]
Length=436

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/401 (65%), Positives = 318/401 (79%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A AG+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  25    AQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGRLYDL  84

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VAD+VINHRCA+ KD+RG+YC+FEGGT DDRLDWG
Sbjct  85    DASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDRLDWG  144

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             PG+IC DDT++SDGTG+ DTG  F  APDIDHLNPRVQ+EL++W+NWLKS++GFDGWR D
Sbjct  145   PGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGWRLD  204

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+  I+K+Y+E+  P   V E+WN ++Y  DGKP  NQD  R EL  WV   GG A
Sbjct  205   FAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAVGGPA  264

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
               FDFTTKG+LQ  V GELWRL+D +GK  G++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  265   MTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGSTQKLWPFPS  324

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EIT L ++R  N I+  S + I+  DA+A
Sbjct  325   DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVADADA  384

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D+KV+VKIG+++DVGN +P +F+  V G+DY VWEK
Sbjct  385   YVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  425



>gb|ADC54369.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV+ +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAAEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCI+EGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSAEMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++QGYAYILTHPGIPC+FYDHFF+ G KDEI  L+++R  N I+ TS+++IL  D +
Sbjct  303   SDKIMQGYAYILTHPGIPCIFYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMHDGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             +YVA+ID KV+VKIGS++DVG +IP  F     G+DY VWEK A
Sbjct  363   SYVAEIDSKVVVKIGSRYDVGAVIPAGFVTSAHGKDYAVWEKIA  406



>ref|XP_003563559.1| PREDICTED: alpha-amylase type A isozyme [Brachypodium distachyon]
Length=447

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/407 (65%), Positives = 317/407 (78%), Gaps = 3/407 (1%)
 Frame = +2

Query  101   AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRL  280
             A G  VLFQGFNWES K QGGWYN L+  + D+A AG+THVWLPPPSHSVS +GYMPGRL
Sbjct  24    ASGHQVLFQGFNWESWKQQGGWYNMLLGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRL  83

Query  281   YDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRL  460
             YDLDASKYG+  +L++L+ ALH  G++ +AD+VINHRCADYKDSRGIYCIFEGGT+D RL
Sbjct  84    YDLDASKYGSASELKSLIGALHGKGVQAIADVVINHRCADYKDSRGIYCIFEGGTADGRL  143

Query  461   DWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGW  640
             DWGP +IC+DDT + DGT N DTGADFA APDIDHLN RVQ+EL++W+ WLKS++GFD W
Sbjct  144   DWGPHMICRDDTAYGDGTANLDTGADFAAAPDIDHLNDRVQRELTDWLLWLKSDLGFDAW  203

Query  641   RFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNag  820
             R DF +GY+  ++K+Y++ T P LAV E+WNDM  G DGKP Y+QD HR  L  WV   G
Sbjct  204   RLDFAKGYSPEMAKVYIDGTKPGLAVAEVWNDMTPGGDGKPAYDQDAHRQALVNWVDRVG  263

Query  821   gaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQS  991
             G  +A      TTKGIL VAV GELWRL DP GK PG+VG  P  AVTFVDNHDTGSTQ+
Sbjct  264   GKDSAGMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVVGWWPAKAVTFVDNHDTGSTQA  323

Query  992   HWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEIL  1171
              WPFP DKV+ GYAYILTHPG PC+FYDHFF+WG K+EI  L++VR  N I+ TS++ IL
Sbjct  324   MWPFPADKVMLGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVRKRNGITATSALRIL  383

Query  1172  GVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
               D +AYVA++D KV+VKIGS++DV  +IP  F     G+DY VWEK
Sbjct  384   MHDGDAYVAEVDGKVVVKIGSRYDVAAVIPSGFVTTAHGKDYAVWEK  430



>gb|ADP88919.1| alpha-amylase [Gunnera manicata]
Length=422

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/414 (66%), Positives = 323/414 (78%), Gaps = 2/414 (0%)
 Frame = +2

Query  74    FCLACAFVPAFGSTVL-FQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSV  250
             F      VP+ G  VL FQGFNWES K +GGWYNSL   IP+LA AGITHVWLPPPSHSV
Sbjct  9     FLYFLCVVPSLGDPVLLFQGFNWESWKKEGGWYNSLAAFIPELAKAGITHVWLPPPSHSV  68

Query  251   SPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCI  430
             S QGY+PGRLYD++AS YG + +L++L+   H +GI  +ADIVINHRCA+ +D RGI+CI
Sbjct  69    SSQGYLPGRLYDINASSYGNQAELKSLINGFHRHGITCLADIVINHRCAEKQDERGIWCI  128

Query  431   FEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNW  610
             FEGGT DDRLDWGP LIC DDTE+S+G GN DTGA +  APDIDH+NPRVQ ELS+WMNW
Sbjct  129   FEGGTPDDRLDWGPSLICSDDTEYSNGKGNPDTGAPYQPAPDIDHINPRVQNELSDWMNW  188

Query  611   LKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRN  790
             LK+EIGFDGWRFDF +GYA   +++Y+  TS   AVGE+WN ++YG+DGKP YNQD HRN
Sbjct  189   LKTEIGFDGWRFDFAKGYAPRFTQLYVGKTSANFAVGEIWNSLSYGNDGKPGYNQDVHRN  248

Query  791   ELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
             EL R       A TAFDFTTKGILQ AV GELWRLKD +GKPPGL+GI P   VTF+DNH
Sbjct  249   EL-RICCGDWWAVTAFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGILPGKGVTFIDNH  307

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ+HWPFP DKV+QGY YILTHPGIP LFYDHF  WGLK++I +L+++R  N I  
Sbjct  308   DTGSTQNHWPFPSDKVMQGYCYILTHPGIPSLFYDHFVGWGLKEQIVELVAIRKRNGIVP  367

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             TS+V IL  D+  YVA ID K+I+KIG +++VG LIP NF V  SG +Y VWEK
Sbjct  368   TSTVRILASDSGLYVAMIDGKIIMKIGPRYEVGILIPPNFRVATSGNNYCVWEK  421



>gb|ADC54370.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/404 (64%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV+ +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAAEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADY+DSRGIYCI+EGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYRDSRGIYCIYEGGTSDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ TSP L V E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSAEMAKVYIDGTSPSLVVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKIMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>gb|ADC54372.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV  +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVFNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCI+EGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSAEMAKVYIDGTSPSLAVAEVWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKIMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>emb|CAA33298.1| alpha-amylase [Hordeum vulgare]
 prf||1609234A high pI alpha amylase
Length=427

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/401 (67%), Positives = 317/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AGITHVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A++KD RGIYCIFEG T D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGDTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLN RVQKEL EW+NWLK++IGFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG   A
Sbjct  206   KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+SVRT + I   S ++I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVGNLIP  F V   G DY VW+K
Sbjct  386   YLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWQK  426



>ref|XP_008651084.1| PREDICTED: uncharacterized protein LOC100273029 isoform X1 [Zea 
mays]
 tpg|DAA61291.1| TPA: putative alpha-amylase family protein [Zea mays]
Length=433

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/403 (67%), Positives = 317/403 (79%), Gaps = 4/403 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQ FNWES K  GGWYN L+  + D+A+AG+THVWLPPPSHSVS QGYMPGRLYDLDA
Sbjct  22    VLFQAFNWESWKQSGGWYNLLMGKVDDIASAGVTHVWLPPPSHSVSTQGYMPGRLYDLDA  81

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYGT  +L++L+AA H  G++VVADIVINHRCADYKD+RGIYCIFEGGT D RLDWGP 
Sbjct  82    SKYGTAAELKSLIAAFHGKGVQVVADIVINHRCADYKDARGIYCIFEGGTPDGRLDWGPH  141

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLK-SEIGFDGWRFDF  652
             +IC+DDT +SDGT N DTGADFA APDIDHLN RVQ+EL++W+ WLK S++GFD WR DF
Sbjct  142   MICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELTDWLLWLKSSDLGFDAWRLDF  201

Query  653   VRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaat  832
              +GY+  ++K+Y++ T+P  AV E+WN MAY  D KP+Y+QD HR  L  WV   GGAA+
Sbjct  202   AKGYSPEVAKVYVDATAPTFAVAEVWNSMAYDGDNKPEYDQDPHRQALVDWVDRVGGAAS  261

Query  833   afdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPF  1003
                    TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPF
Sbjct  262   PATVFDFTTKGILNAAVEGELWRLIDPQGKAPGVIGWWPAKAVTFVDNHDTGSTQAMWPF  321

Query  1004  PKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDA  1183
             P DKV+QGYAYILTHPG PC+FYDHFFDWG KDEI  L++VR  N I+ TS + IL  D 
Sbjct  322   PSDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDG  381

Query  1184  NAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             ++YVA+ID KVIVKIGS++DVG+LIP  F V   G DY VWEK
Sbjct  382   DSYVAEIDGKVIVKIGSRYDVGHLIPAGFEVAAHGNDYAVWEK  424



>gb|ADC54333.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/404 (65%), Positives = 320/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD R  WGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRPGWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIG+++DVG +IP  F     G+DY VWEK A
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKDYAVWEKTA  406



>emb|CAA09323.1| alpha amylase [Avena fatua]
Length=434

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 318/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  26    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ A H  G+ V+ADIVINHRCADYKD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNAAELKSLIGAFHGKGVHVIADIVINHRCADYKDKRGIYCIFEGGTPDSRLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT +SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLK+++GFD WR DF 
Sbjct  146   MICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKTDLGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A+++K+Y++ TSP+LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  206   KGYSAAMAKVYIDGTSPDLAVAEVWDTMQTGGDGKPEYDQDAHRQNLVNWVDGVGGAASA  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  266   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG K+EI  L++VR  N I+ TS ++IL  D +
Sbjct  326   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVRKRNGITATSELKILMHDGD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIGS++DVG++IP  F     G DY VWEK A
Sbjct  386   AYVAEIDGKVVVKIGSRYDVGSVIPAGFVTSAHGSDYAVWEKSA  429



>ref|XP_008811408.1| PREDICTED: alpha-amylase isozyme 3D-like [Phoenix dactylifera]
Length=426

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/403 (65%), Positives = 321/403 (80%), Gaps = 0/403 (0%)
 Frame = +2

Query  107   GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYD  286
              + +LFQGFNWES K +GGWYN L   + D+ANAG+THVWLPPPSHSVS QGY+PGRLYD
Sbjct  24    AAQILFQGFNWESWKKEGGWYNFLKGQVSDIANAGVTHVWLPPPSHSVSEQGYLPGRLYD  83

Query  287   LDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDW  466
             L+ SKYG + +L++L++  H+ GIK +ADIVINHRCAD KD RG+YCIFEGGT DDRLDW
Sbjct  84    LNVSKYGNRGELKSLISEFHEKGIKCIADIVINHRCADKKDGRGVYCIFEGGTPDDRLDW  143

Query  467   GPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRF  646
             GP +IC DDT++SDGTG+ DTG  F  APDIDHLNPRVQ+ELS+WMNWLKS+IGFDGWR 
Sbjct  144   GPTMICSDDTKYSDGTGHPDTGLGFDAAPDIDHLNPRVQRELSDWMNWLKSDIGFDGWRL  203

Query  647   DFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga  826
             DF RGY++ I+KIY++ T+P   V E+W+ +AYG+DGKP Y+Q+ HR EL  WVQ  G  
Sbjct  204   DFARGYSSDIAKIYVDQTTPSFVVAEIWSSLAYGNDGKPAYDQNAHRQELVNWVQTVGSP  263

Query  827   atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
             ATAFDFTTKGILQ AV GELWR++D  G+  G++G  P   VTFVDNHDTGSTQ  WPFP
Sbjct  264   ATAFDFTTKGILQAAVQGELWRMRDSKGEASGMIGWWPEKTVTFVDNHDTGSTQRQWPFP  323

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGY YILTHPGIP +FYDH FDWGLK  I +L ++R+ N I   SS+ I+  D++
Sbjct  324   SDKVMQGYVYILTHPGIPSIFYDHLFDWGLKKPIGELAAIRSRNGIHPGSSLRIMVSDSD  383

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              YVA ID+K+I KIG ++DVGN++P N+++V SG DY VWEKK
Sbjct  384   LYVAAIDEKIIAKIGPRYDVGNIVPSNYHIVASGNDYCVWEKK  426



>ref|NP_001062024.1| Os08g0473900 [Oryza sativa Japonica Group]
 dbj|BAF23938.1| Os08g0473900 [Oryza sativa Japonica Group]
 dbj|BAG93480.1| unnamed protein product [Oryza sativa Japonica Group]
Length=476

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/401 (65%), Positives = 318/401 (79%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A AG+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  65    AQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGRLYDL  124

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VAD+VINHRCA+ KD+RG+YC+FEGGT DDRLDWG
Sbjct  125   DASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDRLDWG  184

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             PG+IC DDT++SDGTG+ DTG  F  APDIDHLNPRVQ+EL++W+NWLKS++GFDGWR D
Sbjct  185   PGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGWRLD  244

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+  I+K+Y+E+  P   V E+WN ++Y  DGKP  NQD  R EL  WV   GG A
Sbjct  245   FAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAVGGPA  304

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
               FDFTTKG+LQ  V GELWRL+D +GK  G++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  305   MTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGSTQKLWPFPS  364

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EIT L ++R  N I+  S + I+  DA+A
Sbjct  365   DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVADADA  424

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D+KV+VKIG+++DVGN +P +F+  V G+DY VWEK
Sbjct  425   YVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  465



>emb|CAX51373.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/401 (66%), Positives = 318/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AG+THVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A+ KD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLNPRVQKEL EW+NWL++++GFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG+  A
Sbjct  206   KGYSADVAKIYVDRSEPSFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNWVNKVGGSGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+RT + I   S ++I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIRTRHGIHSESKLQIMEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DV +LIP  F V   G DY VWEK
Sbjct  386   YLAEIDGKVIVKLGPRYDVRHLIPEGFKVAAHGNDYAVWEK  426



>gb|ADC54336.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/402 (65%), Positives = 319/402 (79%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GG YN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGRYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS+++IL  + +
Sbjct  303   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             AYVA+ID KV+VKIG+++DVG +IP  F     G DY VWEK
Sbjct  363   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGNDYAVWEK  404



>gb|AAA33895.1| alpha-amylase [Oryza sativa Japonica Group]
Length=435

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/401 (65%), Positives = 318/401 (79%), Gaps = 1/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A AG+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  25    AQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGRLYDL  84

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VAD+VINHRCA+ KD+RG+YC+FEGGT D RLDWG
Sbjct  85    DASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPD-RLDWG  143

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             PG+IC DDT++SDGTG+ DTG  F  APDIDHLNPRVQ+EL++W+NWLKS++GFDGWR D
Sbjct  144   PGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGWRLD  203

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+  I+K+Y+E+  P   V E+WN ++Y  DGKP  NQD  R EL  WV   GG A
Sbjct  204   FAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAVGGPA  263

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
               FDFTTKG+LQ  V GELWRL+D +GK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  264   MTFDFTTKGLLQAGVQGELWRLRDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQKLWPFPS  323

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EIT L ++R  N I+  S + I+  DA+A
Sbjct  324   DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVADADA  383

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D+KV+VKIG+++DVGN +P +F+  V G+DY VWEK
Sbjct  384   YVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  424



>gb|EMT32633.1| Alpha-amylase type B isozyme [Aegilops tauschii]
Length=427

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/401 (66%), Positives = 313/401 (78%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AG+THVWLPP S SVS QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVSKQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A+ KD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLNPRVQKEL EW+NWL++++GFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNa--ggaa  829
             +GY+A ++KIY++ +    AV E+W  +AYG DGKP+ NQD HR EL  WV      G  
Sbjct  206   KGYSADVAKIYIDRSEASFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNWVNKVGGSGTG  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D V+QGYAYILTHPG PC+FYDHFFDWG+KDEI +L+S+RT   I   S ++I+  DA+ 
Sbjct  326   DSVMQGYAYILTHPGTPCIFYDHFFDWGMKDEIYRLVSIRTRQGIHSESKLQIMEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID K+IVK+G + DVG+LIP  F V   G+DY VWEK
Sbjct  386   YLAEIDGKIIVKLGPRFDVGHLIPGGFKVAAHGKDYAVWEK  426



>gb|ACZ72923.1| alpha-amylase isoform [Dactylis glomerata]
Length=427

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 316/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L++ + D+A AGITHVWLPP SHS++ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKQNGGWYNLLMSKVDDIAAAGITHVWLPPASHSIAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL+AL+ AL   G+K +ADIVINHR A++KD RGIYC+FEGGTSD RLDWGP 
Sbjct  86    SKYGNEAQLKALIEALKGKGVKAIADIVINHRTAEHKDGRGIYCLFEGGTSDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF GAPDIDHLNP VQKEL EW+NWLK++IGFD WR DF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGGAPDIDHLNPTVQKELVEWLNWLKTDIGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++K+Y++ T P  AV E+W  +AYG DGKP+ NQD HR EL  WV   G +  A
Sbjct  206   KGYSADVAKVYIDGTEPNFAVAEIWTSLAYGGDGKPNLNQDEHRQELVNWVNRVGASGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKG+L VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGVLNVAVEGELWRLRGADGKAPGMIGTLPGKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWG K+EI +L+S+RT +EI   S + I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGHKEEIERLVSIRTRHEIHSESELRIMEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G++ DV +LIP  F VV  G  Y VWEK
Sbjct  386   YLAEIDGKVIVKLGTRSDVEHLIPGGFQVVAHGDGYAVWEK  426



>gb|ADC54368.1| alpha amylase [Hordeum vulgare subsp. spontaneum]
Length=414

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/404 (65%), Positives = 321/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV+ +GYMPGRLYD+DA
Sbjct  3     VLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSHSVAAEGYMPGRLYDIDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKDSRGIYCI+EGGTSD RLDWGP 
Sbjct  63    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT++SDGT N DTGAD+A APDIDHLN RVQ EL EW+ WLKS++GFD WR DF 
Sbjct  123   MICRDDTKYSDGTANLDTGADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWRLDFA  182

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  183   RGYSAEMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  242

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL DP GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP
Sbjct  243   GMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFIDNHDTGSTQAKWPFP  302

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++QGYAYILTH GIPC+FYDHFF+ G KDEI  L+++R  N I+ TS+++IL  D +
Sbjct  303   SDKIMQGYAYILTHSGIPCIFYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMHDGD  362

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIGS++++G +IP  F    +G+DY VWEK A
Sbjct  363   AYVAEIDSKVVVKIGSRYELGAVIPARFVTSANGKDYAVWEKIA  406



>gb|AHY18982.1| high PI alpha-amylase 1, partial [Triticum aestivum]
 gb|AHY18983.1| high PI alpha-amylase 1, partial [Triticum aestivum]
Length=424

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/400 (66%), Positives = 315/400 (79%), Gaps = 2/400 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GGWYN L+  + D+A AG+THVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  25    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVAEQGYMPGRLYDLDA  84

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A+ KD RGIYCIFEGGT D RLDWGP 
Sbjct  85    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPH  144

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLNPRVQKEL EW+NWL++ +GFDGWRFDF 
Sbjct  145   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTNVGFDGWRFDFA  204

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ +    AV E+W  +AYG DGKP+ NQD HR EL  WV   GG+   
Sbjct  205   KGYSADVAKIYIDRSGASFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNWVNKVGGSGPG  264

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  265   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  324

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S++T   I   S ++I+  DA+ 
Sbjct  325   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIKTRQGIHSESKLQIIEADADL  384

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWE  1309
             Y+A+ID KVIVK+G ++DVG+LIP  F VV  G DY VWE
Sbjct  385   YLAEIDGKVIVKLGPRYDVGHLIPQGFKVVAHGNDYAVWE  424



>ref|XP_007017239.1| Alpha-amylase-like [Theobroma cacao]
 gb|EOY14464.1| Alpha-amylase-like [Theobroma cacao]
Length=449

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/452 (62%), Positives = 328/452 (73%), Gaps = 45/452 (10%)
 Frame = +2

Query  74    FCLACAFVPAFGSTV----LFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPS  241
              C    F+  F S V    LFQGFNWES    GGWYN L N + D+ANAG+THVWLPPPS
Sbjct  5     LCFISLFLSVFPSLVSPALLFQGFNWESCNKAGGWYNFLKNSVSDIANAGVTHVWLPPPS  64

Query  242   HSVSPQ----------------------------------GYMPGRLYDLDASKYGTKQQ  319
              SV PQ                                  GY+PGRLYDLDASKYG++ +
Sbjct  65    QSVGPQELRPCILFENCPVLAIFDCIDDYVHILKELIFHPGYLPGRLYDLDASKYGSQAE  124

Query  320   LQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTE  499
             L++L+ A H  G+K VADIVINHR A+ KD RGIYCIFEGGT DDRLDWGP  IC DD E
Sbjct  125   LKSLIDAFHQKGVKCVADIVINHRTAERKDGRGIYCIFEGGTPDDRLDWGPSFICGDDKE  184

Query  500   FSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASIS  679
             +SDGTGN DTG  +  APDIDHLNPRVQKELS+WMNWLK+EIGFDGWRFDFVRGYA SI+
Sbjct  185   YSDGTGNPDTGLCYQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVRGYAPSIT  244

Query  680   KIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaatafdfttKGI  859
             KIYM+ TSP+ AVGE W D + G        +D+HR  L  WV+ AGG  TAFDFTTKG+
Sbjct  245   KIYMDQTSPDFAVGEKWEDFSLG-------QEDSHRGALKDWVEAAGGVVTAFDFTTKGV  297

Query  860   LQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYI  1039
             L  AV GELWRLKD +GKPPG++G+ P+NA TFVDNHDTGSTQ+ WPFP DKV+QGYAYI
Sbjct  298   LNAAVQGELWRLKDSNGKPPGMIGLLPQNAATFVDNHDTGSTQNQWPFPSDKVMQGYAYI  357

Query  1040  LTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVI  1219
             LTHPG+P +FYDHFFDWGLKDEI+KL+++R  N IS +S+V IL  D++ Y+A ID+K+I
Sbjct  358   LTHPGVPSIFYDHFFDWGLKDEISKLVAIRNRNGISTSSTVNILASDSDLYMASIDEKII  417

Query  1220  VKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             +KIG K D+GNL+P N+ +  SG DY VWEKK
Sbjct  418   MKIGPKMDLGNLVPSNYQLATSGNDYAVWEKK  449



>emb|CAA39778.1| alpha-amylase [Oryza sativa Japonica Group]
Length=437

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/401 (66%), Positives = 317/401 (79%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES   QGGWYN L + +  +A  G+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  26    AQVLFQGFNWESWNKQGGWYNFLHSHVDYIAATGVTHVWLPPPSHSVAPQGYMPGRLYDL  85

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H   IK VADIVINHRCADYKDSRGIYCIFEGGT D RLDWG
Sbjct  86    DASKYGTGAELRSLIAAFHSKSIKCVADIVINHRCADYKDSRGIYCIFEGGTPDSRLDWG  145

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++S+G G+ DTGADF  APDIDHLN RVQ ELS+W+NWLKS++GFDGWR D
Sbjct  146   PDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNTRVQTELSDWLNWLKSDVGFDGWRLD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K Y++NT P   V E+W++M Y  +G+P +NQD  R EL  W Q  GG A
Sbjct  206   FAKGYSATVAKTYVDNTDPSFVVAEIWSNMRYDGNGEPSWNQDGDRQELVNWAQAVGGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             +AFDFTTKG LQ AV GELWR+KD +GK PG++G  P  AVTF+DNHDTGSTQ+ WPFP 
Sbjct  266   SAFDFTTKGELQAAVQGELWRMKDGNGKAPGMIGWLPEKAVTFIDNHDTGSTQNSWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+Q YAYILTHPG+PC+FYDH FDW LK EI+ L +VR+ N I   S + IL  D + 
Sbjct  326   DKVMQRYAYILTHPGVPCIFYDHVFDWNLKQEISTLAAVRSRNGIHPGSKLNILAADGDV  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA IDDKVI KIG+++DVGNLIP +F+VV  G +Y VWEK
Sbjct  386   YVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNNYCVWEK  426



>gb|EMS50638.1| Alpha-amylase type B isozyme [Triticum urartu]
Length=427

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/401 (66%), Positives = 316/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GG  N L+  + D+A AG+THVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGGDNFLMGKVDDIAAAGVTHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A+ KD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLNPRVQKEL EW+NWL++++GFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG+   
Sbjct  206   KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVNKVGGSGPG  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+RT   I   S ++I+  DA+ 
Sbjct  326   DKVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVG+LIP  F VV  G DY VWEK
Sbjct  386   YLAEIDGKVIVKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  426



>pir||JC7137 alpha-amylase (EC 3.2.1.1) isozyme I - rice
Length=435

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/401 (64%), Positives = 318/401 (79%), Gaps = 1/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A AG+THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  25    AQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGRLYDL  84

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VAD+VINHRCA+ KD+RG+YC+FEGGT D RLDWG
Sbjct  85    DASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPD-RLDWG  143

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             PG+IC DDT++S+GTG+ DTG  F  APDIDHLNPRVQ+EL++W+NWLKS++GFDGWR D
Sbjct  144   PGMICSDDTQYSEGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGWRLD  203

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+  I+K+Y+E+  P   V E+WN ++Y  DGKP  NQD  R EL  WV   GG A
Sbjct  204   FAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAVGGPA  263

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
               FDFTTKG+LQ  V GELWRL+D +GK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  264   MTFDFTTKGLLQAGVQGELWRLRDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQKLWPFPS  323

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EIT L ++R  N I+  S + I+  DA+A
Sbjct  324   DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVADADA  383

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D+KV+VKIG+++DVGN +P +F+  V G+DY VWEK
Sbjct  384   YVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  424



>emb|CAA09324.1| alpha-amylase [Avena fatua]
Length=437

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 319/404 (79%), Gaps = 3/404 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GG+YN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  29    VLFQGFNWESWKQSGGYYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  88

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ A H  G+ V+ADIVINHRCADYKDSRGIYCIFEGGTSD RLDWGP 
Sbjct  89    SKYGYAAELKSLIGAFHGKGVHVIADIVINHRCADYKDSRGIYCIFEGGTSDSRLDWGPH  148

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT +SDGT N DTGADFA APDIDHLN RVQ+EL EW+ WLK+++GFD WR DF 
Sbjct  149   MICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKTDLGFDAWRLDFA  208

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A+++K+Y++ T+P+LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  209   KGYSAAMAKVYIDGTTPDLAVAEVWDTMPTGGDGKPEYDQDAHRQNLVNWVDGVGGAASA  268

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL D  GK PG++G  P  AVTFVDNHDTGSTQ+ WPFP
Sbjct  269   GMVFDFTTKGILNAAVEGELWRLIDSQGKAPGVIGWWPAKAVTFVDNHDTGSTQAMWPFP  328

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG K+EI  L++VR  N I+ TS ++IL  D +
Sbjct  329   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVRKRNSITSTSELKILMHDGD  388

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             AYVA+ID KV+VKIGS++DVG++IP  F     G DY VWEK A
Sbjct  389   AYVAEIDGKVVVKIGSRYDVGDVIPAGFVNSAHGSDYAVWEKSA  432



>ref|NP_001062023.1| Os08g0473600 [Oryza sativa Japonica Group]
 sp|P27934.1|AMY3E_ORYSJ RecName: Full=Alpha-amylase isozyme 3E; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAA33896.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAD09374.1| alpha-amylase isozyme 3E precursor [Oryza sativa Japonica Group]
 dbj|BAD09334.1| alpha-amylase isozyme 3E precursor [Oryza sativa Japonica Group]
 dbj|BAF23937.1| Os08g0473600 [Oryza sativa Japonica Group]
 gb|EAZ07321.1| hypothetical protein OsI_29569 [Oryza sativa Indica Group]
 gb|EAZ43059.1| hypothetical protein OsJ_27648 [Oryza sativa Japonica Group]
 gb|ACF60463.1| alpha amylase isozyme 3E [Oryza sativa Japonica Group]
 dbj|BAG96068.1| unnamed protein product [Oryza sativa Japonica Group]
Length=437

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/424 (62%), Positives = 325/424 (77%), Gaps = 3/424 (1%)
 Frame = +2

Query  47    TLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
             TL   +    CLA +   A    VLFQGFNWES + QGGWYN L   + ++A+ G THVW
Sbjct  7     TLCCVVFAVLCLASSLAQA---QVLFQGFNWESWRKQGGWYNFLHEKVEEIASTGATHVW  63

Query  227   LPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYK  406
             LPPPSHSVSPQGYMPGRLYDLDASKYGT+ +L++L+ A HD  ++ +ADIVINHRCADYK
Sbjct  64    LPPPSHSVSPQGYMPGRLYDLDASKYGTEAELKSLIEAFHDKNVECLADIVINHRCADYK  123

Query  407   DSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQK  586
             DSRG+YC+FEGGT D RLDWGP +IC DDT++S+G G+ DTGA F  APDIDHLNPRVQ+
Sbjct  124   DSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPRVQR  183

Query  587   ELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPD  766
             EL++W+NWL++++GFDGWR DF +GY+A +++IY++NT+P   VGE+W+ + Y  DGKP 
Sbjct  184   ELTDWLNWLRTDLGFDGWRLDFAKGYSAPLARIYVDNTNPTFVVGEIWSSLIYNGDGKPS  243

Query  767   YNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRN  946
              NQD  R EL  WV+  G  ATAFDFTTKGILQ AV GELWRL D +GK PGL+G  P  
Sbjct  244   TNQDADRQELVNWVEGVGKPATAFDFTTKGILQAAVQGELWRLHDGNGKAPGLMGWMPDQ  303

Query  947   AVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISV  1126
             AVTFVDNHDTGSTQS WPFP DKV+QGYAYILTHPGIPC+FYDH FDW L+ EI  L  +
Sbjct  304   AVTFVDNHDTGSTQSLWPFPSDKVMQGYAYILTHPGIPCIFYDHVFDWNLQHEIATLAEI  363

Query  1127  RTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
             R+ N I   S+++IL  + + YVA ID KVI K+G ++D G +IP +F+VV  G DY VW
Sbjct  364   RSRNGIHAESTLDILKAEGDIYVAMIDGKVITKLGPRYDAGGIIPSDFHVVAHGNDYCVW  423

Query  1307  EKKA  1318
             EK+ 
Sbjct  424   EKEG  427



>ref|XP_009381896.1| PREDICTED: alpha-amylase isozyme 3D-like [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/401 (65%), Positives = 320/401 (80%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S +LFQGFNWES + QGGWYN L   +PD+A AG+T VWLPPPSHSVS QGYMPGRLYDL
Sbjct  24    SHILFQGFNWESWRKQGGWYNFLKGQVPDIARAGVTLVWLPPPSHSVSEQGYMPGRLYDL  83

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
              ASKYGT+ +L++L+ A H  GI+ VADIVINHRCAD KD RGIYC+FEGG+ + RLDWG
Sbjct  84    SASKYGTRDELKSLITAFHAKGIECVADIVINHRCADRKDERGIYCMFEGGSREGRLDWG  143

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++SDGTGN DTGADFA APDIDHLNP+VQ+EL++W+NWL+++IGFDGWR D
Sbjct  144   PHMICSDDTQYSDGTGNPDTGADFAAAPDIDHLNPQVQRELTDWLNWLETDIGFDGWRLD  203

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F RGY+ +I+K Y+  T P   VGELW+ + YG DGKP Y+QD  R EL  WV + GG A
Sbjct  204   FARGYSPNITKTYLSQTRPAFVVGELWSSLTYGQDGKPAYDQDGSRQELVNWVSDVGGPA  263

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKG+LQ AV GELWRL+D  GK  G++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  264   TTFDFTTKGVLQAAVQGELWRLRDRQGKASGMIGWWPEKAVTFVDNHDTGSTQKMWPFPP  323

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             ++V++GYAYILTHPG+P +FYDH FDWGLK+EIT L ++RT N I   S++ IL  DA+ 
Sbjct  324   ERVMEGYAYILTHPGVPTIFYDHLFDWGLKEEITGLAAIRTRNGIRPGSTLRILVADADL  383

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A ID+KV VKIG +++VGNL+  +F+VV SG+++ VWEK
Sbjct  384   YMAVIDEKVAVKIGPRYEVGNLVTADFHVVASGKEFCVWEK  424



>pir||JC7138 alpha-amylase (EC 3.2.1.1) isozyme III - rice
Length=437

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/424 (62%), Positives = 325/424 (77%), Gaps = 3/424 (1%)
 Frame = +2

Query  47    TLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
             TL   +    CLA +   A    VLFQGFNWES + QGGWYN L   + ++A+ G THVW
Sbjct  7     TLCCVVFAVLCLASSLAQA---QVLFQGFNWESWRKQGGWYNFLHEKVEEIASTGATHVW  63

Query  227   LPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYK  406
             LPPPSHSVSPQGYMPGRLYDLDASKYGT+ +L++L+ A HD  ++ +ADIVINHRCADYK
Sbjct  64    LPPPSHSVSPQGYMPGRLYDLDASKYGTEAELKSLIEAFHDKNVECLADIVINHRCADYK  123

Query  407   DSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQK  586
             DSRG+YC+FEGGT D RLDWGP +IC DDT++S+G G+ DTGA F  APDIDHLNPRVQ+
Sbjct  124   DSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPRVQR  183

Query  587   ELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPD  766
             EL++W+NWL++++GFDGWR DF +GY+A +++IY++NT+P   VGE+W+ + Y  DGKP 
Sbjct  184   ELTDWLNWLRTDLGFDGWRLDFAKGYSAPLARIYVDNTNPTFVVGEIWSSLIYNGDGKPS  243

Query  767   YNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRN  946
              NQD  R EL  WV+  G  ATAFDFTTKGILQ AV GELWRL D +GK PGL+G  P  
Sbjct  244   TNQDADRQELVNWVEGVGKPATAFDFTTKGILQAAVQGELWRLHDGNGKAPGLMGWMPDQ  303

Query  947   AVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISV  1126
             AVTFVDNHDTGSTQS WPFP DKV+QGYAYILTHPGIPC+FYDH FDW L+ EI  L  +
Sbjct  304   AVTFVDNHDTGSTQSLWPFPSDKVMQGYAYILTHPGIPCIFYDHVFDWNLQHEIATLAEI  363

Query  1127  RTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
             R+ N I   S+++IL  + + YVA ID KVI K+G ++D G +IP +F+VV  G DY VW
Sbjct  364   RSRNGIHAESTLDILKAEGDIYVAMIDGKVITKLGPRYDAGGIIPSDFHVVAHGNDYCVW  423

Query  1307  EKKA  1318
             EK+ 
Sbjct  424   EKEG  427



>gb|EMT10056.1| Alpha-amylase type A isozyme [Aegilops tauschii]
Length=440

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/407 (64%), Positives = 318/407 (78%), Gaps = 3/407 (1%)
 Frame = +2

Query  107   GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYD  286
             G  VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSV+ +GYMPGRLYD
Sbjct  26    GHQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVANEGYMPGRLYD  85

Query  287   LDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDW  466
             +DASKYG   +L++L+AALH  G++ +ADIVINHRCADYKDSRGIYCI+EGGTSD RLDW
Sbjct  86    IDASKYGNAAELKSLIAALHGKGVQAIADIVINHRCADYKDSRGIYCIYEGGTSDGRLDW  145

Query  467   GPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRF  646
             GP +IC+DDT +SDGT N DTGADF  APDIDHLN RVQ+EL EW+ WLKS++GFD WR 
Sbjct  146   GPHMICRDDTTYSDGTANLDTGADFDHAPDIDHLNERVQRELKEWLLWLKSDLGFDAWRL  205

Query  647   DFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga  826
             DF +GY+  ++K+Y++ T P LAV E+W+DM  G DGKP+Y+QD HR  L  WV   GG 
Sbjct  206   DFAKGYSPEMAKVYIDGTPPSLAVAEIWDDMVPGGDGKPNYDQDAHRQNLVNWVDKVGGV  265

Query  827   atafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHW  997
             A+A      TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ W
Sbjct  266   ASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAKW  325

Query  998   PFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGV  1177
             PFP DKV+QGYAYILTHPGIPC+FYDHFF+ G KD+I  L+++R  N I+ TS+++IL  
Sbjct  326   PFPYDKVMQGYAYILTHPGIPCIFYDHFFNLGFKDQIAALVAIRKRNGITATSALKILMH  385

Query  1178  DANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             + +AYVA+ID KV+VKIGS++DVG +IP  F     G DY VWEK A
Sbjct  386   EGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTTAHGNDYAVWEKTA  432



>gb|ADO63831.1| alpha amylase [Brachypodium distachyon]
Length=447

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/407 (64%), Positives = 313/407 (77%), Gaps = 3/407 (1%)
 Frame = +2

Query  101   AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRL  280
             A G  VLFQGFNWES K QGGWYN L+  + D+A AG+THVWLPPPSHSVS +GYMPGRL
Sbjct  24    ASGHQVLFQGFNWESWKQQGGWYNMLLGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRL  83

Query  281   YDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRL  460
             YD+DASKYG+  +L++L+ ALH  G++ +AD+VINHRCADYKD RGIYCIFEGGT D RL
Sbjct  84    YDIDASKYGSASELKSLIGALHGKGVQAIADVVINHRCADYKDGRGIYCIFEGGTPDGRL  143

Query  461   DWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGW  640
             DWGP +IC+DDT + DGT N DTGADFA APDIDHLN RVQ+EL+ W+ WLKS++GFD W
Sbjct  144   DWGPHMICRDDTAYGDGTANLDTGADFAAAPDIDHLNARVQRELTGWLLWLKSDLGFDAW  203

Query  641   RFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNag  820
             R DF +GY+  ++K+Y++ T P LAV E+WNDM  G DGKP Y+QD HR  L  WV   G
Sbjct  204   RLDFAKGYSPEMAKVYIDGTEPSLAVAEVWNDMTPGGDGKPAYDQDAHRQALVNWVDRVG  263

Query  821   gaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQS  991
             G  +A      TTKGIL VAV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+
Sbjct  264   GKDSAGMVFDFTTKGILNVAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQA  323

Query  992   HWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEIL  1171
              WPFP DKV+ GYAYILTHPG PC+FYDHFF+WG K+EI  L++VR  N I  TS++ +L
Sbjct  324   MWPFPADKVMLGYAYILTHPGTPCIFYDHFFNWGFKEEIAALVAVRKRNGIRATSALRVL  383

Query  1172  GVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
               D +AYVA++D KV+VKIGS++DV  +IP  F     G+DY VWEK
Sbjct  384   MHDGDAYVAEVDGKVVVKIGSRYDVAAVIPSGFVTTAHGKDYAVWEK  430



>ref|XP_010943052.1| PREDICTED: alpha-amylase isozyme 3D-like [Elaeis guineensis]
Length=426

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/402 (65%), Positives = 320/402 (80%), Gaps = 0/402 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + +LFQGFNWES K +GGWYN L   + D+ANAG+THVWLPPPSHSVS QGYMPGRLYDL
Sbjct  25    AQILFQGFNWESWKKEGGWYNFLKGQVSDIANAGVTHVWLPPPSHSVSEQGYMPGRLYDL  84

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             + SKYG + +L++L++A H  GIK VADIVINHRCAD  D RGIYCIFEGGT DDRLDWG
Sbjct  85    NVSKYGNQDELKSLISAFHGKGIKCVADIVINHRCADKMDGRGIYCIFEGGTPDDRLDWG  144

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++SDGTG+ DTG  F  APDIDHLN RVQ ELS+WMNWLKS++GFDGWR D
Sbjct  145   PTMICSDDTKYSDGTGHPDTGLGFDAAPDIDHLNLRVQHELSDWMNWLKSDLGFDGWRLD  204

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY++ I+KIY++ T+P   V E+W+ +AYG+DGKP Y+Q+ HR EL  WVQ   G A
Sbjct  205   FAKGYSSDIAKIYVDQTTPSFVVAEIWSSLAYGNDGKPAYDQNAHRQELVNWVQTVAGPA  264

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             TAFDFTTKGILQ AV GELWR++D +GK  G++G  P  AVTF+DNHDTGSTQ  WPFP 
Sbjct  265   TAFDFTTKGILQAAVQGELWRMRDSNGKASGMLGWWPEKAVTFIDNHDTGSTQRLWPFPS  324

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGY YILTHPGIP +FYDH FDWG K++I++L ++R+ N I   SS+ I+  D++ 
Sbjct  325   DKVMQGYVYILTHPGIPSIFYDHLFDWGFKEQISELATIRSRNGIHPGSSLRIIVSDSDL  384

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             YVA ID+K+I KIG ++DVG ++P NF +V SG DY VWEK+
Sbjct  385   YVAAIDEKIIAKIGPRYDVGKVVPSNFQIVASGNDYCVWEKR  426



>ref|XP_011042248.1| PREDICTED: pentatricopeptide repeat-containing protein At2g04860 
[Populus euphratica]
Length=1272

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/430 (66%), Positives = 335/430 (78%), Gaps = 2/430 (0%)
 Frame = +2

Query  32    PQKMSTLFQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLAN  205
             P   +    FL+ CF  L  +  P   S+ +LFQGFNWES    GGWYNSL N +PDLAN
Sbjct  39    PNSKTKRMSFLTLCFFSLFLSVFPLLTSSYLLFQGFNWESCNKAGGWYNSLKNSVPDLAN  98

Query  206   AGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVIN  385
             AGITHVW PP S SV+PQGYMPGRLYDL AS+YG++ +L++L+   +  GIK +ADIVIN
Sbjct  99    AGITHVWRPPSSQSVAPQGYMPGRLYDLSASRYGSQDELKSLIGDFNQKGIKCLADIVIN  158

Query  386   HRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDH  565
             HR A+ +D RGI+ +FEGGTSDDRLDWGP  IC DDT +SDG GN D+G DF  APDIDH
Sbjct  159   HRTAEKQDERGIWSVFEGGTSDDRLDWGPSFICADDTTYSDGKGNPDSGDDFEPAPDIDH  218

Query  566   LNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAY  745
             LNPRVQ+ELS+WMNWLKSEIGFDGWRFDFV+GYA SI+KIYMENTSP+ AVGE W+ +A 
Sbjct  219   LNPRVQRELSDWMNWLKSEIGFDGWRFDFVKGYAPSITKIYMENTSPDFAVGEKWDSLAD  278

Query  746   GSDGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGL  925
             G DGK DYNQD HR  +  W+Q AGGA TAFDFT+KGILQ AV GELWRLKD +GKPPGL
Sbjct  279   GQDGKLDYNQDAHRGSIRDWIQAAGGAVTAFDFTSKGILQAAVQGELWRLKDSNGKPPGL  338

Query  926   VGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDE  1105
             +G+ P+NAVTF+DNHDTGSTQ  WPFP DKVIQGYAYILTHPG   +FYDHFFDWGLK+E
Sbjct  339   IGLLPQNAVTFIDNHDTGSTQQIWPFPSDKVIQGYAYILTHPGTGSIFYDHFFDWGLKEE  398

Query  1106  ITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVS  1285
             I KL ++R +  I  TS+V IL  DA+ YVA I+D +I+KIG K D+GNLIP NF V  S
Sbjct  399   IGKLATIRKNYGIGSTSTVNILASDADLYVAAINDNIIMKIGPKTDLGNLIPLNFQVATS  458

Query  1286  GQDYVVWEKK  1315
             G D++   +K
Sbjct  459   GTDFINQRQK  468



>gb|KHG00963.1| Uncharacterized protein F383_22263 [Gossypium arboreum]
Length=415

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/406 (65%), Positives = 321/406 (79%), Gaps = 7/406 (2%)
 Frame = +2

Query  98    PAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGR  277
             P    T+LFQGFNWES+   GGWYN L + + D+ANAG+THVWLPPPS S +PQGY+PGR
Sbjct  17    PFATPTLLFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPSQSAAPQGYLPGR  76

Query  278   LYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDR  457
             LYDLDASKYG++ +L++L+ A H  G+K VADIVINHR A+ +D+RGIYC+FEGGTSDDR
Sbjct  77    LYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGGTSDDR  136

Query  458   LDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDG  637
             LDWGP  ICKDDT +SDGTGN DTG  +  APDIDHLNPRVQ ELS+W+NWLK+EIGFDG
Sbjct  137   LDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDG  196

Query  638   WRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNa  817
             WRFDFVRGYA +I+KIYM+ TSP+ AVGE W D   G        ++ HR  L  WV+ A
Sbjct  197   WRFDFVRGYAPTITKIYMDRTSPDFAVGEKWEDFIDG-------QEELHRAALKDWVEAA  249

Query  818   ggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHW  997
             GG  TAFDFTTKG+L  AV G+LWRLKD +GKPPG++G+ P+NAVTF+DNHDTGSTQ+ W
Sbjct  250   GGTVTAFDFTTKGVLNDAVQGKLWRLKDSNGKPPGMIGLLPQNAVTFIDNHDTGSTQNIW  309

Query  998   PFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGV  1177
             PFP DK++QGYAYILTHPGIP +FYDHFFD G KDEI+KL+ +R  N I  TS+V IL  
Sbjct  310   PFPSDKIMQGYAYILTHPGIPSIFYDHFFDLGFKDEISKLVEIRNRNGIQSTSTVTILAS  369

Query  1178  DANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             ++  Y+A IDDK+I+KIG K D+ NL+P N+ +  SG +Y VWEKK
Sbjct  370   ESELYMASIDDKIIMKIGPKMDLANLVPPNYQLATSGNNYAVWEKK  415



>ref|XP_003578230.1| PREDICTED: alpha-amylase isozyme 3A-like [Brachypodium distachyon]
Length=439

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/427 (62%), Positives = 319/427 (75%), Gaps = 2/427 (0%)
 Frame = +2

Query  38    KMSTLFQFLSYCFCLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGI  214
             K  T    L     L C    A   T +LFQGFNWES   QGGWYN L   +  +A++G+
Sbjct  3     KQVTALNGLLVAMALLCLSCDALAQTQILFQGFNWESCNKQGGWYNMLKGRVGSIASSGV  62

Query  215   THVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRC  394
             THVWLPPPSHSVSPQGYMPGRLYD+DASKYGTK +L++L+AA H  G+K VADIVINHR 
Sbjct  63    THVWLPPPSHSVSPQGYMPGRLYDVDASKYGTKAELKSLIAAFHGKGVKCVADIVINHRT  122

Query  395   ADYKDSRGIYCIFEGGTS-DDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLN  571
             A+ KD RG+YCIF+GG   + +LDWGPG+IC DD ++SDGTG+ DTGADFA APDIDHLN
Sbjct  123   AEEKDGRGVYCIFKGGGGPEGQLDWGPGMICSDDAKYSDGTGHRDTGADFAAAPDIDHLN  182

Query  572   PRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGS  751
             PRVQ+ELS W+ WLKS++GFDGWR DF +GY+A ++K+Y  N SP   V E+WN ++Y  
Sbjct  183   PRVQRELSAWLGWLKSDLGFDGWRLDFAKGYSAEVAKVYAGNASPGFVVAEIWNSLSYDG  242

Query  752   DGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVG  931
             DGKP  NQD  R EL  W +  GG A AFDFTTKGILQ AV GELWR++  DGK PG++G
Sbjct  243   DGKPATNQDGERQELVNWAKAVGGPAMAFDFTTKGILQAAVQGELWRMRGKDGKAPGMIG  302

Query  932   ISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEIT  1111
             +SP  AVTFVDNHDTGSTQ  WPFP DKV+ GYAYILTHPG+PC+FYDH FDW LK EI 
Sbjct  303   LSPEKAVTFVDNHDTGSTQKMWPFPADKVMMGYAYILTHPGLPCIFYDHVFDWNLKKEID  362

Query  1112  KLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQ  1291
              L +VR+ N I+  S + IL  +++ YVA +D+KVI KIG + D GNLIP +F+VV  G 
Sbjct  363   TLAAVRSRNGINAGSKLRILAAESDVYVAMVDEKVISKIGPRFDAGNLIPSDFHVVAHGS  422

Query  1292  DYVVWEK  1312
             +Y VWEK
Sbjct  423   NYCVWEK  429



>ref|XP_006659493.1| PREDICTED: alpha-amylase isozyme 3E-like [Oryza brachyantha]
Length=436

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/424 (62%), Positives = 326/424 (77%), Gaps = 3/424 (1%)
 Frame = +2

Query  47    TLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
             T+   L    C+A +   A    VLFQGFNWES + QGGWYN L   + ++A+ G+THVW
Sbjct  7     TVCCALVAVLCMASSLAQA---QVLFQGFNWESWRMQGGWYNFLHEKVEEIASTGVTHVW  63

Query  227   LPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYK  406
             LPPPSHSVSPQGYMPGRLYDLDASKYGT+ +L++L+ A H+  ++ +ADIVINHRCADYK
Sbjct  64    LPPPSHSVSPQGYMPGRLYDLDASKYGTEAELRSLIEAFHEKNVECLADIVINHRCADYK  123

Query  407   DSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQK  586
             DSRG+YC+FEGGT D RLDWGP +IC DDT++S+G G+ DTGA F  APDIDHLNPRVQ+
Sbjct  124   DSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPRVQR  183

Query  587   ELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPD  766
             EL++W+NWLK+++GFDGWR DF +GY+A I+++Y++NT+P   VGE+W+ + Y  DGKP 
Sbjct  184   ELTDWLNWLKADLGFDGWRLDFAKGYSAPIARVYVDNTNPTFVVGEIWSSLIYNGDGKPS  243

Query  767   YNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRN  946
              NQD  R EL  WV   G  ATAFDFTTKGILQ AV GELWRL D +GK PGL+G  P  
Sbjct  244   TNQDADRQELVNWVDGVGKPATAFDFTTKGILQAAVQGELWRLHDGNGKAPGLMGWMPDQ  303

Query  947   AVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISV  1126
             AVTFVDNHDTGSTQS WPFP DKV+QGYAYILTHPGIPC+FYDH FDW L+ EI  L ++
Sbjct  304   AVTFVDNHDTGSTQSLWPFPSDKVMQGYAYILTHPGIPCIFYDHVFDWNLQHEIATLAAI  363

Query  1127  RTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
             R+ N I   S+++IL  + + YVA ID +VI K+G ++D G +IP +F+VV  G DY VW
Sbjct  364   RSRNGIHPESTLDILKAEGDIYVAMIDGRVITKLGPRYDAGGIIPSDFHVVAHGNDYCVW  423

Query  1307  EKKA  1318
             EK +
Sbjct  424   EKHS  427



>ref|XP_010236079.1| PREDICTED: alpha-amylase type B isozyme-like [Brachypodium distachyon]
Length=428

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/403 (65%), Positives = 313/403 (78%), Gaps = 3/403 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             +LFQGFNWES K  GGWYN L   + D+A AG+THVWLPPPS SV  QGYMPGRLYDLDA
Sbjct  26    ILFQGFNWESWKQNGGWYNLLKGKVNDIAAAGVTHVWLPPPSQSVGEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   QL+AL+ A HD G+KV+ADIVINHR A++KD RGIYC+FEGGT D RLDWG  
Sbjct  86    SKYGNAAQLKALIGAFHDKGVKVIADIVINHRTAEHKDGRGIYCLFEGGTPDARLDWGAH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF GAPDIDHLN RVQ+EL+ W+NWLK++IGFD WR DF 
Sbjct  146   MICRDDKPYADGTGNPDTGADFGGAPDIDHLNTRVQEELTAWLNWLKTDIGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++K+Y+E T P+LAV E+W  +AYG DGKPD +QD HR EL  WV  AGGAA  
Sbjct  206   KGYSADVAKVYIEKTEPDLAVAEVWTPLAYGGDGKPDADQDAHRQELVNWVDKAGGAAGR  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWR++  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP
Sbjct  266   ATAFDFTTKGILNVAVDGELWRMRAADGKAPGMIGWWPAKAVTFVDNHDTGSTQRMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI  L+++RT   I + S + I+  DA+
Sbjct  326   SDKVMQGYAYILTHPGSPCIFYDHFFDWGLKEEIEHLVAIRTKQGIHKDSKLRIIEADAD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              Y+A++D KVI K+GS+ DVG+LIP  F VV  G+DY VW KK
Sbjct  386   LYLAEVDGKVITKLGSRFDVGHLIPEGFQVVAHGKDYSVWAKK  428



>gb|KHG23972.1| Uncharacterized protein F383_31428 [Gossypium arboreum]
Length=415

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/406 (65%), Positives = 321/406 (79%), Gaps = 7/406 (2%)
 Frame = +2

Query  98    PAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGR  277
             P    T+LFQGFNWES+   GGWYN L + + D+ANAG+THVWLPPPS S +PQGY+PGR
Sbjct  17    PFATPTLLFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPSQSAAPQGYLPGR  76

Query  278   LYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDR  457
             LYDLDASKYG++ +L++L+ A H  G+K VADIVINHR A+ +D+RGIYC+FEGGTSDDR
Sbjct  77    LYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGGTSDDR  136

Query  458   LDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDG  637
             LDWGP  ICKDDT +SDGTGN DTG  +  APDIDHLNPRVQ ELS+W+NWLK+EIGFDG
Sbjct  137   LDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDG  196

Query  638   WRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNa  817
             WRFDFVRGYA +I+KIYM+ TSP+ AVGE W D   G        ++ HR  L  WV+ A
Sbjct  197   WRFDFVRGYAPTITKIYMDRTSPDFAVGEKWEDFIDG-------QEELHRAALKDWVEAA  249

Query  818   ggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHW  997
             GG  TAFDFTTKG+L  AV G+LWRLKD +GKPPG++G+ P+NAVTF+DNHDTGSTQ+ W
Sbjct  250   GGTVTAFDFTTKGVLNDAVQGKLWRLKDSNGKPPGMIGLLPQNAVTFIDNHDTGSTQNIW  309

Query  998   PFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGV  1177
             PFP DK++QGYAYILTHP IP +FYDHFFD GLKDEI+KL+ +R  N I  TS+V IL  
Sbjct  310   PFPSDKIMQGYAYILTHPSIPSIFYDHFFDLGLKDEISKLVEIRNRNGIQSTSTVTILAS  369

Query  1178  DANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             ++  Y+A IDDK+I+KIG K D+ NL+P N+ +  SG +Y VWEKK
Sbjct  370   ESELYMASIDDKIIMKIGPKMDLANLVPPNYQLATSGNNYAVWEKK  415



>gb|KHG14183.1| Uncharacterized protein F383_17328 [Gossypium arboreum]
 gb|KHG30294.1| Uncharacterized protein F383_36543 [Gossypium arboreum]
Length=415

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/406 (65%), Positives = 320/406 (79%), Gaps = 7/406 (2%)
 Frame = +2

Query  98    PAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGR  277
             P    T+LFQGFNWES+   GGWYN L + + D+ANAG+THVWLPPPS S +PQGY+PGR
Sbjct  17    PFATPTLLFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPSQSAAPQGYLPGR  76

Query  278   LYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDR  457
             LYDLDASKYG++ +L++L+ A H  G+K VADIVINHR A+ +D+RGIYC+FEGGTSDDR
Sbjct  77    LYDLDASKYGSQAELKSLIDAFHQKGVKCVADIVINHRTAERQDNRGIYCLFEGGTSDDR  136

Query  458   LDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDG  637
             LDWGP  ICKDDT +SDGTGN DTG  +  APDIDHLNPRVQ ELS+W+NWLK+EIGFDG
Sbjct  137   LDWGPSFICKDDTAYSDGTGNPDTGLPYDPAPDIDHLNPRVQNELSDWLNWLKTEIGFDG  196

Query  638   WRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNa  817
             WRFDFVRGYA +I+KIYM+ TSP+ AVGE W D   G        ++ HR  L  WV+ A
Sbjct  197   WRFDFVRGYAPTITKIYMDRTSPDFAVGEKWEDFIDG-------QEELHRAALKDWVEAA  249

Query  818   ggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHW  997
             GG  TAFDFTTKG+L  AV G+LWRLKD +GKPPG++G+ P+NAVTF+DNHDTGSTQ+ W
Sbjct  250   GGTVTAFDFTTKGVLNDAVQGKLWRLKDSNGKPPGMIGLLPQNAVTFIDNHDTGSTQNIW  309

Query  998   PFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGV  1177
             PFP DK++QGYAYILTHP IP +FYDHFFD G KDEI+KL+ +R  N I  TS+V IL  
Sbjct  310   PFPSDKIMQGYAYILTHPSIPSIFYDHFFDLGFKDEISKLVEIRNRNGIQSTSTVTILAS  369

Query  1178  DANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             ++  Y+A IDDK+I+KIG K D+ NL+P N+ +  SG +Y VWEKK
Sbjct  370   ESELYMASIDDKIIMKIGPKMDLANLVPPNYQLATSGNNYAVWEKK  415



>ref|XP_006660697.1| PREDICTED: alpha-amylase isozyme 3A-like [Oryza brachyantha]
Length=438

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/401 (65%), Positives = 314/401 (78%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + +LFQGFNW+S K QGGWYN L   + D+A+AG+THVWLPPP+HSVSPQGYMPGRLYDL
Sbjct  28    TQILFQGFNWDSWKKQGGWYNMLQGQVNDIASAGVTHVWLPPPTHSVSPQGYMPGRLYDL  87

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGTK +L++L+AA H  GIK VADIVINHRCAD KDSRG+YCIF+GG     LDWG
Sbjct  88    DASKYGTKAELKSLIAAFHGKGIKCVADIVINHRCADDKDSRGVYCIFKGGGPQGCLDWG  147

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P +IC DDT++SDGTG+ DTGADFA APDIDHLNP VQ+ELS+W+ WL+ ++GFDGWR D
Sbjct  148   PSMICSDDTQYSDGTGHRDTGADFAAAPDIDHLNPLVQRELSDWLRWLRRDVGFDGWRLD  207

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+A+++K Y++N  P   V E+W+ ++Y  DGKP  NQD  R EL  WV+  GG A
Sbjct  208   FAKGYSAAVAKAYVQNARPGFLVAEIWSSLSYDGDGKPAANQDGERQELVNWVKQVGGPA  267

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             TAFDFTTKGILQ AV GELWR++D DGK PG++G  P   VTFVDNHDTGSTQ  WPFP 
Sbjct  268   TAFDFTTKGILQSAVQGELWRMRDKDGKAPGMIGWLPEKTVTFVDNHDTGSTQRMWPFPS  327

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+ GYAYILTHPG+PC+FYDH FDW LK EI  L + R  N I+  S + IL  DA+ 
Sbjct  328   DKVMLGYAYILTHPGVPCIFYDHVFDWNLKQEINALAAARRRNGINAGSKLRILAADADM  387

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D++VI KIG K DVG++IP +F+VV  G DY VWEK
Sbjct  388   YVAMVDERVITKIGPKTDVGSMIPSDFHVVAHGNDYCVWEK  428



>emb|CAA28803.1| alpha-amylase type A [Hordeum vulgare]
 gb|AAA32935.1| alpha-amylase [Hordeum vulgare]
Length=421

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 315/396 (80%), Gaps = 3/396 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPSHSVS +GYMPGRLYD+DA
Sbjct  26    VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG   +L++L+ ALH  G++ +ADIVINHRCADYKD+RGIYCIFEGGTSD RLDWGP 
Sbjct  86    SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDNRGIYCIFEGGTSDGRLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DDT+++DGT N DTGADFA APDIDHLN RVQ+EL EW+ WLKS++GFD WR DF 
Sbjct  146   MICRDDTKYADGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+  ++K+Y++ TSP LAV E+W++MA G DGKP+Y+QD HR  L  WV   GGAA+A
Sbjct  206   RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL  AV GELWRL DP GKPP ++G  P  AVTFVDNHDTGSTQ  WPFP
Sbjct  266   GMVFDFTTKGILNAAVEGELWRLIDPQGKPPDVMGWWPAKAVTFVDNHDTGSTQPMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFF+WG KDEI  L+++R  N I+ TS++EIL  + +
Sbjct  326   SDKVMQGYAYILTHPGTPCIFYDHFFNWGFKDEIAALVAIRKRNGITATSALEILMHEGD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             AYVA+ID KV+VKIG+++DVG +IP  F     G+D
Sbjct  386   AYVAEIDGKVVVKIGTRYDVGAVIPAGFATSAHGKD  421



>ref|NP_001063367.1| Os09g0457400 [Oryza sativa Japonica Group]
 sp|P27932.2|AMY3A_ORYSJ RecName: Full=Alpha-amylase isozyme 3A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD38366.1| Alpha-amylase isozyme 3A precursor (1,4-alpha-D-glucan glucanohydrolase) 
[Oryza sativa Japonica Group]
 dbj|BAF25281.1| Os09g0457400 [Oryza sativa Japonica Group]
 dbj|BAG94071.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94104.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69851.1| hypothetical protein OsJ_29629 [Oryza sativa Japonica Group]
Length=440

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/426 (61%), Positives = 323/426 (76%), Gaps = 0/426 (0%)
 Frame = +2

Query  35    QKMSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGI  214
             ++M+ L  FL          V    + +LFQGFNW+S K QGGWYN L + + D+A+AG+
Sbjct  3     KQMAALCGFLLVALLWLTPDVAHAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASAGV  62

Query  215   THVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRC  394
             THVWLPPP+HSVSPQGYMPGRLYDL+ASKYGTK +L++L+AA H  GIK VADIV+NHRC
Sbjct  63    THVWLPPPTHSVSPQGYMPGRLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNHRC  122

Query  395   ADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNP  574
             AD KD RG+YCIF+GG     LDWGP +IC DDT++SDGTG+ DTGADFA APDIDHLNP
Sbjct  123   ADDKDGRGVYCIFKGGGPRGCLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHLNP  182

Query  575   RVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSD  754
              VQ+ELS+W+ WL+ ++GFDGWR DF +GY+A++++ Y++N  P   V E+WN ++Y  D
Sbjct  183   LVQRELSDWLRWLRRDVGFDGWRLDFAKGYSAAVARTYVQNARPSFVVAEIWNSLSYDGD  242

Query  755   GKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             GKP  NQD  R EL  WV+  GG ATAFDFTTKGILQ AV GELWR++D DGK PG++G 
Sbjct  243   GKPAANQDGQRQELVNWVKQVGGPATAFDFTTKGILQSAVQGELWRMRDKDGKAPGMIGW  302

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P  AVTFVDNHDTGSTQ  WPFP DKVI GYAYILTHPG+PC+FYDH FDW LK EI  
Sbjct  303   YPEKAVTFVDNHDTGSTQRMWPFPSDKVILGYAYILTHPGVPCIFYDHVFDWNLKQEINA  362

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L + R  N I+  S + +L  +++ YVA +D++VI KIG + DVGN+IP +F++V  G D
Sbjct  363   LAATRKRNGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIDVGNIIPSDFHIVAHGND  422

Query  1295  YVVWEK  1312
             Y VWEK
Sbjct  423   YCVWEK  428



>ref|XP_010061758.1| PREDICTED: alpha-amylase-like [Eucalyptus grandis]
Length=422

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/417 (65%), Positives = 330/417 (79%), Gaps = 3/417 (1%)
 Frame = +2

Query  68    YCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSH  244
             + F L+ +++ A  S  +LFQGFNWES++ +GGWYNSL NL+PDLANAGITHVWLPPPS 
Sbjct  8     WFFVLSISYLAALTSPALLFQGFNWESSEKEGGWYNSLKNLVPDLANAGITHVWLPPPSQ  67

Query  245   SVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIY  424
             S    GYMPGRLYDL+AS YG + +L+ L+ A H N IK +ADIVINHR A  +DSRG++
Sbjct  68    SADQHGYMPGRLYDLNASSYGNQDELKQLIDAFHQNRIKCLADIVINHRTAAKQDSRGVW  127

Query  425   CIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWM  604
             CIFEGGT D+RLDWGP  IC++DTE+SDG GN DTG DF  APDIDHLNPRVQKELS+WM
Sbjct  128   CIFEGGTPDNRLDWGPSFICRNDTEYSDGVGNPDTGEDFEPAPDIDHLNPRVQKELSDWM  187

Query  605   NWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNH  784
             NWLKS+IGFDGW+F+FV+GYA +I+KIYM  TSP   VGE    ++YG DGK + +QD H
Sbjct  188   NWLKSDIGFDGWQFNFVQGYAPNITKIYMNQTSPNFTVGEREEQLSYGEDGKLNPDQDKH  247

Query  785   RNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVD  964
             R  L  WV +AGGA TAFDFTT+GILQ AV GELWRL D  G PPGL+G+ P +AVTF+D
Sbjct  248   RRALVDWVNDAGGAITAFDFTTRGILQAAVQGELWRLMDSKGMPPGLIGLQPGSAVTFID  307

Query  965   NHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEI  1144
             NH+TGSTQ   PFP DKV+QGYAYILTHPG+P +FYDHF   GLK+EI KLI++R  N+I
Sbjct  308   NHNTGSTQKKSPFPYDKVMQGYAYILTHPGVPSIFYDHFL--GLKEEIGKLITIRARNQI  365

Query  1145  SETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             +E SSV+IL  D++ YVA+ID  VI+KIG K +VG+L+P N+ +  SGQDY VWEK+
Sbjct  366   NEKSSVKILASDSDLYVAEIDHGVIMKIGPKFEVGDLVPPNYRIATSGQDYCVWEKE  422



>emb|CAA45903.1| alpha-amylase [Oryza sativa Indica Group]
Length=445

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/409 (65%), Positives = 322/409 (79%), Gaps = 7/409 (2%)
 Frame = +2

Query  101   AFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRL  280
             A G  +LFQGFNWES +  GGWYN L+  + D+  AG+THVWLPPPSHSVS QGYMPGRL
Sbjct  19    ASGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQGYMPGRL  78

Query  281   YDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRL  460
             YDLDAS+YGT  +L++L++ALH  GI+ +AD+VINHRCADYKDSRGIYCIFEGGT D RL
Sbjct  79    YDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGRL  138

Query  461   DWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKS-EIGFDG  637
             DWGP +IC+DDT+FSDGTGN DTGADFA APDIDHLN  VQ+EL++W+ WLKS E+GFD 
Sbjct  139   DWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDEVGFDA  198

Query  638   WRFDFVRGYAASISKIYMENTSP-ELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQN  814
             WR DF RGY+  ++K+Y+E T+P  LAV ELW+ MAYG DGKP+YNQD HR  L  WV  
Sbjct  199   WRLDFARGYSPEVAKVYIEGTTPVGLAVAELWDSMAYGGDGKPEYNQDAHRQALVDWVDR  258

Query  815   aggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
              GG A+A      TTKGI+  AV GELWRL D  GK PG++G  P  AVTFVDNHDTGST
Sbjct  259   VGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIGWWPAKAVTFVDNHDTGST  318

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q  WPFP DKV+QGYAYILTHPG PC+FYDHFFDWGLK++I  L++VR  N ++ TSS++
Sbjct  319   QQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVAVRQRNGVTATSSLK  378

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             I+  DA+AYVA+ID KV++KIGS++DV +LIP  F+  +    Y VWEK
Sbjct  379   IMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFH--LRPWPYAVWEK  425



>gb|EEC84703.1| hypothetical protein OsI_31647 [Oryza sativa Indica Group]
Length=440

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/426 (61%), Positives = 323/426 (76%), Gaps = 0/426 (0%)
 Frame = +2

Query  35    QKMSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGI  214
             ++M+ L  FL          V    + +LFQGFNW+S K QGGWYN L + + D+A+AG+
Sbjct  3     KQMAALCGFLLVALLWLTPDVAHAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASAGV  62

Query  215   THVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRC  394
             TH+WLPPP+HSVSPQGYMPGRLYDL+ASKYGTK +L++L+AA H  GIK VADIV+NHRC
Sbjct  63    THIWLPPPTHSVSPQGYMPGRLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNHRC  122

Query  395   ADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNP  574
             AD KD RG+YCIF+GG     LDWGP +IC DDT++SDGTG+ DTGADFA APDIDHLNP
Sbjct  123   ADDKDGRGVYCIFKGGGPRGCLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHLNP  182

Query  575   RVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSD  754
              VQ+ELS+W+ WL+ ++GFDGWR DF +GY+A++++ Y++N  P   V E+WN ++Y  D
Sbjct  183   LVQRELSDWLRWLRRDVGFDGWRLDFAKGYSAAVARTYIQNARPSFVVAEIWNSLSYDGD  242

Query  755   GKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             GKP  NQD  R EL  WV+  GG ATAFDFTTKGILQ AV GELWR++D DGK PG++G 
Sbjct  243   GKPAANQDGQRQELVNWVKQVGGPATAFDFTTKGILQSAVQGELWRMRDKDGKAPGMIGW  302

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P  AVTFVDNHDTGSTQ  WPFP DKVI GYAYILTHPG+PC+FYDH FDW LK EI  
Sbjct  303   YPEKAVTFVDNHDTGSTQRMWPFPSDKVILGYAYILTHPGVPCIFYDHVFDWNLKQEINA  362

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L + R  N I+  S + +L  +++ YVA +D++VI KIG + DVGN+IP +F++V  G D
Sbjct  363   LAATRKRNGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIDVGNIIPSDFHIVAHGND  422

Query  1295  YVVWEK  1312
             Y VWEK
Sbjct  423   YCVWEK  428



>gb|AAA33886.1| alpha-amylase (EC 3.2.1.1) [Oryza sativa]
Length=434

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/401 (64%), Positives = 317/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A AG+THVWLPPPSHSV+ +GYMPGRLYDL
Sbjct  25    AQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVA-RGYMPGRLYDL  83

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VAD+VINHRCA+ KD+RG+YC+FEGGT D RLDWG
Sbjct  84    DASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTRD-RLDWG  142

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             PG+IC DDT++SDGTG+ DTG  F  APDIDHLNPRVQ+EL++W+NWLKS++GFDGWR D
Sbjct  143   PGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDGWRLD  202

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             F +GY+  I+K+Y+E+  P   V E+WN ++Y  DGKP  NQD  R EL  WV   GG A
Sbjct  203   FAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAVGGPA  262

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
               FDFTTKG+LQ  V GELWRL+D +GK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  263   MTFDFTTKGLLQAGVQGELWRLRDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQKLWPFPS  322

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             DKV+QGYAYILTHPG+PC+FYDH FDW LK EIT L ++R  N I+  S + I+  DA+A
Sbjct  323   DKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVADADA  382

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             YVA +D+KV+VKIG+++DVGN +P +F+  V G+DY VWEK
Sbjct  383   YVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEK  423



>ref|XP_002867631.1| hypothetical protein ARALYDRAFT_492338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43890.1| hypothetical protein ARALYDRAFT_492338 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/428 (63%), Positives = 331/428 (77%), Gaps = 8/428 (2%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAF--GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGI  214
             M++L   L         F PAF   ST+LFQ FNWES K  GG+YNSL N I D+ANAG+
Sbjct  1     MTSLHTLLFTSLLFFIVF-PAFTFSSTLLFQSFNWESWKKDGGFYNSLHNSIDDIANAGV  59

Query  215   THVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRC  394
             TH+WLPPPS SV+P+GY+PG+LYDL++SKYG++ +L++L+ AL+  GIK +ADIVINHR 
Sbjct  60    THLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKSLADIVINHRT  119

Query  395   ADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNP  574
             A+ KD +  YC FEGGTSDDRLDW P  +C++D +F  GTGN DTG DF GAPDIDHLNP
Sbjct  120   AERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFP-GTGNLDTGGDFDGAPDIDHLNP  178

Query  575   RVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSD  754
             RVQKELSEWMNWLKSEIGF GWRFD+VRGYA+S++K+Y++NTSP+ AVGE WNDM YG D
Sbjct  179   RVQKELSEWMNWLKSEIGFHGWRFDYVRGYASSVTKLYVQNTSPDFAVGENWNDMKYGGD  238

Query  755   GKPDYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVG  931
             GK DY+Q+ HR+ L +W++ AGG       FTTKGILQ AV GELWRLKD  GKPPGL+G
Sbjct  239   GKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGLIG  298

Query  932   ISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEIT  1111
             I+P NAVTF+DNHDT  T   W FP DKV+ GY YILTHPGIPC+FY+H+ +WGLK+ I+
Sbjct  299   INPGNAVTFIDNHDTFRT---WTFPSDKVLLGYVYILTHPGIPCIFYNHYIEWGLKESIS  355

Query  1112  KLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQ  1291
             KL+++R  N I  TSSV I   +++ YVA IDDKVI+KIG K DVG L+P NF +  SG 
Sbjct  356   KLVAIRNKNGIGNTSSVTIKVAESDLYVANIDDKVIMKIGPKQDVGTLVPSNFALAYSGL  415

Query  1292  DYVVWEKK  1315
             D+ VWEKK
Sbjct  416   DFAVWEKK  423



>ref|NP_001169611.1| uncharacterized protein LOC100383492 precursor [Zea mays]
 gb|ACN34260.1| unknown [Zea mays]
 tpg|DAA48441.1| TPA: putative alpha-amylase family protein [Zea mays]
Length=441

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/405 (63%), Positives = 317/405 (78%), Gaps = 2/405 (0%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWYN L   + D+A AG+THVWLPPPSHSVSPQGYMPGRLYDL
Sbjct  28    AQVLFQGFNWESCKQQGGWYNRLKAQVDDIAKAGVTHVWLPPPSHSVSPQGYMPGRLYDL  87

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYGT  +L++L+AA H  G++ VADIVINHRCA+ KD+RG+YCIFEGGT DDRLDWG
Sbjct  88    DASKYGTAAELKSLIAAFHGRGVQCVADIVINHRCAEKKDARGVYCIFEGGTPDDRLDWG  147

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSE-IGFDGWRF  646
             PG+IC DDT++SDGTG+ DTG  FA APDIDHLNPRVQ+ELS W+NWL+S+ +GFDGWR 
Sbjct  148   PGMICSDDTQYSDGTGHRDTGEGFAAAPDIDHLNPRVQRELSAWLNWLRSDAVGFDGWRL  207

Query  647   DFVRGYAASISKIYMENTS-PELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagg  823
             DF +GY+ +++++Y+E+T  P   V E+WN ++Y  DGKP  NQD  R EL  W +  GG
Sbjct  208   DFAKGYSPAVARMYVESTGPPSFVVAEIWNSLSYSGDGKPAPNQDQCRQELLDWTRAVGG  267

Query  824   aatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPF  1003
              A AFDF TKG+LQ  V GELWRL+D  G   GL+G +P  AVTFVDNHDTGSTQ  WPF
Sbjct  268   PAMAFDFPTKGLLQAGVQGELWRLRDSSGNAAGLIGWAPEKAVTFVDNHDTGSTQKLWPF  327

Query  1004  PKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDA  1183
             P DKV+QGYAYILTHPG+PC+FYDH FDW LK EI+ L ++R  N I   S + IL  DA
Sbjct  328   PSDKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEISTLSAIRARNGIRAGSKLRILVADA  387

Query  1184  NAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             +AYVA +D+KV+VKIG+++ V +++P +F+    G+DY VWEK +
Sbjct  388   DAYVAVVDEKVMVKIGTRYGVSSVVPSDFHPAAHGKDYCVWEKAS  432



>gb|AAA32925.1| alpha-amylase 1 [Hordeum vulgare]
Length=427

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 313/401 (78%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFN ES KH GGWYN L+  + D+A AGITHVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNSESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A++KD RGIYCIFEG T D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGDTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHLN RVQKEL EW+NWLK++   DGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADHRLDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG   A
Sbjct  206   KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+SVRT + I   S ++I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVGNLIP  F V   G DY VW+K
Sbjct  386   YLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWQK  426



>emb|CAA39776.1| alpha-amylase [Oryza sativa Japonica Group]
Length=440

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/426 (61%), Positives = 322/426 (76%), Gaps = 0/426 (0%)
 Frame = +2

Query  35    QKMSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGI  214
             ++M+ L  FL          V    + +LFQGFNW+S K QGGWYN L + + D+A+AG+
Sbjct  3     KQMAALCGFLLVALLWLTPDVAHAQTQILFQGFNWDSWKKQGGWYNMLKDQVGDIASAGV  62

Query  215   THVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRC  394
             THVWLPPP+HSVSPQGYMPGRLYDL+ASKYGTK +L++L+AA H  GIK VADIV+NHRC
Sbjct  63    THVWLPPPTHSVSPQGYMPGRLYDLNASKYGTKAELKSLIAAFHAKGIKCVADIVVNHRC  122

Query  395   ADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNP  574
             AD KD RG+YCIF+GG     LDWGP +IC DDT++SDGTG+ DTGADFA APDIDHLNP
Sbjct  123   ADDKDGRGVYCIFKGGGPRGCLDWGPSMICCDDTQYSDGTGHRDTGADFAAAPDIDHLNP  182

Query  575   RVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSD  754
              VQ+ELS+W+ WL+ ++GFDGWR DF +GY+A++++ Y++N  P   V E+WN ++Y  D
Sbjct  183   LVQRELSDWLRWLRRDVGFDGWRLDFAKGYSAAVARTYVQNARPSFVVAEIWNSLSYDGD  242

Query  755   GKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             GKP  NQD  R EL  WV+  GG ATAFDFTTKGILQ AV GELWR++D DGK PG++G 
Sbjct  243   GKPAANQDGQRQELVNWVKQVGGPATAFDFTTKGILQSAVQGELWRMRDKDGKAPGMIGW  302

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P  AVTFVDNHDTGSTQ  WPFP DKVI GYAYILTHPG+PC+FYD  FDW LK EI  
Sbjct  303   YPEKAVTFVDNHDTGSTQRMWPFPSDKVILGYAYILTHPGVPCIFYDQVFDWNLKQEINA  362

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L + R  N I+  S + +L  +++ YVA +D++VI KIG + +VGN+IP +F++V  G D
Sbjct  363   LAATRKRNGINAGSKLRVLAAESDMYVAMVDERVITKIGPRIEVGNIIPSDFHIVAHGND  422

Query  1295  YVVWEK  1312
             Y VWEK
Sbjct  423   YCVWEK  428



>ref|XP_006647962.1| PREDICTED: alpha-amylase-like [Oryza brachyantha]
Length=427

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/423 (62%), Positives = 317/423 (75%), Gaps = 5/423 (1%)
 Frame = +2

Query  56    QFLSYCFCLACAFVPAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLP  232
             QFLS    +      +     VL QGFNWES +  GGWYN L+  + D+A AG+THVWLP
Sbjct  5     QFLSLFVVVFLGLSSSLALGQVLMQGFNWESWRENGGWYNLLMGKVDDIAAAGVTHVWLP  64

Query  233   PPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDS  412
             PPSHSV+ QGYMPGRLYDLDASKYG + QL++L+ A H  G+KV+ADIVINHR A+ KD 
Sbjct  65    PPSHSVAEQGYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVKVIADIVINHRTAERKDG  124

Query  413   RGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKEL  592
             RGIYC+FEGGT D RLDWGP +IC+DD  +SDGTGN DTGADFA APDIDHLN RVQ+EL
Sbjct  125   RGIYCLFEGGTPDSRLDWGPHMICRDDP-YSDGTGNPDTGADFAAAPDIDHLNKRVQREL  183

Query  593   SEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYN  772
               W++WLK +IGFD WR DF +GY+A ++KIY++NT P  AV E+W  +AYG DGKPDY+
Sbjct  184   IGWLDWLKMDIGFDAWRLDFAKGYSADVAKIYIDNTEPSFAVAEIWTSLAYGGDGKPDYD  243

Query  773   QDNHRNELSRWVQNaggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPR  943
             Q++HR EL  WV   GGA++       TTKGIL VAV GELWRL+  DGK PG++G  P 
Sbjct  244   QNSHRQELVNWVDRVGGASSNATAFDFTTKGILNVAVEGELWRLRAADGKAPGMIGWWPA  303

Query  944   NAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLIS  1123
              AVTFVDNHDTGSTQ  WPFP DKV+QG AYILTHPG PC+FYDHFFDWG K+EI +L+S
Sbjct  304   KAVTFVDNHDTGSTQHMWPFPSDKVMQGSAYILTHPGHPCIFYDHFFDWGHKEEIERLVS  363

Query  1124  VRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVV  1303
             +R  N I   S + I+  DA+ Y+A+ID KVIVKIGS++DV +LIP  F VV  G  Y V
Sbjct  364   IRDQNGIHAESELHIMEADADLYLAEIDGKVIVKIGSRYDVEHLIPEGFQVVAHGDGYAV  423

Query  1304  WEK  1312
             WEK
Sbjct  424   WEK  426



>sp|P04750.2|AMY6_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Clones GRAMY56 
and 963; Flags: Precursor [Hordeum vulgare]
 emb|CAA33299.1| alpha amylase [Hordeum vulgare]
 prf||1609234B high pI alpha amylase
Length=429

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/434 (62%), Positives = 324/434 (75%), Gaps = 10/434 (2%)
 Frame = +2

Query  23    INNPQKMSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLA  202
             + N     +LF  L     L+C+        VLFQGFNWES KH GGWYN L+  + D+A
Sbjct  1     MANKHMSLSLFIVL---LGLSCSLASG---QVLFQGFNWESWKHNGGWYNFLMGKVDDIA  54

Query  203   NAGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVI  382
              AG+THVWLPP S SV+ QGYMPGRLYDLDASKYG K QL++L+ ALH   +K +ADIVI
Sbjct  55    AAGVTHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKAVKAIADIVI  114

Query  383   NHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGN--ADTGADFAGAPD  556
             NHR A+ KD RGIYCIFEGGT D RLDWGP +IC+DD  + DGTGN    T ADF  APD
Sbjct  115   NHRTAERKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYPDGTGNRPTRTRADFGAAPD  174

Query  557   IDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWND  736
             IDHLNPRVQKEL EW+NWL+++ GFDGWRFDF +GY+A ++KIY++ + P  AV E+W  
Sbjct  175   IDHLNPRVQKELVEWLNWLRTDDGFDGWRFDFAKGYSADVAKIYVDRSEPSFAVAEIWTS  234

Query  737   MAYGSDGKPDYNQDNHRNELSRWVQNagga--atafdfttKGILQVAVLGELWRLKDPDG  910
             +AYG DGKP+ NQD HR EL  WV   GG+  AT FDFTTKGIL VAV GELWRL+  DG
Sbjct  235   LAYGGDGKPNLNQDPHRQELVNWVNKVGGSGPATTFDFTTKGILNVAVEGELWRLRGTDG  294

Query  911   KPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDW  1090
             K PG++G  P  AVTFVDNHDTGSTQ  WPFP D+V+QGYAYILTHPG PC+FYDHFFDW
Sbjct  295   KAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGNPCIFYDHFFDW  354

Query  1091  GLKDEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNF  1270
             GLK+EI +L+S+RT   I   S ++I+  DA+ Y+A+I+ KVIVK+G ++DVG+LIP  F
Sbjct  355   GLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIEGKVIVKLGPRYDVGHLIPEGF  414

Query  1271  NVVVSGQDYVVWEK  1312
              VV  G DY VWEK
Sbjct  415   KVVAHGNDYAVWEK  428



>ref|XP_002510219.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52406.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1113

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 327/420 (78%), Gaps = 2/420 (0%)
 Frame = +2

Query  56    QFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPP  235
             + L + F L+  F  +  S +LFQGFNWES    GGWYN L N I D+ANAGITHVWLPP
Sbjct  8     EILFWLFLLSI-FPLSTSSALLFQGFNWESCNKGGGWYNLLKNSILDIANAGITHVWLPP  66

Query  236   PSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSR  415
             PS SVSPQGYMPGRLYDL+AS+YGT+ +L++L+ A H  GIK +ADIVINHR A+ KD R
Sbjct  67    PSQSVSPQGYMPGRLYDLNASRYGTQDELKSLIRAFHHKGIKCLADIVINHRTAEKKDER  126

Query  416   GIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELS  595
             GI+CIFEGGT DDRLDWGP  IC DDT FSDGTGN DTG D+  APDIDHLNPRVQKELS
Sbjct  127   GIWCIFEGGTDDDRLDWGPSFICCDDTVFSDGTGNPDTGEDYPPAPDIDHLNPRVQKELS  186

Query  596   EWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQ  775
             +WMNWLK EIGF GWRFDF +GY+ +I KIYME   P  AVGE W+ ++YG D KPDYNQ
Sbjct  187   DWMNWLKLEIGFGGWRFDFAKGYSPTIMKIYMEQIPPGFAVGEKWDSLSYGQDWKPDYNQ  246

Query  776   DNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVT  955
             D HRN L  W+Q +GG  TAFDFTTKGILQ AV GELWRL D +G PPGL+GI P+NAVT
Sbjct  247   DAHRNALKDWIQASGGVITAFDFTTKGILQAAVQGELWRLIDSNGNPPGLIGIMPQNAVT  306

Query  956   FVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTS  1135
             F+DNHDTGSTQ  WPFP DKV+QGYAYILTHPGIP +FYDHFFDWGLK++I+KL S+R +
Sbjct  307   FIDNHDTGSTQQLWPFPSDKVMQGYAYILTHPGIPTIFYDHFFDWGLKEQISKLASIRKN  366

Query  1136  NEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYN-FNVVVSGQDYVVWEK  1312
               I   S ++IL  +++ Y+A I+D VI+KIG + D+GNL+P   F V  SG+ Y VW K
Sbjct  367   YGIDSRSGMKILAAESDLYMAAINDNVIMKIGPRMDLGNLLPSKEFQVATSGESYAVWVK  426



>ref|NP_567714.1| alpha-amylase 1 [Arabidopsis thaliana]
 sp|Q8VZ56.1|AMY1_ARATH RecName: Full=Alpha-amylase 1; Short=AtAMY1; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL38709.1| putative alpha-amylase [Arabidopsis thaliana]
 gb|AAM51369.1| putative alpha-amylase [Arabidopsis thaliana]
 gb|AEE84990.1| alpha-amylase 1 [Arabidopsis thaliana]
Length=423

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/427 (62%), Positives = 328/427 (77%), Gaps = 6/427 (1%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAF-VPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             M++L   L         F    F ST+LFQ FNWES K +GG+YNSL N I D+ANAGIT
Sbjct  1     MTSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGIT  60

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             H+WLPPPS SV+P+GY+PG+LYDL++SKYG++ +L++L+ AL+  GIK +ADIVINHR A
Sbjct  61    HLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTA  120

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             + KD +  YC FEGGTSDDRLDW P  +C++D +F  GTGN DTG DF GAPDIDHLNPR
Sbjct  121   ERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFP-GTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQKELSEWMNWLK+EIGF GWRFD+VRGYA+SI+K+Y++NTSP+ AVGE W+DM YG DG
Sbjct  180   VQKELSEWMNWLKTEIGFHGWRFDYVRGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDG  239

Query  758   KPDYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             K DY+Q+ HR+ L +W++ AGG       FTTKGILQ AV GELWRLKD  GKPPG++GI
Sbjct  240   KLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGMIGI  299

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P NAVTF+DNHDT  T   W FP DKV+ GY YILTHPG PC+FY+H+ +WGLK+ I+K
Sbjct  300   MPGNAVTFIDNHDTFRT---WVFPSDKVLLGYVYILTHPGTPCIFYNHYIEWGLKESISK  356

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L+++R  N I  TSSV I   +A+ Y+A IDDKVI+KIG K DVG L+P NF +  SG D
Sbjct  357   LVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSNFALAYSGLD  416

Query  1295  YVVWEKK  1315
             + VWEKK
Sbjct  417   FAVWEKK  423



>gb|AAM64582.1| alpha-amylase-like protein [Arabidopsis thaliana]
Length=423

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/427 (62%), Positives = 328/427 (77%), Gaps = 6/427 (1%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAF-VPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             M++L   L         F    F ST+LFQ FNWES K +GG+YNSL N I D+ANAGIT
Sbjct  1     MTSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGIT  60

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             H+WLPPPS SV+P+GY+PG+LYDL++SKYG++ +L++L+ AL+  GIK +ADIVINHR A
Sbjct  61    HLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTA  120

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             + KD +  YC FEGGTSDDRLDW P  +C++D +F  GTGN DTG DF GAPDIDHLNPR
Sbjct  121   ERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFP-GTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQKELSEWMNWLK+EIGF GWRFD+VRGYA+SI+K+Y++NTSP+ AVGE W+DM YG DG
Sbjct  180   VQKELSEWMNWLKTEIGFHGWRFDYVRGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDG  239

Query  758   KPDYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             K DY+Q+ HR+ L +W++ AGG       FTTKGILQ AV GELWRLKD  GKPPG++GI
Sbjct  240   KLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGMIGI  299

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P NAVTF+DNHDT  T   W FP DKV+ GY YILTHPG PC+FY+H+ +WGLK+ I+K
Sbjct  300   MPGNAVTFIDNHDTFRT---WVFPSDKVLLGYVYILTHPGTPCIFYNHYIEWGLKESISK  356

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L+++R  N I  TSSV I   +A+ Y+A IDDKVI+KIG K DVG L+P NF +  SG D
Sbjct  357   LVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSNFALAYSGLD  416

Query  1295  YVVWEKK  1315
             + +WEKK
Sbjct  417   FAIWEKK  423



>ref|XP_010320333.1| PREDICTED: alpha-amylase isoform X2 [Solanum lycopersicum]
Length=351

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/351 (75%), Positives = 298/351 (85%), Gaps = 0/351 (0%)
 Frame = +2

Query  266   MPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGT  445
             MPGRLYDLDASK+G +QQL+ L+ ALHD+GIK VADIVINHR AD KDSRGIY IFEGGT
Sbjct  1     MPGRLYDLDASKFGNQQQLKTLIKALHDHGIKSVADIVINHRTADNKDSRGIYSIFEGGT  60

Query  446   SDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEI  625
             SDDRLDWGP  ICK+DT++SDGTGN DTG DF  APDIDHLN RVQKELS+WMNWLKSEI
Sbjct  61    SDDRLDWGPSFICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTRVQKELSDWMNWLKSEI  120

Query  626   GFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRW  805
             GFDGWRFDFVRGYA  I+KIYM NTSP+ AVGELWN +AYG DGKP+YNQDNHRNEL  W
Sbjct  121   GFDGWRFDFVRGYAPCITKIYMGNTSPDFAVGELWNSLAYGQDGKPEYNQDNHRNELVGW  180

Query  806   VQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
             V+NAG A TAFDFTTKGILQ AV  ELWRLKDP+GKPPG++G+ PR AVTF+DNHDTGST
Sbjct  181   VKNAGRAVTAFDFTTKGILQAAVQEELWRLKDPNGKPPGMIGVLPRKAVTFIDNHDTGST  240

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q+ WPFP DKV+QGYAYILTHPGIP +FYDHFFDWG KD I+ LIS+R  N I  TS+V+
Sbjct  241   QNMWPFPSDKVMQGYAYILTHPGIPSVFYDHFFDWGFKDGISALISIRKRNRICATSNVQ  300

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             I+  D++ Y+A I  K+IVKIG K D+GNLIP N+ V  SGQDY VWE+KA
Sbjct  301   IMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDYAVWEQKA  351



>gb|AAM09952.1| alpha-amylase [Eleusine coracana subsp. coracana]
Length=403

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/401 (65%), Positives = 316/401 (79%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             +LFQGFNWES K  GGWYN L+  +  +A AGITHVWLPPPSHSV+ QGYMPGRLYDLDA
Sbjct  2     ILFQGFNWESWKQNGGWYNLLMGKVDVIAAAGITHVWLPPPSHSVAEQGYMPGRLYDLDA  61

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G+KV+ADIVINHR A+++DSRGIYC+FEGGT D RLDWGP 
Sbjct  62    SKYGNEAQLKSLIQAFHAKGVKVIADIVINHRTAEHQDSRGIYCMFEGGTPDTRLDWGPH  121

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD+ ++DGTGN DTGADF GAPDIDHLN RVQ+EL  W+NWLK++IGFD WR DF 
Sbjct  122   MICRDDSPYADGTGNPDTGADFGGAPDIDHLNTRVQQELIGWLNWLKTDIGFDAWRLDFA  181

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++KIY+++T P  AV E+W  +AYG DGKP+Y+Q  HR EL  WV   G +  A
Sbjct  182   KGYSADVAKIYIDSTEPSFAVAEIWTSLAYGGDGKPNYDQSAHRQELVNWVDRVGRSGPA  241

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTF+DNHDTGSTQ  WPFP 
Sbjct  242   TTFDFTTKGILNVAVDGELWRLRGNDGKAPGMIGWWPAKAVTFIDNHDTGSTQHMWPFPA  301

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             +KV+QGYAYILTHPG PC+FYDHFFDWGLKDEI +L+S+R  + I   S +  +  DA+ 
Sbjct  302   NKVMQGYAYILTHPGNPCIFYDHFFDWGLKDEIVQLVSIRNRHGIHPESELRAIEADADL  361

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVI K+G+++DVG+LIP  F VV  G  Y VWEK
Sbjct  362   YLAEIDGKVITKLGTRYDVGHLIPDGFQVVAHGDGYAVWEK  402



>ref|XP_002452881.1| hypothetical protein SORBIDRAFT_04g034150 [Sorghum bicolor]
 gb|EES05857.1| hypothetical protein SORBIDRAFT_04g034150 [Sorghum bicolor]
Length=428

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/424 (63%), Positives = 315/424 (74%), Gaps = 9/424 (2%)
 Frame = +2

Query  65    SYCFC-----LACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWL  229
             S C C     L  +F  A G  VLFQGFNWES K  GGWY  L++ + D+A AGITHVWL
Sbjct  5     SLCMCFFLVFLGLSFNLALGQ-VLFQGFNWESWKQNGGWYKFLMDKVDDIAEAGITHVWL  63

Query  230   PPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKD  409
             PPPSHSV+ QGY+PGRLYDLDASKYG K QL++L+ A HD G+KV+ADIVINHR A++KD
Sbjct  64    PPPSHSVAEQGYLPGRLYDLDASKYGNKAQLKSLIKAFHDKGVKVIADIVINHRTAEHKD  123

Query  410   SRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKE  589
              RGIYC+FEGGTSD RLDWGP +IC+DD  +SDGTGN DTG DF GAPDIDHLN RVQ+E
Sbjct  124   GRGIYCLFEGGTSDSRLDWGPHMICRDDKAYSDGTGNLDTGLDFPGAPDIDHLNKRVQRE  183

Query  590   LSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDY  769
             L  W+ WL+++IGFD WR DF +GY+A ++KI+++N  P  AV ELW+ +AYG DGKP  
Sbjct  184   LIGWLKWLQTDIGFDAWRLDFAKGYSAEVAKIFIDNAKPSFAVAELWSSLAYGGDGKPLQ  243

Query  770   NQDNHRNELSRWVQNaggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
             +Q+ HR EL  WV   GG A+       TTKGIL VAV GELWRL+  DGK PG++G  P
Sbjct  244   DQNAHRQELVNWVDRVGGKASPATTFDFTTKGILNVAVDGELWRLRGADGKAPGMIGWWP  303

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
               AVTFVDNHDTGSTQ  WPFP DKVIQGYAYILTHPG PC+FYDHFFD GLK+EI +L+
Sbjct  304   AKAVTFVDNHDTGSTQHMWPFPADKVIQGYAYILTHPGNPCIFYDHFFDSGLKNEIAQLV  363

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             S+R  + I   S + I+  DA+ Y+A+IDDKVIVKIG +     LIP  F VV  G  Y 
Sbjct  364   SIRNRHGIQPDSKLRIIKADADLYLAEIDDKVIVKIGPRFGASQLIPGGFQVVAHGNGYA  423

Query  1301  VWEK  1312
             VWEK
Sbjct  424   VWEK  427



>ref|XP_002454601.1| hypothetical protein SORBIDRAFT_04g034140 [Sorghum bicolor]
 gb|EES07577.1| hypothetical protein SORBIDRAFT_04g034140 [Sorghum bicolor]
Length=428

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/402 (65%), Positives = 312/402 (78%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             +LFQGFNWES K  GGWYN ++  + D+A AGITHVWLPP SHS++ QGY+PGRLYDLDA
Sbjct  26    ILFQGFNWESWKQNGGWYNFMMGKVDDIAEAGITHVWLPPASHSLAEQGYLPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A HD G+KV+ADIVINHR A+++D RGIYC+FEGGT D RLDWGP 
Sbjct  86    SKYGNEAQLKSLIEAFHDKGVKVIADIVINHRTAEHEDGRGIYCLFEGGTPDSRLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC DD  +SDGTGN DTGADF GAPDIDHLNPRVQ+EL  W+NWLK++IGFD WR DF 
Sbjct  146   MICSDDRTYSDGTGNPDTGADFGGAPDIDHLNPRVQRELIGWLNWLKTDIGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRW---VQNagga  826
             +GY+A ++K+Y++NT P  AV E+W  +AYG DGKP Y+Q+ HR EL  W   V      
Sbjct  206   KGYSADVAKVYIDNTEPCFAVAEIWTSLAYGGDGKPFYDQNAHRQELVNWLDRVGGKASP  265

Query  827   atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
             AT FDFTTKGIL VAV GELWRL+  DGK PGL+G  P  AVTFVDNHDTGSTQ  WPFP
Sbjct  266   ATTFDFTTKGILNVAVDGELWRLRGADGKAPGLIGWWPAKAVTFVDNHDTGSTQHMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI  L+S+R  + I   S + I+  DA+
Sbjct  326   ADKVMQGYAYILTHPGNPSIFYDHFFDWGLKNEIAHLVSIRDRHGIQADSELRIIEADAD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVIVKIGS++D  +LIP  F VVV G  Y VWEK
Sbjct  386   LYLAEIDGKVIVKIGSRYDCDHLIPEGFQVVVHGDGYAVWEK  427



>ref|NP_001150278.1| alpha-amylase precursor [Zea mays]
 gb|ACF87219.1| unknown [Zea mays]
 gb|ACG38489.1| alpha-amylase precursor [Zea mays]
Length=428

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/402 (65%), Positives = 311/402 (77%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             +LFQGFNWES K  GGWYN L+  + D+A AGITHVWLPP SHS++ QGY+PGRLYDLDA
Sbjct  26    ILFQGFNWESWKQNGGWYNFLMGKVDDIAEAGITHVWLPPASHSLAEQGYLPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G+KV+ADIVINHR A+++D RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNEAQLKSLIEAFHSKGVKVIADIVINHRTAEHQDGRGIYCIFEGGTPDSRLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC DD  +SDGTGN DTGADF GAPDIDHLNPRVQ+EL+ W+NWLK+++GFD WR DF 
Sbjct  146   MICSDDRAYSDGTGNPDTGADFGGAPDIDHLNPRVQQELTGWLNWLKTDVGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRW---VQNagga  826
             +GY+A ++K+Y++ T P  AV E+W  +AYG DGKP Y+Q+ HR EL  W   V      
Sbjct  206   KGYSADVAKVYIDGTQPCFAVAEIWTSLAYGGDGKPFYDQNAHRQELVSWLDRVGGKASP  265

Query  827   atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
             AT FDFTTKGIL VAV GELWRL+  DGK PGL+G  P  AVTFVDNHDTGSTQ  WPFP
Sbjct  266   ATTFDFTTKGILNVAVDGELWRLRGADGKAPGLIGWWPAKAVTFVDNHDTGSTQHMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI  L+S+R  + I   S + I+  DA+
Sbjct  326   ADKVMQGYAYILTHPGNPSIFYDHFFDWGLKNEIAHLVSIRDRHGIQADSELRIIEADAD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVIVKIGS++D G+LIP  F VV  G  Y VWEK
Sbjct  386   LYLAEIDGKVIVKIGSRYDCGHLIPEGFQVVAHGDGYAVWEK  427



>ref|XP_010108610.1| hypothetical protein L484_006341 [Morus notabilis]
 gb|EXC19766.1| hypothetical protein L484_006341 [Morus notabilis]
Length=425

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/419 (64%), Positives = 328/419 (78%), Gaps = 6/419 (1%)
 Frame = +2

Query  71    CFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
               CL  +  P F S T+LFQGFNW S+++  GWYNSL N IPDLA  GITHVWLPPPSHS
Sbjct  9     LLCLFISLFPPFTSPTILFQGFNWASSEN-AGWYNSLKNTIPDLAKVGITHVWLPPPSHS  67

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
              + QGY+PGRLYDL+ASKYGT+++L++L+AAL + GIKV+ADIV+NHR A+ +D RGI C
Sbjct  68    AADQGYLPGRLYDLNASKYGTQEELKSLIAALREKGIKVIADIVLNHRSAEKRDERGILC  127

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGTSD RLDWGP  IC+DDTEFSDGTGN DTG  +   PDIDHLNP+VQ+ELSEWMN
Sbjct  128   IFEGGTSDARLDWGPSFICRDDTEFSDGTGNLDTGDSWGEVPDIDHLNPQVQRELSEWMN  187

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWN--DMAYGSDGKPDYNQDN  781
             WLK+EIGF GWRFD VRGYA +I+KIYME TSPE AVGE W+  + A G DGKP+ NQD 
Sbjct  188   WLKTEIGFVGWRFDMVRGYAPNITKIYMEQTSPEFAVGEKWDRQEFAVGEDGKPNANQDY  247

Query  782   HRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFV  961
             HR  L  WV+ AGG+ TAFDFTTKGILQ AV GELWRLKD +GKPPGL+GI P +AVTF+
Sbjct  248   HRGLLVNWVEAAGGSVTAFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGIKPESAVTFI  307

Query  962   DNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFF-DWGLKDEITKLISVRTSN  1138
             DNHDT S Q  WPFP+DK++ GY YILTHPGIP +FYDH F    L   I+ + ++R  +
Sbjct  308   DNHDTWS-QKLWPFPEDKIMLGYVYILTHPGIPTIFYDHLFIKRELMAPISNVTAIRNRH  366

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              I+  S V IL  +A+ Y+++ID+K+I+KIG K D+GNL+P ++ V  SGQD+ VWEKK
Sbjct  367   GINSRSVVNILAAEADLYMSRIDEKIIMKIGPKTDLGNLLPSDYQVAYSGQDFAVWEKK  425



>ref|XP_004954023.1| PREDICTED: alpha-amylase-like [Setaria italica]
Length=427

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/426 (62%), Positives = 319/426 (75%), Gaps = 2/426 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             M++    L+    L      +    VLFQGFNWES K  GGWYN L+  + D+A AGITH
Sbjct  1     MASKGMLLALFIALLGLSSNSAAGQVLFQGFNWESWKQNGGWYNFLMGKVDDIAEAGITH  60

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             VWLPP SHS++ QGY+PGRLYDLDAS+YG + QL++L+ A HD G+KV+ADIVINHR A+
Sbjct  61    VWLPPASHSLAEQGYLPGRLYDLDASRYGNEAQLKSLIEAFHDKGVKVIADIVINHRTAE  120

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
             ++D RGIYC+FEGGT D RLDWGP +IC DD  +SDGTGN DTGADF GAPDIDHLNPRV
Sbjct  121   HQDGRGIYCMFEGGTPDSRLDWGPHMICSDDRAYSDGTGNPDTGADFGGAPDIDHLNPRV  180

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             Q+EL  W+NWLK++IGFD WR DF +GY+A ++K+Y++NT P  AV E+W  +AYG DGK
Sbjct  181   QRELIGWLNWLKTDIGFDAWRLDFAKGYSADVAKVYIDNTEPCFAVAEIWTSLAYGGDGK  240

Query  761   PDYNQDNHRNELSRWVQNagga--atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             P Y+Q+ HR EL  WV   G +  AT FDFTTKGIL VAV GELWRL+  DGK PGL+G 
Sbjct  241   PYYDQNAHRQELVNWVDRVGRSGPATTFDFTTKGILNVAVDGELWRLRGADGKAPGLIGW  300

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITK  1114
              P  AVTF+DNHDTGSTQ  WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI  
Sbjct  301   WPAKAVTFIDNHDTGSTQHMWPFPADKVMQGYAYILTHPGSPMIFYDHFFDWGLKNEIAH  360

Query  1115  LISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQD  1294
             L+S+R  + I   S + I+  DA+ Y+A+ID KVIVKIGS+ D  +LIP  F+V   G  
Sbjct  361   LVSIRDRHGIQPDSELHIIEADADLYLAEIDGKVIVKIGSRFDCEHLIPEGFHVTAHGDG  420

Query  1295  YVVWEK  1312
             Y VWEK
Sbjct  421   YAVWEK  426



>gb|AFW73583.1| putative alpha-amylase family protein [Zea mays]
Length=480

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/402 (65%), Positives = 311/402 (77%), Gaps = 3/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             +LFQGFNWES K  GGWYN L+  + D+A AGITHVWLPP SHS++ QGY+PGRLYDLDA
Sbjct  78    ILFQGFNWESWKQNGGWYNFLMGKVDDIAEAGITHVWLPPASHSLAEQGYLPGRLYDLDA  137

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G+KV+ADIVINHR A+++D RGIYCIFEGGT D RLDWGP 
Sbjct  138   SKYGNEAQLKSLIEAFHSKGVKVIADIVINHRTAEHQDGRGIYCIFEGGTPDSRLDWGPH  197

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC DD  +SDGTGN DTGADF GAPDIDHLNPRVQ+EL+ W+NWLK+++GFD WR DF 
Sbjct  198   MICSDDRAYSDGTGNPDTGADFGGAPDIDHLNPRVQQELTGWLNWLKTDVGFDAWRLDFA  257

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRW---VQNagga  826
             +GY+A ++K+Y++ T P  AV E+W  +AYG DGKP Y+Q+ HR EL  W   V      
Sbjct  258   KGYSADVAKVYIDGTQPCFAVAEIWTSLAYGGDGKPFYDQNAHRQELVSWLDRVGGKASP  317

Query  827   atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
             AT FDFTTKGIL VAV GELWRL+  DGK PGL+G  P  AVTFVDNHDTGSTQ  WPFP
Sbjct  318   ATTFDFTTKGILNVAVDGELWRLRGADGKAPGLIGWWPAKAVTFVDNHDTGSTQHMWPFP  377

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG P +FYDHFFDWGLK+EI  L+S+R  + I   S + I+  DA+
Sbjct  378   ADKVMQGYAYILTHPGNPSIFYDHFFDWGLKNEIAHLVSIRDRHGIQADSELRIIEADAD  437

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVIVKIGS++D G+LIP  F VV  G  Y VWEK
Sbjct  438   LYLAEIDGKVIVKIGSRYDCGHLIPEGFQVVAHGDGYAVWEK  479



>emb|CAB36742.1| alpha-amylase-like protein [Arabidopsis thaliana]
 emb|CAB79409.1| alpha-amylase-like protein [Arabidopsis thaliana]
Length=428

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/432 (62%), Positives = 328/432 (76%), Gaps = 11/432 (3%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAF-VPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             M++L   L         F    F ST+LFQ FNWES K +GG+YNSL N I D+ANAGIT
Sbjct  1     MTSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGIT  60

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             H+WLPPPS SV+P+GY+PG+LYDL++SKYG++ +L++L+ AL+  GIK +ADIVINHR A
Sbjct  61    HLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTA  120

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             + KD +  YC FEGGTSDDRLDW P  +C++D +F  GTGN DTG DF GAPDIDHLNPR
Sbjct  121   ERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFP-GTGNLDTGGDFDGAPDIDHLNPR  179

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQKELSEWMNWLK+EIGF GWRFD+VRGYA+SI+K+Y++NTSP+ AVGE W+DM YG DG
Sbjct  180   VQKELSEWMNWLKTEIGFHGWRFDYVRGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDG  239

Query  758   KPDYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGI  934
             K DY+Q+ HR+ L +W++ AGG       FTTKGILQ AV GELWRLKD  GKPPG++GI
Sbjct  240   KLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGMIGI  299

Query  935   SPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPC-----LFYDHFFDWGLK  1099
              P NAVTF+DNHDT  T   W FP DKV+ GY YILTHPG PC     LFY+H+ +WGLK
Sbjct  300   MPGNAVTFIDNHDTFRT---WVFPSDKVLLGYVYILTHPGTPCIVSIILFYNHYIEWGLK  356

Query  1100  DEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVV  1279
             + I+KL+++R  N I  TSSV I   +A+ Y+A IDDKVI+KIG K DVG L+P NF + 
Sbjct  357   ESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSNFALA  416

Query  1280  VSGQDYVVWEKK  1315
              SG D+ VWEKK
Sbjct  417   YSGLDFAVWEKK  428



>ref|XP_006413356.1| hypothetical protein EUTSA_v10025232mg [Eutrema salsugineum]
 gb|ESQ54809.1| hypothetical protein EUTSA_v10025232mg [Eutrema salsugineum]
Length=437

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/414 (64%), Positives = 317/414 (77%), Gaps = 7/414 (2%)
 Frame = +2

Query  89    AFVPAF--GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQG  262
              F P F   + +LFQGF WES K +GG+YNSL N I D++N+GITH+WLPPPS SVSP+G
Sbjct  18    VFFPTFTFSTLLLFQGFKWESWKQEGGFYNSLQNSIDDISNSGITHIWLPPPSQSVSPEG  77

Query  263   YMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGG  442
             Y+PG+LYDL++SKYG++ +L++L+AAL+  GIK VADIVINHR  + KD    YC FEGG
Sbjct  78    YLPGKLYDLNSSKYGSETELKSLIAALNQRGIKSVADIVINHRTGERKDDHCGYCYFEGG  137

Query  443   TSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSE  622
             TSD RLDW P  +C+DD +F  GTGN+DTG DF GAPDIDHLNPRVQKELSEWMNWLKSE
Sbjct  138   TSDGRLDWDPSFVCRDDPKFP-GTGNSDTGKDFDGAPDIDHLNPRVQKELSEWMNWLKSE  196

Query  623   IGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSR  802
             IGF GWRFDFVRGYA SI+K Y++NTSPE AVGE W+DM YG DGKP+Y+QD HR+ L  
Sbjct  197   IGFSGWRFDFVRGYAPSITKSYVKNTSPEFAVGEKWDDMKYGGDGKPEYDQDEHRSALRH  256

Query  803   WVQNaggaatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHD  973
             W++ AGG          TTKGILQ AV GELWRLKD  GKPPGL+GI P NAVTFVDNHD
Sbjct  257   WIEEAGGGGGVLTAFDFTTKGILQSAVGGELWRLKDSQGKPPGLIGIMPGNAVTFVDNHD  316

Query  974   TGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISET  1153
             T    + W FP DKV+ GY YILTHPG PC+FY H+ +WGLKD ITKL+++R  N I  T
Sbjct  317   TIRPNT-WAFPSDKVLLGYVYILTHPGTPCIFYSHYMEWGLKDSITKLVAIRKRNGIGST  375

Query  1154  SSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             SSV I   +++ Y+A IDDKVI+KIG K D+G L+P N+ +  SG D  VWEK+
Sbjct  376   SSVTIKAAESDLYLAVIDDKVIMKIGPKMDLGTLVPSNYALAYSGLDCAVWEKQ  429



>gb|AAA32926.1| alpha-amylase 1 [Hordeum vulgare]
Length=429

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/403 (65%), Positives = 312/403 (77%), Gaps = 4/403 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFN ES KH GGWYN L+  + D+A AGITHVWLPP S SV+ QGYMPGR YDLDA
Sbjct  26    VLFQGFNSESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRYYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH   +K +ADIVINHR A+ KD RGIYCIFEGGT D R DWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKAVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARRDWGPH  145

Query  476   LICKDDTEFSDGTGNADTG--ADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             +IC+DD  + DGTGN  T   ADF  APDIDHLNPRVQKEL EW+NWL++++GFDGWRFD
Sbjct  146   MICRDDRPYPDGTGNPATRRRADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDGWRFD  205

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga-  826
             F +GY+A ++KIY++ + P  AV E+W  +AYG DGKP+ NQD HR EL  WV   GG+ 
Sbjct  206   FAKGYSADVAKIYVDRSEPSFAVAEIWTSLAYGGDGKPNLNQDPHRQELVNWVNKVGGSG  265

Query  827   -atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPF  1003
              AT FDFTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHD GST+  WPF
Sbjct  266   PATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDNGSTKHMWPF  325

Query  1004  PKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDA  1183
             P D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+RT  +I   S ++I+  DA
Sbjct  326   PSDRVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIDRLVSIRTRQDIHSESKLQIMEADA  385

Query  1184  NAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             + Y+A+ID KVIVK+G ++DVG+LIP  F VV  G DY VWEK
Sbjct  386   DLYLAEIDGKVIVKLGPRYDVGHLIPEGFKVVAHGNDYAVWEK  428



>gb|EMS54110.1| Alpha-amylase type B isozyme [Triticum urartu]
Length=427

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/401 (64%), Positives = 306/401 (76%), Gaps = 2/401 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES KH GG  N L+  + D+A AG+THVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKHNGGGDNFLMGKVDDIAAAGVTHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG K QL++L+ ALH  G+K +ADIVINHR A+ KD RGIYCIFEGGT D RLDWGP 
Sbjct  86    SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN DTGADF  APDIDHL+PRVQKEL EW+NWL++ +GFDGWRFDF 
Sbjct  146   MICRDDRPYADGTGNPDTGADFGAAPDIDHLSPRVQKELVEWLNWLRTNVGFDGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A  +KIY++ +     V E+W  +AYG   KP+ NQD HR EL  W    GG+   
Sbjct  206   KGYSADGAKIYIDRSGAGFTVAEIWTSLAYGGARKPNLNQDPHRQELVNWGNKGGGSGPG  265

Query  836   fd--fttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
                 FTTKGIL VAV GELWRL+  DGK PG++G  P  AVTFVDNHDTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+RT   I   S ++I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADL  385

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID KVIVK+G ++DVG+LIP  F VV  G DY VWEK
Sbjct  386   YLAEIDGKVIVKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  426



>ref|XP_009148429.1| PREDICTED: alpha-amylase 1 [Brassica rapa]
Length=435

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/408 (65%), Positives = 316/408 (77%), Gaps = 4/408 (1%)
 Frame = +2

Query  98    PAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPG  274
             P F  ST+LFQGF WES   +GG+YNSL N I DL+N+GITHVWLPPPS SVSP+GY+PG
Sbjct  30    PTFTVSTLLFQGFKWESWMKEGGFYNSLHNSIDDLSNSGITHVWLPPPSQSVSPEGYLPG  89

Query  275   RLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDD  454
             +LYDL++SKYG++ +L++L+AAL   GIK VADIVINHR A+ KD    YC FEGGTSDD
Sbjct  90    KLYDLNSSKYGSETELKSLIAALKQKGIKAVADIVINHRTAERKDDHCGYCYFEGGTSDD  149

Query  455   RLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFD  634
             RLDW P  IC+ DT ++ GTGN DTG D+  APDIDHLNPRVQKELSEWMNWLKSEIGF 
Sbjct  150   RLDWDPSFICRGDTNYA-GTGNPDTGEDYKPAPDIDHLNPRVQKELSEWMNWLKSEIGFS  208

Query  635   GWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQN  814
             GWRFDFVRGYAAS++K Y++NTSP+ AVGE W+DM YG DGK +Y+Q+ HR+ L  W++ 
Sbjct  209   GWRFDFVRGYAASVTKSYVQNTSPDFAVGEKWDDMKYGGDGKLEYDQEEHRSGLKHWIEE  268

Query  815   aggaataf-dfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQS  991
              GG      DFTTKGILQ AV GELWRLKD  GKPPGL+GI P NAVTFVDNHDT    S
Sbjct  269   GGGGVLTAFDFTTKGILQSAVGGELWRLKDSQGKPPGLIGIMPGNAVTFVDNHDTIRPNS  328

Query  992   HWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEIL  1171
              W FP DKV+ GY YILTHPG PC+FY H+ +WGLKD I+KL+++R  N I  TSSV I 
Sbjct  329   -WAFPSDKVLLGYVYILTHPGTPCIFYSHYIEWGLKDSISKLVAIRNRNGIGSTSSVMIK  387

Query  1172  GVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
               +A  Y+A ID+KVI+KIG K D+G L+P NF +  SG D+ VWEKK
Sbjct  388   AAEAELYLAMIDEKVIMKIGPKLDIGTLVPPNFVLAYSGLDFAVWEKK  435



>ref|XP_004294808.1| PREDICTED: alpha-amylase-like [Fragaria vesca subsp. vesca]
Length=410

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/431 (63%), Positives = 317/431 (74%), Gaps = 23/431 (5%)
 Frame = +2

Query  29    NPQKMSTLFQFLSYCFCLACAFVPAF-GSTVLFQGFNWESNKHQGGWYNSLINLIPDLAN  205
             N  K+STL      C  L+   +P F  S +LFQGFNWES + +GGWYN L     +LA+
Sbjct  2     NSLKISTL------CILLSIISIPNFTASQILFQGFNWESAR-KGGWYNILEQSAAELAS  54

Query  206   AGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVIN  385
             +GITHVWLPPPS SVS +GYMPGRLYDL  SKYG + +L+ALV A HD GI+ +ADIVIN
Sbjct  55    SGITHVWLPPPSQSVSDEGYMPGRLYDL-TSKYGNQDELKALVKAYHDKGIQSIADIVIN  113

Query  386   HRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDH  565
             HRCA+ +D RG +CIFEGGT DDRLDWGP LIC DDT++SDG GN DTGA F  APDIDH
Sbjct  114   HRCAEKQDERGKWCIFEGGTPDDRLDWGPSLICSDDTDYSDGKGNPDTGAPFVPAPDIDH  173

Query  566   LNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAY  745
              N RVQ ELS+WMNWLK+EIGF GWRFDFV GYA   +K+Y+ NT P  +VGE WN    
Sbjct  174   KNTRVQSELSDWMNWLKTEIGFSGWRFDFVMGYAPEFTKLYVANTKPSFSVGEYWNSTT-  232

Query  746   GSDGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGL  925
                          R+EL+ W+ NAGG  TAFDFTTKGILQ AV GELWRLKD +G PPGL
Sbjct  233   -------------RDELAGWIGNAGGEVTAFDFTTKGILQAAVQGELWRLKDSNGGPPGL  279

Query  926   VGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDE  1105
             +GI PRN+VTF+DNHDTGSTQ  W FP DKV+QGYAY LTHPG+P +FYDHFFDWGLK E
Sbjct  280   IGILPRNSVTFIDNHDTGSTQKKWEFPSDKVMQGYAYTLTHPGVPSIFYDHFFDWGLKGE  339

Query  1106  ITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVS  1285
             I+ L ++R+ N I   S+V IL  DA+ YVA IDDK+I KIG + DVGNL+P  F +  S
Sbjct  340   ISNLTAIRSRNGIKPDSAVSILAADADLYVASIDDKIITKIGPRFDVGNLVPSTFKIATS  399

Query  1286  GQDYVVWEKKA  1318
             G+DY VWEK A
Sbjct  400   GKDYCVWEKSA  410



>gb|AAA32928.1| alpha-amylase 2 [Hordeum vulgare]
Length=437

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/407 (62%), Positives = 314/407 (77%), Gaps = 3/407 (1%)
 Frame = +2

Query  107   GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYD  286
             G  VLFQGFNWES K  GGWYN ++  + D+A AG+THVWLPPPS+SV+ +GYMPGRLYD
Sbjct  23    GHQVLFQGFNWESWKQSGGWYNMMLGKVDDIAAAGVTHVWLPPPSYSVAGEGYMPGRLYD  82

Query  287   LDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDW  466
             +DASKYG   +L++L+ ALH NG++ +ADIVINH CADYKDSRGIYCI+EGGTSD RLDW
Sbjct  83    IDASKYGNAAELKSLIGALHGNGVQAIADIVINHLCADYKDSRGIYCIYEGGTSDSRLDW  142

Query  467   GPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRF  646
             GP +IC+DDT++SDGT N DT AD+A APDIDHLN RVQ EL EW+ WLKS++GFD W  
Sbjct  143   GPHMICRDDTKYSDGTANLDTRADYADAPDIDHLNHRVQSELKEWLLWLKSDLGFDAWPL  202

Query  647   DFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga  826
             DF RGY+A ++K+Y++ TSP LAV E+W+ M  G DGKP+Y+QD HR  L  WV   GG 
Sbjct  203   DFARGYSAEMAKVYIDGTSPSLAVAEIWDGMVPGGDGKPNYDQDAHRQNLVNWVDKVGGR  262

Query  827   atafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHW  997
             A+A      TTKGIL VAV GELWRL  P  K PG++G  P  AVTF+DNHDTGS  S W
Sbjct  263   ASAGMVFDFTTKGILNVAVEGELWRLIGPASKAPGVMGWWPAKAVTFIDNHDTGSNGSKW  322

Query  998   PFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGV  1177
             P P DK++QGYAYILTH GIPC+FYDHFF+ G KDEI  L+++R  N I+ TS+++IL  
Sbjct  323   PVPSDKIMQGYAYILTHSGIPCIFYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMH  382

Query  1178  DANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             D +AYVA+ID KV+VKIGS++++G +IP  F    +G+DY VWEK A
Sbjct  383   DGDAYVAEIDSKVVVKIGSRYELGAVIPARFVTSANGKDYAVWEKIA  429



>gb|AAX33232.1| secreted alpha-amylase [Malus domestica]
Length=399

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/399 (65%), Positives = 313/399 (78%), Gaps = 12/399 (3%)
 Frame = +2

Query  125   QGFNWESNKHQGGWYNSLINLIPD-LANAGITHVWLPPPSHSVSPQGYMPGRLYDLDASK  301
             QGFNWES K +GGWY SL   IP  LA++GITHVWLPPPSHSVSPQGYMPGRLYDL+AS+
Sbjct  7     QGFNWESWKEEGGWYKSLSQSIPQQLASSGITHVWLPPPSHSVSPQGYMPGRLYDLNASR  66

Query  302   YGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLI  481
             YG + +L+AL+   HDNGI+ +ADIVINHRCA+ KD RGI+CIFEGGT DDRLDWGP LI
Sbjct  67    YGNQDELKALINTFHDNGIQSIADIVINHRCAEKKDERGIWCIFEGGTPDDRLDWGPSLI  126

Query  482   CKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRG  661
             C DDT +S+G GN DTGADF+ APDIDH+N RVQ+ELS+WMNWLK+EIGF+GWRFDFV+G
Sbjct  127   CCDDTAYSNGKGNPDTGADFSAAPDIDHINTRVQRELSDWMNWLKTEIGFNGWRFDFVKG  186

Query  662   YAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaatafd  841
             YA   +K+++ NT P  +VGELWN +AYGSDGK +YNQD HR  L  WV+ AGG  TAFD
Sbjct  187   YAPEFTKLFVTNTRPSFSVGELWNSLAYGSDGKLEYNQDAHRRALVGWVEGAGGDVTAFD  246

Query  842   fttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVI  1021
             FTTKGILQ AV GELWR+KD +G  PG++G+SP  +VTFVDNHDTGSTQ+ WPFP DKV+
Sbjct  247   FTTKGILQAAVQGELWRMKDSNGGAPGMIGLSPGKSVTFVDNHDTGSTQNMWPFPSDKVM  306

Query  1022  QGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYVAK  1201
             QGYAYILTHPGIP +             ITKL+++R  N I   S++ IL  DA+ YVA 
Sbjct  307   QGYAYILTHPGIPSI-----------RXITKLVAIRLRNGIGPDSALRILASDADLYVAA  355

Query  1202  IDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
              D+K+I KIG ++DVGNL+P  + +  SG DY V EKKA
Sbjct  356   TDEKIIAKIGPRYDVGNLVPPTYQIATSGNDYCVREKKA  394



>pdb|3WN6|A Chain A, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
 pdb|3WN6|B Chain B, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
 pdb|3WN6|C Chain C, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
 pdb|3WN6|D Chain D, Crystal Structure Of Alpha-amylase Amyi-1 From Oryza 
Sativa
Length=404

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/402 (63%), Positives = 305/402 (76%), Gaps = 4/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AGITHVWLPPPSHSV  QGYMPGRLYDLDA
Sbjct  3     VLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDA  62

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G++V+ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  63    SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPH  122

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  + DGTGN DTGADFA APDIDHLN RVQ+EL  W++WLK +IGFD WR DF 
Sbjct  123   MICRDDP-YGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFA  181

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++KIY++ T P  AV E+W  MA G DGKP+Y+Q+ HR EL  WV   GGA + 
Sbjct  182   KGYSADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSN  241

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL+  DGK PG++G  P  A TFVDNHDTGSTQ  WPFP
Sbjct  242   ATAFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFP  301

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+R    I   S + I+  D++
Sbjct  302   SDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSD  361

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVI KIG ++DV +LIP  F VV  G  Y +WEK
Sbjct  362   LYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  403



>ref|NP_001048220.1| Os02g0765600 [Oryza sativa Japonica Group]
 sp|P17654.2|AMY1_ORYSJ RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 1B; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAD17125.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAD17313.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAF10134.1| Os02g0765600 [Oryza sativa Japonica Group]
 gb|ACA50496.1| alpha-amylase [Oryza sativa Japonica Group]
 dbj|BAG95208.1| unnamed protein product [Oryza sativa Japonica Group]
Length=434

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/402 (63%), Positives = 305/402 (76%), Gaps = 4/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AGITHVWLPPPSHSV  QGYMPGRLYDLDA
Sbjct  33    VLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDA  92

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G++V+ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  93    SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPH  152

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  + DGTGN DTGADFA APDIDHLN RVQ+EL  W++WLK +IGFD WR DF 
Sbjct  153   MICRDDP-YGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFA  211

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++KIY++ T P  AV E+W  MA G DGKP+Y+Q+ HR EL  WV   GGA + 
Sbjct  212   KGYSADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSN  271

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL+  DGK PG++G  P  A TFVDNHDTGSTQ  WPFP
Sbjct  272   ATAFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFP  331

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+R    I   S + I+  D++
Sbjct  332   SDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSD  391

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVI KIG ++DV +LIP  F VV  G  Y +WEK
Sbjct  392   LYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  433



>gb|AAA33885.1| alpha-amylase (EC 3.2.1.1) [Oryza sativa]
Length=434

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/402 (63%), Positives = 305/402 (76%), Gaps = 4/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AGITHVWLPPPSHSV  QGYMPGRLYDLDA
Sbjct  33    VLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDA  92

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G++V+ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  93    SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPH  152

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  + DGTGN DTGADFA APDIDHLN RVQ+EL  W++WLK +IGFD WR DF 
Sbjct  153   MICRDDP-YGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFA  211

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++KIY++ T P  AV E+W  MA G DGKP+Y+Q+ HR EL  WV   GGA + 
Sbjct  212   KGYSADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSN  271

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL+  DGK PG++G  P  A TFVDNHDTGSTQ  WPFP
Sbjct  272   GTAFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFP  331

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+R    I   S + I+  D++
Sbjct  332   SDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSD  391

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVI KIG ++DV +LIP  F VV  G  Y +WEK
Sbjct  392   LYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  433



>emb|CAA34516.1| alpha-amylase [Oryza sativa Japonica Group]
Length=428

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/402 (63%), Positives = 305/402 (76%), Gaps = 4/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AGITHVWLPPPSHSV  QGYMPGRLYDLDA
Sbjct  27    VLFQGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDA  86

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G++V+ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  87    SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPH  146

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  + DGTGN DTGADFA APDIDHLN RVQ+EL  W++WLK +IGFD WR DF 
Sbjct  147   MICRDDP-YGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++KIY++ T P  AV E+W  MA G DGKP+Y+Q+ HR EL  WV   GGA + 
Sbjct  206   KGYSADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSN  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL+  DGK PG++G  P  A TFVDNHDTGSTQ  WPFP
Sbjct  266   GTAFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+R    I   S + I+  D++
Sbjct  326   SDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVI KIG ++DV +LIP  F VV  G  Y +WEK
Sbjct  386   LYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  427



>gb|EAY87654.1| hypothetical protein OsI_09066 [Oryza sativa Indica Group]
Length=428

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/402 (63%), Positives = 305/402 (76%), Gaps = 4/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AGITHVWLPPPS SV+ QGYMPGRLYDLDA
Sbjct  27    VLFQGFNWESWKENGGWYNMLMGKVDDIAAAGITHVWLPPPSQSVAEQGYMPGRLYDLDA  86

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G++V+ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  87    SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPH  146

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  + DGTGN DTGADFA APDIDHLN RVQ+EL  W++WLK +IGFD WR DF 
Sbjct  147   MICRDDP-YGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++KIY++ T P  AV E+W  MA G DGKP+Y+Q+ HR EL  WV   GGA + 
Sbjct  206   KGYSADMAKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSN  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL+  DGK PG++G  P  A TFVDNHDTGSTQ  WPFP
Sbjct  266   ATAFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWGLK+EI +L+S+R    I   S + I+  D++
Sbjct  326   SDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVI KIG ++DV +LIP  F VV  G  Y +WEK
Sbjct  386   LYLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEK  427



>emb|CDY29753.1| BnaA01g19130D [Brassica napus]
Length=434

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/407 (65%), Positives = 312/407 (77%), Gaps = 3/407 (1%)
 Frame = +2

Query  98    PAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGR  277
             P F   V  QGF WES   +GG+YNSL N I DL+N+GITHVWLPPPS SVSP+GY+PG+
Sbjct  30    PTFTFGVFEQGFKWESWMKEGGFYNSLHNSIDDLSNSGITHVWLPPPSQSVSPEGYLPGK  89

Query  278   LYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDR  457
             LYDL++SKYG++ +L++L+AAL   GIK VADIVINHR A+ KD    YC FEGGTSDDR
Sbjct  90    LYDLNSSKYGSETELKSLIAALKQKGIKAVADIVINHRTAERKDDHCGYCYFEGGTSDDR  149

Query  458   LDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDG  637
             LDW P  IC+ DT ++ GTGN DTG D+  APDIDHLNPRVQKELSEWMNWLKSEIGF G
Sbjct  150   LDWDPSFICRGDTNYA-GTGNPDTGEDYKPAPDIDHLNPRVQKELSEWMNWLKSEIGFSG  208

Query  638   WRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNa  817
             WRFDFVRGYAAS++K Y++NTSP+ AVGE W+DM YG DGK +Y+Q+ HR+ L  W++  
Sbjct  209   WRFDFVRGYAASVTKSYVQNTSPDFAVGEKWDDMKYGGDGKLEYDQEEHRSGLKHWIEEG  268

Query  818   ggaataf-dfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSH  994
             GG      DFTTKGILQ AV GELWRLKD  GKPPGL+GI P NAVTFVDNHDT    S 
Sbjct  269   GGGVLTAFDFTTKGILQSAVGGELWRLKDSQGKPPGLIGIMPGNAVTFVDNHDTIRPNS-  327

Query  995   WPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILG  1174
             W FP DKV+ GY YILTHPG PC+FY H+ +WGLKD I+KL+++R  N I  TSSV I  
Sbjct  328   WAFPSDKVLLGYVYILTHPGTPCIFYSHYIEWGLKDSISKLVAIRNRNGIGSTSSVMIKA  387

Query  1175  VDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              +A  Y+A ID+KVI+KIG K D+G L+P NF +  SG D+ VWEKK
Sbjct  388   AEAELYLAMIDEKVIMKIGPKLDIGTLVPPNFVLAYSGLDFAVWEKK  434



>dbj|BAE47517.2| alpha-amylase [Hyacinthus orientalis]
Length=419

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/425 (60%), Positives = 320/425 (75%), Gaps = 8/425 (2%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGIT  217
             MS+    +     ++   +P++ S  +LFQGFNWES K  GGWYN L   + D++++G T
Sbjct  2     MSSNNSRIQALLLISSFLLPSYTSGQILFQGFNWESWKKDGGWYNFLKTKVDDISSSGAT  61

Query  218   HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCA  397
             HVWLPPPSHSV  QGY+PGRLYDL ASKYG + +L++L+ A HD  IK VADIVINHR A
Sbjct  62    HVWLPPPSHSVGQQGYLPGRLYDLSASKYGNQDELKSLIQAFHDKSIKCVADIVINHRTA  121

Query  398   DYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
             + KD RGIYCIFEGGT DDRLDWGP +IC+DD E+SDGTGN DTGA +  APDIDH NPR
Sbjct  122   ETKDGRGIYCIFEGGTPDDRLDWGPTMICRDDAEYSDGTGNPDTGAGYGAAPDIDHTNPR  181

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             VQKEL++W+NWLK+EIGFDGWR DF +GY+A ++K Y+   +P   V E+W+D+  G   
Sbjct  182   VQKELTDWLNWLKTEIGFDGWRLDFAKGYSADVAKGYVSRGAPGFVVAEIWSDLTSG---  238

Query  758   KPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
                 N+D HR EL+RW Q  GG A AFDFTTKGILQ AV G+L R++D +GK PGL+G++
Sbjct  239   ----NEDAHRQELARWAQTVGGPAKAFDFTTKGILQQAVQGQLGRMRDSNGKAPGLIGLA  294

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             P  AVTFVDNHDTGSTQ+ WPFP DKV+QGYAYILTHPGIP +FYDH FDW L +EI+KL
Sbjct  295   PGLAVTFVDNHDTGSTQNMWPFPSDKVMQGYAYILTHPGIPSVFYDHLFDWNLIEEISKL  354

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
              ++R+ N +  TS + I+  D + YVA +D+KVIVKIG K DV NL+P  + +V SG+DY
Sbjct  355   AAIRSKNGLQPTSGLRIIASDNDIYVAVVDEKVIVKIGPKVDVWNLVPTEYKLVASGKDY  414

Query  1298  VVWEK  1312
              VWEK
Sbjct  415   AVWEK  419



>dbj|BAD17123.1| putative alpha-amylase precursor [Oryza sativa Japonica Group]
 dbj|BAD17311.1| putative alpha-amylase precursor [Oryza sativa Japonica Group]
 gb|EAZ24726.1| hypothetical protein OsJ_08496 [Oryza sativa Japonica Group]
 gb|ACA50497.1| alpha-amylase [Oryza sativa Japonica Group]
Length=428

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/402 (62%), Positives = 303/402 (75%), Gaps = 4/402 (1%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K  GGWYN L+  + D+A AGITHVWLPPPS SV+ QGYMPGRLYDLDA
Sbjct  27    VLFQGFNWESWKENGGWYNMLMGKVDDIAAAGITHVWLPPPSQSVAEQGYMPGRLYDLDA  86

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL++L+ A H  G++V+ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  87    SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPH  146

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+ D  + DGTGN DTGADF  APDIDHLN RVQ+EL  W++WLK +IGFD WR DF 
Sbjct  147   MICRGDP-YGDGTGNPDTGADFGAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             +GY+A ++KIY++ T P  AV E+W  +AYG DGKPDY+Q+ HR EL  WV   GGA + 
Sbjct  206   KGYSADVAKIYIDATEPSFAVAEIWTSLAYGGDGKPDYDQNAHRQELVNWVDRVGGANSN  265

Query  836   fdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                   TTKGIL VAV GELWRL+  DGK PG++G  P  A TF+DNHDTGSTQ  WPFP
Sbjct  266   ATTFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFIDNHDTGSTQHMWPFP  325

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DKV+QGYAYILTHPG PC+FYDHFFDWG K+EI +L+S+R    I   S + I+  D++
Sbjct  326   SDKVMQGYAYILTHPGNPCIFYDHFFDWGHKEEIERLVSIRNRQGIHPASELRIMEADSD  385

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              Y+A+ID KVI K+G ++DV +LIP  F VV  G  Y VWEK
Sbjct  386   LYLAEIDGKVITKVGPRYDVEHLIPEGFQVVAHGDGYAVWEK  427



>ref|XP_002462321.1| hypothetical protein SORBIDRAFT_02g023790 [Sorghum bicolor]
 gb|EER98842.1| hypothetical protein SORBIDRAFT_02g023790 [Sorghum bicolor]
Length=435

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/406 (64%), Positives = 308/406 (76%), Gaps = 16/406 (4%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQ----GYMPGRLY  283
             V+ Q FNWES K  GGWYN L+  + D+A AG+THVWLPPPSHSVS Q    GYMPGRLY
Sbjct  30    VIVQAFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPSHSVSTQELGAGYMPGRLY  89

Query  284   DLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLD  463
             DLDASKYGT  +L++L+AA H  G++VVADIVINHRCADYKD         GGT D RLD
Sbjct  90    DLDASKYGTAAELKSLIAAFHGKGVQVVADIVINHRCADYKD---------GGTPDGRLD  140

Query  464   WGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWR  643
             WGP +IC+DDT +SDGT N DTGADFA APDIDHLN RVQ+EL++W+ WLKS++GFD WR
Sbjct  141   WGPHMICRDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELTDWLLWLKSDLGFDAWR  200

Query  644   FDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagg  823
             FDF +GY+A ++K+Y++ T+P  AV E+WN+MAY  + KP+Y+QD HR  L  WV   GG
Sbjct  201   FDFAKGYSAEVAKVYVDGTAPSFAVAEIWNNMAYDGNNKPEYDQDPHRQALVDWVDKVGG  260

Query  824   aatafdf---ttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSH  994
             AA+       TTKGIL  AV GELWRL DP GK PG++G  P  AVTFVDNHDTGSTQ+ 
Sbjct  261   AASPATVFDFTTKGILNAAVEGELWRLIDPQGKAPGVIGWWPAKAVTFVDNHDTGSTQAM  320

Query  995   WPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILG  1174
             WPFP DKV+QGYAYILTHPG PC+FYDHFFDWG KDEI  L++VR  N I+ TS + IL 
Sbjct  321   WPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILE  380

Query  1175  VDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
              D ++YVA+I  KVIVKIGS++DVG+LIP  F V   G DY VWEK
Sbjct  381   HDGDSYVAEIGGKVIVKIGSRYDVGHLIPAGFEVAAHGNDYAVWEK  426



>ref|XP_010448491.1| PREDICTED: alpha-amylase 1-like [Camelina sativa]
Length=422

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/426 (61%), Positives = 318/426 (75%), Gaps = 5/426 (1%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             M++L   L  C      F     ST+LFQ FNWES K +GG+YNS+ N I D+A AG TH
Sbjct  1     MTSLHALLFTCLLFFIVFPTFTFSTLLFQSFNWESWKKEGGFYNSIHNSIDDIAKAGTTH  60

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             +WLPP S SV+P+GY+PG+LYDL +SKYG++ +L++L+ AL+  GIK VADIVINHR   
Sbjct  61    IWLPPSSQSVAPEGYLPGKLYDLKSSKYGSETELKSLIQALNQKGIKAVADIVINHRTGV  120

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
              KD +  YC FEGGTSDDRLDW P  +C++D  F  GTGN DTG DF GAPDIDHLNPRV
Sbjct  121   SKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPNFP-GTGNIDTGGDFNGAPDIDHLNPRV  179

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             QKELSEWMNWLKS+IGF GWRFDFVRGYA+SI+K+Y++NTSP+ AVGE W+ M YG DGK
Sbjct  180   QKELSEWMNWLKSDIGFHGWRFDFVRGYASSITKLYVQNTSPDFAVGENWDHMKYGGDGK  239

Query  761   PDYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
              DYNQD HR+ L +W++ AGG       FTTKGILQ AV GELWRLKD  GKPPGL+G  
Sbjct  240   LDYNQDQHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVQGELWRLKDSQGKPPGLIGTM  299

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             P NAVTF++NHDT  T   W FP DKV+ GY YILTHPG PC+FY+H+ +WGLK+ I+KL
Sbjct  300   PGNAVTFIENHDTFRT---WVFPSDKVLLGYVYILTHPGTPCIFYNHYMEWGLKESISKL  356

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
             +++R  N I  TSSV I   +++ Y+A IDDKVI+KIG K D+G L+P ++ +  SG D+
Sbjct  357   VAIRNRNGIGSTSSVTIKAAESDLYLAMIDDKVIMKIGPKLDLGTLVPPSYALAYSGLDF  416

Query  1298  VVWEKK  1315
              VWE K
Sbjct  417   AVWENK  422



>ref|XP_006282624.1| hypothetical protein CARUB_v10004897mg [Capsella rubella]
 gb|EOA15522.1| hypothetical protein CARUB_v10004897mg [Capsella rubella]
Length=422

 Score =   524 bits (1350),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 257/408 (63%), Positives = 313/408 (77%), Gaps = 6/408 (1%)
 Frame = +2

Query  98    PAFG-STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPG  274
             P F  ST+LFQ FNWES K QGG+YNS+ N I D+ANAG TH+WLPPPS SVSP+GY+PG
Sbjct  19    PTFTLSTLLFQSFNWESWKKQGGFYNSIHNSIDDIANAGTTHIWLPPPSQSVSPEGYLPG  78

Query  275   RLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDD  454
             +LYDL++SKYG++ +L++L+ AL+  GIK VADIVINHR    +D +  YC FEGGTSDD
Sbjct  79    KLYDLNSSKYGSETELKSLIQALNQKGIKAVADIVINHRTGATRDDKCGYCYFEGGTSDD  138

Query  455   RLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFD  634
             RLDW    +C++D  F  GTGN DTG DF GAPDIDHLNPR Q+ELSEWMNWLKS+IGF 
Sbjct  139   RLDWDRSFVCRNDPNFP-GTGNIDTGGDFNGAPDIDHLNPRAQRELSEWMNWLKSDIGFH  197

Query  635   GWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQN  814
             GWR DFV G+A+SI+K+Y++NTSP+ AVGE W+DM YG DGK DYNQD HR  L +WV+ 
Sbjct  198   GWRLDFVIGFASSIAKLYVQNTSPDFAVGEKWDDMKYGGDGKLDYNQDQHRYGLKQWVEE  257

Query  815   aggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQS  991
             AG        FTTKGILQ AV GELWRLKD  GKPPGL+GI P NAVTF++NHDT  T  
Sbjct  258   AGSGVLTAFDFTTKGILQSAVQGELWRLKDSQGKPPGLIGIMPGNAVTFIENHDTFRT--  315

Query  992   HWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEIL  1171
              W FP DKV+ GY YILTHPG PC+FY+H+ +WGLK+ I+KL+++R  N I  TSSV I 
Sbjct  316   -WVFPSDKVLLGYVYILTHPGTPCIFYNHYMEWGLKESISKLVAIRKRNGIGSTSSVAIK  374

Query  1172  GVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
               +++ Y+A IDDKVI+KIG K D+G L+P NF +  SG D+ VWEKK
Sbjct  375   AAESDLYLAMIDDKVIMKIGPKLDLGTLVPSNFALAYSGLDFAVWEKK  422



>ref|XP_004499064.1| PREDICTED: alpha-amylase-like isoform X2 [Cicer arietinum]
Length=401

 Score =   523 bits (1348),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 261/415 (63%), Positives = 310/415 (75%), Gaps = 24/415 (6%)
 Frame = +2

Query  74    FCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVS  253
             FCL+  F     ST+LFQGFNWES+  +GGWYN L N IPDLANAGITHVWLPPPS SV 
Sbjct  10    FCLSI-FPLLASSTLLFQGFNWESSS-KGGWYNLLKNSIPDLANAGITHVWLPPPSQSVG  67

Query  254   PQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIF  433
              QGY+PGRLYDLDASKYG+K +L++L+   +D GIK +ADIVINHR A+ KD RGIYC+F
Sbjct  68    SQGYLPGRLYDLDASKYGSKDELKSLIKEFNDKGIKSLADIVINHRTAERKDERGIYCLF  127

Query  434   EGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWL  613
             EGGT D +LDWGP  ICKDDT +SDGTGN DTG  +  APDIDHLNP+VQ+ELSEWMN  
Sbjct  128   EGGTPDGKLDWGPSFICKDDTTYSDGTGNLDTGEGYNAAPDIDHLNPQVQRELSEWMN--  185

Query  614   KSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNE  793
                                 I+KIY+ENTSP+ AVGE WN ++YG DGK DYNQD  R E
Sbjct  186   -------------------CITKIYVENTSPDFAVGEYWNSLSYGQDGKCDYNQDKARGE  226

Query  794   LSRWVQNaggaataf-dfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNH  970
             L  WV+++G       DFTTKGILQVAV GELWRLKD +GKPPGL+G+ P NAVTF+DNH
Sbjct  227   LVNWVESSGAGVVNAFDFTTKGILQVAVEGELWRLKDSNGKPPGLIGLKPENAVTFIDNH  286

Query  971   DTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISE  1150
             DTGSTQ  WPFP DKV+QGY YILTHPG P +FYDH+ +WGL + I KL ++R  N I+ 
Sbjct  287   DTGSTQKLWPFPSDKVMQGYGYILTHPGTPSIFYDHYIEWGLMEPIKKLTAIRKRNGITA  346

Query  1151  TSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             TSSV IL  +++ Y+A+ID+K+IVKIG K D+GNL+P N  V  +GQDY VWE K
Sbjct  347   TSSVNILAAESDLYMAEIDNKIIVKIGPKLDLGNLLPSNAQVATNGQDYAVWELK  401



>gb|KFK29029.1| hypothetical protein AALP_AA7G079500 [Arabis alpina]
Length=424

 Score =   524 bits (1350),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 262/403 (65%), Positives = 312/403 (77%), Gaps = 3/403 (1%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             ST+LFQGFNWES K +GG+YNSL N I D+  AGITH+WLPPPS SVSP+GY+PG+LYDL
Sbjct  24    STILFQGFNWESWKKEGGFYNSLHNSIDDITKAGITHIWLPPPSQSVSPEGYLPGKLYDL  83

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             D+SKYG+K +L++L++AL++ GIK VADIVINHR A  KD    YC FEGGTSDDRLDW 
Sbjct  84    DSSKYGSKTELKSLISALNEKGIKTVADIVINHRTAARKDDACGYCFFEGGTSDDRLDWD  143

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
                IC+ D+ ++ GTGN DTG D+  APDIDHLNP+VQKELSEWMNWLKSEIGF GWRFD
Sbjct  144   ASFICRGDSNYA-GTGNTDTGEDYKPAPDIDHLNPKVQKELSEWMNWLKSEIGFHGWRFD  202

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaa  829
             FVRGYA SI+KIY++NTSP+ AVGE W+DM YG DGK +YNQD+HR+ L  W++ AGG  
Sbjct  203   FVRGYAPSITKIYVQNTSPDFAVGEKWDDMKYGGDGKLEYNQDDHRSVLGHWIEEAGGGV  262

Query  830   taf-dfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
                 DFTTKGILQ AV GELWRLKD  GKPPGL+G  P NAVTFVDNHDT    S W FP
Sbjct  263   LTAFDFTTKGILQAAVQGELWRLKDSQGKPPGLIGTVPGNAVTFVDNHDTYRPNS-WAFP  321

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              DK++ GY YILTHPG P +FYDH+   GLK+ I KL+ +R  N IS TSSV I   +++
Sbjct  322   SDKLLLGYVYILTHPGTPTIFYDHYMQGGLKESIWKLVEIRKRNGISSTSSVVIKAAESD  381

Query  1187  AYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
              Y+A IDDKVI+KIG K D+G L+P NF +  SG +  VWEKK
Sbjct  382   LYLAMIDDKVIMKIGPKGDLGTLVPSNFALAYSGLNCAVWEKK  424



>ref|XP_006657340.1| PREDICTED: LOW QUALITY PROTEIN: alpha-amylase isozyme 2A-like 
[Oryza brachyantha]
Length=456

 Score =   525 bits (1352),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 255/411 (62%), Positives = 311/411 (76%), Gaps = 8/411 (2%)
 Frame = +2

Query  107   GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYD  286
             G  +LFQGFNWES +  GGWY+ L+  + D+A AG+THVWLPPPSHSVS QGYMPGRLYD
Sbjct  30    GDKILFQGFNWESWRQSGGWYSLLMGKVDDVAAAGVTHVWLPPPSHSVSAQGYMPGRLYD  89

Query  287   LDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDW  466
             LDAS+YGT  +L++L+AALH  G++V+AD+VINHRCADY+DSRGIYC+F+GGT D R   
Sbjct  90    LDASRYGTAAELKSLIAALHGKGLQVIADVVINHRCADYQDSRGIYCVFDGGTPDGRPX-  148

Query  467   GPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKS-EIGFDGWR  643
              P +IC+DD +FSDGTGN DTGADF  APDIDHLN  V++EL++W+ WLKS E+GFD WR
Sbjct  149   PPHMICRDDAQFSDGTGNLDTGADFPAAPDIDHLNGVVRRELTDWLLWLKSDEVGFDAWR  208

Query  644   FDFVRGYAASISKIYMENTSP-ELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNag  820
              DF RGY+  +++ Y++ T+P  LAV E+W+ MAYG DG+P+Y QD HR  L  WV  A 
Sbjct  209   LDFARGYSPEVARAYIDGTAPVALAVAEVWDPMAYGGDGRPEYGQDAHRQALVDWVDGAA  268

Query  821   gaatafdfttKGILQVAVLG-----ELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
              A   FD+TTKGI+  A  G     ELWRL DP GK PG++G  P  AVTFVDNHDTGST
Sbjct  269   SAGMVFDYTTKGIMNAAGGGGGGGGELWRLIDPQGKAPGVIGWWPAKAVTFVDNHDTGST  328

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q  WPFP DKV+QGYAYILTHPG PC+FYDHFFDWG KDEIT L++VR  N I+  SS++
Sbjct  329   QQAWPFPSDKVMQGYAYILTHPGTPCIFYDHFFDWGFKDEITALVAVRQRNGITAVSSLK  388

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             IL  D +AYVA+ID KV +KIG ++DV   IP  F +   G DY VWEK A
Sbjct  389   ILLYDGDAYVAEIDGKVTMKIGPRYDVSGYIPPGFQLAAHGNDYAVWEKTA  439



>ref|XP_010438943.1| PREDICTED: alpha-amylase 1 [Camelina sativa]
Length=422

 Score =   523 bits (1347),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 256/425 (60%), Positives = 319/425 (75%), Gaps = 5/425 (1%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             M++L   L  C      F     ST+LFQ FNWES K +GG+YNS+ N I D+ANAG TH
Sbjct  1     MTSLHALLFTCLLFFIVFPTFTFSTLLFQSFNWESWKREGGFYNSIHNSIDDIANAGTTH  60

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             +WLPP S SV+P+GY+PG+LYDL++SKYG++ +L+ L+ AL+  GIK VADIVINHR   
Sbjct  61    LWLPPSSQSVAPEGYLPGKLYDLNSSKYGSETELKLLIQALNQKGIKAVADIVINHRTGV  120

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
              +D +  YC FEGGTSD RLDW P  +C++D  F  GTGN DTG DF GAPDIDHLNPRV
Sbjct  121   RRDDKCGYCYFEGGTSDGRLDWDPSFVCRNDPNFP-GTGNIDTGGDFNGAPDIDHLNPRV  179

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             QKELSEWMNWLK++IGF GWRFDFV GYA+SI+K+Y++NTSP+ AVGE W+DM YG DGK
Sbjct  180   QKELSEWMNWLKTDIGFHGWRFDFVLGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDGK  239

Query  761   PDYNQDNHRNELSRWVQNaggaatafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
              DYNQD HR+ L +WV+ AGG       FTTKGILQ AV GELWRLKD  GKPPGL+G+ 
Sbjct  240   LDYNQDQHRSGLKQWVEEAGGGVLTAFDFTTKGILQSAVQGELWRLKDSQGKPPGLIGVM  299

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             P NAVTF++NHDT  T   W FP +KV+ GY YILTHPG PC+FY+H+ +WGLK+ I+KL
Sbjct  300   PGNAVTFIENHDTFRT---WVFPSEKVLLGYVYILTHPGTPCIFYNHYMEWGLKESISKL  356

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
             +++R  N I  TSSV I   +++ Y+A IDDKVI+KIG K D+G L+P ++ +  SG D+
Sbjct  357   VAIRKRNGIGSTSSVTIKAAESDLYLAMIDDKVIMKIGPKLDLGTLVPPSYALAYSGLDF  416

Query  1298  VVWEK  1312
              VWEK
Sbjct  417   AVWEK  421



>gb|AAA91883.1| alpha-amylase, partial [Solanum tuberosum]
Length=349

 Score =   520 bits (1338),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 253/341 (74%), Positives = 287/341 (84%), Gaps = 0/341 (0%)
 Frame = +2

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SK+G +QQL+ L+ ALHD+GIK VADIVINHR AD KDSRGIY IFEGGTSDDRLDWGP 
Sbjct  9     SKFGNQQQLKTLIKALHDHGIKSVADIVINHRTADNKDSRGIYSIFEGGTSDDRLDWGPS  68

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
              ICK+DT++SDGTGN DTG DF  APDIDHLN RVQKELS+WMNWLKSEIGFDGWRFDFV
Sbjct  69    FICKNDTQYSDGTGNPDTGLDFEPAPDIDHLNTRVQKELSDWMNWLKSEIGFDGWRFDFV  128

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGYA  I+KIYM NTSP+ AVGE WN +AYG DGKP+YNQDNHRNEL  WV+NAG A TA
Sbjct  129   RGYAPCITKIYMRNTSPDFAVGEFWNSLAYGQDGKPEYNQDNHRNELVGWVKNAGRAVTA  188

Query  836   fdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDK  1015
             FDFTTKGILQ AV GELWRLKDP+GKPPG++G+ PR AVTF+DNHDTGSTQ+ WPFP DK
Sbjct  189   FDFTTKGILQAAVQGELWRLKDPNGKPPGMIGVLPRKAVTFIDNHDTGSTQNMWPFPSDK  248

Query  1016  VIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYV  1195
             V+QGYAYILTHPGIP +FYDHFFDWG  D I+ LIS+R  N I  TS+V+I+  D++ Y+
Sbjct  249   VMQGYAYILTHPGIPSVFYDHFFDWGFMDGISALISIRKRNRICATSNVQIMASDSDLYI  308

Query  1196  AKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKKA  1318
             A I  K+IVKIG K D+GNLIP N+ V  SGQDY VWE+KA
Sbjct  309   AMIHHKIIVKIGPKLDLGNLIPPNYEVATSGQDYAVWEQKA  349



>ref|XP_004973670.1| PREDICTED: alpha-amylase isozyme 3B-like [Setaria italica]
Length=441

 Score =   522 bits (1345),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/425 (58%), Positives = 313/425 (74%), Gaps = 1/425 (0%)
 Frame = +2

Query  41    MSTLFQFLSYCFCLACAFVPAFGSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITH  220
             +  LF  L     L         + VLFQGFNWES K+QGGWYN+L   + D+ANAG TH
Sbjct  6     LPVLFGLLVVTAALGLLGSNTARAQVLFQGFNWESCKNQGGWYNNLKVQVDDIANAGATH  65

Query  221   VWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             VWLPPPSHSV+PQGYMPGRLYDL+AS+YGT+ +L++L+AA    GI+ VAD+VINHRCAD
Sbjct  66    VWLPPPSHSVAPQGYMPGRLYDLNASRYGTEAELRSLIAAFRGRGIQAVADVVINHRCAD  125

Query  401   YKDSRGIYCIFEGGTSD-DRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPR  577
              +D+RG+YC+FEGG  +  RL+W   +IC DDT +S+G GN DTG DF  APDIDHLNPR
Sbjct  126   KQDARGVYCVFEGGDPEGRRLNWDADMICSDDTAYSNGRGNRDTGKDFGAAPDIDHLNPR  185

Query  578   VQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDG  757
             V++EL++W+ WL +++GF GWR DF +GY+A+++K Y++   P   V E+W+ + Y  DG
Sbjct  186   VRRELTDWLRWLTADVGFGGWRLDFAKGYSAAVAKAYVDGAGPSFVVAEIWSSLNYDGDG  245

Query  758   KPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGIS  937
             KP  NQD  R EL  W    GG A AFDFTTKG+LQ AV GELWR++D +GK PGL+G  
Sbjct  246   KPANNQDGDRQELVDWANAVGGPAAAFDFTTKGVLQAAVQGELWRMRDGNGKAPGLIGWL  305

Query  938   PRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKL  1117
             P  AVTF+DNHDTGSTQ+ WPFP+DKV+QGYAYILTHPGIPC+FYDH FDW LK+EI+ L
Sbjct  306   PEKAVTFIDNHDTGSTQNSWPFPRDKVMQGYAYILTHPGIPCIFYDHVFDWNLKEEISTL  365

Query  1118  ISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDY  1297
              ++R  N I   S + IL  + + YVA IDDKVI KIG ++DVG +IP  F+V   G+ Y
Sbjct  366   AAIRKRNGIHPGSKLSILKAEGDVYVAMIDDKVITKIGPRYDVGGVIPSGFHVAAPGEGY  425

Query  1298  VVWEK  1312
              VWEK
Sbjct  426   CVWEK  430



>emb|CDY16261.1| BnaC01g22960D [Brassica napus]
Length=443

 Score =   521 bits (1343),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 258/404 (64%), Positives = 308/404 (76%), Gaps = 3/404 (1%)
 Frame = +2

Query  107   GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYD  286
             G  +   GF WES   +GG+YNSL N I DL+N+GITH+WLPPPS SVSP+GY+PG+LYD
Sbjct  42    GEHIHHIGFKWESWMKEGGFYNSLHNSIDDLSNSGITHIWLPPPSQSVSPEGYLPGKLYD  101

Query  287   LDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDW  466
             L++SKYG++ +L++L+AAL   GIK VADIVINHR A  KD    YC FEGGTSDDRLDW
Sbjct  102   LNSSKYGSEAELKSLIAALKQKGIKAVADIVINHRTAARKDDHCGYCYFEGGTSDDRLDW  161

Query  467   GPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRF  646
              P  IC+ DT ++ GTGN DTG D+  APDIDHLNPRVQKELSEWMNWLKSEIGF GWRF
Sbjct  162   DPSFICRGDTNYA-GTGNPDTGEDYKPAPDIDHLNPRVQKELSEWMNWLKSEIGFSGWRF  220

Query  647   DFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga  826
             DFVRGYAAS++K Y++NTSP+ AVGE W+DM YG DGK +Y+Q+ HR+ L  W++  GG 
Sbjct  221   DFVRGYAASVTKSYVQNTSPDFAVGEKWDDMKYGGDGKLEYDQEEHRSGLKHWIEEGGGG  280

Query  827   atafd-fttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPF  1003
                   FTTKGILQ AV GELWRLKD  GKPPGL+GI P NAVTFVDNHDT    S W F
Sbjct  281   VLTAFDFTTKGILQSAVGGELWRLKDSQGKPPGLIGIMPGNAVTFVDNHDTIRPNS-WAF  339

Query  1004  PKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDA  1183
             P DKV+ GY YILTHPG PC+FY H+ +WGLKD I+KL+++R  N I  TSSV I   +A
Sbjct  340   PSDKVLLGYVYILTHPGTPCIFYSHYIEWGLKDSISKLVAIRNRNGIGSTSSVMIKAAEA  399

Query  1184  NAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
               Y+A ID+KVI+KIG K D+G L+P NF +  SG D+ VWEKK
Sbjct  400   ELYLAMIDEKVIMKIGPKLDIGTLVPPNFVLAYSGLDFAVWEKK  443



>gb|KDP29720.1| hypothetical protein JCGZ_18655 [Jatropha curcas]
Length=401

 Score =   520 bits (1338),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 262/416 (63%), Positives = 311/416 (75%), Gaps = 33/416 (8%)
 Frame = +2

Query  71    CFCLACAFVPAFGSTV----LFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPP  238
              FC    F+  F S +    LFQGFNWES+   GGWYN L NLI DLANAGITHVWLPPP
Sbjct  6     IFCFLSLFLSTFPSFISPHLLFQGFNWESSNQAGGWYNLLENLISDLANAGITHVWLPPP  65

Query  239   SHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRG  418
             S SVS QGY+PG+LYDLDASKYG++ +L++L+ ALH  GIK +ADIVINHR A+ +D   
Sbjct  66    SQSVSSQGYLPGKLYDLDASKYGSQDELKSLIEALHQKGIKSIADIVINHRTAEKQD---  122

Query  419   IYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSE  598
                                       ++SDG GN DTG  +  APDIDH+N  VQ ELS 
Sbjct  123   --------------------------KYSDGQGNPDTGEGYGPAPDIDHVNTTVQTELSN  156

Query  599   WMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQD  778
             W+NWLKS+IGFDGWRFDFV+GYA   +K+YMENTSP+ AVGE W+ +AYG DGKP+ NQD
Sbjct  157   WLNWLKSDIGFDGWRFDFVKGYAPRFTKLYMENTSPDFAVGEKWDSLAYGQDGKPNPNQD  216

Query  779   NHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTF  958
             +HR  L  WV+NAGG  TAFDFTTKGILQVAV GELWRLKD +GKPPG +GI P+NAVTF
Sbjct  217   SHREALKDWVENAGGVVTAFDFTTKGILQVAVEGELWRLKDSNGKPPGFIGILPQNAVTF  276

Query  959   VDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSN  1138
             +DNHDTGSTQ  WPFP DKV+ GYAYILTHPGIP +FYDHFF+WGLK+EI KL ++R +N
Sbjct  277   IDNHDTGSTQKSWPFPSDKVLLGYAYILTHPGIPSVFYDHFFEWGLKEEIIKLSAIRKNN  336

Query  1139  EISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVW  1306
              IS+TSSV IL  D++ YVAKI+D VI+KIG+K+D+GNLIP +F V  SG DY VW
Sbjct  337   GISQTSSVNILAADSDLYVAKINDIVIIKIGTKNDLGNLIPPDFQVAASGNDYAVW  392



>emb|CAN74301.1| hypothetical protein VITISV_028383 [Vitis vinifera]
Length=577

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 255/390 (65%), Positives = 310/390 (79%), Gaps = 1/390 (0%)
 Frame = +2

Query  71    CFCLACAFVPAF-GSTVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHS  247
             C       +PA   S +LFQGFNWES+K +GGWYN LIN IP+LA +GITHVWLPPPS S
Sbjct  9     CLLFFTTILPALTASPILFQGFNWESSKKEGGWYNFLINSIPELAASGITHVWLPPPSQS  68

Query  248   VSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYC  427
             VSP+GYMPGRLYDL+ASKYGT+ +L+ L+   H  G++ +ADIVINHR A+ +D+ GI+ 
Sbjct  69    VSPEGYMPGRLYDLNASKYGTQDELKTLIKVFHSKGVQCIADIVINHRTAEKQDAGGIWA  128

Query  428   IFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMN  607
             IFEGGT DDRLDW P  ICKD+T +SDGTGN D+G D++ APDIDH+NP VQ+EL++WMN
Sbjct  129   IFEGGTPDDRLDWTPSFICKDNTPYSDGTGNPDSGDDYSAAPDIDHINPLVQQELTDWMN  188

Query  608   WLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHR  787
             WLK EIGFDGWRFDF RG++ + +K YM NT  + AVGE+W  ++Y  DGKP YNQD+HR
Sbjct  189   WLKIEIGFDGWRFDFARGFSPAFTKFYMANTRAKFAVGEIWKSLSYRGDGKPSYNQDSHR  248

Query  788   NELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDN  967
              EL  WV+ AGGA  AFDFTTKGILQ AV GELWR+KD +GKPPG++G+ P NAVTF+DN
Sbjct  249   RELMEWVRGAGGAVNAFDFTTKGILQAAVEGELWRMKDLNGKPPGMIGLMPGNAVTFIDN  308

Query  968   HDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEIS  1147
             HDTGST  HWPFP DK++QGYAYILTHPGIP +FYDHFF+WGLK+EI KLI +RT N I 
Sbjct  309   HDTGSTLQHWPFPSDKIMQGYAYILTHPGIPSIFYDHFFEWGLKEEIIKLIIIRTRNRIK  368

Query  1148  ETSSVEILGVDANAYVAKIDDKVIVKIGSK  1237
               S+V IL  D++ YVA ID K+IVKIG +
Sbjct  369   PNSAVRILASDSDLYVAAIDGKIIVKIGPR  398


 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +2

Query  1067  FYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDV  1246
             FYDHFF+WGLK+EI KLI +RT N I   S+V IL  D + YVA ID K+IVKIG   DV
Sbjct  414   FYDHFFEWGLKEEILKLIMIRTRNRIKPNSAVRILASDLDLYVAVIDGKIIVKIGPGFDV  473

Query  1247  GNLIPYNF-NVVVSGQDYVVWEKK  1315
             GNL+P +F  +  SG+DY    +K
Sbjct  474   GNLVPQSFKKIATSGKDYCCMGEK  497



>ref|NP_001276156.1| alpha-amylase-like precursor [Glycine max]
 gb|ACU18643.1| unknown [Glycine max]
Length=422

 Score =   516 bits (1329),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 258/371 (70%), Positives = 298/371 (80%), Gaps = 9/371 (2%)
 Frame = +2

Query  92    FVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYM  268
             F P F S  +LFQGFNWES+K +GGWYNSL N IPDLANAGITHVWLPPPS SVSP+GY+
Sbjct  16    FFPLFASPALLFQGFNWESSK-KGGWYNSLKNTIPDLANAGITHVWLPPPSQSVSPEGYL  74

Query  269   PGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTS  448
             PGRLYDLDASKYGTK QL++L+AA HD GIK +ADIVINHR A+ KD RGIYCIFEGGT 
Sbjct  75    PGRLYDLDASKYGTKDQLKSLIAAFHDKGIKCLADIVINHRTAERKDGRGIYCIFEGGTP  134

Query  449   DDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIG  628
             D RLDWGP  ICKDD  +SDGTGN D+G  +  APDIDHLNP+VQ+ELSEWMNWLK+EIG
Sbjct  135   DARLDWGPSFICKDDNTYSDGTGNLDSGEPYDPAPDIDHLNPQVQRELSEWMNWLKTEIG  194

Query  629   FDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWV  808
             FDGWRFD+V+GYA SI+KIYME T P+ AVGE W+ ++         N D HR  L  WV
Sbjct  195   FDGWRFDYVKGYAPSITKIYMEQTRPDFAVGEKWDSLSID-------NYDGHRGALVNWV  247

Query  809   QNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQ  988
             ++AGGA TAFDFTTKGILQ AV G+LWRLKD +GKP G++G+ P NAVTF+DNHDTGSTQ
Sbjct  248   ESAGGAITAFDFTTKGILQAAVQGQLWRLKDSNGKPSGMIGVKPENAVTFIDNHDTGSTQ  307

Query  989   SHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEI  1168
               WPFP DKV+QGYAYILTHPG P +FYDHFFDWGLK++I KL S+R  + I+E SSV I
Sbjct  308   RIWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSIRVKHGINEKSSVNI  367

Query  1169  LGVDANAYVAK  1201
             L  +A+    K
Sbjct  368   LAAEADLLCCK  378



>ref|XP_006446537.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina]
 gb|ESR59777.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina]
Length=404

 Score =   511 bits (1316),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 255/396 (64%), Positives = 301/396 (76%), Gaps = 8/396 (2%)
 Frame = +2

Query  128   GFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYG  307
             GFNWES   +GGWYN L   IPD+A+AGITHVWLPPPS S +PQG    RLYDL+AS YG
Sbjct  17    GFNWESCNKKGGWYNFLKKRIPDIASAGITHVWLPPPSQSAAPQG----RLYDLNASSYG  72

Query  308   TKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICK  487
             ++ +L++L+ A +  GIK +ADIVINHR A+ KDSRGI+CIFEGGT D RLDWGP  IC+
Sbjct  73    SQNELKSLIQAFNKKGIKYLADIVINHRTAEKKDSRGIWCIFEGGTPDKRLDWGPFFICR  132

Query  488   DDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYA  667
             DDT +SDG G+ D+G  F  APDIDHLNP+VQKELS+WMNWLK+EIGFDGWRFDFV+GYA
Sbjct  133   DDTTYSDGRGHPDSGEPFGPAPDIDHLNPKVQKELSDWMNWLKTEIGFDGWRFDFVKGYA  192

Query  668   ASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaatafdft  847
              SI+++YM+NT P  AV E W+ ++   DGK D  QD HR  L  WVQ AG A TAFDFT
Sbjct  193   PSITRLYMKNTMPHFAVAEKWDSLSDRQDGKLDARQDAHRRNLKHWVQAAGRAVTAFDFT  252

Query  848   tKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQG  1027
             TKGILQ AV GELWRLKD +GKPPG +G+ P+NAVTF+DNHDTGSTQ  WPFP DKV+ G
Sbjct  253   TKGILQAAVQGELWRLKDSNGKPPGFIGLLPQNAVTFIDNHDTGSTQRLWPFPSDKVMLG  312

Query  1028  YAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYVAKID  1207
             Y   +  P    LFYDH FDWGLK EI KL ++RT N I+ TS V IL   ++ YVA ID
Sbjct  313   YTNKVLAP----LFYDHLFDWGLKKEIGKLAAIRTKNGINTTSRVNILASQSDLYVAAID  368

Query  1208  DKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             DK+I KIG K D+ NLIP NF V  SG+DY VW+KK
Sbjct  369   DKIITKIGPKMDLRNLIPRNFKVATSGKDYAVWQKK  404



>gb|EAZ07323.1| hypothetical protein OsI_29572 [Oryza sativa Indica Group]
Length=418

 Score =   511 bits (1316),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 293/376 (78%), Gaps = 0/376 (0%)
 Frame = +2

Query  185   LIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKV  364
             ++ D+A AG+THVWLPPPSHSV+PQGYMPGRLYDLDASKYGT  +L++L+AA H  G++ 
Sbjct  32    IVDDIAKAGVTHVWLPPPSHSVAPQGYMPGRLYDLDASKYGTAAELKSLIAAFHGKGVQC  91

Query  365   VADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFA  544
             VAD+VINHRCA+ KD+RG+YC+FEGGT DDRLDWGPG+IC DDT++SDGTG+ DTG  F 
Sbjct  92    VADVVINHRCAEKKDARGVYCVFEGGTPDDRLDWGPGMICSDDTQYSDGTGHRDTGEGFG  151

Query  545   GAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGE  724
              APDIDHLNPRVQ+EL++W+NWLKS++GFDGWR DF +GY+  I+K+Y+E+  P   V E
Sbjct  152   AAPDIDHLNPRVQRELTDWLNWLKSDVGFDGWRLDFAKGYSTDIAKMYVESCKPGFVVAE  211

Query  725   LWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDP  904
             +WN ++Y  DGKP  NQD  R EL  WV   GG A  FDFTTKG+LQ  V GELWRL+D 
Sbjct  212   IWNSLSYNGDGKPAANQDQGRQELVNWVNAVGGPAMTFDFTTKGLLQAGVQGELWRLRDG  271

Query  905   DGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFF  1084
             +GK  G++G  P  AVTFVDNHDTGSTQ  WPFP DKV+QGYAYILTHPG+PC+FYDH F
Sbjct  272   NGKAAGMIGWLPEKAVTFVDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGVPCIFYDHMF  331

Query  1085  DWGLKDEITKLISVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPY  1264
             DW LK EIT     +          + I+  DA+AYVA +D+KV+VKIG+++DVGN +P 
Sbjct  332   DWNLKQEITARGGDQGEERHQRREQLRIVVADADAYVAVVDEKVMVKIGTRYDVGNAVPS  391

Query  1265  NFNVVVSGQDYVVWEK  1312
             +F+  V G+DY VWEK
Sbjct  392   DFHQTVHGKDYSVWEK  407



>gb|EPS57430.1| hypothetical protein M569_17388 [Genlisea aurea]
Length=441

 Score =   511 bits (1315),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 250/403 (62%), Positives = 307/403 (76%), Gaps = 5/403 (1%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             S VL QGFNWES  ++GGWYNSLI + P +A AG+THVWLPPPS +V PQGY+PGRLYDL
Sbjct  34    SDVLLQGFNWESC-YRGGWYNSLIAVAPQIAAAGVTHVWLPPPSQAVDPQGYLPGRLYDL  92

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWG  469
             DASKYG+K++L AL+ +LHD G+K VAD+VINHR A+ KD+RGIYCIFEGGT D RLDWG
Sbjct  93    DASKYGSKEELTALIKSLHDRGVKAVADVVINHRTAERKDARGIYCIFEGGTDDGRLDWG  152

Query  470   PGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFD  649
             P  IC+DD E+SDGTGN DTG  +AGAPDIDHLNP VQ ELSEW+NWL+ EIGFDGWR D
Sbjct  153   PAFICRDDAEYSDGTGNLDTGEGYAGAPDIDHLNPTVQAELSEWLNWLRHEIGFDGWRLD  212

Query  650   FVRGYAASISKIYMENTSPELAVGELWNDMAYGS-DGKPDYNQDNHRNELSRWVQNagga  826
             FV+GY+  I++IY+ NT P   VGELW+ + Y + DG+ +YNQD HR+ ++ W  +AGG 
Sbjct  213   FVKGYSTGIAQIYVNNTDPRFVVGELWSSLYYNTLDGRLEYNQDRHRDRIANWANSAGGG  272

Query  827   atafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFP  1006
               AFDFTT GIL+VAV GELWRLKD  G PPG++GISP  +VT V NHD+   Q HW FP
Sbjct  273   VKAFDFTTMGILRVAVQGELWRLKDAPGNPPGMMGISPEKSVTLVANHDSVDDQ-HWRFP  331

Query  1007  KDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDAN  1186
              +K+I GYAYILTHPG P +F DHF  W  +D I +L ++R  N ISETS +EIL  DA+
Sbjct  332   PEKLILGYAYILTHPGTPMIFCDHFLAWSNRDAILELTAIRARNGISETSKLEILIADAD  391

Query  1187  AYVAKIDDKVIVKIGSKHD--VGNLIPYNFNVVVSGQDYVVWE  1309
              YVAKI+ KVI  IGS     +G L+P  F++  SG +Y ++E
Sbjct  392   LYVAKIEGKVITMIGSGMGMALGTLVPPTFDLATSGDEYAIFE  434



>gb|ACY38052.1| alpha-amylase precursor [Dactylis glomerata]
Length=413

 Score =   509 bits (1311),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 250/401 (62%), Positives = 298/401 (74%), Gaps = 16/401 (4%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             VLFQGFNWES K    WYN L++ + D+A AGITHVWLPP S SV+ QGYMPGRLYDLDA
Sbjct  26    VLFQGFNWESWKQNDEWYNLLMSKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA  85

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             SKYG + QL+AL+ AL   G+K +ADIVINHR A++KD RGIYC+FEGGT D RLDWGP 
Sbjct  86    SKYGNEAQLKALIEALKGKGVKAIADIVINHRTAEHKDGRGIYCLFEGGTPDARLDWGPH  145

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
             +IC+DD  ++DGTGN  TGADF GAPDIDHLNP VQKEL EW+NWLK++IGF+GWRFDF 
Sbjct  146   MICRDDRPYADGTGNPGTGADFGGAPDIDHLNPTVQKELVEWLNWLKTDIGFEGWRFDFA  205

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNagga--a  829
             +GY+A ++K+Y++ T P  AV  +W  +AYG DGKP+ NQD HR EL  WV   G +  A
Sbjct  206   KGYSADVAKVYIDGTEPNFAVAGIWTSLAYGGDGKPNLNQDEHRQELVNWVNRVGASGPA  265

Query  830   tafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPK  1009
             T FDFTTKG+L VAV GELWRL+  DGK PG++G  P  AVT VDN DTGSTQ  WPFP 
Sbjct  266   TTFDFTTKGVLNVAVEGELWRLRGADGKAPGMIGTLPGKAVTSVDNRDTGSTQHMWPFPS  325

Query  1010  DKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANA  1189
             D+V+QGYAYILTHPG PC+FYDHFFDWG              +EI   S + I+  DA+ 
Sbjct  326   DRVMQGYAYILTHPGTPCIFYDHFFDWG--------------HEIHNESELRIMEADADL  371

Query  1190  YVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             Y+A+ID K IVK+G++ DV NLIP  F VV  G  Y VWEK
Sbjct  372   YLAEIDGKGIVKLGTRFDVENLIPGGFQVVAHGDGYAVWEK  412



>ref|XP_009348705.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
 ref|XP_009348715.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=425

 Score =   509 bits (1312),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 321/423 (76%), Gaps = 7/423 (2%)
 Frame = +2

Query  59    FLSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPP  235
              L +C CL  + +P+F +  VLFQGFNW+S+K +GGWYN+L   IP+LA++GITHVWLPP
Sbjct  4     LLFFCICLCTSLLPSFAAPAVLFQGFNWDSSK-KGGWYNTLKTSIPELADSGITHVWLPP  62

Query  236   PSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSR  415
             PSH+   +GY PGRLYDLDAS YG K +L++L+AA+H+ GIK +ADIVINHR A  +D  
Sbjct  63    PSHANGTEGYYPGRLYDLDASSYGNKDELKSLIAAMHEKGIKAIADIVINHRAAVKQDEN  122

Query  416   GIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELS  595
             GI+ IFEGGT+D RLD+   LIC+DD +   GTGN DTG +F    D+DH NPR+Q ELS
Sbjct  123   GIWSIFEGGTADGRLDFNASLICRDDNDHPFGTGNPDTGDNFPYTADVDHTNPRLQSELS  182

Query  596   EWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWN-DMAYGSDGKPDYN  772
             +WMNWLK+EIGFDGWRFD+  GY +S +K+YM+ TSPE AV E W  ++A G DGK + N
Sbjct  183   DWMNWLKTEIGFDGWRFDYAIGYGSSFTKLYMDRTSPEFAVAEYWRWNIAKGQDGKLEQN  242

Query  773   QDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAV  952
             QD HRNE++ W+Q AGG  TAFD TTK I+ VAV+GELWRLKD +GKPPGL+GI P NAV
Sbjct  243   QDAHRNEIASWIQAAGGVVTAFDMTTKYIMDVAVVGELWRLKDSNGKPPGLIGIKPENAV  302

Query  953   TFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGL-KDEITKLISVR  1129
             TF+DNHDT S Q   PFP D+V+ GYAYILTHPG P +FYDHFF+WG  K+ I  L ++R
Sbjct  303   TFIDNHDTWS-QKLLPFPSDQVLLGYAYILTHPGTPSIFYDHFFEWGWPKEPIRNLTAIR  361

Query  1130  TSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPY--NFNVVVSGQDYVV  1303
               N I+  SSV IL  +AN Y+A IDDK+I+KIG+K D+G+L P   NF+V  SGQD+ V
Sbjct  362   ARNGINSKSSVSILAAEANLYMANIDDKIIMKIGTKLDLGDLDPTKSNFHVATSGQDFAV  421

Query  1304  WEK  1312
             WE+
Sbjct  422   WER  424



>ref|XP_002444507.1| hypothetical protein SORBIDRAFT_07g023010 [Sorghum bicolor]
 gb|EES14002.1| hypothetical protein SORBIDRAFT_07g023010 [Sorghum bicolor]
Length=443

 Score =   509 bits (1311),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 248/409 (61%), Positives = 309/409 (76%), Gaps = 7/409 (2%)
 Frame = +2

Query  110   STVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDL  289
             + VLFQGFNWES K QGGWY  L   + D+A AG THVWLPPPSHSV+PQGYMPGRLYDL
Sbjct  30    AQVLFQGFNWESCKKQGGWYKFLQAQVDDIAGAGATHVWLPPPSHSVAPQGYMPGRLYDL  89

Query  290   DASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDD-----  454
             +AS+YGT+ +L++L+AA    G++ VADIVINHRCAD KD RG+YCIFEGG  DD     
Sbjct  90    NASRYGTEAELRSLIAAFRGKGVEAVADIVINHRCADKKDGRGVYCIFEGGGGDDGGTGT  149

Query  455   -RLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGF  631
              RL+W   +IC DDTEFS+G GN DTG DF  APDIDHLNPRVQ+ELS+W+ WL +++GF
Sbjct  150   GRLNWDADMICGDDTEFSNGRGNRDTGKDFGAAPDIDHLNPRVQRELSDWLCWLSADVGF  209

Query  632   DG-WRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWV  808
              G WR DF +GY+A+++K Y++ T P   V E+W+ ++Y  DGKP +NQD  R EL  WV
Sbjct  210   TGGWRLDFAKGYSAAVAKAYVDRTRPSFVVAEIWSSLSYDGDGKPKHNQDGDRQELVDWV  269

Query  809   QNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQ  988
                GG A AFDFTTKG+LQ AV GELWR++D +GK PG++G  P  AVTFVDNHDTGSTQ
Sbjct  270   NAVGGPAAAFDFTTKGVLQAAVQGELWRMRDGNGKAPGMIGWLPEKAVTFVDNHDTGSTQ  329

Query  989   SHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEI  1168
             + WPFP+DKV+QGYAYILTHPGIP +FYDH F+W LK EI+ L ++R  N I   S + I
Sbjct  330   NSWPFPRDKVMQGYAYILTHPGIPSIFYDHVFEWNLKQEISTLAAIRKRNGIHPGSKLSI  389

Query  1169  LGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEKK  1315
             +  + + YVA IDDKVI KIG+++DVG++IP  F+V   G  Y +WEK+
Sbjct  390   VKAEGDVYVAMIDDKVITKIGTRYDVGSVIPSGFSVAAHGDGYCIWEKR  438



>gb|EMT15942.1| Alpha-amylase isozyme 3D [Aegilops tauschii]
Length=437

 Score =   508 bits (1309),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 230/399 (58%), Positives = 298/399 (75%), Gaps = 0/399 (0%)
 Frame = +2

Query  116   VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPPPSHSVSPQGYMPGRLYDLDA  295
             +LFQGFNWES K QGGWYN L   + D+A+AG+THVWLPPPSHSVSPQGYMPGRLY LDA
Sbjct  29    ILFQGFNWESWKKQGGWYNHLKAQVGDIADAGVTHVWLPPPSHSVSPQGYMPGRLYALDA  88

Query  296   SKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGTSDDRLDWGPG  475
             S+YG   +L++L+AA H  GI+  AD+VI HR AD +D+RG+YC FEGGT D RLDWGP 
Sbjct  89    SRYGAAAELRSLLAAFHARGIQCGADVVITHRTADKQDARGVYCAFEGGTPDARLDWGPA  148

Query  476   LICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEIGFDGWRFDFV  655
              +C DD  +SDGTG+ DTG  F   PD+DHL+PRV++ELS+W+ WLK+++GFDGWR DF 
Sbjct  149   EVCADDATYSDGTGHRDTGDGFDAPPDVDHLSPRVRRELSDWLRWLKTDVGFDGWRLDFA  208

Query  656   RGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRWVQNaggaata  835
             RGY+ ++++ Y++   P   V E+WN +AY  DG+P +NQD  R  L  WV+ A  +  A
Sbjct  209   RGYSPAVARTYIDAVRPGFVVAEIWNPLAYDGDGRPSHNQDRCRQGLVDWVEAASPSVMA  268

Query  836   fdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGSTQSHWPFPKDK  1015
             FDF TKG+LQ  V  ELWR++D  GK  G++G  P  AVTFVDNHDTGSTQ  WPFP DK
Sbjct  269   FDFATKGVLQAGVQAELWRVRDRSGKAAGMIGWLPERAVTFVDNHDTGSTQKLWPFPADK  328

Query  1016  VIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVEILGVDANAYV  1195
             V+QGYAYILTHPG+PC+FYDH F+W LK ++ KL ++R  N +   S + IL  DA+ YV
Sbjct  329   VMQGYAYILTHPGVPCIFYDHMFEWNLKVQLAKLAAIRARNGVHAGSKLRILVADADLYV  388

Query  1196  AKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             A ++++V VKIG+++DVG  +P +F++   G+DY VWEK
Sbjct  389   AVVNERVFVKIGTRYDVGGAVPSDFHIAAHGRDYCVWEK  427



>ref|XP_008347138.1| PREDICTED: alpha-amylase-like [Malus domestica]
 ref|XP_008356942.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=425

 Score =   507 bits (1306),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 253/423 (60%), Positives = 319/423 (75%), Gaps = 7/423 (2%)
 Frame = +2

Query  59    FLSYCFCLACAFVPAFGS-TVLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVWLPP  235
              LS+CFCL  + +P+F +  VLFQGFNW+S+K +GGWYN L   IP+LA++GI HVWLPP
Sbjct  4     LLSFCFCLCTSLLPSFATPAVLFQGFNWDSSK-KGGWYNXLKTSIPELADSGIXHVWLPP  62

Query  236   PSHSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSR  415
             PSH+   +GY PGRLYDLDAS YG K +L++L+ A+H+ GIK +ADIVINHR A  +D  
Sbjct  63    PSHANGTEGYYPGRLYDLDASSYGNKDELKSLIXAMHEKGIKAIADIVINHRAAVKQDEN  122

Query  416   GIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELS  595
             GI+ IFEGGT+D RLD+   LIC+DD +   GTGN DTG +     D+DH NPR+Q ELS
Sbjct  123   GIWSIFEGGTADGRLDFNASLICRDDNDHPFGTGNPDTGDNXPYTADVDHTNPRLQSELS  182

Query  596   EWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWN-DMAYGSDGKPDYN  772
             +WMNWLK+EIGFDGWRFD+  GY +S +K+YM+ TSPE AV E W  ++A G DGK + N
Sbjct  183   DWMNWLKTEIGFDGWRFDYAIGYGSSFTKLYMDRTSPEFAVAEYWRWNIAKGQDGKLEQN  242

Query  773   QDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAV  952
             QD HRNE++ W+Q AGG  TAFD TTK I+ VAV+GELWRLKD +GKPPGL+GI P NAV
Sbjct  243   QDAHRNEIASWIQAAGGVVTAFDMTTKYIMDVAVVGELWRLKDSNGKPPGLIGIKPENAV  302

Query  953   TFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGL-KDEITKLISVR  1129
             TF+DNHDT S Q   PFP D+V+ GYAYILTHPG P +FYDHFF+WG  K+ I  L ++R
Sbjct  303   TFIDNHDTWS-QKLLPFPSDQVLLGYAYILTHPGTPSIFYDHFFEWGWPKEPIRNLTAIR  361

Query  1130  TSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPY--NFNVVVSGQDYVV  1303
               N I+  SSV IL  +AN Y+A ID+K+I+KIG+K D+G+L P   NF+V  SGQD+ V
Sbjct  362   ARNGINSKSSVSILAAEANLYMANIDBKIIMKIGTKLDLGDLDPTKSNFHVATSGQDFAV  421

Query  1304  WEK  1312
             WE+
Sbjct  422   WER  424



>ref|XP_004499060.1| PREDICTED: alpha-amylase-like [Cicer arietinum]
Length=424

 Score =   506 bits (1303),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 256/425 (60%), Positives = 315/425 (74%), Gaps = 7/425 (2%)
 Frame = +2

Query  53    FQFLSYCF-CLACAFVPAFGST-VLFQGFNWESNKHQGGWYNSLINLIPDLANAGITHVW  226
             F   S+CF CL  +  P+F S+ +LFQGFNW S++  GGWYN L + +PD+A+AG+ +VW
Sbjct  3     FLLTSFCFLCLCISLFPSFSSSAILFQGFNWASSEKAGGWYNFLKSKVPDIADAGVEYVW  62

Query  227   LPPPS--HSVSPQGYMPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCAD  400
             LPPPS  H   PQGY+P RLYDLD SKYG K +L+ALVAA  + G+K ++DIVINHR A+
Sbjct  63    LPPPSNSHDDGPQGYLPKRLYDLDTSKYGNKNELKALVAAFRERGVKTISDIVINHRTAE  122

Query  401   YKDSRGIYCIFEGGTSDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRV  580
               DS+G+  IFEGGT D RLDW    IC  D EF  GTGN DTG D+ GAPDIDH NP+V
Sbjct  123   RLDSQGL-SIFEGGTPDTRLDWDVSYICSTDVEFK-GTGNPDTGDDWGGAPDIDHTNPKV  180

Query  581   QKELSEWMNWLKSEIGFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGK  760
             Q+ELS+WMNWLK+++GF GWRFD V GYA   +K YME TSP+ AVGEL+  +A GSDGK
Sbjct  181   QQELSDWMNWLKTDVGFVGWRFDMVVGYAPRYTKTYMEKTSPDFAVGELYEKVALGSDGK  240

Query  761   PDYNQDNHRNELSRWVQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISP  940
             P  NQ+ HR  L +WV +AGG  T FDFTTK IL  AV GELWR+KD +GKPPG++GI  
Sbjct  241   PLSNQEAHRQRLVKWVNDAGGVVTTFDFTTKMILGAAVEGELWRMKDGNGKPPGMIGIKS  300

Query  941   RNAVTFVDNHDTGSTQSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLI  1120
              NAVTFVDNHDTGS Q  WPFP DKV+ GY YILTHPG P +FYDH+ +WGL + I KL 
Sbjct  301   SNAVTFVDNHDTGS-QKLWPFPDDKVMLGYVYILTHPGHPTIFYDHYIEWGLMEPIKKLT  359

Query  1121  SVRTSNEISETSSVEILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYV  1300
             ++R  N I+ TSSV IL  +++ Y+A+ID+K+IVKIG K D+GNL+P N  V  +GQDY 
Sbjct  360   AIRKRNGITATSSVNILAAESDLYMAEIDNKIIVKIGPKLDLGNLLPSNAQVATNGQDYA  419

Query  1301  VWEKK  1315
             VWE K
Sbjct  420   VWELK  424



>gb|KDO84181.1| hypothetical protein CISIN_1g014447mg [Citrus sinensis]
Length=350

 Score =   503 bits (1295),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 247/349 (71%), Positives = 282/349 (81%), Gaps = 0/349 (0%)
 Frame = +2

Query  266   MPGRLYDLDASKYGTKQQLQALVAALHDNGIKVVADIVINHRCADYKDSRGIYCIFEGGT  445
             MPGRLYDLDASKYG++  L++L+ A    GIK +AD+VINHR A+ KD RGIYCIFEGGT
Sbjct  1     MPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGT  60

Query  446   SDDRLDWGPGLICKDDTEFSDGTGNADTGADFAGAPDIDHLNPRVQKELSEWMNWLKSEI  625
             SDDRLDWGP  IC+ D E+SDG GN DTG DF  APDIDHLNPRVQKELS+WMNWLK+EI
Sbjct  61    SDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEI  120

Query  626   GFDGWRFDFVRGYAASISKIYMENTSPELAVGELWNDMAYGSDGKPDYNQDNHRNELSRW  805
             GFDGWRFDFV+GYA SI+K+YMENTSP+ AVGE W+ ++YG DGKPD NQD HR  L  W
Sbjct  121   GFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDW  180

Query  806   VQNaggaatafdfttKGILQVAVLGELWRLKDPDGKPPGLVGISPRNAVTFVDNHDTGST  985
             VQ AGGA  AFDFTTKGILQ AV GELWRLKD +GKPPG +GI P+NAVTF+DNHDTGST
Sbjct  181   VQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGST  240

Query  986   QSHWPFPKDKVIQGYAYILTHPGIPCLFYDHFFDWGLKDEITKLISVRTSNEISETSSVE  1165
             Q  WPFP DKV+ GYAYILTHPG PC+FYDHFFDWGLK+ I+KL +VR  N I+  S V 
Sbjct  241   QRLWPFPSDKVMLGYAYILTHPGTPCIFYDHFFDWGLKEAISKLAAVRNRNGINTASRVN  300

Query  1166  ILGVDANAYVAKIDDKVIVKIGSKHDVGNLIPYNFNVVVSGQDYVVWEK  1312
             IL  DA+ Y+A I D+VI+KIG K D+GNLIP +F V   G DY VWEK
Sbjct  301   ILASDADVYIAAIGDRVIMKIGPKMDIGNLIPSDFKVAADGTDYAVWEK  349



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3911414158386