BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24755_g1_i1 len=1013 path=[1755:0-43 7713:44-58 1814:59-204
5540:205-309 2023:310-310 2024:311-383 2097:384-410 2124:411-443
2963:444-450 8023:451-506 7659:507-522 3042:523-608 6236:609-642
3162:643-1012]

Length=1013
                                                                      Score     E

dbj|BAC02435.1|  alpha-amylase                                          163   2e-42   Ipomoea nil [qian niu]
gb|EMT01911.1|  Alpha-amylase type A isozyme                          99.0    3e-33   
ref|XP_003589187.1|  Alpha-amylase                                      133   6e-33   
ref|XP_009586775.1|  PREDICTED: alpha-amylase                           135   2e-32   
ref|XP_009758535.1|  PREDICTED: alpha-amylase                           135   2e-32   
ref|XP_007017239.1|  Alpha-amylase-like                                 135   3e-32   
ref|XP_010061756.1|  PREDICTED: alpha-amylase-like isoform X3           134   3e-32   
ref|XP_010061754.1|  PREDICTED: alpha-amylase-like isoform X1           134   4e-32   
ref|XP_011083843.1|  PREDICTED: alpha-amylase                           134   5e-32   
ref|XP_010061755.1|  PREDICTED: alpha-amylase-like isoform X2           133   1e-31   
ref|XP_010061752.1|  PREDICTED: alpha-amylase-like                      132   2e-31   
ref|XP_003589186.1|  Alpha-amylase                                      132   3e-31   
ref|XP_008373147.1|  PREDICTED: alpha-amylase-like                      131   6e-31   
ref|XP_004235226.1|  PREDICTED: alpha-amylase                           131   6e-31   
gb|AFK42146.1|  unknown                                                 130   7e-31   
ref|XP_004294806.1|  PREDICTED: alpha-amylase-like                      130   1e-30   
emb|CDP01359.1|  unnamed protein product                                130   1e-30   
gb|AFO84070.1|  alpha-amylase                                           130   2e-30   
ref|XP_003550340.1|  PREDICTED: alpha-amylase-like                      130   2e-30   
gb|KHN35676.1|  Alpha-amylase                                           114   2e-30   
gb|KHG27234.1|  Uncharacterized protein F383_11580                      129   3e-30   
ref|XP_007134076.1|  hypothetical protein PHAVU_010G017600g             129   4e-30   
dbj|BAC76729.1|  alpha-amylase                                          128   5e-30   Vigna angularis [azuki bean]
gb|KHG23972.1|  Uncharacterized protein F383_31428                      127   9e-30   
ref|XP_009350378.1|  PREDICTED: alpha-amylase-like                      127   1e-29   
ref|XP_010108609.1|  hypothetical protein L484_006340                   127   1e-29   
gb|EYU25422.1|  hypothetical protein MIMGU_mgv1a006910mg                127   1e-29   
ref|XP_004499059.1|  PREDICTED: alpha-amylase-like                      126   3e-29   
gb|KDO84181.1|  hypothetical protein CISIN_1g014447mg                   125   3e-29   
gb|KHG14183.1|  Uncharacterized protein F383_17328                      126   3e-29   
gb|KHG00963.1|  Uncharacterized protein F383_22263                      126   3e-29   
gb|AAA16513.1|  alpha amylase precursor                                 125   4e-29   Cuscuta reflexa [giant dodder]
ref|XP_010320333.1|  PREDICTED: alpha-amylase isoform X2                125   4e-29   
prf||1803517A  alpha amylase                                            125   5e-29
sp|P17859.1|AMYA_VIGMU  RecName: Full=Alpha-amylase; AltName: Ful...    125   6e-29   Vigna mungo [urad dal]
ref|XP_004294808.1|  PREDICTED: alpha-amylase-like                      125   7e-29   
ref|XP_004238157.1|  PREDICTED: alpha-amylase isoform X1                125   7e-29   
ref|XP_006434774.1|  hypothetical protein CICLE_v10001266mg             125   7e-29   
ref|XP_006354888.1|  PREDICTED: alpha-amylase-like                      125   8e-29   
ref|XP_007199844.1|  hypothetical protein PRUPE_ppa006152mg             125   9e-29   
ref|XP_008236505.1|  PREDICTED: alpha-amylase-like                      124   2e-28   
gb|AHB20171.1|  high pI alpha-amylase                                   117   2e-28   
gb|AAA91883.1|  alpha-amylase                                           122   2e-28   Solanum tuberosum [potatoes]
gb|AHB20175.1|  high pI alpha-amylase                                   116   3e-28   
ref|XP_010690292.1|  PREDICTED: alpha-amylase-like                      123   4e-28   
gb|EMT30755.1|  Alpha-amylase type B isozyme                            116   4e-28   
ref|XP_008236504.1|  PREDICTED: alpha-amylase-like                      123   4e-28   
ref|XP_006446537.1|  hypothetical protein CICLE_v10018086mg             122   5e-28   
ref|XP_010690290.1|  PREDICTED: alpha-amylase-like                      122   5e-28   
gb|AHB20172.1|  high pI alpha-amylase                                   115   6e-28   
ref|XP_002285213.1|  PREDICTED: alpha-amylase                           122   6e-28   Vitis vinifera
ref|XP_007017240.1|  Alpha-amylase-like isoform 1                       122   8e-28   
ref|XP_002460333.1|  hypothetical protein SORBIDRAFT_02g026625          115   1e-27   Sorghum bicolor [broomcorn]
ref|XP_010667402.1|  PREDICTED: alpha-amylase-like                      121   1e-27   
emb|CAN77038.1|  hypothetical protein VITISV_004485                     121   2e-27   Vitis vinifera
gb|AHB20174.1|  high pI alpha-amylase                                   114   2e-27   
gb|AHB20173.1|  high pI alpha-amylase                                   114   2e-27   
ref|XP_009148429.1|  PREDICTED: alpha-amylase 1                         120   2e-27   
gb|EPS60632.1|  alpha-amylase                                           120   2e-27   
emb|CDY16261.1|  BnaC01g22960D                                          120   2e-27   
emb|CDY29753.1|  BnaA01g19130D                                          120   2e-27   
ref|NP_567714.1|  alpha-amylase 1                                       120   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690291.1|  PREDICTED: alpha-amylase-like                      120   3e-27   
ref|XP_009349497.1|  PREDICTED: alpha-amylase-like                      120   3e-27   
ref|XP_010690299.1|  PREDICTED: alpha-amylase-like                      120   4e-27   
ref|XP_008373148.1|  PREDICTED: alpha-amylase-like                      120   4e-27   
gb|AHO49118.1|  alpha amylase                                           118   4e-27   
gb|AAM64582.1|  alpha-amylase-like protein                              120   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AHL44839.1|  alpha-amylase-like protein                              119   7e-27   
ref|XP_011017206.1|  PREDICTED: alpha-amylase isoform X2                119   7e-27   
emb|CAB36742.1|  alpha-amylase-like protein                             119   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011017205.1|  PREDICTED: alpha-amylase isoform X1                119   8e-27   
ref|NP_001140950.1|  uncharacterized protein LOC100273029               112   9e-27   Zea mays [maize]
gb|AFV30790.1|  alpha-amylase 2                                         116   1e-26   
ref|XP_006374943.1|  alpha amylase family protein                       119   1e-26   
gb|KDP29720.1|  hypothetical protein JCGZ_18655                         118   1e-26   
gb|AFV30709.1|  alpha-amylase 2                                         116   1e-26   
ref|XP_006387871.1|  hypothetical protein POPTR_0515s00220g             118   2e-26   
gb|AFV30283.1|  amylase 1                                               111   2e-26   
gb|AFV30275.1|  amylase 1                                               111   2e-26   
ref|XP_006387870.1|  alpha amylase family protein                       118   2e-26   
ref|XP_002301186.2|  hypothetical protein POPTR_0002s12790g             118   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006657340.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-amylas...    117   3e-26   
ref|XP_010448491.1|  PREDICTED: alpha-amylase 1-like                    117   3e-26   
gb|AFV30328.1|  amylase 1                                               110   3e-26   
gb|AFV30390.1|  amylase 1                                               110   3e-26   
ref|XP_006282624.1|  hypothetical protein CARUB_v10004897mg             117   3e-26   
gb|AFV30374.1|  amylase 1                                               110   3e-26   
gb|AAY44169.1|  alpha-amylase                                           112   4e-26   Hordeum vulgare [barley]
gb|AFV30351.1|  amylase 1                                               110   4e-26   
ref|XP_003589191.1|  Alpha amylase                                      117   4e-26   
ref|XP_002867631.1|  hypothetical protein ARALYDRAFT_492338             117   4e-26   
ref|XP_004957016.1|  PREDICTED: alpha-amylase isozyme 3C-like           117   5e-26   
dbj|BAJ34359.1|  unnamed protein product                                114   5e-26   
gb|AFV30789.1|  alpha-amylase 2                                         114   5e-26   
gb|AFV30385.1|  amylase 1                                               110   5e-26   
gb|AFV30304.1|  amylase 1                                               110   5e-26   
gb|AFV30292.1|  amylase 1                                               110   5e-26   
gb|AFV30781.1|  alpha-amylase 2                                         114   5e-26   
gb|AAA98615.1|  alpha-amylase                                           116   6e-26   Hordeum vulgare [barley]
gb|EMS54110.1|  Alpha-amylase type B isozyme                            116   6e-26   
gb|AFV30649.1|  alpha-amylase 2                                         114   6e-26   
gb|EMS50638.1|  Alpha-amylase type B isozyme                            116   7e-26   
gb|AFV30656.1|  alpha-amylase 2                                         114   7e-26   
gb|AFV30309.1|  amylase 1                                               109   7e-26   
gb|AFV30661.1|  alpha-amylase 2                                         114   8e-26   
emb|CAX51374.1|  alpha-amylase                                          116   8e-26   Hordeum vulgare subsp. vulgare [barley]
sp|P04748.1|AMY4_HORVU  RecName: Full=Alpha-amylase type B isozym...    111   8e-26   Hordeum vulgare [barley]
gb|AFV30348.1|  amylase 1                                               109   8e-26   
gb|AFV30775.1|  alpha-amylase 2                                         114   9e-26   
pdb|1AVA|A  Chain A, Amy2BASI PROTEIN-Protein Complex From Barley...    115   1e-25   
ref|XP_010274277.1|  PREDICTED: pentatricopeptide repeat-containi...    119   1e-25   
sp|P04063.3|AMY2_HORVU  RecName: Full=Alpha-amylase type B isozym...    115   1e-25   Hordeum vulgare [barley]
gb|AAA33894.1|  alpha-amylase                                           116   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AFV30287.1|  amylase 1                                               109   1e-25   
ref|NP_001058568.1|  Os06g0713800                                       115   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AFV30419.1|  amylase 1                                               109   1e-25   
gb|AFV30824.1|  alpha-amylase 2                                         113   1e-25   
sp|A2YGY2.1|AMY2A_ORYSI  RecName: Full=Alpha-amylase isozyme 2A; ...    115   1e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004499060.1|  PREDICTED: alpha-amylase-like                      115   1e-25   
gb|AAY44170.1|  alpha-amylase                                           111   1e-25   Hordeum vulgare [barley]
ref|XP_004499064.1|  PREDICTED: alpha-amylase-like isoform X2           115   1e-25   
gb|EMT32632.1|  hypothetical protein F775_52311                         117   1e-25   
ref|XP_010438943.1|  PREDICTED: alpha-amylase 1                         115   1e-25   
tpg|DAA61290.1|  TPA: hypothetical protein ZEAMMB73_810620              112   1e-25   
gb|EMT32633.1|  Alpha-amylase type B isozyme                            115   2e-25   
ref|XP_004499063.1|  PREDICTED: alpha-amylase-like isoform X1           115   2e-25   
gb|AFV30825.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30596.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30290.1|  amylase 1                                               108   2e-25   
gb|AFV30633.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30655.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30591.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30654.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30648.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30644.1|  alpha-amylase 2                                         112   2e-25   
gb|AAA32925.1|  alpha-amylase 1                                         115   2e-25   Hordeum vulgare [barley]
gb|AFV30609.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30637.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30616.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30811.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30595.1|  alpha-amylase 2                                         112   2e-25   
gb|KDP38338.1|  hypothetical protein JCGZ_04263                         114   2e-25   
gb|AFV30622.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30641.1|  alpha-amylase 2                                         112   2e-25   
gb|AFV30640.1|  alpha-amylase 2                                         112   2e-25   
emb|CAA33298.1|  alpha-amylase                                          114   2e-25   Hordeum vulgare [barley]
gb|AFV30809.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30636.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30826.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30660.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30629.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30613.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30611.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30593.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30598.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30742.1|  alpha-amylase 2                                         112   3e-25   
gb|ACF88424.1|  unknown                                                 114   3e-25   Zea mays [maize]
gb|AFV30673.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30795.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30832.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30744.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30846.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30797.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30765.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30759.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30737.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30736.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30817.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30804.1|  alpha-amylase 2                                         112   3e-25   
ref|NP_001105539.1|  alpha-amylase precursor                            114   3e-25   Zea mays [maize]
ref|XP_002460331.1|  hypothetical protein SORBIDRAFT_02g026610          114   3e-25   Sorghum bicolor [broomcorn]
gb|ADH43281.1|  alpha amylase                                           114   3e-25   
gb|AFV30833.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30706.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30845.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30662.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30835.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30688.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30670.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30752.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30741.1|  alpha-amylase 2                                         112   3e-25   
gb|AFV30605.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30410.1|  amylase 1                                               107   4e-25   
gb|AFV30685.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30602.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30652.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30615.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30720.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30697.1|  alpha-amylase 2                                         112   4e-25   
ref|XP_004966428.1|  PREDICTED: alpha-amylase type A isozyme-like       114   4e-25   
gb|AFV30689.1|  alpha-amylase 2                                         112   4e-25   
ref|XP_008653926.1|  PREDICTED: alpha-amylase type A isozyme-like       112   4e-25   
gb|AFV30711.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30692.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30428.1|  amylase 1                                               107   4e-25   
gb|AFV30793.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30665.1|  alpha-amylase 2                                         112   4e-25   
gb|AFV30682.1|  alpha-amylase 2                                         112   5e-25   
gb|AFV30714.1|  alpha-amylase 2                                         111   5e-25   
gb|AFV30726.1|  alpha-amylase 2                                         111   5e-25   
gb|AFV30694.1|  alpha-amylase 2                                         111   5e-25   
ref|XP_004957017.1|  PREDICTED: alpha-amylase isozyme 3C-like           114   5e-25   
ref|XP_004957015.1|  PREDICTED: alpha-amylase isozyme 3C-like           114   5e-25   
gb|AFV30746.1|  alpha-amylase 2                                         111   5e-25   
gb|AFV30808.1|  alpha-amylase 2                                         111   5e-25   
gb|AFV30735.1|  alpha-amylase 2                                         111   6e-25   
ref|XP_009410104.1|  PREDICTED: alpha-amylase isozyme 3D-like           114   6e-25   
gb|AFV30837.1|  alpha-amylase 2                                         111   6e-25   
sp|P04750.2|AMY6_HORVU  RecName: Full=Alpha-amylase type B isozym...    113   6e-25   Hordeum vulgare [barley]
ref|XP_004960025.1|  PREDICTED: alpha-amylase type A isozyme-like       113   6e-25   
gb|AFV30409.1|  amylase 1                                               107   6e-25   
gb|AFV30840.1|  alpha-amylase 2                                         111   6e-25   
gb|AFV30274.1|  amylase 1                                               107   6e-25   
ref|XP_006413356.1|  hypothetical protein EUTSA_v10025232mg             113   7e-25   
gb|AFV30842.1|  alpha-amylase 2                                         111   7e-25   
gb|AFV30678.1|  alpha-amylase 2                                         111   7e-25   
gb|AFV30618.1|  alpha-amylase 2                                         111   7e-25   
ref|XP_008220223.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    116   7e-25   
gb|AFV30675.1|  alpha-amylase 2                                         111   8e-25   
gb|AFV30627.1|  alpha-amylase 2                                         111   8e-25   
gb|AFV30779.1|  alpha-amylase 2                                         111   8e-25   
ref|XP_007017242.1|  Alpha-amylase-like                                 113   8e-25   
gb|AFV30679.1|  alpha-amylase 2                                         110   9e-25   
gb|AFV30696.1|  alpha-amylase 2                                         110   9e-25   
gb|AFV30686.1|  alpha-amylase 2                                         110   9e-25   
gb|AFV30751.1|  alpha-amylase 2                                         110   1e-24   
gb|AHY18982.1|  high PI alpha-amylase 1                                 113   1e-24   
gb|AFV30614.1|  alpha-amylase 2                                         110   1e-24   
ref|XP_011042248.1|  PREDICTED: pentatricopeptide repeat-containi...    116   1e-24   
gb|AFV30836.1|  alpha-amylase 2                                         110   1e-24   
gb|AFV30604.1|  alpha-amylase 2                                         110   1e-24   
gb|AFV30608.1|  alpha-amylase 2                                         110   1e-24   
gb|ADP88919.1|  alpha-amylase                                           112   1e-24   
gb|AFV30776.1|  alpha-amylase 2                                         110   1e-24   
gb|AFV30666.1|  alpha-amylase 2                                         110   1e-24   
ref|XP_008811408.1|  PREDICTED: alpha-amylase isozyme 3D-like           112   1e-24   
gb|AFV30639.1|  alpha-amylase 2                                         110   1e-24   
gb|AFV30695.1|  alpha-amylase 2                                         110   2e-24   
gb|AFV30733.1|  alpha-amylase 2                                         110   2e-24   
gb|AFV30701.1|  alpha-amylase 2                                         110   2e-24   
ref|XP_010943052.1|  PREDICTED: alpha-amylase isozyme 3D-like           112   2e-24   
emb|CAX51373.1|  alpha-amylase                                          112   2e-24   Hordeum vulgare subsp. vulgare [barley]
gb|AFV30718.1|  alpha-amylase 2                                         110   2e-24   
gb|AFV30601.1|  alpha-amylase 2                                         110   2e-24   
gb|AFV30829.1|  alpha-amylase 2                                         110   2e-24   
gb|AFV30731.1|  alpha-amylase 2                                         110   2e-24   
gb|AFV30272.1|  amylase 1                                               105   2e-24   
ref|XP_009391375.1|  PREDICTED: alpha-amylase isozyme 3C-like           110   2e-24   
ref|XP_010061758.1|  PREDICTED: alpha-amylase-like                      112   2e-24   
ref|XP_008651084.1|  PREDICTED: uncharacterized protein LOC100273...    112   2e-24   
gb|AFV30664.1|  alpha-amylase 2                                         109   2e-24   
gb|AFV30420.1|  amylase 1                                               105   3e-24   
emb|CAA72144.1|  alpha-amylase                                          111   3e-24   Hordeum vulgare [barley]
gb|AAA32926.1|  alpha-amylase 1                                         111   3e-24   Hordeum vulgare [barley]
sp|P04749.1|AMY5_HORVU  RecName: Full=Alpha-amylase type B isozym...    106   3e-24   Hordeum vulgare [barley]
ref|XP_004965680.1|  PREDICTED: alpha-amylase type A isozyme-like       111   3e-24   
gb|AFV30716.1|  alpha-amylase 2                                         108   4e-24   
gb|AFV30830.1|  alpha-amylase 2                                         108   5e-24   
gb|AFV30738.1|  alpha-amylase 2                                         108   5e-24   
gb|AFV30820.1|  alpha-amylase 2                                         108   5e-24   
ref|XP_002282184.1|  PREDICTED: alpha-amylase                           110   5e-24   Vitis vinifera
gb|AFV30725.1|  alpha-amylase 2                                         108   5e-24   
gb|AFV30271.1|  amylase 1                                               104   6e-24   
gb|AFV30710.1|  alpha-amylase 2                                         108   6e-24   
gb|EAZ24727.1|  hypothetical protein OsJ_08498                          110   7e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AFV30659.1|  alpha-amylase 2                                         108   7e-24   
gb|AFV30590.1|  alpha-amylase 2                                         108   7e-24   
dbj|BAE47517.2|  alpha-amylase                                          110   7e-24   Hyacinthus orientalis [common hyacinth]
ref|XP_009399983.1|  PREDICTED: alpha-amylase isozyme 3C-like           110   7e-24   
ref|XP_006660697.1|  PREDICTED: alpha-amylase isozyme 3A-like           110   8e-24   
gb|AFV30657.1|  alpha-amylase 2                                         108   8e-24   
gb|AFV30592.1|  alpha-amylase 2                                         108   9e-24   
gb|ADC54371.1|  alpha amylase                                           110   9e-24   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54370.1|  alpha amylase                                           110   9e-24   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54358.1|  alpha amylase                                           110   9e-24   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ADC54351.1|  alpha amylase                                           110   9e-24   Hordeum vulgare subsp. spontaneum [wild barley]
ref|NP_001063369.1|  Os09g0457800                                       110   1e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CAA39778.1|  alpha-amylase                                          110   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ADC54339.1|  alpha amylase                                           110   1e-23   
gb|ADC54327.1|  alpha amylase                                           110   1e-23   
gb|ADC54314.1|  alpha amylase                                           110   1e-23   
gb|ADC54353.1|  alpha amylase                                           110   1e-23   
gb|ADC54332.1|  alpha amylase                                           110   1e-23   
gb|EAZ09376.1|  hypothetical protein OsI_31649                          110   1e-23   
gb|ADC54356.1|  alpha amylase                                           110   1e-23   
gb|ADC54322.1|  alpha amylase                                           110   1e-23   
gb|ADC54319.1|  alpha amylase                                           110   1e-23   
gb|ADC54357.1|  alpha amylase                                           110   1e-23   
gb|ADC54282.1|  alpha amylase                                           110   1e-23   
gb|ADC54278.1|  alpha amylase                                           110   1e-23   
gb|ADC54338.1|  alpha amylase                                           110   1e-23   
gb|ADC54329.1|  alpha amylase                                           110   1e-23   
gb|ADC54326.1|  alpha amylase                                           110   1e-23   
gb|ADC54321.1|  alpha amylase                                           110   1e-23   
gb|ADC54318.1|  alpha amylase                                           110   1e-23   
gb|ADC54286.1|  alpha amylase                                           110   1e-23   
gb|ADC54359.1|  alpha amylase                                           110   1e-23   
gb|ADC54330.1|  alpha amylase                                           110   1e-23   
gb|ADC54313.1|  alpha amylase                                           110   1e-23   
gb|ADC54307.1|  alpha amylase                                           110   1e-23   
gb|ADC54372.1|  alpha amylase                                           110   1e-23   
gb|ADC54361.1|  alpha amylase                                           110   1e-23   
gb|ADC54333.1|  alpha amylase                                           110   1e-23   
gb|ADC54301.1|  alpha amylase                                           110   1e-23   
gb|ADC54281.1|  alpha amylase                                           110   1e-23   
gb|ADC54277.1|  alpha amylase                                           110   1e-23   
gb|ADC54316.1|  alpha amylase                                           110   1e-23   
gb|ADC54308.1|  alpha amylase                                           110   1e-23   
gb|ADC54337.1|  alpha amylase                                           110   1e-23   
gb|ADC54323.1|  alpha amylase                                           110   1e-23   
gb|ADC54320.1|  alpha amylase                                           109   1e-23   
gb|ADC54283.1|  alpha amylase                                           109   1e-23   
gb|ADC54334.1|  alpha amylase                                           109   1e-23   
gb|AEO09337.4|  alpha-amylase                                           109   1e-23   
ref|XP_006660698.1|  PREDICTED: alpha-amylase isozyme 3B-like iso...    109   1e-23   
gb|EAY87654.1|  hypothetical protein OsI_09066                          109   1e-23   
ref|XP_002462321.1|  hypothetical protein SORBIDRAFT_02g023790          109   1e-23   
ref|XP_002510219.1|  pentatricopeptide repeat-containing protein,...    112   1e-23   
gb|AAA33885.1|  alpha-amylase (EC 3.2.1.1)                              109   1e-23   
ref|NP_001048220.1|  Os02g0765600                                       109   1e-23   
pdb|3WN6|A  Chain A, Crystal Structure Of Alpha-amylase Amyi-1 Fr...    109   1e-23   
emb|CAA09323.1|  alpha amylase                                          109   2e-23   
gb|EMS62196.1|  Alpha-amylase type A isozyme                            107   2e-23   
gb|ADC54336.1|  alpha amylase                                           109   2e-23   
emb|CAA34516.1|  alpha-amylase                                          109   2e-23   
gb|ADC54324.1|  alpha amylase                                           109   2e-23   
gb|ADC54284.1|  alpha amylase                                           109   2e-23   
gb|AFV30705.1|  alpha-amylase 2                                         107   2e-23   
gb|EMS45096.1|  Alpha-amylase type A isozyme                            106   2e-23   
gb|ADC54296.1|  alpha amylase                                           108   3e-23   
gb|ADC54285.1|  alpha amylase                                           108   3e-23   
gb|AAO11776.1|  alpha-amylase precursor                                 108   3e-23   
gb|ADC54328.1|  alpha amylase                                           108   4e-23   
gb|AAM09952.1|  alpha-amylase                                           108   4e-23   
ref|XP_009381896.1|  PREDICTED: alpha-amylase isozyme 3D-like           108   4e-23   
gb|ADC54306.1|  alpha amylase                                           108   4e-23   
gb|KFK29029.1|  hypothetical protein AALP_AA7G079500                    108   4e-23   
pdb|2QPU|A  Chain A, Sugar Tongs Mutant S378p In Complex With Aca...    107   5e-23   
gb|AAN01149.1|  alpha-amylase precursor                                 108   5e-23   
ref|XP_008376016.1|  PREDICTED: alpha-amylase-like                      105   5e-23   
ref|XP_007222445.1|  hypothetical protein PRUPE_ppa006160mg             108   5e-23   
ref|XP_002510218.1|  alpha-amylase, putative                            108   5e-23   
gb|KDO66103.1|  hypothetical protein CISIN_1g045962mg                   108   5e-23   
ref|XP_006659494.1|  PREDICTED: alpha-amylase isozyme 3D-like           108   5e-23   
gb|ADC54350.1|  alpha amylase                                           107   5e-23   
gb|AFV30748.1|  alpha-amylase 2                                         105   6e-23   
ref|NP_001150278.1|  alpha-amylase precursor                            107   6e-23   
gb|ADC54352.1|  alpha amylase                                           107   6e-23   
gb|ADC54348.1|  alpha amylase                                           107   6e-23   
gb|AFW73583.1|  putative alpha-amylase family protein                   108   8e-23   
gb|EMT07020.1|  Alpha-amylase type A isozyme                            105   8e-23   
ref|NP_001063367.1|  Os09g0457400                                       107   9e-23   
gb|EEC84703.1|  hypothetical protein OsI_31647                          107   9e-23   
dbj|BAD17123.1|  putative alpha-amylase precursor                       107   1e-22   
ref|XP_003578230.1|  PREDICTED: alpha-amylase isozyme 3A-like           107   1e-22   
gb|EMT33741.1|  Alpha-amylase isozyme 3A                                107   1e-22   
gb|ADC54276.1|  alpha amylase                                           107   1e-22   
ref|XP_003563559.1|  PREDICTED: alpha-amylase type A isozyme            106   2e-22   
gb|ADC54362.1|  alpha amylase                                           106   2e-22   
ref|XP_004973671.1|  PREDICTED: alpha-amylase isozyme 3D-like           106   2e-22   
emb|CAA09324.1|  alpha-amylase                                          106   2e-22   
emb|CAA45903.1|  alpha-amylase                                          106   2e-22   
pdb|3BSH|A  Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double...    105   2e-22   
ref|XP_006826844.1|  hypothetical protein AMTR_s00010p00102390          106   2e-22   
pdb|2QPS|A  Chain A, "sugar Tongs" Mutant Y380a In Complex With A...    105   3e-22   
ref|XP_010236079.1|  PREDICTED: alpha-amylase type B isozyme-like       105   3e-22   
pdb|3BSG|A  Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a ...    105   3e-22   
ref|XP_004973670.1|  PREDICTED: alpha-amylase isozyme 3B-like           105   3e-22   
emb|CBI32411.3|  unnamed protein product                                100   4e-22   
gb|ADC54365.1|  alpha amylase                                           105   4e-22   
gb|ADC54344.1|  alpha amylase                                           105   4e-22   
gb|ADC54364.1|  alpha amylase                                           105   5e-22   
ref|NP_001175871.1|  Os09g0457500                                       105   5e-22   
gb|ADC54363.1|  alpha amylase                                           105   5e-22   
gb|ADC54347.1|  alpha amylase                                           105   5e-22   
gb|ADC54340.1|  alpha amylase                                           105   5e-22   
gb|AAA33886.1|  alpha-amylase (EC 3.2.1.1)                              105   5e-22   
gb|ADC54366.1|  alpha amylase                                           105   5e-22   
gb|ADO63831.1|  alpha amylase                                           105   5e-22   
sp|P00693.1|AMY1_HORVU  RecName: Full=Alpha-amylase type A isozym...    105   5e-22   
gb|ADC54373.1|  alpha amylase                                           105   5e-22   
sp|P27933.2|AMY3D_ORYSJ  RecName: Full=Alpha-amylase isozyme 3D; ...    105   5e-22   
pdb|1RP8|A  Chain A, Crystal Structure Of Barley Alpha-Amylase Is...    104   5e-22   
pdb|1HT6|A  Chain A, Crystal Structure At 1.5a Resolution Of The ...    104   5e-22   
gb|AAA32927.1|  alpha-amylase 2                                         105   5e-22   
emb|CAX51372.1|  alpha-amylase                                          105   5e-22   
pir||JC7137  alpha-amylase (EC 3.2.1.1) isozyme I - rice                105   6e-22
gb|AAA33895.1|  alpha-amylase                                           105   6e-22   
ref|XP_006647962.1|  PREDICTED: alpha-amylase-like                      104   6e-22   
gb|EMS49001.1|  Alpha-amylase isozyme 3A                                106   7e-22   
ref|XP_002452881.1|  hypothetical protein SORBIDRAFT_04g034150          104   7e-22   
ref|NP_001062024.1|  Os08g0473900                                       105   8e-22   
ref|XP_002454601.1|  hypothetical protein SORBIDRAFT_04g034140          104   9e-22   
ref|XP_004954023.1|  PREDICTED: alpha-amylase-like                      104   9e-22   
ref|XP_009348705.1|  PREDICTED: alpha-amylase-like                      103   1e-21   
emb|CAA72143.1|  alpha-amylase                                          103   1e-21   
gb|ADC54349.1|  alpha amylase                                           103   1e-21   
ref|XP_008347138.1|  PREDICTED: alpha-amylase-like                      103   2e-21   
gb|ADC54346.1|  alpha amylase                                           103   2e-21   
gb|ACZ72923.1|  alpha-amylase isoform                                   103   2e-21   
emb|CAA39776.1|  alpha-amylase                                          103   3e-21   
gb|ADC54369.1|  alpha amylase                                           102   4e-21   
gb|ABC87289.1|  putative alpha-amylase                                98.6    4e-21   
gb|ADC54367.1|  alpha amylase                                           102   4e-21   
pir||JC7138  alpha-amylase (EC 3.2.1.1) isozyme III - rice              102   4e-21
ref|NP_001062023.1|  Os08g0473600                                       102   4e-21   
ref|XP_004973672.1|  PREDICTED: alpha-amylase isozyme 3D-like           102   5e-21   
ref|XP_006659493.1|  PREDICTED: alpha-amylase isozyme 3E-like           101   8e-21   
emb|CBI32415.3|  unnamed protein product                                100   8e-21   
ref|XP_010108610.1|  hypothetical protein L484_006341                   101   9e-21   
ref|XP_001754460.1|  predicted protein                                  101   1e-20   
gb|ADC54368.1|  alpha amylase                                           101   1e-20   
gb|AAA32928.1|  alpha-amylase 2                                         101   1e-20   
ref|NP_001169611.1|  uncharacterized protein LOC100383492 precursor     101   1e-20   
gb|EEC83729.1|  hypothetical protein OsI_29571                        94.4    2e-20   
gb|EMT10056.1|  Alpha-amylase type A isozyme                            100   2e-20   
gb|AFG66542.1|  hypothetical protein 0_9562_01                        95.1    3e-20   
emb|CAN74301.1|  hypothetical protein VITISV_028383                     100   8e-20   
ref|XP_002444507.1|  hypothetical protein SORBIDRAFT_07g023010        99.0    8e-20   
ref|XP_001777583.1|  predicted protein                                98.6    9e-20   
emb|CAA28803.1|  alpha-amylase type A                                 98.6    1e-19   
gb|EMS67306.1|  Alpha-amylase type B isozyme                          97.8    1e-19   
ref|XP_009783973.1|  PREDICTED: alpha-amylase-like                    98.2    1e-19   
ref|XP_007210561.1|  hypothetical protein PRUPE_ppa014615mg           90.1    4e-19   
gb|EMT15942.1|  Alpha-amylase isozyme 3D                              96.7    5e-19   
gb|EPS57430.1|  hypothetical protein M569_17388                       96.7    5e-19   
gb|EMS55723.1|  Alpha-amylase AMY3                                    94.4    7e-19   
ref|XP_008351999.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  97.8    8e-19   
ref|XP_008393808.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  97.8    8e-19   
gb|EMT14206.1|  Alpha-amylase AMY3                                    95.1    1e-18   
gb|ABK24287.1|  unknown                                               95.5    1e-18   
gb|ABR16554.1|  unknown                                               95.5    2e-18   
ref|XP_004980703.1|  PREDICTED: alpha-amylase type B isozyme-like     95.9    2e-18   
gb|ABK24434.1|  unknown                                               95.1    2e-18   
gb|KDP42284.1|  hypothetical protein JCGZ_01608                       92.4    3e-18   
sp|P08117.1|AMY3_WHEAT  RecName: Full=Alpha-amylase AMY3; AltName...  94.0    4e-18   
ref|XP_002460139.1|  hypothetical protein SORBIDRAFT_02g023250        93.6    2e-17   
ref|XP_002980855.1|  hypothetical protein SELMODRAFT_33940            90.1    7e-17   
ref|XP_001694202.1|  alpha-amylase                                    89.7    1e-16   
ref|XP_001694304.1|  alpha-amylase-like protein                       89.7    1e-16   
ref|XP_005850743.1|  hypothetical protein CHLNCDRAFT_29945            90.5    1e-16   
ref|XP_002989346.1|  hypothetical protein SELMODRAFT_129632           89.7    2e-16   
ref|XP_002972254.1|  hypothetical protein SELMODRAFT_97625            88.2    4e-16   
ref|XP_002984168.1|  hypothetical protein SELMODRAFT_119619           87.8    4e-16   
ref|XP_002962512.1|  hypothetical protein SELMODRAFT_79072            88.6    5e-16   
ref|XP_002962777.1|  hypothetical protein SELMODRAFT_404058           88.2    5e-16   
gb|AAX33232.1|  secreted alpha-amylase                                87.0    7e-16   
ref|XP_005649456.1|  glycoside hydrolase                              87.4    1e-15   
gb|EAZ07323.1|  hypothetical protein OsI_29572                        86.3    2e-15   
ref|XP_005850744.1|  hypothetical protein CHLNCDRAFT_50463            84.7    7e-15   
ref|XP_010943051.1|  PREDICTED: alpha-amylase isozyme 3D-like         84.7    7e-15   
gb|KDO84180.1|  hypothetical protein CISIN_1g014447mg                 82.8    2e-14   
ref|NP_001276156.1|  alpha-amylase-like precursor                     80.1    3e-13   
ref|XP_002954444.1|  hypothetical protein VOLCADRAFT_82772            80.1    3e-13   
ref|XP_007017241.1|  Alpha-amylase-like isoform 2                     78.6    5e-13   
emb|CBI32412.3|  unnamed protein product                              75.5    9e-13   
ref|XP_009391376.1|  PREDICTED: alpha-amylase isozyme 3A-like         73.9    1e-12   
gb|AFD62767.1|  putative alpha-amylase                                72.8    1e-12   
ref|WP_013314377.1|  alpha-amylase                                    77.4    2e-12   
ref|XP_007160611.1|  hypothetical protein PHAVU_001G001900g           77.0    2e-12   
gb|EEC83728.1|  hypothetical protein OsI_29570                        76.6    3e-12   
dbj|BAD73797.1|  putative alpha-amylase isozyme 3E precursor          76.6    3e-12   
ref|WP_014625247.1|  alpha-amylase                                    77.0    3e-12   
ref|XP_006661310.1|  PREDICTED: alpha-amylase isozyme 3C-like         73.2    4e-12   
ref|XP_003589189.1|  Alpha-amylase                                    70.9    4e-12   
ref|XP_001752981.1|  predicted protein                                76.3    4e-12   
ref|XP_009411975.1|  PREDICTED: probable alpha-amylase 2              75.9    6e-12   
gb|ACY38052.1|  alpha-amylase precursor                               75.9    7e-12   
dbj|BAJ85677.1|  predicted protein                                    74.3    7e-12   
gb|KCW68751.1|  hypothetical protein EUGRSUZ_F02347                   75.5    7e-12   
gb|AAY82266.1|  alpha-amylase                                         72.4    7e-12   
ref|NP_001241207.1|  uncharacterized protein LOC100813490             75.9    7e-12   
gb|KCW68749.1|  hypothetical protein EUGRSUZ_F02347                   75.5    8e-12   
gb|AAY85174.1|  alpha-amylase 2                                       75.1    1e-11   
emb|CAX51375.1|  alpha-amylase                                        74.3    2e-11   
gb|EMS45313.1|  Alpha-amylase                                         74.7    3e-11   
ref|NP_001048218.1|  Os02g0765300                                     70.1    3e-11   
gb|EMT18685.1|  Alpha-amylase                                         74.3    3e-11   
gb|EYU18612.1|  hypothetical protein MIMGU_mgv1a007250mg              73.9    3e-11   
emb|CDP00291.1|  unnamed protein product                              74.3    4e-11   
gb|KDO82806.1|  hypothetical protein CISIN_1g002585mg                 73.9    4e-11   
ref|XP_008791968.1|  PREDICTED: probable alpha-amylase 2              73.6    4e-11   
emb|CAH58639.1|  alpha-amylase                                        73.6    4e-11   
gb|KDO82805.1|  hypothetical protein CISIN_1g002585mg                 73.9    5e-11   
gb|AFV30434.1|  alpha-amylase 1                                       72.8    5e-11   
gb|AFV30435.1|  alpha-amylase 1                                       72.8    5e-11   
gb|AFV30438.1|  alpha-amylase 1                                       72.8    5e-11   
gb|AFV30436.1|  alpha-amylase 1                                       72.8    5e-11   
gb|KDO82801.1|  hypothetical protein CISIN_1g002585mg                 73.6    5e-11   
ref|XP_009411354.1|  PREDICTED: probable alpha-amylase 2              73.2    5e-11   
gb|AFV30431.1|  alpha-amylase 1                                       72.8    5e-11   
ref|XP_001768202.1|  predicted protein                                73.2    6e-11   
gb|AFO84071.1|  alpha-amylase                                         72.8    7e-11   
gb|AAA32932.1|  alpha-amylase type B, EC 3.2.1.1                      67.0    8e-11   
ref|XP_006438621.1|  hypothetical protein CICLE_v10030661mg           73.2    8e-11   
ref|XP_006483229.1|  PREDICTED: alpha-amylase 3, chloroplastic        73.2    9e-11   
ref|XP_002991426.1|  hypothetical protein SELMODRAFT_133553           72.4    9e-11   
ref|XP_006438622.1|  hypothetical protein CICLE_v10030661mg           73.2    9e-11   
gb|AFV30430.1|  alpha-amylase 1                                       72.0    1e-10   



>dbj|BAC02435.1| alpha-amylase [Ipomoea nil]
Length=424

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLKDEISKLTSIR+RNGISETSNVEILAADADAYVAKIDDKVIMKIG K DV
Sbjct  341  FYDHFFDWGLKDEISKLTSIRSRNGISETSNVEILAADADAYVAKIDDKVIMKIGSKYDV  400

Query  626  GNLIPPNFNLVTSGQDYAVWEKKI  697
            GNLIPPNFNLVTSGQDYAVWEKKI
Sbjct  401  GNLIPPNFNLVTSGQDYAVWEKKI  424


 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 68/85 (80%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            MNLFQ LSCFCLACIFVPAIGSTLL                GFNWESNKQQGGWYNSLIN
Sbjct  1    MNLFQFLSCFCLACIFVPAIGSTLLFQ--------------GFNWESNKQQGGWYNSLIN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPSHSVAPQ
Sbjct  47   SIPDLANAGITHVWLPPPSHSVAPQ  71



>gb|EMT01911.1| Alpha-amylase type A isozyme [Aegilops tauschii]
Length=253

 Score = 99.0 bits (245),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF WG KDEI+ L +IR RNGI+  S ++IL  + DAYVA+ID KV++KIG + DV
Sbjct  113  FYDHFFTWGFKDEIAALMAIRKRNGITAMSALKILMHEGDAYVAEIDGKVVVKIGSRYDV  172

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G +IP  F     G  YAVW +
Sbjct  173  GAVIPVGFATSAHGNGYAVWCR  194


 Score = 71.2 bits (173),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES KQ GGWYN ++  + D+A AG+THVWLPPPSHS++ Q
Sbjct  30   GFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSISTQ  73



>ref|XP_003589187.1| Alpha-amylase [Medicago truncatula]
Length=236

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLKD+I+KLT+IR RNGI+  S V ILAADAD YVAKID+K+I
Sbjct  149  HPGTPSI--FYDHFFDWGLKDQIAKLTAIRQRNGINMKSTVNILAADADLYVAKIDNKII  206

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGP+ D+GNLIP NF++ TSGQDYAVWE
Sbjct  207  VKIGPRMDLGNLIPSNFHVATSGQDYAVWE  236



>ref|XP_009586775.1| PREDICTED: alpha-amylase [Nicotiana tomentosiformis]
Length=422

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLKD IS L SIRNRNGIS TSNV+I+AA+AD YVA +D K+I+KIGPK D+
Sbjct  339  FYDHFFDWGLKDGISTLVSIRNRNGISATSNVQIMAANADLYVAMVDKKIIVKIGPKTDL  398

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G+LIPPN+ + TSGQDYAVWE+K
Sbjct  399  GSLIPPNYQVATSGQDYAVWEQK  421


 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES+ QQGGWYNSLIN +PDLA AG+THVWLPP S+SV+PQ
Sbjct  26   GFNWESSNQQGGWYNSLINLVPDLAKAGVTHVWLPPSSNSVSPQ  69



>ref|XP_009758535.1| PREDICTED: alpha-amylase [Nicotiana sylvestris]
Length=422

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLKD IS L SIRNRNGIS TSNV+I+AADAD YVA +D K+++KIGPK D+
Sbjct  339  FYDHFFDWGLKDGISTLVSIRNRNGISATSNVQIMAADADLYVAMVDQKIVVKIGPKTDL  398

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G+LIPPN+ + TSGQDY VWE+K
Sbjct  399  GSLIPPNYQVATSGQDYVVWEQK  421


 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES+ QQGGWYNSLIN +PDLA AGITHVWLPP S+SV+PQ
Sbjct  26   GFNWESSNQQGGWYNSLINLVPDLAKAGITHVWLPPSSNSVSPQ  69



>ref|XP_007017239.1| Alpha-amylase-like [Theobroma cacao]
 gb|EOY14464.1| Alpha-amylase-like [Theobroma cacao]
Length=449

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLKDEISKL +IRNRNGIS +S V ILA+D+D Y+A ID+K+IMKIGPK D+
Sbjct  367  FYDHFFDWGLKDEISKLVAIRNRNGISTSSTVNILASDSDLYMASIDEKIIMKIGPKMDL  426

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+P N+ L TSG DYAVWEKK
Sbjct  427  GNLVPSNYQLATSGNDYAVWEKK  449


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQVL  450
            GFNWES  + GGWYN L NS+ D+ANAG+THVWLPPPS SV PQ L
Sbjct  27   GFNWESCNKAGGWYNFLKNSVSDIANAGVTHVWLPPPSQSVGPQEL  72



>ref|XP_010061756.1| PREDICTED: alpha-amylase-like isoform X3 [Eucalyptus grandis]
Length=425

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI KLT+IR RN I+E S+VEILA+D+D YVAKIDD VIMKIGP+ +V
Sbjct  343  FYDHFFDWGLKEEIGKLTAIRARNQINEKSSVEILASDSDLYVAKIDDGVIMKIGPRFEV  402

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PPN+ + TSGQDY VWEKK
Sbjct  403  GNLVPPNYQIATSGQDYCVWEKK  425


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
              L  GFNWES+K++GGWYNSL N +PDLANAGITHVWLPPPS S A Q
Sbjct  25   ALLFQGFNWESSKKEGGWYNSLKNLVPDLANAGITHVWLPPPSQSAAQQ  73



>ref|XP_010061754.1| PREDICTED: alpha-amylase-like isoform X1 [Eucalyptus grandis]
 gb|KCW68752.1| hypothetical protein EUGRSUZ_F02349 [Eucalyptus grandis]
Length=425

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI KLT+IR RN I+E S+VEILA+D+D YVAKIDD VIMKIGP+ +V
Sbjct  343  FYDHFFDWGLKEEIGKLTAIRARNQINEKSSVEILASDSDLYVAKIDDGVIMKIGPRFEV  402

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PPN+ + TSGQDY VWEKK
Sbjct  403  GNLVPPNYQIATSGQDYCVWEKK  425


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
              L  GFNWES+K++GGWYNSL N +PDLANAGITHVWLPPPS S A Q
Sbjct  25   ALLFQGFNWESSKKEGGWYNSLKNLVPDLANAGITHVWLPPPSQSAAQQ  73



>ref|XP_011083843.1| PREDICTED: alpha-amylase [Sesamum indicum]
 ref|XP_011083844.1| PREDICTED: alpha-amylase [Sesamum indicum]
Length=449

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KDEISKL++IR RNGI+ETS VEILAADAD YVAKID+++I KIGPK D+
Sbjct  366  FYDHFFDWGKKDEISKLSAIRARNGITETSKVEILAADADLYVAKIDNRIITKIGPKMDL  425

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPP+F +  SG DYAVWEK+
Sbjct  426  GNLIPPDFQVAASGIDYAVWEKQ  448


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 13/78 (17%)
 Frame = +1

Query  211  SCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLAN  390
            SC  LA    P++ +  L             L  GFNWES+ ++GGWYNSL+N +PD+A+
Sbjct  32   SCLYLAFALFPSLAAPTL-------------LFQGFNWESSGRKGGWYNSLLNVVPDIAS  78

Query  391  AGITHVWLPPPSHSVAPQ  444
            A +THVWLPPPS S APQ
Sbjct  79   ARVTHVWLPPPSQSAAPQ  96



>ref|XP_010061755.1| PREDICTED: alpha-amylase-like isoform X2 [Eucalyptus grandis]
Length=425

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI KLT+IR RN I+E S+V+ILA+D+D YVAKIDD VIMKIGP+ +V
Sbjct  343  FYDHFFDWGLKEEIGKLTAIRARNRINEKSSVKILASDSDLYVAKIDDGVIMKIGPRFEV  402

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PPN+ + TSGQDY VWEKK
Sbjct  403  GNLVPPNYQIATSGQDYCVWEKK  425


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
              L  GFNWES K++GGWYNSL N +PDLANAGITHVWLPPPS S A Q
Sbjct  25   ALLFQGFNWESWKKEGGWYNSLKNLVPDLANAGITHVWLPPPSQSAAQQ  73



>ref|XP_010061752.1| PREDICTED: alpha-amylase-like [Eucalyptus grandis]
 gb|KCW68748.1| hypothetical protein EUGRSUZ_F02347 [Eucalyptus grandis]
 gb|KCW68750.1| hypothetical protein EUGRSUZ_F02347 [Eucalyptus grandis]
Length=425

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI KLT+IR RN I+E S+V+ILA+D+D YVAKIDD VIMKIGP+ +V
Sbjct  343  FYDHFFDWGLKEEIGKLTAIRARNRINEKSSVKILASDSDLYVAKIDDGVIMKIGPRFEV  402

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PPN+ + TSGQDY VWEKK
Sbjct  403  GNLVPPNYQIATSGQDYCVWEKK  425


 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
              L  GFNWES K++GGWYNSL N +PDLANAGITHVWLPPPS S A Q
Sbjct  25   ALLFQGFNWESWKKEGGWYNSLKNLVPDLANAGITHVWLPPPSQSAAQQ  73



>ref|XP_003589186.1| Alpha-amylase [Medicago truncatula]
 gb|AES59437.1| alpha amylase domain protein [Medicago truncatula]
Length=421

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLKD+I+KLT+IR RNGI+  S V ILAADAD YVAKID+K+I
Sbjct  334  HPGTPSI--FYDHFFDWGLKDQIAKLTAIRQRNGINMKSTVNILAADADLYVAKIDNKII  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGP+ D+GNLIP NF++ TSGQDYAVWE
Sbjct  392  VKIGPRMDLGNLIPSNFHVATSGQDYAVWE  421


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 50/85 (59%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            MN    LS FC      P + S+ L             L  GFNWES+  +GGWYNSL N
Sbjct  1    MNSLPWLSLFCFCLSIFPLLASSTL-------------LFQGFNWESS-NKGGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
             IPDLANAGITHVWLPPPS SV PQ
Sbjct  47   LIPDLANAGITHVWLPPPSQSVGPQ  71



>ref|XP_008373147.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=424

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK EISKLT+IR+RNGI   S + ILAADAD YVA ID+K+I+KIGPK D+
Sbjct  341  FYDHFFDWGLKGEISKLTAIRSRNGIKPDSALRILAADADVYVASIDEKIIVKIGPKMDL  400

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G LIPPNF + TSG+DYAVWE+K
Sbjct  401  GQLIPPNFQVSTSGKDYAVWERK  423


 Score = 63.9 bits (154),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 14/79 (18%)
 Frame = +1

Query  208  LSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLA  387
            L CF L+ +  P   ++ +             +  GFNWES+++ GGWYN L  S+ DLA
Sbjct  8    LICFLLSILLTPNFTASQI-------------IFQGFNWESSRK-GGWYNILKQSVQDLA  53

Query  388  NAGITHVWLPPPSHSVAPQ  444
            ++GITHVWLPP SH+ + +
Sbjct  54   SSGITHVWLPPSSHAASDE  72


 Score = 21.9 bits (45),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 0/35 (0%)
 Frame = +2

Query  443  KFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEI  547
            + YD    +G KDE+  L S    +GI   +++ I
Sbjct  78   RLYDLNSKFGNKDELKSLVSAYRNSGIQSVADIVI  112



>ref|XP_004235226.1| PREDICTED: alpha-amylase [Solanum lycopersicum]
Length=453

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP   L+  FYDHFFDWGLKD IS L SIR R+GI  TSNV+ILA+D+D Y+A ID K+I
Sbjct  342  HPGIPLV--FYDHFFDWGLKDGISALISIRKRSGICATSNVQILASDSDLYIAMIDQKII  399

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            +KIGPK D+GNLIPP++ + TSGQDYAVWEKK
Sbjct  400  VKIGPKLDLGNLIPPSYQVATSGQDYAVWEKK  431


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES+ +Q GWYNSLIN +PDLA+AG+THVWLPP SHSV+PQ
Sbjct  36   GFNWESSNKQSGWYNSLINLVPDLAHAGVTHVWLPPSSHSVSPQ  79



>gb|AFK42146.1| unknown [Medicago truncatula]
Length=421

 Score =   130 bits (328),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLKD+I KLT+IR RNGI+  S V ILAADAD YVAKID+K+I
Sbjct  334  HPGTPSI--FYDHFFDWGLKDQIVKLTAIRQRNGINMKSTVNILAADADLYVAKIDNKII  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGP+ D+GNLIP NF++ TSGQDYAVWE
Sbjct  392  VKIGPRMDLGNLIPSNFHVATSGQDYAVWE  421


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 50/85 (59%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            MN    LS FC      P + S+ L             L  GFNWES+  +GGWYNSL N
Sbjct  1    MNSLPWLSLFCFCLSIFPLLASSTL-------------LFQGFNWESS-NKGGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
             IPDLANAGITHVWLPPPS SV PQ
Sbjct  47   LIPDLANAGITHVWLPPPSQSVGPQ  71



>ref|XP_004294806.1| PREDICTED: alpha-amylase-like [Fragaria vesca subsp. vesca]
Length=461

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK EISKLT+IR+RNGI   S V ILAADAD YVA IDDK+I KIGP+ DV
Sbjct  378  FYDHFFDWGLKGEISKLTAIRSRNGIKPDSAVRILAADADLYVASIDDKIITKIGPRFDV  437

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            GNL+PP F + TSG+DY+VWEK
Sbjct  438  GNLVPPTFKIATSGKDYSVWEK  459


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 14/77 (18%)
 Frame = +1

Query  214  CFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANA  393
            CF L+ I +P               ++   L  GFNWES K+ GGWYN L  S  +LA++
Sbjct  47   CFLLSIISIPNF-------------TVSQILFQGFNWESAKK-GGWYNILEQSAAELASS  92

Query  394  GITHVWLPPPSHSVAPQ  444
            GITHVWLPPPS +++ +
Sbjct  93   GITHVWLPPPSQAISDE  109



>emb|CDP01359.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 6/94 (6%)
 Frame = +2

Query  419  HP--PTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDK  592
            HP  P+L    FYDH FDWGLKD I+KL+++R RNGI+ TS V+ILA+D+D YVAKIDDK
Sbjct  338  HPGIPSL----FYDHLFDWGLKDGITKLSTLRIRNGITATSKVQILASDSDLYVAKIDDK  393

Query  593  VIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            +I+KIGPK D+GNLIPPN+ + TSG DYAVWE+K
Sbjct  394  IIVKIGPKLDLGNLIPPNYQVSTSGNDYAVWERK  427


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 51/87 (59%), Gaps = 17/87 (20%)
 Frame = +1

Query  193  NLFQCLSCFCL---ACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSL  363
            NL   L+ F L    C F      TLL                GFNWES+ +QGGWYN L
Sbjct  3    NLMISLAYFFLIAGVCFFPNVAAQTLLFQ--------------GFNWESSNKQGGWYNFL  48

Query  364  INSIPDLANAGITHVWLPPPSHSVAPQ  444
            +N I DLA+AG+THVWLPPPSHSVAPQ
Sbjct  49   LNEISDLASAGVTHVWLPPPSHSVAPQ  75



>gb|AFO84070.1| alpha-amylase [Actinidia chinensis]
Length=427

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLKD+I++LT+IR RN I  TS V+I+A+D D YVA +DDK+I+KIGPK D+
Sbjct  346  FYDHFFDWGLKDQIARLTAIRTRNSIGATSKVQIMASDPDLYVAMVDDKIIVKIGPKLDL  405

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            GNLIPPNF++ TSG DYAVWEK
Sbjct  406  GNLIPPNFHVSTSGNDYAVWEK  427


 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +1

Query  235  FVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWL  414
            FV  +   LL +    L +    L+ GFNWES+ +Q GWYNSL+NSIPDLA+AGITHVWL
Sbjct  8    FVSFVSLALL-IFPTALLAAPTLLIQGFNWESSNKQEGWYNSLLNSIPDLASAGITHVWL  66

Query  415  PPPSHSVAPQ  444
            PPPS SV+ Q
Sbjct  67   PPPSQSVSSQ  76



>ref|XP_003550340.1| PREDICTED: alpha-amylase-like [Glycine max]
 gb|KHN12782.1| Alpha-amylase [Glycine soja]
Length=414

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK++I+KL+SIR ++GI+E S+V ILAA+AD YVAKID+K+ 
Sbjct  327  HPGTPSI--FYDHFFDWGLKEQIAKLSSIRVKHGINEKSSVNILAAEADLYVAKIDNKIF  384

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGPK D+GNLIPPNF++ TSGQDYAVWE
Sbjct  385  LKIGPKMDLGNLIPPNFHVATSGQDYAVWE  414


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
              L  GFNWES+K+ GGWYNSL N+IPDLANAGITHVWLPPPS SV+P+
Sbjct  24   ALLFQGFNWESSKK-GGWYNSLKNTIPDLANAGITHVWLPPPSQSVSPE  71



>gb|KHN35676.1| Alpha-amylase [Glycine soja]
Length=143

 Score =   114 bits (286),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYD + +WGLK+ I K+T IR RNG++ TS V ILAA+AD Y+A+ID+K+I+KIGPK D+
Sbjct  61   FYDPYIEWGLKEPIKKVTEIRKRNGVTATSRVNILAAEADLYMAEIDNKIIVKIGPKMDL  120

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
             NL+PPN  + TSGQDYAVW++K
Sbjct  121  VNLLPPNVQVATSGQDYAVWKRK  143


 Score = 46.6 bits (109),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 14/77 (18%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFV-PAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLI  366
            M+ F    CF   CIF+ P+  S+               L  GFNW S+++ G WYN + 
Sbjct  1    MDEFLTSLCFLFLCIFLFPSFSSS-------------AILFQGFNWASSEKAGEWYNFMK  47

Query  367  NSIPDLANAGITHVWLP  417
              +PD+A++G+ + + P
Sbjct  48   TLVPDIADSGVDYFYDP  64



>gb|KHG27234.1| Uncharacterized protein F383_11580 [Gossypium arboreum]
Length=419

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHF DWGLKDEI+KL +IR +NGISETS V+ILA+D+D YVA ID+K+I
Sbjct  330  HPGTPSI--FYDHFVDWGLKDEITKLATIRRKNGISETSKVDILASDSDLYVAAIDEKII  387

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
             KIGPK D+GNL+P N+ L TSG+DYAVW KK
Sbjct  388  TKIGPKMDLGNLVPSNYQLATSGKDYAVWAKK  419


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = +1

Query  199  FQCLSCFCLACIFV---PAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
              C++  C   +F+   P++ S  L             L  GFNWES  + GGWY+SL N
Sbjct  1    MSCVTSLCFLSLFLYIFPSLTSPSL-------------LFQGFNWESCNKAGGWYSSLKN  47

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPD+ANAG+THVWLPPPS SV PQ
Sbjct  48   SIPDIANAGVTHVWLPPPSQSVGPQ  72



>ref|XP_007134076.1| hypothetical protein PHAVU_010G017600g [Phaseolus vulgaris]
 dbj|BAA33879.1| alpha-amylase [Phaseolus vulgaris]
 gb|ESW06070.1| hypothetical protein PHAVU_010G017600g [Phaseolus vulgaris]
Length=420

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK++I+KL+SIR RNGI+E S VEI+AA+ D YVAKID+K++
Sbjct  333  HPGTPSI--FYDHFFDWGLKEQIAKLSSIRVRNGINEKSTVEIMAAEGDLYVAKIDNKIM  390

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGPK D+G LIP NF++ TSGQDYAVWE
Sbjct  391  VKIGPKMDLGKLIPSNFHVATSGQDYAVWE  420


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+ F  LS FCL     P   S+ L             L  GFNWES+K+ GGWYNSL N
Sbjct  1    MHSFSRLSIFCLFISLSPLFSSSAL-------------LFQGFNWESSKK-GGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            S+PD+ANAGITHVWLPPPS SV+P+
Sbjct  47   SVPDIANAGITHVWLPPPSQSVSPE  71



>dbj|BAC76729.1| alpha-amylase [Vigna angularis]
Length=421

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK++I+KL+SIR RNGI+E S V+ILA++ D YVAKID+K++
Sbjct  334  HPGTPSI--FYDHFFDWGLKEQIAKLSSIRVRNGINEKSTVKILASEGDLYVAKIDNKIM  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGPK D+GNLIP NF++ TSGQDYAVWE
Sbjct  392  VKIGPKMDLGNLIPSNFHVATSGQDYAVWE  421


 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 54/85 (64%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+ F  LS FCL    +P   S  L             L  GFNWES+K+ GGWYNSL N
Sbjct  1    MDSFSRLSIFCLFISLLPLFSSPAL-------------LFQGFNWESSKK-GGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPS SV+P+
Sbjct  47   SIPDLANAGITHVWLPPPSQSVSPE  71



>gb|KHG23972.1| Uncharacterized protein F383_31428 [Gossypium arboreum]
Length=415

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFD GLKDEISKL  IRNRNGI  TS V ILA++++ Y+A IDDK+IMKIGPK D+
Sbjct  333  FYDHFFDLGLKDEISKLVEIRNRNGIQSTSTVTILASESELYMASIDDKIIMKIGPKMDL  392

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
             NL+PPN+ L TSG +YAVWEKK
Sbjct  393  ANLVPPNYQLATSGNNYAVWEKK  415


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES+ + GGWYN L +S+ D+ANAG+THVWLPPPS S APQ
Sbjct  24   LFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPSQSAAPQ  70



>ref|XP_009350378.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=424

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDH+FDWGLK+EISK+T+IR+RNGI   S + ILAADAD YVA ID+K+I+KIGPK D+
Sbjct  341  FYDHYFDWGLKEEISKITAIRSRNGIKPNSALRILAADADVYVASIDEKIIVKIGPKMDL  400

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G LIP NF + TSG+DYAVWE+K
Sbjct  401  GQLIPTNFQVSTSGKDYAVWERK  423


 Score = 63.2 bits (152),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 14/80 (18%)
 Frame = +1

Query  205  CLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDL  384
             L CF L+ +  P   ++ +             L  GFNWES+++ GGWYN L  S+ DL
Sbjct  7    SLICFLLSILLTPNFAASQI-------------LFQGFNWESSRK-GGWYNILKQSVKDL  52

Query  385  ANAGITHVWLPPPSHSVAPQ  444
            A++GITHVWLPP S + + +
Sbjct  53   ASSGITHVWLPPSSQAASDE  72


 Score = 22.3 bits (46),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 0/35 (0%)
 Frame = +2

Query  443  KFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEI  547
            + YD    +G KDE+  L S    +GI   +++ I
Sbjct  78   RLYDLNTKYGNKDELKSLVSAYRDSGIQSVADIVI  112



>ref|XP_010108609.1| hypothetical protein L484_006340 [Morus notabilis]
 gb|EXC19765.1| hypothetical protein L484_006340 [Morus notabilis]
Length=424

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  386  LMLG*LMFGCHHPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADAD  565
            +MLG  ++   HP T  +  FYDH  +WGLKD+ISKL+ IR  +GI+  S V ILAA+AD
Sbjct  324  VMLG-YVYILTHPGTPTI--FYDHLIEWGLKDQISKLSGIRTTHGINSGSTVRILAAEAD  380

Query  566  AYVAKIDDKVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
             Y+A IDDKVIMKIGPK D+GNL+P N+ LVTSGQDYAVWEKK
Sbjct  381  IYMAGIDDKVIMKIGPKLDLGNLLPSNYQLVTSGQDYAVWEKK  423


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 48/85 (56%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+    L  FCL     P+  +  +             L  GFNW S+  +GGWYNSL N
Sbjct  1    MDSLISLCVFCLCISLFPSFTTPTI-------------LFQGFNWGSS-DKGGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            +IPDLA AGITHVWLPP S SVAPQ
Sbjct  47   TIPDLAAAGITHVWLPPSSQSVAPQ  71



>gb|EYU25422.1| hypothetical protein MIMGU_mgv1a006910mg [Erythranthe guttata]
Length=426

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDWG KDEISKL  IR RNGI  TS VEILAADAD YVAKID+KVI
Sbjct  337  HPGTPSV--FYDHLFDWGKKDEISKLIGIRGRNGIGATSKVEILAADADLYVAKIDNKVI  394

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
             KIGPK D+GNLIP +F +  SG DYAVWEK
Sbjct  395  TKIGPKADLGNLIPADFKVSASGTDYAVWEK  425


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 13/83 (16%)
 Frame = +1

Query  196  LFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSI  375
            L  CLS F +   F PA+  + +             L+ GFNWES+ ++GGWYN+L N +
Sbjct  5    LITCLSSFLIVFGFFPALTRSTI-------------LLQGFNWESSNKRGGWYNTLQNVV  51

Query  376  PDLANAGITHVWLPPPSHSVAPQ  444
            PD+A+AG THVWLPPPSHSV+PQ
Sbjct  52   PDIASAGFTHVWLPPPSHSVSPQ  74



>ref|XP_004499059.1| PREDICTED: alpha-amylase-like [Cicer arietinum]
Length=420

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDWGLK++I+KLT+IR RNGI+  S V ILAAD D YVAKID+K+I
Sbjct  333  HPGTPSI--FYDHLFDWGLKEQITKLTAIRVRNGINMKSTVNILAADGDIYVAKIDNKII  390

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGPK D+GNL+P NF++ TSGQDYAVWE
Sbjct  391  VKIGPKMDLGNLVPSNFHVATSGQDYAVWE  420


 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+    LS FCL+    P + S+ L             L  GFNWES+  +GGWYN L N
Sbjct  1    MDSLPWLSLFCLSIF--PLLASSTL-------------LFQGFNWESS-SKGGWYNLLKN  44

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPS SV  Q
Sbjct  45   SIPDLANAGITHVWLPPPSQSVGSQ  69



>gb|KDO84181.1| hypothetical protein CISIN_1g014447mg [Citrus sinensis]
Length=350

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 78/112 (70%), Gaps = 9/112 (8%)
 Frame = +2

Query  374  SRIW------LMLG*LMFGCHHPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETS  535
             R+W      +MLG   +   HP T  +  FYDHFFDWGLK+ ISKL ++RNRNGI+  S
Sbjct  241  QRLWPFPSDKVMLG-YAYILTHPGTPCI--FYDHFFDWGLKEAISKLAAVRNRNGINTAS  297

Query  536  NVEILAADADAYVAKIDDKVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
             V ILA+DAD Y+A I D+VIMKIGPK D+GNLIP +F +   G DYAVWEK
Sbjct  298  RVNILASDADVYIAAIGDRVIMKIGPKMDIGNLIPSDFKVAADGTDYAVWEK  349



>gb|KHG14183.1| Uncharacterized protein F383_17328 [Gossypium arboreum]
 gb|KHG30294.1| Uncharacterized protein F383_36543 [Gossypium arboreum]
Length=415

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFD G KDEISKL  IRNRNGI  TS V ILA++++ Y+A IDDK+IMKIGPK D+
Sbjct  333  FYDHFFDLGFKDEISKLVEIRNRNGIQSTSTVTILASESELYMASIDDKIIMKIGPKMDL  392

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
             NL+PPN+ L TSG +YAVWEKK
Sbjct  393  ANLVPPNYQLATSGNNYAVWEKK  415


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES+ + GGWYN L +S+ D+ANAG+THVWLPPPS S APQ
Sbjct  24   LFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPSQSAAPQ  70



>gb|KHG00963.1| Uncharacterized protein F383_22263 [Gossypium arboreum]
Length=415

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFD G KDEISKL  IRNRNGI  TS V ILA++++ Y+A IDDK+IMKIGPK D+
Sbjct  333  FYDHFFDLGFKDEISKLVEIRNRNGIQSTSTVTILASESELYMASIDDKIIMKIGPKMDL  392

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
             NL+PPN+ L TSG +YAVWEKK
Sbjct  393  ANLVPPNYQLATSGNNYAVWEKK  415


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES+ + GGWYN L +S+ D+ANAG+THVWLPPPS S APQ
Sbjct  24   LFQGFNWESSNKAGGWYNFLQSSVSDIANAGVTHVWLPPPSQSAAPQ  70



>gb|AAA16513.1| alpha amylase precursor, partial [Cuscuta reflexa]
Length=423

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK +I  L S RNRNGI+ETS+V ILAAD D YVAK+DDKVI+KIG + D+
Sbjct  338  FYDHFFDWGLKAQI-LLISSRNRNGITETSSVNILAADHDLYVAKVDDKVIVKIGTRMDL  396

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPP F +V SGQDYAVWEKK
Sbjct  397  GNLIPPGFKVVASGQDYAVWEKK  419


 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 60/82 (73%), Gaps = 14/82 (17%)
 Frame = +1

Query  199  FQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIP  378
            FQ LSC C+A  FVPAIGST+L                GFNWESNKQQGGWYNSLIN IP
Sbjct  1    FQFLSCICIAFFFVPAIGSTVLFQ--------------GFNWESNKQQGGWYNSLINLIP  46

Query  379  DLANAGITHVWLPPPSHSVAPQ  444
            DLANAGITHVWLPP SHSV+PQ
Sbjct  47   DLANAGITHVWLPPSSHSVSPQ  68



>ref|XP_010320333.1| PREDICTED: alpha-amylase isoform X2 [Solanum lycopersicum]
Length=351

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KD IS L SIR RN I  TSNV+I+A+D+D Y+A I  K+I+KIGPK D+
Sbjct  268  FYDHFFDWGFKDGISALISIRKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDL  327

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPPN+ + TSGQDYAVWE+K
Sbjct  328  GNLIPPNYEVATSGQDYAVWEQK  350



>prf||1803517A alpha amylase
Length=421

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK++I+KL+SIR RNGI+E S+V+I+A++ D YVAKID+K++
Sbjct  334  HPGTPSI--FYDHFFDWGLKEQIAKLSSIRLRNGINEKSSVKIMASEGDLYVAKIDNKIM  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGPK D+GNLIP N ++ TSGQDYAVWE
Sbjct  392  VKIGPKMDLGNLIPSNLHVATSGQDYAVWE  421


 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 54/85 (64%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+ F  LS FCL    +P   S  L             L  GFNWES+K+ GGWYNSL N
Sbjct  1    MDSFSRLSIFCLFISLLPLFSSPAL-------------LFQGFNWESSKK-GGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPS SV+P+
Sbjct  47   SIPDLANAGITHVWLPPPSQSVSPE  71



>sp|P17859.1|AMYA_VIGMU RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Vigna mungo]
 emb|CAA37217.1| unnamed protein product [Vigna mungo]
 emb|CAA51734.1| alpha-amylase [Vigna mungo]
 prf||2016476A alpha amylase
Length=421

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK++I+KL+SIR RNGI+E S V+I+A++ D YVAKID+K++
Sbjct  334  HPGTPSI--FYDHFFDWGLKEQIAKLSSIRLRNGINEKSTVKIMASEGDLYVAKIDNKIM  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +KIGPK D+GNLIP N ++ TSGQDYAVWE
Sbjct  392  VKIGPKMDLGNLIPSNLHVATSGQDYAVWE  421


 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 54/85 (64%), Gaps = 14/85 (16%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+ F  LS FCL    +P   S  L             L  GFNWES+K+ GGWYNSL N
Sbjct  1    MDSFSRLSIFCLFISLLPLFSSPAL-------------LFQGFNWESSKK-GGWYNSLKN  46

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPS SV+P+
Sbjct  47   SIPDLANAGITHVWLPPPSQSVSPE  71



>ref|XP_004294808.1| PREDICTED: alpha-amylase-like [Fragaria vesca subsp. vesca]
Length=410

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK EIS LT+IR+RNGI   S V ILAADAD YVA IDDK+I KIGP+ DV
Sbjct  327  FYDHFFDWGLKGEISNLTAIRSRNGIKPDSAVSILAADADLYVASIDDKIITKIGPRFDV  386

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            GNL+P  F + TSG+DY VWEK
Sbjct  387  GNLVPSTFKIATSGKDYCVWEK  408


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 14/77 (18%)
 Frame = +1

Query  214  CFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANA  393
            C  L+ I +P   ++ +             L  GFNWES ++ GGWYN L  S  +LA++
Sbjct  10   CILLSIISIPNFTASQI-------------LFQGFNWESARK-GGWYNILEQSAAELASS  55

Query  394  GITHVWLPPPSHSVAPQ  444
            GITHVWLPPPS SV+ +
Sbjct  56   GITHVWLPPPSQSVSDE  72



>ref|XP_004238157.1| PREDICTED: alpha-amylase isoform X1 [Solanum lycopersicum]
Length=407

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KD IS L SIR RN I  TSNV+I+A+D+D Y+A I  K+I+KIGPK D+
Sbjct  324  FYDHFFDWGFKDGISALISIRKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDL  383

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPPN+ + TSGQDYAVWE+K
Sbjct  384  GNLIPPNYEVATSGQDYAVWEQK  406


 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
              L  GFNW+S+ +QGGWYNSLIN +PDLA AG+THVWLPP SHSV+PQ
Sbjct  6    TVLFQGFNWDSSNKQGGWYNSLINLVPDLAKAGVTHVWLPPSSHSVSPQ  54



>ref|XP_006434774.1| hypothetical protein CICLE_v10001266mg [Citrus clementina]
 ref|XP_006473327.1| PREDICTED: alpha-amylase-like [Citrus sinensis]
 gb|ESR48014.1| hypothetical protein CICLE_v10001266mg [Citrus clementina]
 gb|KDO84179.1| hypothetical protein CISIN_1g014447mg [Citrus sinensis]
Length=424

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 78/112 (70%), Gaps = 9/112 (8%)
 Frame = +2

Query  374  SRIW------LMLG*LMFGCHHPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETS  535
             R+W      +MLG   +   HP T  +  FYDHFFDWGLK+ ISKL ++RNRNGI+  S
Sbjct  315  QRLWPFPSDKVMLG-YAYILTHPGTPCI--FYDHFFDWGLKEAISKLAAVRNRNGINTAS  371

Query  536  NVEILAADADAYVAKIDDKVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
             V ILA+DAD Y+A I D+VIMKIGPK D+GNLIP +F +   G DYAVWEK
Sbjct  372  RVNILASDADVYIAAIGDRVIMKIGPKMDIGNLIPSDFKVAADGTDYAVWEK  423


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 50/80 (63%), Gaps = 15/80 (19%)
 Frame = +1

Query  205  CLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDL  384
            C   F LA IF+P     LL                GFNWES+ + GGWYNSL NSIPDL
Sbjct  8    CFLSFLLA-IFLPFTSPALLFQ--------------GFNWESSNKAGGWYNSLKNSIPDL  52

Query  385  ANAGITHVWLPPPSHSVAPQ  444
            +NAGITHVWLPPPS SVAPQ
Sbjct  53   SNAGITHVWLPPPSQSVAPQ  72



>ref|XP_006354888.1| PREDICTED: alpha-amylase-like [Solanum tuberosum]
Length=423

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KD IS L SIR RN I  TSNV+I+A+D+D Y+A I  K+I+KIGPK D+
Sbjct  340  FYDHFFDWGFKDGISALISIRKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDL  399

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPPN+ + TSGQDYAVWE+K
Sbjct  400  GNLIPPNYEVATSGQDYAVWEQK  422


 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 14/77 (18%)
 Frame = +1

Query  214  CFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANA  393
            C  L+ +F+P   S+               L  GFNWES+ +QGGWYNSLIN +PDLA A
Sbjct  8    CLILS-LFLPMFASS-------------TVLFQGFNWESSNKQGGWYNSLINLVPDLAKA  53

Query  394  GITHVWLPPPSHSVAPQ  444
            G+THVWLPP SHSVAPQ
Sbjct  54   GVTHVWLPPSSHSVAPQ  70



>ref|XP_007199844.1| hypothetical protein PRUPE_ppa006152mg [Prunus persica]
 gb|EMJ01043.1| hypothetical protein PRUPE_ppa006152mg [Prunus persica]
Length=425

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLKDEI+KL +IR+RNGI   S + ILA+DAD YVA ID+K+I KIG + DV
Sbjct  342  FYDHFFDWGLKDEITKLIAIRSRNGIKPDSALRILASDADLYVAAIDEKIIAKIGSRYDV  401

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PP + + TSG+DYAVWEKK
Sbjct  402  GNLVPPTYQVATSGKDYAVWEKK  424


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 13/85 (15%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M     L C  L    +P   ++ +             L  GFNWES K +GGWYNSL  
Sbjct  1    MKSLTTLFCVLLCINLLPNFAASQI-------------LFQGFNWESWKTEGGWYNSLRK  47

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            S+P+LA++GITHVWLPPPS + + +
Sbjct  48   SVPELASSGITHVWLPPPSQAASSE  72



>ref|XP_008236505.1| PREDICTED: alpha-amylase-like [Prunus mume]
Length=419

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI+KL +IR+RNGI   S + ILA+DAD YVA ID+K+I KIG + DV
Sbjct  336  FYDHFFDWGLKEEITKLIAIRSRNGIQPNSALRILASDADLYVAAIDEKIIAKIGSRYDV  395

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PP + + TSG+DYAVWEKK
Sbjct  396  GNLVPPTYQIATSGKDYAVWEKK  418


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K++GGWYNSL  S+P+LA++GITHVWLPPPS + + +
Sbjct  26   ILFQGFNWESWKKEGGWYNSLRKSVPELASSGITHVWLPPPSQAASDE  73



>gb|AHB20171.1| high pI alpha-amylase [Triticum aestivum]
Length=108

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  19   HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDGKVI  76

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G DYAVWEK
Sbjct  77   VKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  107



>gb|AAA91883.1| alpha-amylase, partial [Solanum tuberosum]
Length=349

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG  D IS L SIR RN I  TSNV+I+A+D+D Y+A I  K+I+KIGPK D+
Sbjct  266  FYDHFFDWGFMDGISALISIRKRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDL  325

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPPN+ + TSGQDYAVWE+K
Sbjct  326  GNLIPPNYEVATSGQDYAVWEQK  348



>gb|AHB20175.1| high pI alpha-amylase [Triticum aestivum]
Length=108

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  19   HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDSKVI  76

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G+DYAVWEK
Sbjct  77   VKLGPRYDVGHLIPGGFKVVAHGKDYAVWEK  107



>ref|XP_010690292.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=430

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHF +WGLK+EI KLTSIR RNGISE+SNV I+A+DAD YVA ID KVI+K+GP+ D+
Sbjct  347  FYDHFLEWGLKEEIDKLTSIRLRNGISESSNVNIMASDADLYVAMIDGKVIVKLGPRYDL  406

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIP NF   T G+DY VWEK+
Sbjct  407  GNLIPSNFKASTFGKDYCVWEKQ  429


 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 48/82 (59%), Gaps = 13/82 (16%)
 Frame = +1

Query  199  FQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIP  378
            F  L C  L+          L S +   L      L  GFNWES+ + GG YNSL NSI 
Sbjct  8    FATLCCLSLSYFL-------LFSFVTPTL------LFQGFNWESSNKPGGLYNSLKNSID  54

Query  379  DLANAGITHVWLPPPSHSVAPQ  444
            DLA AG+THVWLPPP+HSV+PQ
Sbjct  55   DLARAGVTHVWLPPPTHSVSPQ  76



>gb|EMT30755.1| Alpha-amylase type B isozyme [Aegilops tauschii]
Length=112

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  434  LLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGP  613
            +L +FYDHFFDWGLK+EI +L SIR R+GI   S ++I+ AD+D Y+A+ID KVI+K+GP
Sbjct  26   VLFQFYDHFFDWGLKEEIDRLVSIRTRHGIHSESKLQIIEADSDLYLAEIDGKVIVKLGP  85

Query  614  KPDVGNLIPPNFNLVTSGQDYAVWEK  691
            + DVG+LIP  F +   G DYAVWEK
Sbjct  86   RYDVGHLIPGGFKVAAHGNDYAVWEK  111



>ref|XP_008236504.1| PREDICTED: alpha-amylase-like [Prunus mume]
Length=425

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI+KL +IR+RNGI   S + ILA+DAD YVA ID+K+I KIG + +V
Sbjct  342  FYDHFFDWGLKEEITKLIAIRSRNGIKPDSALRILASDADLYVAAIDEKIIAKIGSRYEV  401

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PP + L TSG+DYAVWEKK
Sbjct  402  GNLVPPTYQLATSGKDYAVWEKK  424


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNW S K +GGWYNSL  S+P+LA++GITHVWLPPPS + + +
Sbjct  26   ILFQGFNWVSWKTEGGWYNSLRKSVPELASSGITHVWLPPPSQAASDE  73



>ref|XP_006446537.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina]
 gb|ESR59777.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina]
Length=404

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  431  LLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIG  610
            +L P FYDH FDWGLK EI KL +IR +NGI+ TS V ILA+ +D YVA IDDK+I KIG
Sbjct  317  VLAPLFYDHLFDWGLKKEIGKLAAIRTKNGINTTSRVNILASQSDLYVAAIDDKIITKIG  376

Query  611  PKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            PK D+ NLIP NF + TSG+DYAVW+KK
Sbjct  377  PKMDLRNLIPRNFKVATSGKDYAVWQKK  404


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES  ++GGWYN L   IPD+A+AGITHVWLPPPS S APQ
Sbjct  17   GFNWESCNKKGGWYNFLKKRIPDIASAGITHVWLPPPSQSAAPQ  60



>ref|XP_010690290.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=427

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI +LTS+R RNGISETS V I+A D D Y+A ID+K+I+KIG K D 
Sbjct  344  FYDHFFDWGLKEEIIRLTSVRTRNGISETSRVNIMACDPDLYMAMIDEKIIVKIGSKYDT  403

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIPPN+ +VT G  Y VWEK+
Sbjct  404  GNLIPPNYKVVTYGSCYCVWEKQ  426


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNW+S  + GG YN L  S+ DLA AG+THVWLPPP+HSV+PQ
Sbjct  31   GFNWDSWNKPGGLYNFLKGSVNDLARAGVTHVWLPPPTHSVSPQ  74



>gb|AHB20172.1| high pI alpha-amylase [Triticum aestivum]
Length=108

 Score =   115 bits (289),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  19   HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDGKVI  76

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G DYAVWEK
Sbjct  77   VKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  107



>ref|XP_002285213.1| PREDICTED: alpha-amylase [Vitis vinifera]
 emb|CBI32409.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EISKL SIR RNGI   S V ILA+D D YVA ID+K+I KIGP+ DV
Sbjct  342  FYDHFFDWGLKEEISKLISIRTRNGIKPNSVVRILASDPDLYVAAIDEKIIAKIGPRYDV  401

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+P  F L TSG +YAVWEK+
Sbjct  402  GNLVPSTFKLATSGNNYAVWEKQ  424


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES+K+QGGWYN LINSIP+L+ +GITHVWLPPPS S A +
Sbjct  25   ILFQGFNWESSKKQGGWYNFLINSIPELSASGITHVWLPPPSQSAASE  72



>ref|XP_007017240.1| Alpha-amylase-like isoform 1 [Theobroma cacao]
 gb|EOY14465.1| Alpha-amylase-like isoform 1 [Theobroma cacao]
Length=419

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHF  WGLK EI+KL ++R++NGIS TS V ILA+D+D YVA ID+K+I
Sbjct  330  HPGTPSI--FYDHFVGWGLKGEITKLAAVRSKNGISATSTVNILASDSDLYVAAIDEKII  387

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+GNL+P ++ L TSG+DYAVW KK
Sbjct  388  MKIGPKLDLGNLVPSSYQLATSGKDYAVWAKK  419


 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 16/82 (20%)
 Frame = +1

Query  208  LSCFCLACIFV---PAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIP  378
            ++  C   +F+   PA+ S  L             L  GFNWES  + GGWYNSL NSIP
Sbjct  4    VTSLCFLSLFLYIFPALTSPTL-------------LFQGFNWESCNKAGGWYNSLKNSIP  50

Query  379  DLANAGITHVWLPPPSHSVAPQ  444
            D+ANAG+THVWLPPPS SV PQ
Sbjct  51   DIANAGVTHVWLPPPSQSVGPQ  72



>ref|XP_002460333.1| hypothetical protein SORBIDRAFT_02g026625 [Sorghum bicolor]
 gb|EER96854.1| hypothetical protein SORBIDRAFT_02g026625 [Sorghum bicolor]
Length=111

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S + ILAAD D YVAKIDDKVI
Sbjct  12   HPGTPCI--FYDHVFDWNLKQEISALSAVRSRNGIHPGSKLNILAADGDLYVAKIDDKVI  69

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ V  G +Y VWEK
Sbjct  70   VKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  100



>ref|XP_010667402.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=351

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WG+K+EI+KLTSIR RN I+ +S V I+A+DAD YVA ID+KVI+KIGP+ +V
Sbjct  268  FYDHFFEWGIKEEIAKLTSIRLRNMINGSSGVNIMASDADLYVAMIDEKVIVKIGPRYNV  327

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIP NF + TSG+DYA WEK+
Sbjct  328  GNLIPSNFKISTSGKDYAFWEKQ  350



>emb|CAN77038.1| hypothetical protein VITISV_004485 [Vitis vinifera]
Length=442

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EISKL  IR RNGI   S V ILA+D D YVA ID+K+I KIGP+ DV
Sbjct  360  FYDHFFDWGLKEEISKLIIIRTRNGIKPNSGVRILASDPDLYVAAIDEKIIAKIGPRYDV  419

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+P  F L TSG +YAVWEK+
Sbjct  420  GNLVPSTFKLATSGNNYAVWEKQ  442


 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 5/90 (6%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGST-----LLSVLNAQL*SI*CCLV*GFNWESNKQQGGWY  354
            M +   LS      I +P + ++     +L ++ + + S+   +  GFNWES+K+QGGWY
Sbjct  1    MGITTSLSYLLFFNIILPTLTASPILFQVLHIILSHILSLSLPMCLGFNWESSKKQGGWY  60

Query  355  NSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            N LINSIP+L+ +GITHVWLPPPS S A +
Sbjct  61   NFLINSIPELSASGITHVWLPPPSQSAASE  90



>gb|AHB20174.1| high pI alpha-amylase [Triticum aestivum]
Length=108

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWG+KDEI +L SIR R GI   S ++I+ ADAD Y+A+ID K+I
Sbjct  19   HPGTPCI--FYDHFFDWGMKDEIYRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKII  76

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +   G+DYAVWEK
Sbjct  77   VKLGPRFDVGHLIPGGFKVAAHGKDYAVWEK  107



>gb|AHB20173.1| high pI alpha-amylase [Triticum aestivum]
Length=108

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  19   HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDGKVI  76

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +   G+DYA+WEK
Sbjct  77   VKLGPRYDVGHLIPGGFKVAAHGKDYAIWEK  107



>ref|XP_009148429.1| PREDICTED: alpha-amylase 1 [Brassica rapa]
Length=435

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY H+ +WGLKD ISKL +IRNRNGI  TS+V I AA+A+ Y+A ID+KVI
Sbjct  346  HPGTPCI--FYSHYIEWGLKDSISKLVAIRNRNGIGSTSSVMIKAAEAELYLAMIDEKVI  403

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+G L+PPNF L  SG D+AVWEKK
Sbjct  404  MKIGPKLDIGTLVPPNFVLAYSGLDFAVWEKK  435


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GF WES  ++GG+YNSL NSI DL+N+GITHVWLPPPS SV+P+
Sbjct  38   LFQGFKWESWMKEGGFYNSLHNSIDDLSNSGITHVWLPPPSQSVSPE  84



>gb|EPS60632.1| alpha-amylase, partial [Genlisea aurea]
Length=351

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 3/101 (3%)
 Frame = +2

Query  386  LMLG*LMFGCHHPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADAD  565
            +MLG   +   HP T  +  FYDHFFDWG KDEIS LT+IR RNGI++TS VEI+ ADAD
Sbjct  254  VMLG-YAYILTHPGTPSV--FYDHFFDWGKKDEISNLTAIRARNGITDTSRVEIIVADAD  310

Query  566  AYVAKIDDKVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
             YVAKID KVI KIG + D+G LIP  F L TSG DYAV+E
Sbjct  311  LYVAKIDGKVIAKIGQRTDLGTLIPTGFALATSGDDYAVFE  351



>emb|CDY16261.1| BnaC01g22960D [Brassica napus]
Length=443

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY H+ +WGLKD ISKL +IRNRNGI  TS+V I AA+A+ Y+A ID+KVI
Sbjct  354  HPGTPCI--FYSHYIEWGLKDSISKLVAIRNRNGIGSTSSVMIKAAEAELYLAMIDEKVI  411

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+G L+PPNF L  SG D+AVWEKK
Sbjct  412  MKIGPKLDIGTLVPPNFVLAYSGLDFAVWEKK  443


 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GF WES  ++GG+YNSL NSI DL+N+GITH+WLPPPS SV+P+
Sbjct  49   GFKWESWMKEGGFYNSLHNSIDDLSNSGITHIWLPPPSQSVSPE  92



>emb|CDY29753.1| BnaA01g19130D [Brassica napus]
Length=434

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY H+ +WGLKD ISKL +IRNRNGI  TS+V I AA+A+ Y+A ID+KVI
Sbjct  345  HPGTPCI--FYSHYIEWGLKDSISKLVAIRNRNGIGSTSSVMIKAAEAELYLAMIDEKVI  402

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+G L+PPNF L  SG D+AVWEKK
Sbjct  403  MKIGPKLDIGTLVPPNFVLAYSGLDFAVWEKK  434


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GF WES  ++GG+YNSL NSI DL+N+GITHVWLPPPS SV+P+
Sbjct  40   GFKWESWMKEGGFYNSLHNSIDDLSNSGITHVWLPPPSQSVSPE  83



>ref|NP_567714.1| alpha-amylase 1 [Arabidopsis thaliana]
 sp|Q8VZ56.1|AMY1_ARATH RecName: Full=Alpha-amylase 1; Short=AtAMY1; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL38709.1| putative alpha-amylase [Arabidopsis thaliana]
 gb|AAM51369.1| putative alpha-amylase [Arabidopsis thaliana]
 gb|AEE84990.1| alpha-amylase 1 [Arabidopsis thaliana]
Length=423

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY+H+ +WGLK+ ISKL +IRN+NGI  TS+V I AA+AD Y+A IDDKVI
Sbjct  334  HPGTPCI--FYNHYIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVI  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK DVG L+P NF L  SG D+AVWEKK
Sbjct  392  MKIGPKQDVGTLVPSNFALAYSGLDFAVWEKK  423


 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  FNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            FNWES K++GG+YNSL NSI D+ANAGITH+WLPPPS SVAP+
Sbjct  32   FNWESWKKEGGFYNSLHNSIDDIANAGITHLWLPPPSQSVAPE  74



>ref|XP_010690291.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHF +WGLK+E+ KLTSIR RNGISE+SNV I+A+DAD YVA ID KVI+K+GP+ ++
Sbjct  345  FYDHFLEWGLKEELVKLTSIRLRNGISESSNVNIMASDADLYVAMIDGKVIVKLGPRYNL  404

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIP NF   T G+DY VWEK+
Sbjct  405  GNLIPSNFKASTFGKDYCVWEKQ  427


 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES  + GG YNSL NSI DLA AG+THVWLPPP+HSV+PQ
Sbjct  31   GFNWESCNKPGGLYNSLKNSIDDLARAGVTHVWLPPPTHSVSPQ  74



>ref|XP_009349497.1| PREDICTED: alpha-amylase-like [Pyrus x bretschneideri]
Length=432

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI+KL +IR RN I   S + ILA+DAD YVA ID+K+I KIGP+ DV
Sbjct  344  FYDHFFDWGLKEEITKLVAIRLRNRIGPDSALRILASDADLYVAAIDEKIIAKIGPRYDV  403

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PP + + TSG DY VWEKK
Sbjct  404  GNLVPPTYQIATSGNDYCVWEKK  426


 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPD-LANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K++GGWY SL    P  LA++GITHVWLPPPSHSV+PQ
Sbjct  27   LFQGFNWESWKEEGGWYKSLSKCTPQQLASSGITHVWLPPPSHSVSPQ  74



>ref|XP_010690299.1| PREDICTED: alpha-amylase-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WG+K+EI+KL SIR RN I+ +S V I+A+DAD YVA ID+KVI+KIGP+ +V
Sbjct  349  FYDHFFEWGIKEEIAKLASIRLRNMINGSSGVNIMASDADLYVAMIDEKVIVKIGPRYNV  408

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNLIP NF + TSG+DYAVWEK+
Sbjct  409  GNLIPSNFKISTSGKDYAVWEKQ  431


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 50/80 (63%), Gaps = 15/80 (19%)
 Frame = +1

Query  208  LSCFCLA-CIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDL  384
            L C  L+  I   ++ STLL                GFNWES  +QGG YNSL+NSI DL
Sbjct  9    LCCLNLSFSILFNSVASTLLFQ--------------GFNWESCNKQGGLYNSLLNSIDDL  54

Query  385  ANAGITHVWLPPPSHSVAPQ  444
            A AGITH+WLPPPSHSVAPQ
Sbjct  55   ARAGITHIWLPPPSHSVAPQ  74



>ref|XP_008373148.1| PREDICTED: alpha-amylase-like [Malus domestica]
Length=432

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDH+FDWGLK+EI+KL +IR RNG+   S + ILA+DAD YVA  D+K+I KIGP+ DV
Sbjct  344  FYDHYFDWGLKEEITKLVAIRLRNGVGPDSALRILASDADLYVAATDEKIIAKIGPRYDV  403

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PP + + TSG DY VWEKK
Sbjct  404  GNLVPPTYQIATSGNDYCVWEKK  426


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPD-LANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K++GGWY SL  SIP  LA++GITHVWLPPPSHSV+PQ
Sbjct  27   LFQGFNWESWKEEGGWYKSLSQSIPQQLASSGITHVWLPPPSHSVSPQ  74



>gb|AHO49118.1| alpha amylase, partial [Lilium hybrid cultivar]
Length=296

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDH FDWGLKD+IS L ++RNRNGI+ TS + I+  DAD YVA +D+K+IMKIGP+ +V
Sbjct  214  FYDHLFDWGLKDQISLLAAVRNRNGINPTSTLRIITYDADLYVAAVDEKIIMKIGPRYNV  273

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GN+IP NF++V SG DY VWE K
Sbjct  274  GNVIPSNFHVVASGIDYCVWEVK  296



>gb|AAM64582.1| alpha-amylase-like protein [Arabidopsis thaliana]
Length=423

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY+H+ +WGLK+ ISKL +IRN+NGI  TS+V I AA+AD Y+A IDDKVI
Sbjct  334  HPGTPCI--FYNHYIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVI  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK DVG L+P NF L  SG D+A+WEKK
Sbjct  392  MKIGPKQDVGTLVPSNFALAYSGLDFAIWEKK  423


 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  FNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            FNWES K++GG+YNSL NSI D+ANAGITH+WLPPPS SVAP+
Sbjct  32   FNWESWKKEGGFYNSLHNSIDDIANAGITHLWLPPPSQSVAPE  74



>gb|AHL44839.1| alpha-amylase-like protein [Vitis labrusca x Vitis vinifera]
Length=424

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EISKL SIR RNGI   S V ILA+D D YVA ID+K+I KIG + DV
Sbjct  342  FYDHFFDWGLKEEISKLISIRTRNGIKPNSVVRILASDPDLYVAAIDEKIIAKIGSRYDV  401

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+P  F L TSG +YAVWEK+
Sbjct  402  GNLVPSTFKLATSGNNYAVWEKQ  424


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES+K+QGGWYN LINSIP+L+ +GITHVWLPPPS S A +
Sbjct  25   ILFQGFNWESSKKQGGWYNFLINSIPELSASGITHVWLPPPSQSAASE  72



>ref|XP_011017206.1| PREDICTED: alpha-amylase isoform X2 [Populus euphratica]
Length=423

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK EI KLT+IR  +GI   S V ILA+DAD YVA ID  VI
Sbjct  334  HPGTPSI--FYDHFFDWGLKTEIGKLTTIRRTSGIGSASTVNILASDADLYVAAIDGNVI  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+GNLIP NF +  SG DY VW K+
Sbjct  392  MKIGPKMDLGNLIPSNFQVAASGADYCVWVKQ  423


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 45/76 (59%), Gaps = 10/76 (13%)
 Frame = +1

Query  217  FCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANAG  396
            FC   +F+        S L  Q          GFNWES  Q GGWYN+L N +PDLANAG
Sbjct  6    FCFFSLFLSVFPLFTSSALLFQ----------GFNWESCNQAGGWYNTLKNLVPDLANAG  55

Query  397  ITHVWLPPPSHSVAPQ  444
            ITHVWLPP S SVAPQ
Sbjct  56   ITHVWLPPASQSVAPQ  71



>emb|CAB36742.1| alpha-amylase-like protein [Arabidopsis thaliana]
 emb|CAB79409.1| alpha-amylase-like protein [Arabidopsis thaliana]
Length=428

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  419  HPPTLLLPK---FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDD  589
            HP T  +     FY+H+ +WGLK+ ISKL +IRN+NGI  TS+V I AA+AD Y+A IDD
Sbjct  334  HPGTPCIVSIILFYNHYIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDD  393

Query  590  KVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            KVIMKIGPK DVG L+P NF L  SG D+AVWEKK
Sbjct  394  KVIMKIGPKQDVGTLVPSNFALAYSGLDFAVWEKK  428


 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  FNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            FNWES K++GG+YNSL NSI D+ANAGITH+WLPPPS SVAP+
Sbjct  32   FNWESWKKEGGFYNSLHNSIDDIANAGITHLWLPPPSQSVAPE  74



>ref|XP_011017205.1| PREDICTED: alpha-amylase isoform X1 [Populus euphratica]
Length=435

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK EI KLT+IR  +GI   S V ILA+DAD YVA ID  VI
Sbjct  346  HPGTPSI--FYDHFFDWGLKTEIGKLTTIRRTSGIGSASTVNILASDADLYVAAIDGNVI  403

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+GNLIP NF +  SG DY VW K+
Sbjct  404  MKIGPKMDLGNLIPSNFQVAASGADYCVWVKQ  435


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 45/76 (59%), Gaps = 10/76 (13%)
 Frame = +1

Query  217  FCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANAG  396
            FC   +F+        S L  Q          GFNWES  Q GGWYN+L N +PDLANAG
Sbjct  6    FCFFSLFLSVFPLFTSSALLFQ----------GFNWESCNQAGGWYNTLKNLVPDLANAG  55

Query  397  ITHVWLPPPSHSVAPQ  444
            ITHVWLPP S SVAPQ
Sbjct  56   ITHVWLPPASQSVAPQ  71



>ref|NP_001140950.1| uncharacterized protein LOC100273029 [Zea mays]
 gb|ACF85041.1| unknown [Zea mays]
Length=116

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KDEI+ L ++R RNGI+ TS + IL  D D+YVA+ID KVI+KIG + DV
Sbjct  26   FYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDGDSYVAEIDGKVIVKIGSRYDV  85

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G+LIP  F +   G DYAVWEK
Sbjct  86   GHLIPAGFEVAAHGNDYAVWEK  107



>gb|AFV30790.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+IDDKVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDDKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F + T G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVATHGNDYAVW  253



>ref|XP_006374943.1| alpha amylase family protein [Populus trichocarpa]
 gb|ERP52740.1| alpha amylase family protein [Populus trichocarpa]
Length=423

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI KL +IR   GI   S V ILA+DAD YVA I+D +I
Sbjct  335  HPGTPSI--FYDHFFDWGLKEEIGKLATIRKNYGIGSASTVNILASDADLYVAAINDNII  392

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            MKIGPK D+GNLIP NF + TSG DY VW K
Sbjct  393  MKIGPKTDLGNLIPSNFQVATSGTDYCVWVK  423


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 16/79 (20%)
 Frame = +1

Query  217  FCLACIFV---PAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLA  387
            FC   +F+   P + S+ L             L  GFNWES  + GGWYNSL NS+PDLA
Sbjct  6    FCFFSLFLSVFPLLTSSYL-------------LFQGFNWESCNKAGGWYNSLKNSVPDLA  52

Query  388  NAGITHVWLPPPSHSVAPQ  444
            NAGITHVWLPP S SVAPQ
Sbjct  53   NAGITHVWLPPSSQSVAPQ  71



>gb|KDP29720.1| hypothetical protein JCGZ_18655 [Jatropha curcas]
Length=401

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WGLK+EI KL++IR  NGIS+TS+V ILAAD+D YVAKI+D VI+KIG K D+
Sbjct  313  FYDHFFEWGLKEEIIKLSAIRKNNGISQTSSVNILAADSDLYVAKINDIVIIKIGTKNDL  372

Query  626  GNLIPPNFNLVTSGQDYAVW  685
            GNLIPP+F +  SG DYAVW
Sbjct  373  GNLIPPDFQVAASGNDYAVW  392


 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 50/81 (62%), Gaps = 10/81 (12%)
 Frame = +1

Query  202  QCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPD  381
            + L  FC   +F+    ST  S ++  L      L  GFNWES+ Q GGWYN L N I D
Sbjct  2    RFLIIFCFLSLFL----STFPSFISPHL------LFQGFNWESSNQAGGWYNLLENLISD  51

Query  382  LANAGITHVWLPPPSHSVAPQ  444
            LANAGITHVWLPPPS SV+ Q
Sbjct  52   LANAGITHVWLPPPSQSVSSQ  72



>gb|AFV30709.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+IDDKVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDDKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F + T G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVATHGNDYAVW  253



>ref|XP_006387871.1| hypothetical protein POPTR_0515s00220g [Populus trichocarpa]
 gb|ERP46785.1| hypothetical protein POPTR_0515s00220g [Populus trichocarpa]
Length=423

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI KL +IR  +GI   S V ILA+DAD YVA ID  +I
Sbjct  334  HPGTPSI--FYDHFFDWGLKEEIGKLATIRKTSGIGSASTVNILASDADLYVAAIDGNMI  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+GNLIP NF +  SG DY VW KK
Sbjct  392  MKIGPKMDLGNLIPSNFQVAASGTDYCVWVKK  423


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 45/76 (59%), Gaps = 10/76 (13%)
 Frame = +1

Query  217  FCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANAG  396
            FC   +F+        S L  Q          GFNWES  Q GGWYNSL N +PDLANAG
Sbjct  6    FCFFSLFLSVFPLFTSSALLFQ----------GFNWESCNQAGGWYNSLKNLVPDLANAG  55

Query  397  ITHVWLPPPSHSVAPQ  444
            ITHVWLPP S SVAPQ
Sbjct  56   ITHVWLPPASQSVAPQ  71



>gb|AFV30283.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30284.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30285.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30286.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30288.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30289.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30291.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30293.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30295.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30296.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30392.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30393.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30401.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30402.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30275.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30276.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30277.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30278.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30279.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30280.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30281.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30282.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30294.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30297.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30298.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30299.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30300.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30301.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30302.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30303.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30310.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30311.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30312.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30313.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30314.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30315.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30316.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30317.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30318.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30319.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30320.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30321.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30322.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30323.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30324.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30325.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30326.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30327.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30329.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30330.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30331.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30332.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30333.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30334.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30335.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30336.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30337.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30338.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30339.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30340.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30341.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30342.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30343.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30344.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30345.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30346.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30347.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30349.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30350.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30353.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30354.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30355.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30356.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30357.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30358.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30359.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30360.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30361.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30362.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30363.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30364.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30365.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30366.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30367.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30368.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30369.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30370.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30371.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30372.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30373.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30376.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30377.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30378.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30379.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30380.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30381.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30382.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30383.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30384.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30386.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30387.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30388.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30389.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30394.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30395.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30396.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30397.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30398.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30399.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30400.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30403.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30404.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30405.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30406.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30407.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30408.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>ref|XP_006387870.1| alpha amylase family protein [Populus trichocarpa]
 gb|ERP46784.1| alpha amylase family protein [Populus trichocarpa]
Length=404

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI KL +IR  +GI   S V ILA+DAD YVA ID  +I
Sbjct  315  HPGTPSI--FYDHFFDWGLKEEIGKLATIRKTSGIGSASTVNILASDADLYVAAIDGNMI  372

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+GNLIP NF +  SG DY VW KK
Sbjct  373  MKIGPKMDLGNLIPSNFQVAASGTDYCVWVKK  404


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES  Q GGWYNSL N +PDLANAGITHVWLPP S SVAPQ
Sbjct  9    GFNWESCNQAGGWYNSLKNLVPDLANAGITHVWLPPASQSVAPQ  52



>ref|XP_002301186.2| hypothetical protein POPTR_0002s12790g, partial [Populus trichocarpa]
 gb|EEE80459.2| hypothetical protein POPTR_0002s12790g, partial [Populus trichocarpa]
Length=422

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI KL +IR  +GI   S V ILA+DAD YVA ID  +I
Sbjct  334  HPGTPSI--FYDHFFDWGLKEEIGKLATIRKTSGIGSASTVNILASDADLYVAAIDGNMI  391

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            MKIGPK D+GNLIP NF + TSG DY VW K
Sbjct  392  MKIGPKMDLGNLIPSNFQVATSGADYCVWVK  422


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 45/76 (59%), Gaps = 10/76 (13%)
 Frame = +1

Query  217  FCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANAG  396
            FC   +F+        S L  Q          GFNWES  Q GGWYNSL N +PDLANAG
Sbjct  6    FCFFSLFLSVFPLFTSSALLFQ----------GFNWESCNQAGGWYNSLKNLVPDLANAG  55

Query  397  ITHVWLPPPSHSVAPQ  444
            ITHVWLPP S SVAPQ
Sbjct  56   ITHVWLPPASQSVAPQ  71



>ref|XP_006657340.1| PREDICTED: LOW QUALITY PROTEIN: alpha-amylase isozyme 2A-like 
[Oryza brachyantha]
Length=456

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWG KDEI+ L ++R RNGI+  S+++IL  D DAYVA+ID KV 
Sbjct  349  HPGTPCI--FYDHFFDWGFKDEITALVAVRQRNGITAVSSLKILLYDGDAYVAEIDGKVT  406

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            MKIGP+ DV   IPP F L   G DYAVWEK
Sbjct  407  MKIGPRYDVSGYIPPGFQLAAHGNDYAVWEK  437


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES +Q GGWY+ L+  + D+A AG+THVWLPPPSHSV+ Q
Sbjct  37   GFNWESWRQSGGWYSLLMGKVDDVAAAGVTHVWLPPPSHSVSAQ  80



>ref|XP_010448491.1| PREDICTED: alpha-amylase 1-like [Camelina sativa]
Length=422

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY+H+ +WGLK+ ISKL +IRNRNGI  TS+V I AA++D Y+A IDDKVI
Sbjct  333  HPGTPCI--FYNHYMEWGLKESISKLVAIRNRNGIGSTSSVTIKAAESDLYLAMIDDKVI  390

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+G L+PP++ L  SG D+AVWE K
Sbjct  391  MKIGPKLDLGTLVPPSYALAYSGLDFAVWENK  422


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 47/83 (57%), Gaps = 17/83 (20%)
 Frame = +1

Query  196  LFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSI  375
            LF CL  F    +F     STLL                 FNWES K++GG+YNS+ NSI
Sbjct  8    LFTCLLFFI---VFPTFTFSTLLFQ--------------SFNWESWKKEGGFYNSIHNSI  50

Query  376  PDLANAGITHVWLPPPSHSVAPQ  444
             D+A AG TH+WLPP S SVAP+
Sbjct  51   DDIAKAGTTHIWLPPSSQSVAPE  73



>gb|AFV30328.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPGI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30390.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30391.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAGIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>ref|XP_006282624.1| hypothetical protein CARUB_v10004897mg [Capsella rubella]
 gb|EOA15522.1| hypothetical protein CARUB_v10004897mg [Capsella rubella]
Length=422

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY+H+ +WGLK+ ISKL +IR RNGI  TS+V I AA++D Y+A IDDKVI
Sbjct  333  HPGTPCI--FYNHYMEWGLKESISKLVAIRKRNGIGSTSSVAIKAAESDLYLAMIDDKVI  390

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            MKIGPK D+G L+P NF L  SG D+AVWEKK
Sbjct  391  MKIGPKLDLGTLVPSNFALAYSGLDFAVWEKK  422


 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  FNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            FNWES K+QGG+YNS+ NSI D+ANAG TH+WLPPPS SV+P+
Sbjct  31   FNWESWKKQGGFYNSIHNSIDDIANAGTTHIWLPPPSQSVSPE  73



>gb|AFV30374.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30375.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGNDYAVWEK  94



>gb|AAY44169.1| alpha-amylase [Hordeum vulgare]
Length=173

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS +EIL  + DAYVA+ID KV+
Sbjct  81   HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALEILMHEGDAYVAEIDGKVV  138

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  139  VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  169



>gb|AFV30351.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30352.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPDGFATSAHGKDYAVWEK  94



>ref|XP_003589191.1| Alpha amylase [Medicago truncatula]
 gb|AES59442.1| alpha amylase domain protein [Medicago truncatula]
Length=402

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 7/105 (7%)
 Frame = +2

Query  386  LMLG*LMFGCHHP--PTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAAD  559
            +MLG  ++   HP  PT+    FYDH+ +WGL + I KLT+IR RNGI+ TSNV ILAA+
Sbjct  303  VMLG-YVYILTHPGHPTI----FYDHYIEWGLMEPIKKLTAIRKRNGITATSNVNILAAE  357

Query  560  ADAYVAKIDDKVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
             D Y+A I +K+I+KIGPK D+GNL+PPN  + TSGQDYAVWE K
Sbjct  358  NDLYMANIGNKIIVKIGPKLDLGNLLPPNAQVATSGQDYAVWEIK  402


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPP--SHSVAPQ  444
            GF W S++++GGW+N L   +PD+A+AG+ +VWLPPP  SH   PQ
Sbjct  29   GFKWASSEKEGGWWNFLKTKVPDIADAGVEYVWLPPPSNSHDDGPQ  74



>ref|XP_002867631.1| hypothetical protein ARALYDRAFT_492338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43890.1| hypothetical protein ARALYDRAFT_492338 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FY+H+ +WGLK+ ISKL +IRN+NGI  TS+V I  A++D YVA IDDKVIMKIGPK DV
Sbjct  341  FYNHYIEWGLKESISKLVAIRNKNGIGNTSSVTIKVAESDLYVANIDDKVIMKIGPKQDV  400

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G L+P NF L  SG D+AVWEKK
Sbjct  401  GTLVPSNFALAYSGLDFAVWEKK  423


 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  FNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            FNWES K+ GG+YNSL NSI D+ANAG+TH+WLPPPS SVAP+
Sbjct  32   FNWESWKKDGGFYNSLHNSIDDIANAGVTHLWLPPPSQSVAPE  74



>ref|XP_004957016.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S ++ILAAD D YVAKIDDKVI
Sbjct  338  HPGTPCI--FYDHVFDWNLKQEISTLSTVRSRNGIHAGSKLDILAADGDLYVAKIDDKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+L+  G +Y VWEK
Sbjct  396  VKIGSRYDVGNLIPSDFHLIAHGNNYCVWEK  426


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L   + D+A  G THVWLPPPSHSVAPQ
Sbjct  29   LFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVAPQ  75



>dbj|BAJ34359.1| unnamed protein product [Thellungiella halophila]
Length=248

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY H+ +WGLKD I+KL +IR RNGI  TS+V I AA++D Y+A IDDKVI
Sbjct  151  HPGTPCI--FYSHYMEWGLKDSITKLVAIRKRNGIGSTSSVTIKAAESDLYLAVIDDKVI  208

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKKI  697
            MKIGPK D+G L+P N+ L  SG D AVWEK++
Sbjct  209  MKIGPKMDLGTLVPSNYALAYSGLDCAVWEKQL  241



>gb|AFV30789.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+IDDKVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDDKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30385.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+I+ KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEINGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30304.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30305.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30306.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30307.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30308.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            ++IG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VEIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30292.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG +DEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFEDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30781.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30783.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30786.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+IDDKVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDDKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AAA98615.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G DYAVWEK
Sbjct  396  VKLGPRYDVGHLIPEGFKVVAHGNDYAVWEK  426


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AG+THVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVAEQ  73



>gb|EMS54110.1| Alpha-amylase type B isozyme [Triticum urartu]
Length=427

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G DYAVWEK
Sbjct  396  VKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  426


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GG  N L+  + D+A AG+THVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGGDNFLMGKVDDIAAAGVTHVWLPPASQSVAEQ  73



>gb|AFV30649.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30650.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGNLIPEGFKVVAHGNDYAVW  253



>gb|EMS50638.1| Alpha-amylase type B isozyme [Triticum urartu]
Length=427

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G DYAVWEK
Sbjct  396  VKLGPRYDVGHLIPQGFKVVAHGNDYAVWEK  426


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GG  N L+  + D+A AG+THVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGGDNFLMGKVDDIAAAGVTHVWLPPASQSVAEQ  73



>gb|AFV30656.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S + I+ ADAD Y+A+IDDKVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLHIMEADADLYLAEIDDKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30309.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   109 bits (273),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++ L  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKTLMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30661.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F + T G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVATHGNDYAVW  253



>emb|CAX51374.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
 dbj|BAK03603.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVGNLIP  F +   G DYAVWEK
Sbjct  396  VKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  426


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AGITHVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQ  73



>sp|P04748.1|AMY4_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Clone 103, partial 
[Hordeum vulgare]
 gb|AAA32930.1| alpha-amylase type B, EC 3.2.1.1, partial [Hordeum vulgare]
Length=153

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWG K+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  64   HPRTPCI--FYDHFFDWGPKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  121

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVGNLIP  F     G DYAVWEK
Sbjct  122  VKLGPRYDVGNLIPGGFEGAAHGNDYAVWEK  152



>gb|AFV30348.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   109 bits (273),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY HFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYGHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30775.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGL++EI +L S+R R+GI   S ++I+ ADAD Y+A+IDDKVI
Sbjct  167  HPGTPCI--FYDHFFDWGLREEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDDKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AVA|B Chain B, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AMY|A Chain A, Crystal And Molecular Structure Of Barley Alpha-Amylase
 pdb|1BG9|A Chain A, Barley Alpha-Amylase With Substrate Analogue Acarbose
Length=403

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  314  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  371

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVGNLIP  F +   G DYAVWEK
Sbjct  372  VKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  402


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AGITHVWLPP S SVA Q
Sbjct  2    VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQ  49



>ref|XP_010274277.1| PREDICTED: pentatricopeptide repeat-containing protein At2g04860 
[Nelumbo nucifera]
Length=1179

 Score =   119 bits (298),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WGLK+EI KL +IR RNGI   S + I+A + D Y+A ID+K+I KIG + DV
Sbjct  342  FYDHFFNWGLKEEIVKLVAIRTRNGIRPNSTLRIIAFNPDLYLAAIDEKIIAKIGSRYDV  401

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PP F + TSG DY VWEKK
Sbjct  402  GNLVPPTFQIATSGNDYCVWEKK  424


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            MN+    S  CL    +P   +++ + L  Q          GFNWES K++GGWYNSL N
Sbjct  1    MNVVAAFSYLCLIVSLLP---TSIFAQLVFQ----------GFNWESWKKEGGWYNSLRN  47

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIP+LANAG+THVWLPPPSHSV+ +
Sbjct  48   SIPELANAGVTHVWLPPPSHSVSSE  72



>sp|P04063.3|AMY2_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=AMY2-2; AltName: 
Full=High pI alpha-amylase; Flags: Precursor [Hordeum vulgare]
 gb|AAA98790.1| alpha-amylase type B isozyme precursor [Hordeum vulgare subsp. 
vulgare]
Length=427

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVGNLIP  F +   G DYAVWEK
Sbjct  396  VKLGPRYDVGNLIPGGFKVAAHGNDYAVWEK  426


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AGITHVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQ  73



>gb|AAA33894.1| alpha-amylase [Oryza sativa Japonica Group]
Length=443

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK++I+ L ++R RNG++ TS+++I+  DADAYVA+ID KV+MKIG + DV
Sbjct  346  FYDHFFDWGLKEQIAALVAVRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDV  405

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
             +LIPP F+L   G  YAVWEK 
Sbjct  406  SSLIPPGFHLAAHGNGYAVWEKS  428


 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES +Q GGWYN L+  + D+  AG+THVWLPPPSHSV+ Q
Sbjct  28   GFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQ  71



>gb|AFV30287.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L + R RNGI+ TS +++L  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDEIAALVATRKRNGITATSALKVLMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>ref|NP_001058568.1| Os06g0713800 [Oryza sativa Japonica Group]
 sp|Q0D9J1.1|AMY2A_ORYSJ RecName: Full=Alpha-amylase isozyme 2A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 
C2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD54103.1| alpha-amylase isozyme 2A precursor [Oryza sativa Japonica Group]
 dbj|BAF20482.1| Os06g0713800 [Oryza sativa Japonica Group]
 dbj|BAG94883.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87072.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66350.1| hypothetical protein OsJ_22644 [Oryza sativa Japonica Group]
Length=445

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK++I+ L ++R RNG++ TS+++I+  DADAYVA+ID KV+MKIG + DV
Sbjct  346  FYDHFFDWGLKEQIAALVAVRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDV  405

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
             +LIPP F+L   G  YAVWEK
Sbjct  406  SSLIPPGFHLAAHGNGYAVWEK  427


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES +Q GGWYN L+  + D+  AG+THVWLPPPSHSV+ Q
Sbjct  28   GFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQ  71



>gb|AFV30419.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KD+I+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G DYAVWEK
Sbjct  64   VKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK  94



>gb|AFV30824.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTSCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>sp|A2YGY2.1|AMY2A_ORYSI RecName: Full=Alpha-amylase isozyme 2A; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Alpha-amylase isozyme 
C2; Flags: Precursor [Oryza sativa Indica Group]
 gb|EAZ02343.1| hypothetical protein OsI_24446 [Oryza sativa Indica Group]
Length=446

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK++I+ L ++R RNG++ TS+++I+  DADAYVA+ID KV+MKIG + DV
Sbjct  346  FYDHFFDWGLKEQIAALVAVRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDV  405

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
             +LIPP F+L   G  YAVWEK 
Sbjct  406  SSLIPPGFHLAAHGNGYAVWEKS  428


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES +Q GGWYN L+  + D+  AG+THVWLPPPSHSV+ Q
Sbjct  28   GFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVSTQ  71



>ref|XP_004499060.1| PREDICTED: alpha-amylase-like [Cicer arietinum]
Length=424

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 7/105 (7%)
 Frame = +2

Query  386  LMLG*LMFGCHHP--PTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAAD  559
            +MLG  ++   HP  PT+    FYDH+ +WGL + I KLT+IR RNGI+ TS+V ILAA+
Sbjct  325  VMLG-YVYILTHPGHPTI----FYDHYIEWGLMEPIKKLTAIRKRNGITATSSVNILAAE  379

Query  560  ADAYVAKIDDKVIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            +D Y+A+ID+K+I+KIGPK D+GNL+P N  + T+GQDYAVWE K
Sbjct  380  SDLYMAEIDNKIIVKIGPKLDLGNLLPSNAQVATNGQDYAVWELK  424


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 18/84 (21%)
 Frame = +1

Query  208  LSCFCLACI---FVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIP  378
            L+ FC  C+     P+  S+               L  GFNW S+++ GGWYN L + +P
Sbjct  5    LTSFCFLCLCISLFPSFSSS-------------AILFQGFNWASSEKAGGWYNFLKSKVP  51

Query  379  DLANAGITHVWLPPP--SHSVAPQ  444
            D+A+AG+ +VWLPPP  SH   PQ
Sbjct  52   DIADAGVEYVWLPPPSNSHDDGPQ  75



>gb|AAY44170.1| alpha-amylase [Hordeum vulgare]
Length=174

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  81   HPGTPCI--FYDHFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  138

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  139  VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  169



>ref|XP_004499064.1| PREDICTED: alpha-amylase-like isoform X2 [Cicer arietinum]
Length=401

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH+ +WGL + I KLT+IR RNGI+ TS+V ILAA++D Y+A+ID+K+I
Sbjct  312  HPGTPSI--FYDHYIEWGLMEPIKKLTAIRKRNGITATSSVNILAAESDLYMAEIDNKII  369

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            +KIGPK D+GNL+P N  + T+GQDYAVWE K
Sbjct  370  VKIGPKLDLGNLLPSNAQVATNGQDYAVWELK  401


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 53/85 (62%), Gaps = 16/85 (19%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+    LS FCL+ IF P + S+ L             L  GFNWES+  +GGWYN L N
Sbjct  1    MDSLAWLSLFCLS-IF-PLLASSTL-------------LFQGFNWESS-SKGGWYNLLKN  44

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPS SV  Q
Sbjct  45   SIPDLANAGITHVWLPPPSQSVGSQ  69



>gb|EMT32632.1| hypothetical protein F775_52311 [Aegilops tauschii]
Length=636

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  547  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIIEADADLYLAEIDSKVI  604

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +V  G+DYAVWEK
Sbjct  605  VKLGPRYDVGHLIPGGFKVVAHGKDYAVWEK  635


 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES    GGWYN L+  + D+A  GITHVWLPP S SVA Q
Sbjct  68   GFNWESWNHNGGWYNFLMGKVDDIAAGGITHVWLPPASQSVAEQ  111



>ref|XP_010438943.1| PREDICTED: alpha-amylase 1 [Camelina sativa]
Length=422

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY+H+ +WGLK+ ISKL +IR RNGI  TS+V I AA++D Y+A IDDKVI
Sbjct  333  HPGTPCI--FYNHYMEWGLKESISKLVAIRKRNGIGSTSSVTIKAAESDLYLAMIDDKVI  390

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            MKIGPK D+G L+PP++ L  SG D+AVWEK
Sbjct  391  MKIGPKLDLGTLVPPSYALAYSGLDFAVWEK  421


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 48/83 (58%), Gaps = 17/83 (20%)
 Frame = +1

Query  196  LFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSI  375
            LF CL  F    +F     STLL                 FNWES K++GG+YNS+ NSI
Sbjct  8    LFTCLLFFI---VFPTFTFSTLLFQ--------------SFNWESWKREGGFYNSIHNSI  50

Query  376  PDLANAGITHVWLPPPSHSVAPQ  444
             D+ANAG TH+WLPP S SVAP+
Sbjct  51   DDIANAGTTHLWLPPSSQSVAPE  73



>tpg|DAA61290.1| TPA: hypothetical protein ZEAMMB73_810620 [Zea mays]
Length=204

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KDEI+ L ++R RNGI+ TS + IL  D D+YVA+ID KVI+KIG + DV
Sbjct  114  FYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDGDSYVAEIDGKVIVKIGSRYDV  173

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G+LIP  F +   G DYAVWEK
Sbjct  174  GHLIPAGFEVAAHGNDYAVWEK  195



>gb|EMT32633.1| Alpha-amylase type B isozyme [Aegilops tauschii]
Length=427

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWG+KDEI +L SIR R GI   S ++I+ ADAD Y+A+ID K+I
Sbjct  338  HPGTPCI--FYDHFFDWGMKDEIYRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKII  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVG+LIP  F +   G+DYAVWEK
Sbjct  396  VKLGPRFDVGHLIPGGFKVAAHGKDYAVWEK  426


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AG+THVWLPP S SV+ Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVSKQ  73



>ref|XP_004499063.1| PREDICTED: alpha-amylase-like isoform X1 [Cicer arietinum]
Length=422

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH+ +WGL + I KLT+IR RNGI+ TS+V ILAA++D Y+A+ID+K+I
Sbjct  333  HPGTPSI--FYDHYIEWGLMEPIKKLTAIRKRNGITATSSVNILAAESDLYMAEIDNKII  390

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            +KIGPK D+GNL+P N  + T+GQDYAVWE K
Sbjct  391  VKIGPKLDLGNLLPSNAQVATNGQDYAVWELK  422


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 51/85 (60%), Gaps = 16/85 (19%)
 Frame = +1

Query  190  MNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLIN  369
            M+    LS FCL+    P + S+ L             L  GFNWES+  +GGWYN L N
Sbjct  1    MDSLAWLSLFCLSIF--PLLASSTL-------------LFQGFNWESS-SKGGWYNLLKN  44

Query  370  SIPDLANAGITHVWLPPPSHSVAPQ  444
            SIPDLANAGITHVWLPPPS SV  Q
Sbjct  45   SIPDLANAGITHVWLPPPSQSVGSQ  69



>gb|AFV30825.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI++L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEINRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>gb|AFV30596.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30290.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYD FF+WG KDEI+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV+
Sbjct  6    HPGTPCI--FYDRFFNWGFKDEIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVV  63

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVG +IP  F     G+DYAVWEK
Sbjct  64   VKIGTRYDVGAVIPAGFATSAHGKDYAVWEK  94



>gb|AFV30633.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30634.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30655.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDSKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30591.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30654.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDSKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPERFKVVAHGNDYAVW  253



>gb|AFV30648.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30651.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDSKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30644.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30645.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>gb|AAA32925.1| alpha-amylase 1 [Hordeum vulgare]
Length=427

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVGNLIP  F +   G DYAVW+K
Sbjct  396  VKLGPRYDVGNLIPGGFKVAAHGNDYAVWQK  426


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFN ES K  GGWYN L+  + D+A AGITHVWLPP S SVA Q
Sbjct  26   VLFQGFNSESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQ  73



>gb|AFV30609.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30610.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=254

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  168  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  225

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  226  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  254



>gb|AFV30637.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30616.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30811.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>gb|AFV30595.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|KDP38338.1| hypothetical protein JCGZ_04263 [Jatropha curcas]
Length=421

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WGLKD+I+KL SIR    I   S V+ILAA++D Y+A I+D VIMKIGPK D+
Sbjct  338  FYDHFFEWGLKDQITKLASIRKACRIHNRSTVKILAAESDLYMAAINDNVIMKIGPKMDL  397

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+PPN  L TSG+ YAVW KK
Sbjct  398  GNLLPPNVQLATSGESYAVWIKK  420


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES  ++GG YNSL NSIP+L  AGITH+WLPPPS SVAPQ
Sbjct  25   GFNWESCNKEGGLYNSLKNSIPELVGAGITHIWLPPPSQSVAPQ  68



>gb|AFV30622.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30641.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30640.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>emb|CAA33298.1| alpha-amylase [Hordeum vulgare]
 prf||1609234A high pI alpha amylase
Length=427

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DVGNLIP  F +   G DYAVW+K
Sbjct  396  VKLGPRYDVGNLIPGGFKVAAHGNDYAVWQK  426


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AGITHVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQ  73



>gb|AFV30809.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>gb|AFV30636.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30826.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>gb|AFV30660.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30629.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30613.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30611.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30593.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30594.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30597.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30599.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30600.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30606.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30607.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30612.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30617.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30619.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30620.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30621.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30623.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30624.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30625.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30626.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30628.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30630.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30631.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30635.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30638.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30642.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30643.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30646.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30647.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30653.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30598.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30742.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|ACF88424.1| unknown [Zea mays]
 tpg|DAA40237.1| TPA: alpha amylase3 [Zea mays]
Length=439

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S + ILAAD D YVAKIDDKVI
Sbjct  340  HPGTPCI--FYDHVFDWNLKQEISALSAVRSRNGIHPGSELNILAADGDLYVAKIDDKVI  397

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ V  G +Y VWEK
Sbjct  398  VKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L+  + D+A  G THVWLPPPSHSVAPQ
Sbjct  31   LFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQ  77



>gb|AFV30673.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30795.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30832.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30744.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30846.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30797.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30765.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30787.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30759.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30760.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30737.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30736.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30817.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSKSKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30804.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|NP_001105539.1| alpha-amylase precursor [Zea mays]
 gb|AAA50161.1| alpha-amylase [Zea mays]
Length=439

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S + ILAAD D YVAKIDDKVI
Sbjct  340  HPGTPCI--FYDHVFDWNLKQEISALSAVRSRNGIHPGSELNILAADGDLYVAKIDDKVI  397

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ V  G +Y VWEK
Sbjct  398  VKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L+  + D+A  G THVWLPPPSHSVAPQ
Sbjct  31   LFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQ  77



>ref|XP_002460331.1| hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
 ref|XP_002460332.1| hypothetical protein SORBIDRAFT_02g026620 [Sorghum bicolor]
 gb|EER96852.1| hypothetical protein SORBIDRAFT_02g026610 [Sorghum bicolor]
 gb|EER96853.1| hypothetical protein SORBIDRAFT_02g026620 [Sorghum bicolor]
Length=437

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S + ILAAD D YVAKIDDKVI
Sbjct  338  HPGTPCI--FYDHVFDWNLKQEISALSAVRSRNGIHPGSKLNILAADGDLYVAKIDDKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ V  G +Y VWEK
Sbjct  396  VKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  426


 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L   + D+A  G THVWLPPPSHSVAPQ
Sbjct  29   LFQGFNWESCKKQGGWYNYLRGQVDDIAATGATHVWLPPPSHSVAPQ  75



>gb|ADH43281.1| alpha amylase [Zea mays]
Length=439

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S + ILAAD D YVAKIDDKVI
Sbjct  340  HPGTPCI--FYDHVFDWNLKQEISALSAVRSRNGIHPGSELNILAADGDLYVAKIDDKVI  397

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ V  G +Y VWEK
Sbjct  398  VKIGSRYDVGNLIPSDFHAVAHGNNYCVWEK  428


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L+  + D+A  G THVWLPPPSHSVAPQ
Sbjct  31   LFQGFNWESWKKQGGWYNYLLGRVDDIAATGATHVWLPPPSHSVAPQ  77



>gb|AFV30833.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30706.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30845.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30662.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30663.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30667.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30668.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30669.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30671.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30672.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30674.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30681.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30693.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30704.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30707.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30708.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30712.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30713.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30715.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30717.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30719.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30722.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30723.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30724.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30732.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30745.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30754.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30755.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30756.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30757.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30758.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30761.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30762.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30763.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30764.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30766.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30767.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30768.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30769.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30770.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30771.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30772.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30773.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30774.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30777.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30778.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30780.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30782.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30784.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30785.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30788.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30791.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30792.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30796.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30798.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30799.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30800.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30801.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30802.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30803.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30805.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30806.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30807.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30810.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30812.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30813.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30814.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30815.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30816.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30818.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30819.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30822.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30823.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30827.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30828.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30831.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30834.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30841.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30843.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30844.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30847.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30848.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30835.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30688.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30670.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30752.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30741.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30605.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F ++  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVIAHGNDYAVW  253



>gb|AFV30410.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30411.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WG KD+I+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV++KIG + DV
Sbjct  13   FYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDV  72

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G +IP  F     G DYAVWEK
Sbjct  73   GAMIPAGFVTSAHGNDYAVWEK  94



>gb|AFV30685.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30602.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30603.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F ++  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVIAHGNDYAVW  253



>gb|AFV30652.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
             K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  AKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30615.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F ++  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVIAHGNDYAVW  253



>gb|AFV30720.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30697.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_004966428.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
 ref|XP_004966429.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=436

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KDEI+ L ++R RNGI+ TS + IL  D DAYVA+ID KVI+KIG + D+
Sbjct  346  FYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDGDAYVAEIDGKVIVKIGSRYDL  405

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G+LIP  F + T G+DYAVWEK
Sbjct  406  GHLIPVGFEVATHGKDYAVWEK  427


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GFNWES+KQ GGWYN+L+  + D+A AG+THVWLPPPSHSV+ +
Sbjct  29   GFNWESSKQTGGWYNNLMGKVDDIAAAGVTHVWLPPPSHSVSSE  72



>gb|AFV30689.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30690.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_008653926.1| PREDICTED: alpha-amylase type A isozyme-like [Zea mays]
Length=258

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KDEI+ L ++R RNGI+ TS + IL  D D+YVA+ID KVI+KIG + DV
Sbjct  168  FYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDGDSYVAEIDGKVIVKIGSRYDV  227

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G+LIP  F +   G DYAVWEK
Sbjct  228  GHLIPAGFEVAAHGNDYAVWEK  249



>gb|AFV30711.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30692.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30428.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30429.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WG KD+I+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV++KIG + DV
Sbjct  13   FYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDV  72

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G +IP  F     G DYAVWEK
Sbjct  73   GAVIPAGFVTSAHGNDYAVWEK  94



>gb|AFV30793.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30665.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30676.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30677.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30680.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30683.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30684.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30687.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30691.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30698.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30699.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30700.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30702.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30703.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30727.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30728.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30729.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30730.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30734.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30739.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30740.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30743.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30747.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30749.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30750.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30753.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30794.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30682.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30714.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30726.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30694.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_004957017.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S ++ILAAD D YVAKIDDKVI
Sbjct  338  HPGTPCI--FYDHVFDWNLKQEISTLSTVRSRNGIHAGSKLDILAADGDLYVAKIDDKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ +  G +Y VWEK
Sbjct  396  VKIGSRYDVGNLIPSDFHPIAHGNNYCVWEK  426


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L   + D+A  G THVWLPPPSHSVAPQ
Sbjct  29   LFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVAPQ  75



>ref|XP_004957015.1| PREDICTED: alpha-amylase isozyme 3C-like [Setaria italica]
Length=437

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDW LK EIS L+++R+RNGI   S ++ILAAD D YVAKIDDKVI
Sbjct  338  HPGTPCI--FYDHVFDWNLKQEISTLSTVRSRNGIHAGSKLDILAADGDLYVAKIDDKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +KIG + DVGNLIP +F+ +  G +Y VWEK
Sbjct  396  VKIGSRYDVGNLIPSDFHPIAHGNNYCVWEK  426


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K+QGGWYN L   + D+A  G THVWLPPPSHSVAPQ
Sbjct  29   LFQGFNWESWKKQGGWYNFLRGRVDDIAATGATHVWLPPPSHSVAPQ  75



>gb|AFV30746.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30808.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID K+I
Sbjct  167  HPGTPYI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKII  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPAGFKVAAHGNDYAVW  253



>gb|AFV30735.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADPYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_009410104.1| PREDICTED: alpha-amylase isozyme 3D-like [Musa acuminata subsp. 
malaccensis]
Length=422

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +2

Query  419  HP--PTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDK  592
            HP  PT+    FYDH FDWGLKDEI+ L +IR RNGI   S + IL ADAD Y+A ID+K
Sbjct  333  HPGVPTI----FYDHLFDWGLKDEITGLAAIRTRNGILPGSTLRILVADADLYLAVIDEK  388

Query  593  VIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKK  694
            V++KIG + DVGNL+P NF++V SG  Y +WEK+
Sbjct  389  VMVKIGQRYDVGNLVPANFHVVASGNGYCIWEKR  422


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +1

Query  217  FCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSLINSIPDLANAG  396
              LA +F+      +LS+  AQ       L  GFNWES ++QGGWYN L + +PD+A AG
Sbjct  4    LLLAFVFL-----VVLSLTTAQS----QILFQGFNWESWRKQGGWYNFLRSQVPDIARAG  54

Query  397  ITHVWLPPPSHSVAPQ  444
            +THVWLPPPSHSV+ Q
Sbjct  55   VTHVWLPPPSHSVSEQ  70



>gb|AFV30837.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30838.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30839.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T     FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPC--TFYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>sp|P04750.2|AMY6_HORVU RecName: Full=Alpha-amylase type B isozyme; AltName: Full=1,4-alpha-D-glucan 
glucanohydrolase; AltName: Full=Clones GRAMY56 
and 963; Flags: Precursor [Hordeum vulgare]
 emb|CAA33299.1| alpha amylase [Hordeum vulgare]
 prf||1609234B high pI alpha amylase
Length=429

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+I+ KVI+K+GP+ DV
Sbjct  347  FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIEGKVIVKLGPRYDV  406

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G+LIP  F +V  G DYAVWEK
Sbjct  407  GHLIPEGFKVVAHGNDYAVWEK  428


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AG+THVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVAEQ  73



>ref|XP_004960025.1| PREDICTED: alpha-amylase type A isozyme-like [Setaria italica]
Length=427

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFFDWG KDEI+ L ++R RNGI+ TS + IL  D DAYVA+ID KVIMKIG + DV
Sbjct  343  FYDHFFDWGFKDEIAALVAVRKRNGITPTSKLTILEHDGDAYVAEIDGKVIMKIGSRLDV  402

Query  626  GNLIPPNFNLVTSGQDYAVWE  688
            G+LIP  F +   G DYAVWE
Sbjct  403  GHLIPAGFEVAAHGNDYAVWE  423


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES KQ GGWYN L+  + D+A AG+THVWLPPPSHSV+ Q
Sbjct  23   VLFQGFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPSHSVSTQ  70



>gb|AFV30409.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30412.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30413.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30414.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30415.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30416.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30417.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30418.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30421.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30422.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30423.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30424.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30425.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30426.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30427.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+WG KD+I+ L +IR RNGI+ TS ++IL  + DAYVA+ID KV++KIG + DV
Sbjct  13   FYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDV  72

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G +IP  F     G DYAVWEK
Sbjct  73   GAVIPAGFVTSAHGNDYAVWEK  94



>gb|AFV30840.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHCESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30274.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+ G KDEI+ L +IR RNGI+ TS ++IL  D DAYVA+ID KV++KIG + DV
Sbjct  13   FYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMHDGDAYVAEIDSKVVVKIGSRYDV  72

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G +IP  F     G+DYAVWEK
Sbjct  73   GAVIPAGFVTSAHGKDYAVWEK  94



>ref|XP_006413356.1| hypothetical protein EUTSA_v10025232mg [Eutrema salsugineum]
 gb|ESQ54809.1| hypothetical protein EUTSA_v10025232mg [Eutrema salsugineum]
Length=437

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY H+ +WGLKD I+KL +IR RNGI  TS+V I AA++D Y+A IDDKVI
Sbjct  340  HPGTPCI--FYSHYMEWGLKDSITKLVAIRKRNGIGSTSSVTIKAAESDLYLAVIDDKVI  397

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEKKI  697
            MKIGPK D+G L+P N+ L  SG D AVWEK++
Sbjct  398  MKIGPKMDLGTLVPSNYALAYSGLDCAVWEKQL  430


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  313  GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            GF WES KQ+GG+YNSL NSI D++N+GITH+WLPPPS SV+P+
Sbjct  33   GFKWESWKQEGGFYNSLQNSIDDISNSGITHIWLPPPSQSVSPE  76



>gb|AFV30842.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F     G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKAAAHGNDYAVW  253



>gb|AFV30678.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRARHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30618.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGL++EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLEEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_008220223.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g04860 [Prunus mume]
Length=1127

 Score =   116 bits (291),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGL-KDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKV  595
            HP T  +  FYDHFFDWG  K+ I  LT+IR RNGI+  S+V ILAA+AD Y+A IDDK+
Sbjct  352  HPGTPSI--FYDHFFDWGWPKEPIRNLTAIRARNGINSGSSVTILAAEADLYMANIDDKI  409

Query  596  IMKIGPKPDVGNLIP--PNFNLVTSGQDYAVWEK  691
            IMKIGP+ D+G+L P   NF++ TSGQD+AVWEK
Sbjct  410  IMKIGPRSDLGDLDPTKSNFHVATSGQDFAVWEK  443


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 15/89 (17%)
 Frame = +1

Query  181  STKMNLFQCLS-CFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYN  357
            ++K N+   LS CFCL    +P+  +                L  GFNW+S+K+ GGWYN
Sbjct  15   TSKGNMNFLLSFCFCLCVSRLPSFATP-------------AVLFQGFNWDSSKK-GGWYN  60

Query  358  SLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            SL  +IP+LA++GITHVWLPPPSHS A +
Sbjct  61   SLKTTIPELASSGITHVWLPPPSHSNATE  89



>gb|AFV30675.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T     FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPC--SFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30627.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID +VI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGEVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30779.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKKEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_007017242.1| Alpha-amylase-like [Theobroma cacao]
 gb|EOY14467.1| Alpha-amylase-like [Theobroma cacao]
Length=412

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHF +WGLKD I  LT+IR ++GI+ TS V+ILAA++D Y+A+ID+K+IMKIGPK D+
Sbjct  330  FYDHFLEWGLKDTIKNLTAIRKKHGINPTSKVKILAAESDLYMAEIDEKIIMKIGPKGDL  389

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            GNL+P  + L   G+D+AVWEK
Sbjct  390  GNLLPSTYQLAYPGKDFAVWEK  411


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNW+S  ++GG+YN L +S+P+LA+AGITHVWLPPPS S  P+
Sbjct  21   ILFQGFNWQSWTKEGGFYNFLKSSVPELASAGITHVWLPPPSQSRDPE  68



>gb|AFV30679.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH+FDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHYFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30696.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F     G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKAAAHGNDYAVW  253



>gb|AFV30686.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S++ R+GI + S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVKTRHGIHDESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30751.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP  DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPGYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AHY18982.1| high PI alpha-amylase 1, partial [Triticum aestivum]
 gb|AHY18983.1| high PI alpha-amylase 1, partial [Triticum aestivum]
Length=424

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SI+ R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  337  HPGTPCI--FYDHFFDWGLKEEIDRLVSIKTRQGIHSESKLQIIEADADLYLAEIDGKVI  394

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWE  688
            +K+GP+ DVG+LIP  F +V  G DYAVWE
Sbjct  395  VKLGPRYDVGHLIPQGFKVVAHGNDYAVWE  424


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AG+THVWLPP S SVA Q
Sbjct  25   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVAEQ  72



>gb|AFV30614.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+L P  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLTPEGFKVVAHGNDYAVW  253



>ref|XP_011042248.1| PREDICTED: pentatricopeptide repeat-containing protein At2g04860 
[Populus euphratica]
Length=1272

 Score =   116 bits (290),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI KL +IR   GI  TS V ILA+DAD YVA I+D +I
Sbjct  379  HPGTGSI--FYDHFFDWGLKEEIGKLATIRKNYGIGSTSTVNILASDADLYVAAINDNII  436

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDY  676
            MKIGPK D+GNLIP NF + TSG D+
Sbjct  437  MKIGPKTDLGNLIPLNFQVATSGTDF  462


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 49/87 (56%), Gaps = 13/87 (15%)
 Frame = +1

Query  184  TKMNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSL  363
            TK   F  L  F L     P + S+ L             L  GFNWES  + GGWYNSL
Sbjct  43   TKRMSFLTLCFFSLFLSVFPLLTSSYL-------------LFQGFNWESCNKAGGWYNSL  89

Query  364  INSIPDLANAGITHVWLPPPSHSVAPQ  444
             NS+PDLANAGITHVW PP S SVAPQ
Sbjct  90   KNSVPDLANAGITHVWRPPSSQSVAPQ  116



>gb|AFV30836.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F     G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKGAAHGNDYAVW  253



>gb|AFV30604.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI     ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSEGKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F ++  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVIAHGNDYAVW  253



>gb|AFV30608.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+I  KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIGGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPERFKVVAHGNDYAVW  253



>gb|ADP88919.1| alpha-amylase [Gunnera manicata]
Length=422

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +2

Query  419  HP--PTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDK  592
            HP  P+L    FYDHF  WGLK++I +L +IR RNGI  TS V ILA+D+  YVA ID K
Sbjct  333  HPGIPSL----FYDHFVGWGLKEQIVELVAIRKRNGIVPTSTVRILASDSGLYVAMIDGK  388

Query  593  VIMKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +IMKIGP+ +VG LIPPNF + TSG +Y VWEK
Sbjct  389  IIMKIGPRYEVGILIPPNFRVATSGNNYCVWEK  421


 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 52/87 (60%), Gaps = 17/87 (20%)
 Frame = +1

Query  184  TKMNLFQCLSCFCLACIFVPAIGSTLLSVLNAQL*SI*CCLV*GFNWESNKQQGGWYNSL  363
             +MN    L   C+    VP++G  +L             L  GFNWES K++GGWYNSL
Sbjct  2    KRMNYAAFLYFLCV----VPSLGDPVL-------------LFQGFNWESWKKEGGWYNSL  44

Query  364  INSIPDLANAGITHVWLPPPSHSVAPQ  444
               IP+LA AGITHVWLPPPSHSV+ Q
Sbjct  45   AAFIPELAKAGITHVWLPPPSHSVSSQ  71



>gb|AFV30776.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ D KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAETDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30666.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R ++GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTQHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>ref|XP_008811408.1| PREDICTED: alpha-amylase isozyme 3D-like [Phoenix dactylifera]
Length=426

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDH FDWGLK  I +L +IR+RNGI   S++ I+ +D+D YVA ID+K+I KIGP+ DV
Sbjct  344  FYDHLFDWGLKKPIGELAAIRSRNGIHPGSSLRIMVSDSDLYVAAIDEKIIAKIGPRYDV  403

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GN++P N+++V SG DY VWEKK
Sbjct  404  GNIVPSNYHIVASGNDYCVWEKK  426


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K++GGWYN L   + D+ANAG+THVWLPPPSHSV+ Q
Sbjct  28   LFQGFNWESWKKEGGWYNFLKGQVSDIANAGVTHVWLPPPSHSVSEQ  74



>gb|AFV30639.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FY HFFDWGLK+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYGHFFDWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30695.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+  DAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIETDADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30733.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI ++ S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRVLSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30701.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNL P  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLTPGGFKVAAHGNDYAVW  253



>ref|XP_010943052.1| PREDICTED: alpha-amylase isozyme 3D-like [Elaeis guineensis]
Length=426

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDH FDWG K++IS+L +IR+RNGI   S++ I+ +D+D YVA ID+K+I KIGP+ DV
Sbjct  344  FYDHLFDWGFKEQISELATIRSRNGIHPGSSLRIIVSDSDLYVAAIDEKIIAKIGPRYDV  403

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G ++P NF +V SG DY VWEK+
Sbjct  404  GKVVPSNFQIVASGNDYCVWEKR  426


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  304  LV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
            L  GFNWES K++GGWYN L   + D+ANAG+THVWLPPPSHSV+ Q
Sbjct  28   LFQGFNWESWKKEGGWYNFLKGQVSDIANAGVTHVWLPPPSHSVSEQ  74



>emb|CAX51373.1| alpha-amylase [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L SIR R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  338  HPGTPCI--FYDHFFDWGLKEEIDRLVSIRTRHGIHSESKLQIMEADADLYLAEIDGKVI  395

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVWEK  691
            +K+GP+ DV +LIP  F +   G DYAVWEK
Sbjct  396  VKLGPRYDVRHLIPEGFKVAAHGNDYAVWEK  426


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  301  CLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSVAPQ  444
             L  GFNWES K  GGWYN L+  + D+A AG+THVWLPP S SVA Q
Sbjct  26   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGVTHVWLPPASQSVAEQ  73



>gb|AFV30718.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI ++ S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRVLSVRTRHGIHNESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30601.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWG K+EI +L SIR R GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGSKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVG+LIP  F +V  G DYAVW
Sbjct  225  VKLGPRYDVGHLIPEGFKVVAHGNDYAVW  253



>gb|AFV30829.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDH FDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHLFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP  F +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGFKVAAHGNDYAVW  253



>gb|AFV30731.1| alpha-amylase 2, partial [Hordeum vulgare subsp. spontaneum]
Length=253

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = +2

Query  419  HPPTLLLPKFYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVI  598
            HP T  +  FYDHFFDWGLK+EI +L S+R R+GI   S ++I+ ADAD Y+A+ID KVI
Sbjct  167  HPGTPCI--FYDHFFDWGLKEEIDRLVSVRTRHGIHSESKLQIIEADADLYLAEIDGKVI  224

Query  599  MKIGPKPDVGNLIPPNFNLVTSGQDYAVW  685
            +K+GP+ DVGNLIP    +   G DYAVW
Sbjct  225  VKLGPRYDVGNLIPGGLKVAAHGNDYAVW  253



>gb|AFV30272.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
 gb|AFV30273.1| amylase 1, partial [Hordeum vulgare subsp. spontaneum]
Length=104

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHFF+ G KDEI+ L +IR RNGI+ TS ++IL  D D+YVA+ID KV++KIG + DV
Sbjct  13   FYDHFFNLGFKDEIAALVAIRKRNGITATSALKILMHDGDSYVAEIDSKVVVKIGSRYDV  72

Query  626  GNLIPPNFNLVTSGQDYAVWEK  691
            G +IP  F     G+DYAVWEK
Sbjct  73   GAVIPAGFVTSAHGKDYAVWEK  94



>ref|XP_009391375.1| PREDICTED: alpha-amylase isozyme 3C-like [Musa acuminata subsp. 
malaccensis]
Length=280

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDH FDWGLK+ I++L   R RNGI   S + ILA+DAD Y+A ID K+++K+G + DV
Sbjct  198  FYDHMFDWGLKEAITQLAETRTRNGIHSGSALNILASDADLYMAMIDGKILIKLGSRYDV  257

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            GNL+P NF++V SG DY VWEK+
Sbjct  258  GNLVPSNFHVVASGNDYCVWEKR  280



>ref|XP_010061758.1| PREDICTED: alpha-amylase-like [Eucalyptus grandis]
Length=422

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = +2

Query  446  FYDHFFDWGLKDEISKLTSIRNRNGISETSNVEILAADADAYVAKIDDKVIMKIGPKPDV  625
            FYDHF   GLK+EI KL +IR RN I+E S+V+ILA+D+D YVA+ID  VIMKIGPK +V
Sbjct  342  FYDHFL--GLKEEIGKLITIRARNQINEKSSVKILASDSDLYVAEIDHGVIMKIGPKFEV  399

Query  626  GNLIPPNFNLVTSGQDYAVWEKK  694
            G+L+PPN+ + TSGQDY VWEK+
Sbjct  400  GDLVPPNYRIATSGQDYCVWEKE  422


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  298  CCLV*GFNWESNKQQGGWYNSLINSIPDLANAGITHVWLPPPSHSV  435
              L  GFNWES++++GGWYNSL N +PDLANAGITHVWLPPPS S 
Sbjct  24   ALLFQGFNWESSEKEGGWYNSLKNLVPDLANAGITHVWLPPPSQSA  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2332319717284