BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24748_g3_i3 len=1121 path=[1:0-952 31165:953-954 28416:955-1046
28508:1047-1059 31179:1060-1068 31188:1069-1084 31204:1085-1086
31206:1087-1087 31207:1088-1089 10989:1090-1090 31210:1091-1098
31218:1099-1099 31219:1100-1103 31223:1104-1111 17317:1112-1120]

Length=1121
                                                                      Score     E

ref|XP_009627129.1|  PREDICTED: uncharacterized protein LOC104117749    315   6e-100   
ref|XP_009761711.1|  PREDICTED: uncharacterized protein LOC104213860    313   2e-99    
ref|XP_004229535.1|  PREDICTED: uncharacterized protein LOC101261157    313   4e-99    
ref|XP_009786623.1|  PREDICTED: uncharacterized protein LOC104234713    311   2e-98    
ref|XP_006359111.1|  PREDICTED: uncharacterized protein LOC102583...    310   5e-98    
emb|CDP16208.1|  unnamed protein product                                310   6e-98    
ref|XP_010324887.1|  PREDICTED: uncharacterized protein LOC101268299    309   9e-98    
ref|XP_006346697.1|  PREDICTED: uncharacterized protein LOC102596535    308   1e-97    
emb|CAJ19269.1|  putative stress-induced protein                        305   3e-96    Solanum commersonii
ref|XP_009619401.1|  PREDICTED: uncharacterized protein LOC104111412    305   3e-96    
ref|XP_003529004.1|  PREDICTED: uncharacterized protein LOC100788...    300   3e-94    
emb|CAN65847.1|  hypothetical protein VITISV_014976                     298   1e-93    Vitis vinifera
ref|XP_002268337.1|  PREDICTED: uncharacterized protein LOC100245378    298   1e-93    Vitis vinifera
ref|XP_011086622.1|  PREDICTED: uncharacterized protein LOC105168293    298   2e-93    
ref|XP_007029857.1|  Nuclear factor 1 A-type isoform 2                  294   5e-92    
ref|XP_007029856.1|  Nuclear factor 1 A-type isoform 1                  293   5e-91    
ref|XP_008345095.1|  PREDICTED: uncharacterized protein LOC103407996    292   1e-90    
ref|XP_006437344.1|  hypothetical protein CICLE_v10031611mg             290   3e-90    
gb|KHG10101.1|  Mitochondrial inner membrane protease subunit 1         290   4e-90    
gb|ACV88395.1|  putative stress-induced protein                         282   7e-90    Cucumis sativus [cucumbers]
gb|KDP39605.1|  hypothetical protein JCGZ_02625                         288   1e-89    
ref|XP_004307193.1|  PREDICTED: uncharacterized protein LOC101307926    288   1e-89    
ref|XP_008232195.1|  PREDICTED: uncharacterized protein LOC103331357    288   1e-89    
ref|XP_007218028.1|  hypothetical protein PRUPE_ppa005972mg             288   2e-89    
ref|XP_002523978.1|  conserved hypothetical protein                     288   2e-89    Ricinus communis
ref|XP_008460086.1|  PREDICTED: uncharacterized protein LOC103499002    286   4e-89    
ref|XP_010097676.1|  hypothetical protein L484_023816                   286   5e-89    
ref|XP_004145014.1|  PREDICTED: uncharacterized protein LOC101209874    286   5e-89    
ref|XP_002319218.1|  hypothetical protein POPTR_0013s06840g             283   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006400305.1|  hypothetical protein EUTSA_v10013602mg             280   2e-86    
ref|XP_003521028.1|  PREDICTED: uncharacterized protein LOC100815...    280   2e-86    
ref|XP_009361368.1|  PREDICTED: uncharacterized protein LOC103951663    277   4e-85    
gb|KEH18002.1|  stress-induced protein, putative                        276   5e-85    
ref|XP_007134346.1|  hypothetical protein PHAVU_010G039800g             276   5e-85    
gb|KFK25983.1|  hypothetical protein AALP_AA8G187900                    276   5e-85    
ref|XP_004510160.1|  PREDICTED: uncharacterized protein LOC101490...    276   7e-85    
ref|XP_009345575.1|  PREDICTED: uncharacterized protein LOC103937356    276   7e-85    
ref|XP_009107533.1|  PREDICTED: uncharacterized protein LOC103833189    275   1e-84    
emb|CDY16904.1|  BnaC09g40310D                                          275   1e-84    
ref|NP_197266.1|  uncharacterized protein                               275   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873840.1|  hypothetical protein ARALYDRAFT_909762             275   2e-84    
ref|XP_010420495.1|  PREDICTED: uncharacterized protein LOC104706...    275   2e-84    
ref|XP_010420494.1|  PREDICTED: uncharacterized protein LOC104706...    275   2e-84    
ref|XP_006289579.1|  hypothetical protein CARUB_v10003124mg             274   3e-84    
ref|XP_010492723.1|  PREDICTED: uncharacterized protein LOC104770072    274   4e-84    
ref|XP_010453965.1|  PREDICTED: uncharacterized protein LOC104735808    273   6e-84    
ref|XP_010056513.1|  PREDICTED: uncharacterized protein LOC104444526    273   1e-83    
gb|KHG03019.1|  Wilms tumor                                             270   8e-83    
ref|XP_011004940.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    264   2e-80    
ref|XP_010266416.1|  PREDICTED: uncharacterized protein LOC104603937    264   2e-80    
ref|XP_010549738.1|  PREDICTED: uncharacterized protein LOC104820818    263   6e-80    
gb|EYU27182.1|  hypothetical protein MIMGU_mgv1a006729mg                256   4e-77    
ref|XP_010275162.1|  PREDICTED: uncharacterized protein LOC104610306    247   9e-74    
ref|XP_010905311.1|  PREDICTED: uncharacterized protein LOC105032546    224   8e-65    
gb|EYU42265.1|  hypothetical protein MIMGU_mgv1a007286mg                222   2e-64    
ref|XP_008777938.1|  PREDICTED: uncharacterized protein LOC103697788    220   1e-63    
ref|XP_009398606.1|  PREDICTED: uncharacterized protein LOC103983151    214   6e-61    
ref|XP_002443918.1|  hypothetical protein SORBIDRAFT_07g004370          197   1e-54    Sorghum bicolor [broomcorn]
gb|ACN28488.1|  unknown                                                 193   3e-53    Zea mays [maize]
dbj|BAJ98408.1|  predicted protein                                      186   2e-50    
ref|NP_001061067.1|  Os08g0163500                                       179   4e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965215.1|  hypothetical protein SELMODRAFT_230537             178   1e-47    
ref|XP_002962295.1|  hypothetical protein SELMODRAFT_77561              178   1e-47    
ref|XP_001760212.1|  predicted protein                                  177   1e-47    
gb|AIE44349.1|  putative stress-induced protein                         165   4e-46    
gb|AIE44355.1|  putative stress-induced protein                         164   1e-45    
ref|XP_001778621.1|  predicted protein                                  173   1e-45    
ref|XP_002992680.1|  hypothetical protein SELMODRAFT_135747             173   1e-45    
gb|AIE44359.1|  DUF1005 protein                                         163   2e-45    
emb|CDM84004.1|  unnamed protein product                                171   4e-45    
ref|XP_002980096.1|  hypothetical protein SELMODRAFT_111932             171   4e-45    
ref|XP_010049600.1|  PREDICTED: uncharacterized protein LOC104438202    169   3e-44    
dbj|BAJ91729.1|  predicted protein                                      169   4e-44    
ref|XP_009395733.1|  PREDICTED: uncharacterized protein LOC103980924    168   6e-44    
gb|KDO55858.1|  hypothetical protein CISIN_1g017474mg                   166   9e-44    
ref|XP_004969897.1|  PREDICTED: uncharacterized protein LOC101784603    168   1e-43    
ref|XP_009416467.1|  PREDICTED: uncharacterized protein LOC103997060    166   3e-43    
ref|XP_003620756.1|  hypothetical protein MTR_6g090060                  166   3e-43    
ref|XP_008242466.1|  PREDICTED: uncharacterized protein LOC103340798    166   4e-43    
ref|XP_006451341.1|  hypothetical protein CICLE_v10008480mg             165   4e-43    
ref|XP_008799780.1|  PREDICTED: uncharacterized protein LOC103714350    166   5e-43    
ref|XP_004157897.1|  PREDICTED: uncharacterized LOC101219082            160   6e-43    
ref|XP_010042246.1|  PREDICTED: uncharacterized protein LOC104431287    162   6e-43    
emb|CDP03235.1|  unnamed protein product                                165   6e-43    
gb|KHG29270.1|  hypothetical protein F383_14119                         165   7e-43    
ref|XP_004287493.1|  PREDICTED: uncharacterized protein LOC101301714    165   9e-43    
emb|CDY06823.1|  BnaC01g09220D                                          164   2e-42    
ref|XP_010232287.1|  PREDICTED: uncharacterized protein LOC100822437    164   2e-42    
ref|XP_007202154.1|  hypothetical protein PRUPE_ppa006267mg             163   3e-42    
ref|XP_010924447.1|  PREDICTED: uncharacterized protein LOC105047284    164   3e-42    
gb|KDP33775.1|  hypothetical protein JCGZ_07346                         163   4e-42    
ref|XP_007152956.1|  hypothetical protein PHAVU_004G174300g             163   4e-42    
ref|XP_008795504.1|  PREDICTED: uncharacterized protein LOC103711219    162   7e-42    
ref|XP_009766756.1|  PREDICTED: uncharacterized protein LOC104218054    162   9e-42    
ref|XP_008458969.1|  PREDICTED: uncharacterized protein LOC103498220    162   9e-42    
ref|XP_009352575.1|  PREDICTED: uncharacterized protein LOC103943924    162   1e-41    
ref|XP_006852767.1|  hypothetical protein AMTR_s00033p00137950          162   1e-41    
ref|XP_008367920.1|  PREDICTED: uncharacterized protein LOC103431533    157   2e-41    
ref|XP_007012983.1|  Uncharacterized protein TCM_037753                 161   2e-41    
ref|XP_011093657.1|  PREDICTED: uncharacterized protein LOC105173566    160   3e-41    
ref|XP_010249469.1|  PREDICTED: uncharacterized protein LOC104592027    160   3e-41    
ref|XP_009602498.1|  PREDICTED: uncharacterized protein LOC104097612    160   3e-41    
gb|KHG26934.1|  hypothetical protein F383_08453                         160   3e-41    
ref|XP_008387423.1|  PREDICTED: uncharacterized protein LOC103449874    160   4e-41    
ref|XP_010915009.1|  PREDICTED: uncharacterized protein LOC105040251    160   4e-41    
gb|KGN60567.1|  hypothetical protein Csa_2G000750                       160   5e-41    
ref|XP_004141026.1|  PREDICTED: uncharacterized protein LOC101219082    160   5e-41    
ref|XP_001754636.1|  predicted protein                                  160   5e-41    
ref|XP_002514196.1|  conserved hypothetical protein                     160   6e-41    Ricinus communis
ref|XP_010688362.1|  PREDICTED: uncharacterized protein LOC104902329    160   7e-41    
gb|KFK29490.1|  hypothetical protein AALP_AA7G141200                    160   7e-41    
ref|XP_010267102.1|  PREDICTED: uncharacterized protein LOC104604464    159   7e-41    
ref|XP_002867413.1|  hypothetical protein ARALYDRAFT_913577             159   9e-41    
ref|XP_010438312.1|  PREDICTED: uncharacterized protein LOC104721933    159   1e-40    
ref|XP_010433108.1|  PREDICTED: uncharacterized protein LOC104717264    159   1e-40    
ref|XP_003530524.1|  PREDICTED: uncharacterized protein LOC100811...    159   1e-40    
ref|XP_010447867.1|  PREDICTED: uncharacterized protein LOC104730404    160   1e-40    
ref|NP_194660.1|  uncharacterized protein                               159   1e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160272.1|  hypothetical protein PHAVU_002G307300g             159   1e-40    
ref|XP_003525292.1|  PREDICTED: uncharacterized protein LOC100785838    159   2e-40    
ref|XP_010110868.1|  hypothetical protein L484_006983                   158   2e-40    
ref|XP_003530182.1|  PREDICTED: uncharacterized protein LOC100790306    158   3e-40    
ref|XP_006412853.1|  hypothetical protein EUTSA_v10025288mg             158   3e-40    
ref|XP_002456333.1|  hypothetical protein SORBIDRAFT_03g034120          158   4e-40    Sorghum bicolor [broomcorn]
ref|XP_006283793.1|  hypothetical protein CARUB_v10004884mg             157   4e-40    
ref|XP_010526420.1|  PREDICTED: uncharacterized protein LOC104803996    157   5e-40    
ref|XP_002283391.1|  PREDICTED: uncharacterized protein LOC100245695    157   6e-40    Vitis vinifera
emb|CDY48610.1|  BnaA01g07550D                                          157   7e-40    
ref|XP_009597038.1|  PREDICTED: uncharacterized protein LOC104093034    157   7e-40    
ref|XP_008337614.1|  PREDICTED: uncharacterized protein LOC103400735    156   1e-39    
ref|XP_006356806.1|  PREDICTED: uncharacterized protein LOC102599523    156   1e-39    
ref|XP_004238051.1|  PREDICTED: uncharacterized protein LOC101246921    155   3e-39    
ref|XP_002301131.1|  hypothetical protein POPTR_0002s11320g             155   3e-39    Populus trichocarpa [western balsam poplar]
ref|XP_002285542.1|  PREDICTED: uncharacterized protein LOC100245533    155   3e-39    Vitis vinifera
ref|XP_004251646.1|  PREDICTED: uncharacterized protein LOC101262285    155   3e-39    
ref|XP_006353504.1|  PREDICTED: uncharacterized protein LOC102579879    155   4e-39    
gb|KDP41556.1|  hypothetical protein JCGZ_15963                         155   5e-39    
ref|XP_010061596.1|  PREDICTED: uncharacterized protein LOC104449221    155   5e-39    
ref|XP_009406176.1|  PREDICTED: uncharacterized protein LOC103989135    155   5e-39    
emb|CAN62368.1|  hypothetical protein VITISV_001847                     155   6e-39    Vitis vinifera
ref|XP_009757179.1|  PREDICTED: uncharacterized protein LOC104210073    154   7e-39    
ref|XP_004136235.1|  PREDICTED: uncharacterized protein LOC101220969    154   7e-39    
ref|XP_002510019.1|  conserved hypothetical protein                     154   9e-39    Ricinus communis
ref|XP_009410899.1|  PREDICTED: uncharacterized protein LOC103992782    154   1e-38    
ref|XP_011017042.1|  PREDICTED: uncharacterized protein LOC105120505    153   2e-38    
emb|CDP00983.1|  unnamed protein product                                154   2e-38    
ref|XP_006646307.1|  PREDICTED: uncharacterized protein LOC102706623    151   2e-38    
ref|XP_009335470.1|  PREDICTED: uncharacterized protein LOC103928190    153   2e-38    
gb|KHN16657.1|  hypothetical protein glysoja_002754                     146   3e-38    
gb|KHM99820.1|  hypothetical protein glysoja_017518                     146   4e-38    
ref|XP_009128862.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    152   5e-38    
ref|XP_008466095.1|  PREDICTED: uncharacterized protein LOC103503621    152   5e-38    
ref|XP_010245617.1|  PREDICTED: uncharacterized protein LOC104589117    152   6e-38    
ref|XP_002306517.2|  hypothetical protein POPTR_0005s19380g             152   6e-38    Populus trichocarpa [western balsam poplar]
ref|XP_003516376.1|  PREDICTED: uncharacterized protein LOC100805866    151   8e-38    
ref|NP_001143291.1|  hypothetical protein                               151   9e-38    Zea mays [maize]
gb|KHN40365.1|  hypothetical protein glysoja_000863                     145   1e-37    
ref|XP_008352747.1|  PREDICTED: uncharacterized protein LOC103416271    151   1e-37    
ref|NP_001044201.1|  Os01g0740400                                       147   2e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009759768.1|  PREDICTED: uncharacterized protein LOC104212246    150   2e-37    
ref|XP_009357220.1|  PREDICTED: uncharacterized protein LOC103947956    150   2e-37    
ref|XP_008339055.1|  PREDICTED: uncharacterized protein LOC103402092    150   3e-37    
ref|XP_004503501.1|  PREDICTED: uncharacterized protein LOC101489321    149   5e-37    
ref|XP_004299850.1|  PREDICTED: uncharacterized protein LOC101308766    149   6e-37    
ref|XP_009595727.1|  PREDICTED: uncharacterized protein LOC104091979    149   7e-37    
ref|XP_007018388.1|  Formin-like protein 18                             149   7e-37    
gb|EAY75765.1|  hypothetical protein OsI_03678                          149   8e-37    Oryza sativa Indica Group [Indian rice]
ref|XP_004501082.1|  PREDICTED: uncharacterized protein LOC101496773    148   1e-36    
gb|EYU36412.1|  hypothetical protein MIMGU_mgv1a006276mg                148   2e-36    
ref|XP_011078236.1|  PREDICTED: uncharacterized protein LOC105162032    147   2e-36    
ref|XP_008219142.1|  PREDICTED: uncharacterized protein LOC103319390    147   2e-36    
ref|XP_007222135.1|  hypothetical protein PRUPE_ppa005719mg             147   3e-36    
ref|XP_003573437.1|  PREDICTED: uncharacterized protein LOC100828811    147   3e-36    
ref|XP_010104534.1|  hypothetical protein L484_025508                   146   5e-36    
gb|EYU30689.1|  hypothetical protein MIMGU_mgv1a0070432mg               141   7e-36    
emb|CDY63745.1|  BnaC05g07770D                                          145   1e-35    
emb|CDY57930.1|  BnaA06g37990D                                          145   1e-35    
ref|XP_010692653.1|  PREDICTED: uncharacterized protein LOC104905738    145   1e-35    
ref|XP_011074314.1|  PREDICTED: uncharacterized protein LOC105159071    145   2e-35    
ref|XP_007137270.1|  hypothetical protein PHAVU_009G113400g             145   2e-35    
ref|XP_003526511.1|  PREDICTED: uncharacterized protein LOC100805268    145   2e-35    
gb|EYU34216.1|  hypothetical protein MIMGU_mgv1a006107mg                145   2e-35    
ref|XP_011011605.1|  PREDICTED: uncharacterized protein LOC105116107    144   3e-35    
ref|XP_010266771.1|  PREDICTED: uncharacterized protein LOC104604209    144   3e-35    
emb|CDY20666.1|  BnaC08g13920D                                          144   3e-35    
ref|XP_003522725.1|  PREDICTED: uncharacterized protein LOC100775...    144   4e-35    
ref|XP_003603662.1|  hypothetical protein MTR_3g110630                  144   5e-35    
ref|XP_003610647.1|  hypothetical protein MTR_5g005420                  142   8e-35    
gb|AFK43684.1|  unknown                                                 142   9e-35    
emb|CDY31054.1|  BnaA08g26040D                                          143   1e-34    
ref|XP_007041415.1|  Gb:AAC34331.1                                      142   1e-34    
ref|XP_009144481.1|  PREDICTED: uncharacterized protein LOC103868126    142   1e-34    
ref|XP_006307457.1|  hypothetical protein CARUB_v10009083mg             142   2e-34    
ref|XP_009148322.1|  PREDICTED: uncharacterized protein LOC103871783    142   2e-34    
gb|KFK43302.1|  hypothetical protein AALP_AA1G106600                    142   2e-34    
ref|XP_010458327.1|  PREDICTED: uncharacterized protein LOC104739...    142   2e-34    
ref|XP_010490593.1|  PREDICTED: uncharacterized protein LOC104768341    142   2e-34    
ref|XP_011078480.1|  PREDICTED: uncharacterized protein LOC105162206    142   3e-34    
ref|XP_006486865.1|  PREDICTED: uncharacterized protein LOC102617316    141   6e-34    
gb|KDO49502.1|  hypothetical protein CISIN_1g012226mg                   140   8e-34    
ref|XP_006422727.1|  hypothetical protein CICLE_v10028366mg             140   8e-34    
ref|NP_172473.1|  uncharacterized protein                               140   8e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892543.1|  hypothetical protein ARALYDRAFT_888260             140   9e-34    
ref|XP_010544039.1|  PREDICTED: uncharacterized protein LOC104816779    140   1e-33    
dbj|BAJ89116.1|  predicted protein                                      138   1e-33    
ref|XP_008801663.1|  PREDICTED: uncharacterized protein LOC103715709    140   1e-33    
ref|XP_010539384.1|  PREDICTED: uncharacterized protein LOC104813482    139   1e-33    
ref|XP_010943312.1|  PREDICTED: uncharacterized protein LOC105061065    139   1e-33    
ref|XP_009407691.1|  PREDICTED: uncharacterized protein LOC103990325    139   2e-33    
ref|XP_006417503.1|  hypothetical protein EUTSA_v10007581mg             139   3e-33    
ref|XP_006355293.1|  PREDICTED: uncharacterized protein LOC102593921    138   3e-33    
ref|XP_007157186.1|  hypothetical protein PHAVU_002G049700g             138   3e-33    
ref|XP_010458326.1|  PREDICTED: uncharacterized protein LOC104739...    139   4e-33    
ref|XP_004511326.1|  PREDICTED: uncharacterized protein LOC101500065    138   4e-33    
ref|XP_004150270.1|  PREDICTED: uncharacterized protein LOC101221491    138   4e-33    
gb|KGN52731.1|  hypothetical protein Csa_4G000030                       138   4e-33    
ref|XP_004156872.1|  PREDICTED: uncharacterized LOC101221491            138   4e-33    
ref|XP_009399078.1|  PREDICTED: uncharacterized protein LOC103983571    138   5e-33    
dbj|BAF00981.1|  hypothetical protein                                   138   5e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557619.1|  PREDICTED: uncharacterized protein LOC100825031    138   6e-33    
ref|XP_008372951.1|  PREDICTED: uncharacterized protein LOC103436305    137   8e-33    
ref|XP_009801206.1|  PREDICTED: uncharacterized protein LOC104246980    136   2e-32    
ref|XP_004981601.1|  PREDICTED: uncharacterized protein LOC101765126    136   2e-32    
ref|XP_008454429.1|  PREDICTED: uncharacterized protein LOC103494838    136   2e-32    
gb|KCW56839.1|  hypothetical protein EUGRSUZ_I02507                     136   2e-32    
ref|XP_002274843.1|  PREDICTED: uncharacterized protein LOC100254836    135   3e-32    Vitis vinifera
ref|XP_008776853.1|  PREDICTED: uncharacterized protein LOC103696910    135   3e-32    
gb|EAY92004.1|  hypothetical protein OsI_13693                          135   4e-32    Oryza sativa Indica Group [Indian rice]
emb|CBI25109.3|  unnamed protein product                                135   4e-32    
ref|XP_010030891.1|  PREDICTED: uncharacterized protein LOC104420809    135   4e-32    
ref|XP_003630690.1|  hypothetical protein MTR_8g102270                  130   4e-32    
ref|XP_004230673.1|  PREDICTED: uncharacterized protein LOC101258701    135   4e-32    
ref|XP_004292055.1|  PREDICTED: uncharacterized protein LOC101308741    135   4e-32    
ref|XP_007201076.1|  hypothetical protein PRUPE_ppa006838mg             134   5e-32    
ref|XP_010941977.1|  PREDICTED: uncharacterized protein LOC105060083    135   6e-32    
ref|XP_011088149.1|  PREDICTED: uncharacterized protein LOC105169457    134   7e-32    
gb|ACF82838.1|  unknown                                                 134   7e-32    Zea mays [maize]
gb|EAZ28736.1|  hypothetical protein OsJ_12756                          134   7e-32    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558723.1|  PREDICTED: uncharacterized protein LOC100826176    134   8e-32    
ref|XP_002463817.1|  hypothetical protein SORBIDRAFT_01g006730          134   8e-32    Sorghum bicolor [broomcorn]
gb|AAP68894.1|  unknown protein                                         133   1e-31    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA51652.1|  TPA: hypothetical protein ZEAMMB73_809833              134   1e-31    
ref|XP_004955420.1|  PREDICTED: uncharacterized protein LOC101777215    134   1e-31    
gb|ACG44256.1|  hypothetical protein                                    133   2e-31    Zea mays [maize]
ref|NP_188602.1|  uncharacterized protein                               134   2e-31    Arabidopsis thaliana [mouse-ear cress]
gb|AAL60032.1|  unknown protein                                         134   2e-31    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001051414.1|  Os03g0773000                                       133   2e-31    Oryza sativa Japonica Group [Japonica rice]
gb|KFK39297.1|  hypothetical protein AALP_AA3G226300                    133   3e-31    
ref|XP_008671026.1|  PREDICTED: uncharacterized protein LOC103648311    133   3e-31    
ref|NP_001058837.1|  Os07g0133500                                       133   3e-31    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011030280.1|  PREDICTED: uncharacterized protein LOC105129770    132   3e-31    
ref|NP_001141500.1|  uncharacterized protein LOC100273612               132   4e-31    Zea mays [maize]
ref|XP_009761264.1|  PREDICTED: uncharacterized protein LOC104213456    132   4e-31    
ref|XP_002883199.1|  hypothetical protein ARALYDRAFT_479485             132   5e-31    
gb|EAZ02678.1|  hypothetical protein OsI_24791                          132   5e-31    Oryza sativa Indica Group [Indian rice]
gb|EYU37533.1|  hypothetical protein MIMGU_mgv1a018154mg                132   6e-31    
emb|CDY24620.1|  BnaC05g33040D                                          132   7e-31    
ref|XP_010327488.1|  PREDICTED: uncharacterized protein LOC101263856    129   8e-31    
emb|CDY51694.1|  BnaA05g36810D                                          131   9e-31    
ref|XP_011092476.1|  PREDICTED: uncharacterized protein LOC105172657    131   9e-31    
ref|XP_002313199.1|  hypothetical protein POPTR_0009s08730g             131   9e-31    Populus trichocarpa [western balsam poplar]
emb|CDX95423.1|  BnaC01g33150D                                          131   1e-30    
dbj|BAJ89011.1|  predicted protein                                      131   1e-30    
emb|CDO97321.1|  unnamed protein product                                131   1e-30    
tpg|DAA51653.1|  TPA: hypothetical protein ZEAMMB73_809833              133   1e-30    
ref|XP_009145758.1|  PREDICTED: uncharacterized protein LOC103869426    131   2e-30    
ref|XP_009605701.1|  PREDICTED: uncharacterized protein LOC104100222    130   2e-30    
gb|EPS64751.1|  hypothetical protein M569_10025                         130   2e-30    
ref|XP_009408582.1|  PREDICTED: uncharacterized protein LOC103990981    130   2e-30    
ref|XP_009111603.1|  PREDICTED: uncharacterized protein LOC103837023    130   3e-30    
ref|XP_010487913.1|  PREDICTED: uncharacterized protein LOC104765839    130   3e-30    
ref|XP_006406471.1|  hypothetical protein EUTSA_v10020590mg             130   4e-30    
ref|XP_006297520.1|  hypothetical protein CARUB_v10013544mg             130   4e-30    
ref|XP_010466129.1|  PREDICTED: uncharacterized protein LOC104746366    129   5e-30    
ref|XP_011002550.1|  PREDICTED: uncharacterized protein LOC105109515    129   8e-30    
ref|XP_010095633.1|  hypothetical protein L484_003734                   129   8e-30    
emb|CDY42200.1|  BnaA01g25950D                                          124   1e-29    
ref|XP_009610822.1|  PREDICTED: uncharacterized protein LOC104104441    128   1e-29    
ref|XP_002298796.1|  hypothetical protein POPTR_0001s29590g             128   1e-29    Populus trichocarpa [western balsam poplar]
ref|XP_009381291.1|  PREDICTED: uncharacterized protein LOC103969480    128   1e-29    
gb|KHG13181.1|  hypothetical protein F383_01774                         128   1e-29    
ref|XP_002985234.1|  hypothetical protein SELMODRAFT_234693             128   2e-29    
ref|XP_002970044.1|  hypothetical protein SELMODRAFT_440968             127   2e-29    
gb|KHG07926.1|  hypothetical protein F383_34968                         127   2e-29    
ref|XP_006307458.1|  hypothetical protein CARUB_v10009084mg             127   3e-29    
gb|KDP37617.1|  hypothetical protein JCGZ_06960                         126   5e-29    
ref|XP_002522078.1|  conserved hypothetical protein                     125   1e-28    
ref|XP_010557540.1|  PREDICTED: uncharacterized protein LOC104826503    125   1e-28    
ref|XP_010541837.1|  PREDICTED: uncharacterized protein LOC104815217    125   1e-28    
ref|XP_009108354.1|  PREDICTED: uncharacterized protein LOC103834048    122   1e-27    
ref|XP_002461423.1|  hypothetical protein SORBIDRAFT_02g002380          122   2e-27    
ref|XP_006393185.1|  hypothetical protein EUTSA_v10011462mg             122   2e-27    
emb|CDY40836.1|  BnaC01g31200D                                          121   2e-27    
ref|XP_010691530.1|  PREDICTED: uncharacterized protein LOC104904833    121   4e-27    
gb|AFW87787.1|  hypothetical protein ZEAMMB73_393258                    120   4e-27    
emb|CDY35490.1|  BnaA01g24220D                                          120   5e-27    
ref|XP_002891552.1|  predicted protein                                  120   9e-27    
ref|XP_010478443.1|  PREDICTED: uncharacterized protein LOC104757404    119   1e-26    
ref|NP_175426.1|  uncharacterized protein                               119   1e-26    
emb|CBI27979.3|  unnamed protein product                                117   3e-26    
ref|XP_010500559.1|  PREDICTED: uncharacterized protein LOC104777930    117   6e-26    
ref|NP_001183106.1|  uncharacterized protein LOC100501471               113   1e-25    
ref|XP_010461856.1|  PREDICTED: uncharacterized protein LOC104742540    116   2e-25    
gb|EPS68322.1|  hypothetical protein M569_06448                         115   2e-25    
ref|XP_010420061.1|  PREDICTED: uncharacterized protein DDB_G0271...    115   2e-25    
emb|CDY28137.1|  BnaC06g03180D                                          114   5e-25    
ref|XP_008236238.1|  PREDICTED: uncharacterized protein LOC103335027    114   6e-25    
gb|AFK46956.1|  unknown                                                 109   1e-24    
tpg|DAA59484.1|  TPA: hypothetical protein ZEAMMB73_809167              113   1e-24    
gb|EMT00514.1|  hypothetical protein F775_52390                         109   3e-24    
emb|CAN70307.1|  hypothetical protein VITISV_026399                     110   7e-24    
emb|CBI19337.3|  unnamed protein product                                109   3e-23    
gb|AET05166.2|  DUF1005 family protein                                  108   4e-23    
dbj|BAJ85980.1|  predicted protein                                      105   6e-22    
ref|XP_009792899.1|  PREDICTED: uncharacterized protein LOC104239868    104   8e-22    
gb|AAM62635.1|  unknown                                                 100   2e-21    
gb|EMT05408.1|  hypothetical protein F775_19846                       94.4    3e-19    
ref|XP_006853723.1|  hypothetical protein AMTR_s00056p00161630        95.5    5e-19    
ref|XP_006658256.1|  PREDICTED: uncharacterized protein LOC102703230  95.5    1e-18    
ref|NP_001145181.1|  uncharacterized protein LOC100278423             86.7    5e-17    
emb|CDX82283.1|  BnaA03g35380D                                        85.1    7e-16    
emb|CDY48608.1|  BnaA01g07570D                                        83.6    9e-16    
ref|XP_010327489.1|  PREDICTED: uncharacterized protein LOC101265079  73.2    1e-11    
gb|EAZ13484.1|  hypothetical protein OsJ_03399                        70.9    4e-11    
gb|ACF84078.1|  unknown                                               72.8    7e-11    
ref|XP_006659865.1|  PREDICTED: uncharacterized protein LOC102704909  62.0    3e-07    
emb|CBI40002.3|  unnamed protein product                              53.9    2e-05    
ref|NP_001143250.1|  uncharacterized protein LOC100275778             53.5    3e-05    



>ref|XP_009627129.1| PREDICTED: uncharacterized protein LOC104117749 [Nicotiana tomentosiformis]
Length=428

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 193/235 (82%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+   DPL +FWSSS  SS+LEI++RERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSQDRVSPRDPLSNFWSSSSDSSELEIDKRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV  D CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  249  ITTPFVPSTGCDWVARSNPGAWLIVRSDVCRPESWQPWGKLEAWRERGIRDSICCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             D  E   DLLMSEILISAEKGGEFYIDTD+QVRAA+       PL SPR SGD+  AL+
Sbjct  309  SDEQEC-ADLLMSEILISAEKGGEFYIDTDRQVRAAS------SPLRSPRGSGDF-TALS  360

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQGE G+CSK P VQLA R+VTCVED AIFMALAAAVDLSIEAC
Sbjct  361  PVAGGFVMSCRVQGE-GKCSK-PVVQLAMRHVTCVEDVAIFMALAAAVDLSIEAC  413



>ref|XP_009761711.1| PREDICTED: uncharacterized protein LOC104213860 [Nicotiana sylvestris]
Length=428

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/235 (75%), Positives = 193/235 (82%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+   DPL  FWSSS  SS+L+I++RERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSQDRVSPRDPLSHFWSSSSDSSELDIDKRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV  D CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  249  ITTPFVPSTGCDWVARSNPGAWLIVRSDVCRPESWQPWGKLEAWRERGIRDSICCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E+  DLLMSEILISAEKGGEFYIDTD+QVRAA+       PL SPR SGD+  AL+
Sbjct  309  SEEQEY-ADLLMSEILISAEKGGEFYIDTDRQVRAAS------SPLHSPRGSGDF-TALS  360

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQGE G+CSK P VQLA R+VTCVED AIFMALAAAVDLSIEAC
Sbjct  361  PVAGGFVMSCRVQGE-GKCSK-PLVQLAMRHVTCVEDVAIFMALAAAVDLSIEAC  413



>ref|XP_004229535.1| PREDICTED: uncharacterized protein LOC101261157 [Solanum lycopersicum]
 ref|XP_010323393.1| PREDICTED: uncharacterized protein LOC101261157 [Solanum lycopersicum]
 ref|XP_010323395.1| PREDICTED: uncharacterized protein LOC101261157 [Solanum lycopersicum]
Length=430

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 181/235 (77%), Positives = 198/235 (84%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+  VDPL +FWS+SV  S+L+IE+RERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSQDRVSPVDPLNNFWSNSVDGSELDIEKRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIVHPD CRP  WQPWGKLEAWRERGIRD+ICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWLIVHPDVCRPGCWQPWGKLEAWRERGIRDTICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E+  DLLMSEILISAEKGGEFYIDTDKQVRAA        PLPSPRSSGD+ AAL+
Sbjct  310  SEGQENGGDLLMSEILISAEKGGEFYIDTDKQVRAAT------SPLPSPRSSGDF-AALS  362

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQGE G+CSK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  363  PVAGGFVMSCRVQGE-GKCSK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  415



>ref|XP_009786623.1| PREDICTED: uncharacterized protein LOC104234713 [Nicotiana sylvestris]
 ref|XP_009786625.1| PREDICTED: uncharacterized protein LOC104234713 [Nicotiana sylvestris]
 ref|XP_009786626.1| PREDICTED: uncharacterized protein LOC104234713 [Nicotiana sylvestris]
Length=432

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 198/235 (84%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F C+    F   R+  VDPL +FWSSS   S+LE+E+RERKGWKV IHDLSGSAVAAAF
Sbjct  196  IFSCE----FSQDRVSPVDPLNNFWSSSFDGSELEVEKRERKGWKVKIHDLSGSAVAAAF  251

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIV PD CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  252  ITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWQPWGKLEAWRERGIRDSICCRFHLL  311

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DLLMSEILISAEKGGEFYIDTD+QV+AAA       PLPSPRSSGD+ AAL+
Sbjct  312  SEGQECGGDLLMSEILISAEKGGEFYIDTDRQVQAAA------SPLPSPRSSGDF-AALS  364

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQGE G+CSK P VQLA R++TCVEDAAIFMALAAAVDLSIEAC
Sbjct  365  PVAGGFVMSCRVQGE-GKCSK-PLVQLAMRHITCVEDAAIFMALAAAVDLSIEAC  417



>ref|XP_006359111.1| PREDICTED: uncharacterized protein LOC102583788 isoform X1 [Solanum 
tuberosum]
 ref|XP_006359112.1| PREDICTED: uncharacterized protein LOC102583788 isoform X2 [Solanum 
tuberosum]
Length=430

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 198/235 (84%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+  VDPL +FWS+SV  S+L++E+RERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSQDRVSPVDPLNNFWSNSVDGSELDVEKRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIVHPD CRP  WQPWGKLEAWRERGIRD+ICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWLIVHPDVCRPGCWQPWGKLEAWRERGIRDTICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E+  DLLMSEILISAEKGGEFYIDTD+QVRAA        PLPSPRSSGD+ AAL+
Sbjct  310  SEGQENGGDLLMSEILISAEKGGEFYIDTDRQVRAAT------SPLPSPRSSGDF-AALS  362

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQG+ G+CSK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  363  PVAGGFVMSCRVQGD-GKCSK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  415



>emb|CDP16208.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 205/251 (82%), Gaps = 17/251 (7%)
 Frame = -1

Query  1034  RATFQSLRIKVTY---LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGW  864
             R++ Q ++++ T+   +F CK    F   R+ Q+DPL +FWS SV SSD ++ERRERKGW
Sbjct  207   RSSPQIVQLQGTFKQRIFSCK----FNQDRVTQLDPLSNFWSHSVDSSDQDVERRERKGW  262

Query  863   KVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAW  684
             KV IHDLSGSAVAAAFITTPFVPS+GC WVA+SNPG WLIV PD CRPESWQPWGKLEAW
Sbjct  263   KVKIHDLSGSAVAAAFITTPFVPSSGCDWVAKSNPGAWLIVRPDACRPESWQPWGKLEAW  322

Query  683   RERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptpp  504
             RERGIRDSICCRFH+L +  E   ++LMSEILI+AEKGGEF+IDTD+QV+AAA       
Sbjct  323   RERGIRDSICCRFHLLSEGQEG-GEILMSEILINAEKGGEFFIDTDRQVKAAA------T  375

Query  503   plpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMAL  324
             P+PSP+SSGD+ AAL+PV GGFVMS RVQGEG RC   P VQLA RYVTCVEDAAIFMAL
Sbjct  376   PVPSPQSSGDF-AALSPVHGGFVMSSRVQGEGKRCK--PLVQLAMRYVTCVEDAAIFMAL  432

Query  323   AAAVDLSIEAC  291
             AAAVDLSIEAC
Sbjct  433   AAAVDLSIEAC  443



>ref|XP_010324887.1| PREDICTED: uncharacterized protein LOC101268299 [Solanum lycopersicum]
Length=419

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 184/235 (78%), Gaps = 18/235 (8%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+   DPL +FWSSS   S+L++ +RERKGW V IHDLSGSAVAAAF
Sbjct  188  IFSCK----FSQDRVSPRDPLSNFWSSSFDGSELDVGKRERKGWNVKIHDLSGSAVAAAF  243

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WV+RSNPG WLIV  D CRPESW PWGKLEAWRERGIRDSICCRFH+L
Sbjct  244  ITTPFVPSTGCDWVSRSNPGAWLIVRSDVCRPESWHPWGKLEAWRERGIRDSICCRFHLL  303

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DLLMSEILISAEKGGEFYIDTDKQVRAA+          SP  SGD+ AAL+
Sbjct  304  TEGQE-LGDLLMSEILISAEKGGEFYIDTDKQVRAAS----------SPGGSGDF-AALS  351

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              +GGFVMSCRVQGE G+CSK P VQLA R+VTCVED  IFMALAAAVDLSIEAC
Sbjct  352  LAAGGFVMSCRVQGE-GKCSK-PLVQLAMRHVTCVEDVGIFMALAAAVDLSIEAC  404



>ref|XP_006346697.1| PREDICTED: uncharacterized protein LOC102596535 [Solanum tuberosum]
Length=429

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 187/235 (80%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+   DPL +FWSSS   S+L+I +RERKGW V IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSQDRVSPRDPLSNFWSSSFDGSELDIGKRERKGWNVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV  D CRPESW PWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVRSDVCRPESWHPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             + HE   DLLMSEILISAEKGGEFYIDTDKQVRAA+       P+ SPR SGD+ AA++
Sbjct  310  TEGHE-LGDLLMSEILISAEKGGEFYIDTDKQVRAAS------TPMHSPRGSGDF-AAVS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              + GFVMSCRVQGE G+CSK P VQLA R+VTCVED  IFMALAAAVDLSIEAC
Sbjct  362  LAAEGFVMSCRVQGE-GKCSK-PLVQLAMRHVTCVEDVGIFMALAAAVDLSIEAC  414



>emb|CAJ19269.1| putative stress-induced protein [Solanum commersonii]
Length=433

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 198/236 (84%), Gaps = 14/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+  VDPL +FWS+SV  S+L++E+RER+GWKV IHDLSGSAVAAAF
Sbjct  196  IFSCK----FSHDRVSPVDPLNNFWSNSVDGSELDVEKRERRGWKVKIHDLSGSAVAAAF  251

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIVHPD CRP  WQPWGKLEAWRERGIRD+ICCRFH+L
Sbjct  252  ITTPFVPSTGCDWVAKSNPGAWLIVHPDVCRPGCWQPWGKLEAWRERGIRDTICCRFHLL  311

Query  635  CDSHEHRDDLLMSEILIS-AEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAAL  459
             +  E+  DLLMSEILIS AEKGGEFYIDTD+QVRAA        PLPSPRSSGD+ AAL
Sbjct  312  SEGQENGGDLLMSEILISAAEKGGEFYIDTDRQVRAAT------SPLPSPRSSGDF-AAL  364

Query  458  NPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +PV+GGFVMSCRVQGE G+CSK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  365  SPVAGGFVMSCRVQGE-GKCSK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  418



>ref|XP_009619401.1| PREDICTED: uncharacterized protein LOC104111412 [Nicotiana tomentosiformis]
Length=431

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 196/235 (83%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F C+    F   R+  VDPL +FWSSS   S+LE+E+RERKGWKV IHDLSGSAVAAAF
Sbjct  195  IFSCE----FSQDRVSPVDPLNNFWSSSFDGSELEVEKRERKGWKVKIHDLSGSAVAAAF  250

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIV PD CRPESWQPWGKLEAWRERGIRDSI CRFH+L
Sbjct  251  ITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWQPWGKLEAWRERGIRDSIYCRFHLL  310

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DLLMSEILISAEKGGEFYIDTD+QV+AA        PLPSPRSSGD+ AAL+
Sbjct  311  SEGQECGGDLLMSEILISAEKGGEFYIDTDRQVQAAV------SPLPSPRSSGDF-AALS  363

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQGE G+CSK P VQLA R++TCVEDAAIFMALAAAVDLSIEAC
Sbjct  364  PVAGGFVMSCRVQGE-GKCSK-PLVQLAMRHITCVEDAAIFMALAAAVDLSIEAC  416



>ref|XP_003529004.1| PREDICTED: uncharacterized protein LOC100788522 isoform X1 [Glycine 
max]
 ref|XP_006583497.1| PREDICTED: uncharacterized protein LOC100788522 isoform X2 [Glycine 
max]
 ref|XP_006583498.1| PREDICTED: uncharacterized protein LOC100788522 isoform X3 [Glycine 
max]
 gb|KHN34008.1| hypothetical protein glysoja_033455 [Glycine soja]
Length=431

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 185/235 (79%), Gaps = 12/235 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  K     R+ Q+DPL ++WS S   SDLE ERRERKGWKVTIHDLSGSAVAAAF
Sbjct  194  IFSCKFSK----DRVSQIDPLSAYWSGSNDISDLETERRERKGWKVTIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPS+GC WVARSNPG+WLIV PD  R ESWQPWGKLEAWRERGIRD++CCRFH+L
Sbjct  250  ITTPFVPSSGCDWVARSNPGSWLIVRPDLGRSESWQPWGKLEAWRERGIRDTVCCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
              S     + LMSEI ISAEKGGEF+IDT+K ++  A       P+PSP+SSGD+  AL+
Sbjct  310  --SEAQGGEFLMSEIHISAEKGGEFFIDTEKHMQTVA---TAASPIPSPQSSGDF-GALS  363

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P+ GGFVMSCRVQGEG R    P VQLA R+VTCVEDAAIFMALAA+VDLSI AC
Sbjct  364  PLVGGFVMSCRVQGEGKRSK--PLVQLAMRHVTCVEDAAIFMALAASVDLSIVAC  416



>emb|CAN65847.1| hypothetical protein VITISV_014976 [Vitis vinifera]
Length=430

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 190/235 (81%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS S  SS+ E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQVDPLSTYWSGSADSSEQETERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV PD CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVRPDACRPESWQPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  +   +LLMSEI I+AEKGGEF+IDTD+QVRAAA       P+PSP+SSGD+ AAL 
Sbjct  310  SEGQDG-GELLMSEIFINAEKGGEFFIDTDRQVRAAA-----TTPIPSPQSSGDF-AALA  362

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  GGFVMSCRVQGEG   S  P VQLA R++TCVEDAAIFMALAAAVDLSIEAC
Sbjct  363  PAVGGFVMSCRVQGEGK--SSKPLVQLAIRHITCVEDAAIFMALAAAVDLSIEAC  415



>ref|XP_002268337.1| PREDICTED: uncharacterized protein LOC100245378 [Vitis vinifera]
Length=430

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 190/235 (81%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS S  SS+ E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQVDPLSTYWSGSADSSEQETERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV PD CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVRPDACRPESWQPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  +   +LLMSEI I+AEKGGEF+IDTD+QVRAAA       P+PSP+SSGD+ AAL 
Sbjct  310  SEGQDG-GELLMSEIFINAEKGGEFFIDTDRQVRAAA-----TTPIPSPQSSGDF-AALA  362

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  GGFVMSCRVQGEG   S  P VQLA R++TCVEDAAIFMALAAAVDLSIEAC
Sbjct  363  PAVGGFVMSCRVQGEGK--SSKPLVQLAIRHITCVEDAAIFMALAAAVDLSIEAC  415



>ref|XP_011086622.1| PREDICTED: uncharacterized protein LOC105168293 [Sesamum indicum]
Length=429

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 192/235 (82%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL SFWSSS   S  +IERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQVDPLSSFWSSSGDGSYQDIERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPS+GC WVA+SNPG WLIV PD CRPESWQPWGKLE WRERGIRDSIC RFHV 
Sbjct  250  ITTPFVPSSGCDWVAKSNPGAWLIVRPDACRPESWQPWGKLEVWRERGIRDSICFRFHVF  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             D  E   + LMSE+LI+AEKGGEF+IDTD+Q+R AA       P+PSP+SSGD+ AAL+
Sbjct  310  SDGQEG-GEFLMSELLINAEKGGEFFIDTDRQIRGAA------TPVPSPQSSGDF-AALS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV+GGFVMSCRVQGE G+CSK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  362  PVTGGFVMSCRVQGE-GKCSK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  414



>ref|XP_007029857.1| Nuclear factor 1 A-type isoform 2 [Theobroma cacao]
 gb|EOY10359.1| Nuclear factor 1 A-type isoform 2 [Theobroma cacao]
Length=429

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 192/235 (82%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS S  S D+E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVAQVDPLSTYWSGSADSLDIETERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV PD CRPESW PWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ +   ++LMSEILISAEKGGEF+IDTD+Q+R A        P+PSP+SSGD+ +AL+
Sbjct  310  SEAQDG-AEVLMSEILISAEKGGEFFIDTDRQMRRAP------TPIPSPQSSGDF-SALS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P++GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  362  PIAGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  414



>ref|XP_007029856.1| Nuclear factor 1 A-type isoform 1 [Theobroma cacao]
 gb|EOY10358.1| Nuclear factor 1 A-type isoform 1 [Theobroma cacao]
Length=491

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 192/235 (82%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS S  S D+E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVAQVDPLSTYWSGSADSLDIETERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV PD CRPESW PWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ +   ++LMSEILISAEKGGEF+IDTD+Q+R A        P+PSP+SSGD+ +AL+
Sbjct  310  SEAQDGA-EVLMSEILISAEKGGEFFIDTDRQMRRAP------TPIPSPQSSGDF-SALS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P++GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  362  PIAGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  414



>ref|XP_008345095.1| PREDICTED: uncharacterized protein LOC103407996 [Malus domestica]
Length=457

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 189/235 (80%), Gaps = 8/235 (3%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+PQVDPL ++WS +  + DLE ERRERKGWKVTIHDLSGSAVAAAF
Sbjct  216  IFSCK----FIRDRVPQVDPLNTYWSGAANNPDLETERRERKGWKVTIHDLSGSAVAAAF  271

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVP+TGC WVARSNPG WLIV PD CRP+SWQPWGKLEAWRERGIRD +CCRF +L
Sbjct  272  ITTPFVPATGCDWVARSNPGAWLIVSPDPCRPDSWQPWGKLEAWRERGIRDXVCCRFRLL  331

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DL MSEI I+AEKGGEF+IDTD+Q+RA A    +  P+PSP+SSGD+ A L 
Sbjct  332  SECQEAV-DLFMSEIRINAEKGGEFFIDTDRQMRAVAAAAASASPIPSPQSSGDF-AGLY  389

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  GGFVMSCRVQGE G+ SK P VQ A R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  390  PFVGGFVMSCRVQGE-GKASK-PLVQJAMRHVTCVEDAAIFMALAAAVDLSIEAC  442



>ref|XP_006437344.1| hypothetical protein CICLE_v10031611mg [Citrus clementina]
 ref|XP_006484748.1| PREDICTED: uncharacterized protein LOC102622177 isoform X1 [Citrus 
sinensis]
 ref|XP_006484749.1| PREDICTED: uncharacterized protein LOC102622177 isoform X2 [Citrus 
sinensis]
 gb|ESR50584.1| hypothetical protein CICLE_v10031611mg [Citrus clementina]
 gb|KDO49406.1| hypothetical protein CISIN_1g014188mg [Citrus sinensis]
Length=429

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 186/235 (79%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R PQVD L S+WS SV  + LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRGPQVDLLSSYWSGSVDCNALETERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG WLIV PD CR ESWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVRPDACRAESWQPWGKLEAWRERGIRDSVCCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   ++LMSEILISAEKGGEF+IDTDKQ+R A        P+PSP+SSGD+ + L 
Sbjct  310  SEGQE-AGEVLMSEILISAEKGGEFFIDTDKQLRTAT------SPIPSPQSSGDF-SGLG  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV GGFVM CRVQGEG R    P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  362  PVIGGFVMCCRVQGEGKRSK--PMVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  414



>gb|KHG10101.1| Mitochondrial inner membrane protease subunit 1 [Gossypium arboreum]
Length=432

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 192/235 (82%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F C+    F   R+ +VDPL ++W+ S  SSD+E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  197  IFSCE----FSRDRVAKVDPLGTYWTGSADSSDIETERRERKGWKVKIHDLSGSAVAAAF  252

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIV PD CRPESW PWGKLEAWRERGIRDSICCRFH+L
Sbjct  253  ITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHLL  312

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ +   ++LMSEILISAEKGGEF+IDTD+Q+R          P+PSP+SSGD+ +AL+
Sbjct  313  SEAQDG-AEVLMSEILISAEKGGEFFIDTDRQMRQGP------TPIPSPQSSGDF-SALS  364

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P++GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  365  PIAGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  417



>gb|ACV88395.1| putative stress-induced protein [Cucumis sativus]
Length=230

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 168/233 (72%), Positives = 188/233 (81%), Gaps = 14/233 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ Q D L ++WS     SDLE+ERRERKGWKV IHDLSGSAVAAAF
Sbjct  12   IFSCK----FSRDRVSQADSLSNYWSGLGDGSDLEVERRERKGWKVKIHDLSGSAVAAAF  67

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG+WLIV PD C PESWQPWGKLEAWRERGIRD++CCRFH+L
Sbjct  68   ITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQPWGKLEAWRERGIRDTVCCRFHLL  127

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ E   +LLMSEI I+AEKGGEF+IDTDKQ+RAA        P+PSP+SSGD+ AAL 
Sbjct  128  SEAQEG-GELLMSEIHINAEKGGEFFIDTDKQLRAAT------SPIPSPQSSGDF-AALG  179

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIE  297
             V GGFVMSCRVQGE GR SKP  VQLA R+VTC+EDAAIFMALAAAVDLSIE
Sbjct  180  QVVGGFVMSCRVQGE-GRSSKPT-VQLAMRHVTCIEDAAIFMALAAAVDLSIE  230



>gb|KDP39605.1| hypothetical protein JCGZ_02625 [Jatropha curcas]
Length=428

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 189/235 (80%), Gaps = 15/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS++V   DLE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQVDPLSNYWSTAVEGMDLETERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIV PD CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWLIVRPDVCRPESWQPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +S E   ++LMSEI +SAEKGGEF+IDTD+Q+R AA       P+PSP+SSGD+ + L 
Sbjct  310  SESQEG-GEVLMSEIFMSAEKGGEFFIDTDRQMRTAA------TPIPSPQSSGDF-SGLG  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P +GGFVMSCRVQGEG      P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  362  P-TGGFVMSCRVQGEGKHSK--PLVQLAMRHVTCVEDAAIFMALAAAVDLSIVAC  413



>ref|XP_004307193.1| PREDICTED: uncharacterized protein LOC101307926 [Fragaria vesca 
subsp. vesca]
Length=433

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 192/236 (81%), Gaps = 12/236 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F C+    F   R+PQVDPL ++WS SV  S+LE ERRERKGWKVTIHDLSGSAVAAAF
Sbjct  194  IFSCR----FSRDRVPQVDPLSNYWSGSVDDSNLETERRERKGWKVTIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERG-IRDSICCRFHV  639
            ITTPFVPSTGC WVARSNPG WLIV PD CRPESWQPW KLEAWRERG IRDS+CCRF +
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWLIVSPDPCRPESWQPWAKLEAWRERGSIRDSVCCRFRL  309

Query  638  LCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAAL  459
            L +  E   +LLMSEI I+AEKGGEF+IDTD+Q++AAA      PPLPSP+SSGDY AAL
Sbjct  310  LSECQEA-AELLMSEIHINAEKGGEFFIDTDRQMQAAAA---AAPPLPSPQSSGDY-AAL  364

Query  458  NPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             PV GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAA DLSIEAC
Sbjct  365  GPVEGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAADLSIEAC  418



>ref|XP_008232195.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
 ref|XP_008232196.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
 ref|XP_008232197.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
 ref|XP_008232198.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
Length=434

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 188/235 (80%), Gaps = 9/235 (4%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+P  DPL ++WS S  + DLE ERRERKGWKVTIHDLSGSAVAAAF
Sbjct  194  IFSCK----FIRDRVPHADPLSTYWSGSANNPDLESERRERKGWKVTIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG W+IV PD CRP+SWQPWGKLEAWRERGIRDS+CCRF +L
Sbjct  250  ITTPFVPSTGCDWVARSNPGAWMIVSPDPCRPDSWQPWGKLEAWRERGIRDSVCCRFRLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   +LL SEI I+AEKGGEF+IDTDKQ+RAAA       P+PSP+SSGD+ A L 
Sbjct  310  SECQEAV-ELLQSEIRINAEKGGEFFIDTDKQMRAAAE-AAAASPIPSPQSSGDF-AGLG  366

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  367  PVVGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  419



>ref|XP_007218028.1| hypothetical protein PRUPE_ppa005972mg [Prunus persica]
 gb|EMJ19227.1| hypothetical protein PRUPE_ppa005972mg [Prunus persica]
Length=434

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 189/235 (80%), Gaps = 9/235 (4%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+P  DPL ++WS S  ++DLE ERRERKGWKVTIHDLSGSAVAAAF
Sbjct  194  IFSCK----FIRDRVPHADPLSTYWSGSANNTDLESERRERKGWKVTIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG W+IV PD CRP+SWQPWGKLEAWRERGIRDS+CCRF +L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWMIVSPDPCRPDSWQPWGKLEAWRERGIRDSVCCRFRLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   +LL SEI I+AEKGGEF+IDTDKQ+RAAA       P+PSP+SSGD+ A L 
Sbjct  310  SECQEAV-ELLQSEIRINAEKGGEFFIDTDKQMRAAAE-AAAASPIPSPQSSGDF-AGLG  366

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  367  PVVGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  419



>ref|XP_002523978.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38346.1| conserved hypothetical protein [Ricinus communis]
Length=427

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 189/235 (80%), Gaps = 15/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+PQVDPL  +WS+S    D+E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVPQVDPLSIYWSTSADGIDMETERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLIV PD CRPESWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLIVRPDMCRPESWQPWGKLEAWRERGIRDSICCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +S E   ++LMSEI ++AEKGGEF+IDTD+Q++AAA       P+PSP+SSGD+ + L 
Sbjct  309  SESQEG-GEVLMSEIFMNAEKGGEFFIDTDRQMQAAA------TPIPSPQSSGDF-SGLG  360

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P +GGFVMSCRVQGEG      P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  361  P-AGGFVMSCRVQGEGKHSK--PLVQLAMRHVTCVEDAAIFMALAAAVDLSIVAC  412



>ref|XP_008460086.1| PREDICTED: uncharacterized protein LOC103499002 [Cucumis melo]
 ref|XP_008460087.1| PREDICTED: uncharacterized protein LOC103499002 [Cucumis melo]
Length=428

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 190/235 (81%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ Q D L ++WS     SDLE+ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQADSLSNYWSGLGDGSDLEVERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG+WLIV PD C PESWQPWGKLEAWRERGIRD++CCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQPWGKLEAWRERGIRDTVCCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ E   +LLMSEI I+AEKGGEF+IDTDKQ+RAA        P+PSP+SSGD+ AAL 
Sbjct  310  SEAQEG-GELLMSEIHINAEKGGEFFIDTDKQLRAAT------SPIPSPQSSGDF-AALG  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             V GGFVMSCRVQGE GR SK P VQLA R+VTC+EDAAIFMALAAAVDLSIEAC
Sbjct  362  QVVGGFVMSCRVQGE-GRSSK-PTVQLAMRHVTCIEDAAIFMALAAAVDLSIEAC  414



>ref|XP_010097676.1| hypothetical protein L484_023816 [Morus notabilis]
 gb|EXB70631.1| hypothetical protein L484_023816 [Morus notabilis]
Length=431

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 188/235 (80%), Gaps = 13/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+PQVDPL ++WS S  ++DLE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  195  IFSCK----FSRDRVPQVDPLCNYWSGSTDNADLEAERRERKGWKVKIHDLSGSAVAAAF  250

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            +TTPFVPSTGC WVA+SNPG WLIV PD CR ESWQPWGKLEAWRERGIRDS+CCRF ++
Sbjct  251  MTTPFVPSTGCDWVAKSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIRDSVCCRFRLM  310

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   +LLMSEI I+ EKGGEF+IDTD+Q+ AAA       P+PSP+SSGD+ AAL 
Sbjct  311  SEGQE-VGELLMSEIYINTEKGGEFFIDTDRQMPAAA-----ASPIPSPQSSGDF-AALG  363

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             V GGFVMSCRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  364  TVVGGFVMSCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  416



>ref|XP_004145014.1| PREDICTED: uncharacterized protein LOC101209874 [Cucumis sativus]
 ref|XP_004153015.1| PREDICTED: uncharacterized protein LOC101204096 [Cucumis sativus]
 ref|XP_004160679.1| PREDICTED: uncharacterized protein LOC101224857 [Cucumis sativus]
 gb|KGN46265.1| hypothetical protein Csa_6G078600 [Cucumis sativus]
Length=428

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 190/235 (81%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ Q D L ++WS     SDLE+ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQADSLSNYWSGLGDGSDLEVERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVARSNPG+WLIV PD C PESWQPWGKLEAWRERGIRD++CCRFH+L
Sbjct  250  ITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQPWGKLEAWRERGIRDTVCCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ E   +LLMSEI I+AEKGGEF+IDTDKQ+RAA        P+PSP+SSGD+ AAL 
Sbjct  310  SEAQEG-GELLMSEIHINAEKGGEFFIDTDKQLRAAT------SPIPSPQSSGDF-AALG  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             V GGFVMSCRVQGE GR SK P VQLA R+VTC+EDAAIFMALAAAVDLSIEAC
Sbjct  362  QVVGGFVMSCRVQGE-GRSSK-PTVQLAMRHVTCIEDAAIFMALAAAVDLSIEAC  414



>ref|XP_002319218.1| hypothetical protein POPTR_0013s06840g [Populus trichocarpa]
 gb|EEE95141.1| hypothetical protein POPTR_0013s06840g [Populus trichocarpa]
Length=428

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 188/235 (80%), Gaps = 15/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS+S   +D+E ER+ERKGWKV IHDLSGSAVAA F
Sbjct  194  IFSCK----FSRDRVTQVDPLSTYWSTSDDGADVETERKERKGWKVKIHDLSGSAVAATF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVP+TGC WVARSNPG WLIV PD CRP+SWQPWGKLEAWRERGIRDSICCRFH+L
Sbjct  250  ITTPFVPATGCDWVARSNPGAWLIVRPDACRPDSWQPWGKLEAWRERGIRDSICCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   ++LMSEILISAEKGGEF+IDTD+Q+R AA       P+PSP+SSGD+ + L+
Sbjct  310  SEGQEG-GEVLMSEILISAEKGGEFFIDTDRQLRTAA------APIPSPQSSGDF-SGLS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P+  GF+MSCRVQGEG      P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  362  PIV-GFIMSCRVQGEGKH--NKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIVAC  413



>ref|XP_006400305.1| hypothetical protein EUTSA_v10013602mg [Eutrema salsugineum]
 gb|ESQ41758.1| hypothetical protein EUTSA_v10013602mg [Eutrema salsugineum]
Length=432

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 183/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD CRP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGDY+    
Sbjct  309  SNGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDYSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_003521028.1| PREDICTED: uncharacterized protein LOC100815012 isoform X1 [Glycine 
max]
 ref|XP_006576673.1| PREDICTED: uncharacterized protein LOC100815012 isoform X2 [Glycine 
max]
 gb|KHM98980.1| hypothetical protein glysoja_044010 [Glycine soja]
Length=432

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 186/235 (79%), Gaps = 11/235 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  K     R+ Q+D L ++WS S   SDLE ERRERKGWKVTIHDLSGSAVAAAF
Sbjct  194  IFSCKFSK----DRVSQIDSLSAYWSGSNDISDLETERRERKGWKVTIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPS+GC WVARSNPG+WLIV PD  R ESWQPWGKLEAWRERGIRD++CCRFH+L
Sbjct  250  ITTPFVPSSGCDWVARSNPGSWLIVRPDIGRSESWQPWGKLEAWRERGIRDTVCCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ E   + LMSEI ISAEKGGEF+IDT+K +R  A       P+PSP+SSGD+  AL+
Sbjct  310  SEAQEG-GEFLMSEIHISAEKGGEFFIDTEKHMRTVA---TAASPIPSPQSSGDF-GALS  364

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P+ GGFVMSCRVQGEG R    P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  365  PLVGGFVMSCRVQGEGKRSK--PSVQLAMRHVTCVEDAAIFMALAAAVDLSIVAC  417



>ref|XP_009361368.1| PREDICTED: uncharacterized protein LOC103951663 [Pyrus x bretschneideri]
Length=461

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 188/235 (80%), Gaps = 9/235 (4%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+PQVDPL ++WS +  + DL+ ERRERKGWKVTIHDLSGSA+AAAF
Sbjct  222  IFSCK----FIRDRVPQVDPLSTYWSGAANNPDLDTERRERKGWKVTIHDLSGSAIAAAF  277

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVP+TGC WVARSNPG WLIV PD  RP+SWQPWGKLEAWRERGIRDS+ CRF +L
Sbjct  278  ITTPFVPATGCDWVARSNPGAWLIVSPDAYRPDSWQPWGKLEAWRERGIRDSVFCRFRLL  337

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DL MSEI I+AEKGG+F IDTDKQ++AAA       P+PSP++SGD+ A L 
Sbjct  338  SECQEAV-DLFMSEIRINAEKGGDFSIDTDKQMQAAAA-TAAASPIPSPQTSGDF-AGLY  394

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  GGFVMSCRVQGE G+ SK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  395  PDVGGFVMSCRVQGE-GKASK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  447



>gb|KEH18002.1| stress-induced protein, putative [Medicago truncatula]
Length=433

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 186/236 (79%), Gaps = 12/236 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ Q+D L ++WS S   SDLE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSKDRVSQIDSLSTYWSGSPDISDLESERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGC-RPESWQPWGKLEAWRERGIRDSICCRFHV  639
            ITTPFVPS+GC WVARSNPG WLIV PD   R ESWQPWGKLEAWRERGI+DSICC+FH+
Sbjct  250  ITTPFVPSSGCDWVARSNPGAWLIVRPDVVGRSESWQPWGKLEAWRERGIKDSICCKFHL  309

Query  638  LCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAAL  459
            L +  +   +LLMSEI I+AEKGGEF+IDT+K +R  A       P+PSP+SSGD+  AL
Sbjct  310  LSEPQDG-GNLLMSEIHINAEKGGEFFIDTEKHMRTVA---SAASPIPSPQSSGDF-GAL  364

Query  458  NPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +PV+GGFVMSCRVQGEG R    P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  365  SPVAGGFVMSCRVQGEGKRGK--PLVQLALRHVTCVEDAAIFMALAAAVDLSIEAC  418



>ref|XP_007134346.1| hypothetical protein PHAVU_010G039800g [Phaseolus vulgaris]
 gb|ESW06340.1| hypothetical protein PHAVU_010G039800g [Phaseolus vulgaris]
Length=433

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 187/236 (79%), Gaps = 12/236 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGS-SDLEIERRERKGWKVTIHDLSGSAVAAA  819
            +F CK    F   R+ Q+DPL ++WS S    S+LE ERRERKGWKVTIHDLSGSAVAAA
Sbjct  194  IFSCK----FSKDRVSQIDPLSAYWSGSTTEISNLETERRERKGWKVTIHDLSGSAVAAA  249

Query  818  FITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHV  639
            FITTPFVPS+GC WVARSNPG+WLIV PD  R ESW PWGKLEAWRERGIRD++CC+FH+
Sbjct  250  FITTPFVPSSGCDWVARSNPGSWLIVRPDTGRSESWHPWGKLEAWRERGIRDTVCCKFHL  309

Query  638  LCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAAL  459
            L ++ E   +LLMSEI I+AEKGGEF+IDT+K +R A        P+PSP+SSGD+  AL
Sbjct  310  LSEAQEG-GELLMSEIHINAEKGGEFFIDTEKHLRTAT---TAASPIPSPQSSGDF-GAL  364

Query  458  NPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +P+ GGFVMSCR+QGEG +    P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  365  SPLVGGFVMSCRIQGEGKQSK--PLVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  418



>gb|KFK25983.1| hypothetical protein AALP_AA8G187900 [Arabis alpina]
Length=432

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 184/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSS    ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSVGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD CRP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  309  ANGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPVPSPQSSGDFSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGE G+ SK P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGE-GKLSK-PVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_004510160.1| PREDICTED: uncharacterized protein LOC101490219 isoform X1 [Cicer 
arietinum]
 ref|XP_004510161.1| PREDICTED: uncharacterized protein LOC101490219 isoform X2 [Cicer 
arietinum]
 ref|XP_004510162.1| PREDICTED: uncharacterized protein LOC101490219 isoform X3 [Cicer 
arietinum]
 ref|XP_004510163.1| PREDICTED: uncharacterized protein LOC101490219 isoform X4 [Cicer 
arietinum]
 ref|XP_004510164.1| PREDICTED: uncharacterized protein LOC101490219 isoform X5 [Cicer 
arietinum]
 ref|XP_004510165.1| PREDICTED: uncharacterized protein LOC101490219 isoform X6 [Cicer 
arietinum]
Length=429

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 186/235 (79%), Gaps = 11/235 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  K     R+ Q+D L ++W  S+  SDLE ++RERKGWKV IHDLSGSAVAAAF
Sbjct  191  IFSCKFSK----DRVSQIDALSNYWPDSIDISDLECKKRERKGWKVKIHDLSGSAVAAAF  246

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPS+G  WVARSNPG WLIV PD  R ESWQPWGKLEAWRERGI+DS+CCRFH+L
Sbjct  247  ITTPFVPSSGYDWVARSNPGAWLIVRPDVGRSESWQPWGKLEAWRERGIKDSVCCRFHLL  306

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++H+   +LLMSEI I+AEKGGEF+IDT+K +R A        P+PSP+SSGD+  AL+
Sbjct  307  PEAHDG-GNLLMSEIHINAEKGGEFFIDTEKHMRTAT---SAASPIPSPQSSGDF-GALS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P+ GGFVMSCRVQGEG R    P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  362  PIVGGFVMSCRVQGEGKRSK--PLVQLALRHVTCVEDAAIFMALAAAVDLSIEAC  414



>ref|XP_009345575.1| PREDICTED: uncharacterized protein LOC103937356 [Pyrus x bretschneideri]
 ref|XP_009345576.1| PREDICTED: uncharacterized protein LOC103937356 [Pyrus x bretschneideri]
 ref|XP_009345577.1| PREDICTED: uncharacterized protein LOC103937356 [Pyrus x bretschneideri]
Length=434

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 188/235 (80%), Gaps = 9/235 (4%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+PQVDPL ++WS +  + DL+ ERRERKGWKVTIHDLSGSA+AAAF
Sbjct  195  IFSCK----FIRDRVPQVDPLSTYWSGAANNPDLDTERRERKGWKVTIHDLSGSAIAAAF  250

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVP+TGC WVARSNPG WLIV PD  RP+SWQPWGKLEAWRERGIRDS+ CRF +L
Sbjct  251  ITTPFVPATGCDWVARSNPGAWLIVSPDAYRPDSWQPWGKLEAWRERGIRDSVFCRFRLL  310

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DL MSEI I+AE+GG+F IDTDKQ++AAA       P+PSP++SGD+ A L 
Sbjct  311  SECQEAV-DLFMSEIRINAERGGDFSIDTDKQMQAAAA-TAAASPIPSPQTSGDF-AGLY  367

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  GGFVMSCRVQGE G+ SK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  368  PDVGGFVMSCRVQGE-GKASK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  420



>ref|XP_009107533.1| PREDICTED: uncharacterized protein LOC103833189 [Brassica rapa]
 ref|XP_009107534.1| PREDICTED: uncharacterized protein LOC103833189 [Brassica rapa]
 ref|XP_009107535.1| PREDICTED: uncharacterized protein LOC103833189 [Brassica rapa]
 emb|CDY38449.1| BnaA10g17090D [Brassica napus]
Length=433

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 181/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++L  ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELGSERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG W +V PD CRP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWHVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHIL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGDY+    
Sbjct  310  SNGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDYSGLGQ  363

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  364  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  417



>emb|CDY16904.1| BnaC09g40310D [Brassica napus]
Length=433

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 181/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++L  ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELGSERRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG W +V PD CRP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWHVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHIL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGDY+    
Sbjct  310  SNGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDYSGLGQ  363

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  364  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  417



>ref|NP_197266.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAC01908.1| putative protein [Arabidopsis thaliana]
 gb|ABM06007.1| At5g17640 [Arabidopsis thaliana]
 gb|AED92451.1| uncharacterized protein AT5G17640 [Arabidopsis thaliana]
Length=432

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 182/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  309  SNGLE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_002873840.1| hypothetical protein ARALYDRAFT_909762 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50099.1| hypothetical protein ARALYDRAFT_909762 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 183/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPS+GC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSSGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF+IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  309  SNGLEI-GDVLMSEILISAEKGGEFFIDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_010420495.1| PREDICTED: uncharacterized protein LOC104706063 isoform X2 [Camelina 
sativa]
Length=431

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 182/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  192  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  247

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  248  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  307

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  308  SNGLE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  361

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  362  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  415



>ref|XP_010420494.1| PREDICTED: uncharacterized protein LOC104706063 isoform X1 [Camelina 
sativa]
Length=431

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 182/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  192  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  247

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  248  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  307

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  308  SNGLE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  361

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  362  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  415



>ref|XP_006289579.1| hypothetical protein CARUB_v10003124mg [Capsella rubella]
 gb|EOA22477.1| hypothetical protein CARUB_v10003124mg [Capsella rubella]
Length=432

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 182/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  309  SNGLEI-GDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_010492723.1| PREDICTED: uncharacterized protein LOC104770072 [Camelina sativa]
Length=432

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 182/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF IDTDKQ+   A       P+PSP+SSGD++    
Sbjct  309  SNGLEI-GDVLMSEILISAEKGGEFLIDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_010453965.1| PREDICTED: uncharacterized protein LOC104735808 [Camelina sativa]
Length=432

 Score =   273 bits (699),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 182/236 (77%), Gaps = 13/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL  +WSSS   ++LE ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK----FSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WL+V PD  RP SWQPWGKLEAWRERGIRDS+CCRFH+L
Sbjct  249  ITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   D+LMSEILISAEKGGEF +DTDKQ+   A       P+PSP+SSGD++    
Sbjct  309  SNGLE-VGDVLMSEILISAEKGGEFLVDTDKQMLTVA-----ATPIPSPQSSGDFSGLGQ  362

Query  455  PVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             VS GGFVMS RVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSI AC
Sbjct  363  CVSGGGFVMSSRVQGEGK--SSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILAC  416



>ref|XP_010056513.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 ref|XP_010056515.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 ref|XP_010056516.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 gb|KCW73287.1| hypothetical protein EUGRSUZ_E01747 [Eucalyptus grandis]
Length=431

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 188/235 (80%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL ++WS+  GS D E ERRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSQDRVTQVDPLSTYWSAIEGS-DQETERRERKGWKVKIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPS GC WVA+SNPG W+IV PD  RPESWQPWGKLEAWRERG+RDSICCRF +L
Sbjct  249  ITTPFVPSNGCDWVAKSNPGAWVIVRPDPYRPESWQPWGKLEAWRERGMRDSICCRFRLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   + L+SEI I+AEKGGEF+IDTD+Q+RA+      P P+PSPRSSGD+   L+
Sbjct  309  SEGQEG-GEFLVSEININAEKGGEFFIDTDRQMRASG-----PTPIPSPRSSGDF-GGLS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV GGFVMSC+V+GE G+ SK P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  362  PVVGGFVMSCKVRGE-GKNSK-PLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  414



>gb|KHG03019.1| Wilms tumor [Gossypium arboreum]
Length=432

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 186/235 (79%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R  QVD L ++W  S  + D+E  RRERKGWKV IHDLSGSAVAAAF
Sbjct  194  IFSCK----FSRDRASQVDLLNAYWPGSADNLDIETSRRERKGWKVKIHDLSGSAVAAAF  249

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVPSTGC WVA+SNPG WLI+ PD  RPESW PWGKLEAWRERGIRD++CCRFH+L
Sbjct  250  ITTPFVPSTGCDWVAKSNPGAWLILRPDVVRPESWLPWGKLEAWRERGIRDAVCCRFHLL  309

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             ++ +   ++LMSEI ISAEKGGEF+IDTD+ +R A        P+PSP+SSGD+ +AL+
Sbjct  310  SEAQDG-AEVLMSEIRISAEKGGEFFIDTDRLMRQAP------TPIPSPQSSGDF-SALS  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P+SGGFVMSCRVQGE  + SK P VQLA R+VTC+EDAAIFMALAAAVDLSIEAC
Sbjct  362  PISGGFVMSCRVQGE-SKNSK-PLVQLAMRHVTCIEDAAIFMALAAAVDLSIEAC  414



>ref|XP_011004940.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105111323 
[Populus euphratica]
Length=427

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 172/235 (73%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   ++ +VDPL ++WS     +D+E +RRERKGWKV +HDLS S +A  F
Sbjct  192  IFSCK----FSRDKLTRVDPLSTYWSIFDDGADVETKRRERKGWKVKLHDLSSSTIATTF  247

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            ITTPFVP+TGC WVARSNP  WLIV PD C+P+ WQPWGKLE WRE GIRDSICCRFH+L
Sbjct  248  ITTPFVPATGCDWVARSNPRAWLIVFPDACKPDRWQPWGKLEVWRECGIRDSICCRFHLL  307

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   ++LMSEILISAEKG +F+I+TD+Q+R  A       P+PSP+S GD+ + L 
Sbjct  308  SEGXEG-GEVLMSEILISAEKGTKFFINTDRQLRTTA------TPIPSPQSRGDF-SGLG  359

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P+ GGFVMSCRV+G+G      P VQLA  +VT VEDAAIFMALA  VDLSI AC
Sbjct  360  PIIGGFVMSCRVEGKGS--XNKPLVQLAMXHVTYVEDAAIFMALAVVVDLSIVAC  412



>ref|XP_010266416.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266417.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266418.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266419.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
Length=431

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 181/236 (77%), Gaps = 15/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  +   D R  Q+DP+ ++WSS+    D E ERRERKGWKV I+DLSGSAVAAAF
Sbjct  194  IFSCKFSR---DRRASQLDPMSNYWSSTRNGMDEEAERRERKGWKVMIYDLSGSAVAAAF  250

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHV  639
            + TPFVPSTGC  VARSNPG WLIV PD C PESWQPWGKLEAWRER GIRDSICCRFH+
Sbjct  251  MATPFVPSTGCDRVARSNPGAWLIVRPDACMPESWQPWGKLEAWRERGGIRDSICCRFHL  310

Query  638  LCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAAL  459
            L +  E    LL+SE LISA+KGG F IDTD+Q  +A        P+PSPRSSGD+ A+L
Sbjct  311  LSEGQEG-GGLLVSEKLISADKGGVFVIDTDRQTPSAT-------PVPSPRSSGDF-ASL  361

Query  458  NPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             P+ GGFVM+CRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLS+EAC
Sbjct  362  APIVGGFVMNCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSVEAC  415



>ref|XP_010549738.1| PREDICTED: uncharacterized protein LOC104820818 [Tarenaya hassleriana]
Length=436

 Score =   263 bits (672),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 171/223 (77%), Gaps = 9/223 (4%)
 Frame = -1

Query  956  RIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAW  777
            R+   DPL  + SS    S+LE ERRERKGWKV IHDLSG AVAAAFITTPFVPSTGC W
Sbjct  204  RVSHGDPLSGYCSSLGDVSELEAERRERKGWKVKIHDLSGFAVAAAFITTPFVPSTGCDW  263

Query  776  VARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMS  597
            V +SNPG WL+V PD CRP+SWQPWGKLEAWRERG++DSICCRFH+L +  +   D+LMS
Sbjct  264  VTKSNPGAWLVVRPDPCRPDSWQPWGKLEAWRERGLQDSICCRFHLLSN-WQGDGDVLMS  322

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYA-AALNPVSGGFVMSCRV  420
            E+LISAEKGG+F ID D+Q+   A       P+PSP+SSGD++    +   GGFVMSCRV
Sbjct  323  EVLISAEKGGDFVIDMDRQMLTTA-----GTPVPSPQSSGDFSGLGPSGQGGGFVMSCRV  377

Query  419  QGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            QGEG   S  P VQLA R++ CVEDAAIFMAL+AAVDLSI AC
Sbjct  378  QGEGK--SSKPVVQLAMRHIMCVEDAAIFMALSAAVDLSIVAC  418



>gb|EYU27182.1| hypothetical protein MIMGU_mgv1a006729mg [Erythranthe guttata]
 gb|EYU27183.1| hypothetical protein MIMGU_mgv1a006729mg [Erythranthe guttata]
Length=433

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 178/239 (74%), Gaps = 12/239 (5%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK    F   R+ QVDPL +F SSS   S  + ERRERKGW V IHDLSGSAVAAAF
Sbjct  187  IFSCK----FIRDRVSQVDPLSTFASSSGDGSHQDTERRERKGWNVKIHDLSGSAVAAAF  242

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERG----IRDSICCR  648
            ITTPFVPSTGC WVARSNPG WLIV PD  + +SWQPWGKLEAWRER     IRDS+  R
Sbjct  243  ITTPFVPSTGCDWVARSNPGAWLIVRPDPYQHDSWQPWGKLEAWRERRGGGIIRDSVNFR  302

Query  647  FHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYA  468
            FHV  D  E   +LL+SEI + AEKGGEF+IDTD+Q+RA A        +PSP+SSGD+ 
Sbjct  303  FHVFSDGQEGGKNLLISEISLGAEKGGEFFIDTDRQIRATAE-AAAAAAVPSPQSSGDF-  360

Query  467  AALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              L+PV+GGFVMSCRV GEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLSIEAC
Sbjct  361  TELSPVAGGFVMSCRVCGEGK--SSKPTVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  417



>ref|XP_010275162.1| PREDICTED: uncharacterized protein LOC104610306 [Nelumbo nucifera]
Length=432

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 177/235 (75%), Gaps = 14/235 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  +   D R  Q+D + +   S+   +D + +RRERKGW+V IHDLSGSAVAAAF
Sbjct  194  IFSCKFSR---DRRASQLDSVSNHRVSTTYGTDQDTDRRERKGWRVMIHDLSGSAVAAAF  250

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            + TPFVPS GC  VARSNPG WLIV PD   P+SWQPWGKLEAWRERGI+DSICCRFH+L
Sbjct  251  MATPFVPSMGCDRVARSNPGAWLIVRPDAFGPDSWQPWGKLEAWRERGIKDSICCRFHLL  310

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN  456
             +  E   DLL+SEILISA+KGG F+IDT+++  +         PLPSPRSSGD+ A+L 
Sbjct  311  SEGQEG-GDLLVSEILISADKGGVFFIDTERRTPSVT-------PLPSPRSSGDF-ASLG  361

Query  455  PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            PV GGFVM+CRVQGEG   S  P VQLA R+VTCVEDAAIFMALAAAVDLS+ AC
Sbjct  362  PVFGGFVMNCRVQGEGK--SSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSMVAC  414



>ref|XP_010905311.1| PREDICTED: uncharacterized protein LOC105032546 [Elaeis guineensis]
Length=432

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 162/237 (68%), Gaps = 16/237 (7%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  +   D R  Q+D + ++W SS    D + +RRERKGWK+ IHDLSGSAVAAAF
Sbjct  193  IFSCKFSR---DRRASQLDTVGNYWLSS-NREDQDADRRERKGWKIMIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            + TPFVPS GC  VARSNPG WLI+ PD      W PWG+LEAWRE G RD +C R H+L
Sbjct  249  MATPFVPSMGCDRVARSNPGAWLILRPDAAGSSGWYPWGRLEAWRETGSRDFVCLRLHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY--AAA  462
             D  E    +L+SE+LIS+EKGGEFYID D+Q           P   S   +GDY   + 
Sbjct  309  PDGQEA--GVLVSEVLISSEKGGEFYIDMDRQTPVGT------PVPSSQGGTGDYFTTSL  360

Query  461  LNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
               ++GGFVM+CRVQGE G+ SKP  VQLA R+VTCVEDAAIFMALAAA DLSI+AC
Sbjct  361  AGSLAGGFVMNCRVQGE-GKISKPS-VQLAMRHVTCVEDAAIFMALAAAADLSIKAC  415



>gb|EYU42265.1| hypothetical protein MIMGU_mgv1a007286mg [Erythranthe guttata]
Length=412

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 163/239 (68%), Gaps = 30/239 (13%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKS-FWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAA  819
            +F CK    F   R  + DPL S F S+S   S  + ERRERKGWKV IHDLSGSA+AAA
Sbjct  185  IFSCK----FSGDRGSEGDPLISTFRSNSSNGSHTDAERRERKGWKVKIHDLSGSAIAAA  240

Query  818  FITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER---GIRDSICCR  648
            FITTPFVPSTGC WV++SNPG WLIVHPD  RP SWQPWGKLEAWR+R      DSI  R
Sbjct  241  FITTPFVPSTGCDWVSKSNPGAWLIVHPDPYRPHSWQPWGKLEAWRQRSGTAREDSIFLR  300

Query  647  FHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYA  468
            FH+L D ++   +LLMSE+ I+AEKGGEF IDTD+     A  P     +          
Sbjct  301  FHLLSDGNK---ELLMSEVSINAEKGGEFLIDTDRPAEEGAEAPVGSTEVV---------  348

Query  467  AALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
                    GFVMS R++G GG+CS+ P VQLA ++VTCVEDAAIFMALAAAVDLS+EAC
Sbjct  349  --------GFVMSFRMRG-GGKCSE-PVVQLAVKHVTCVEDAAIFMALAAAVDLSVEAC  397



>ref|XP_008777938.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
 ref|XP_008777939.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
 ref|XP_008777940.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
Length=431

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 162/236 (69%), Gaps = 15/236 (6%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK  +   D R  Q+D + + W SS    D + +RRERKGWK+ IHDLSGSAVAAAF
Sbjct  193  IFSCKFSR---DRRASQLDTVGNNWLSS-NCEDQDADRRERKGWKIMIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVL  636
            + TPFVPS GC  VARSNPG WLI+ PD      W PWG+LEAWRE G RDS+C R H+L
Sbjct  249  MATPFVPSMGCDRVARSNPGAWLILRPDAAGSSGWHPWGRLEAWRETGSRDSVCLRLHLL  308

Query  635  CDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAAL-  459
             +  E    +L+SE LIS+EKGGEFYID D+Q           P   S   +G +  +L 
Sbjct  309  PEGQEA--GVLVSEALISSEKGGEFYIDMDRQTPVGT------PVPSSQGGTGYFTTSLA  360

Query  458  NPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              ++GGFVM+CRVQGE G+ SKP  VQLA R+VTCVEDAAIFMALAAAVDLSI+AC
Sbjct  361  GLMAGGFVMNCRVQGE-GKISKPS-VQLAMRHVTCVEDAAIFMALAAAVDLSIKAC  414



>ref|XP_009398606.1| PREDICTED: uncharacterized protein LOC103983151 [Musa acuminata 
subsp. malaccensis]
Length=436

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 166/237 (70%), Gaps = 16/237 (7%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAF  816
            +F CK      D R   +D +   W++S  + + + ERRERKGWKV IHDLSGSAVAAAF
Sbjct  193  IFSCK---FIQDRRTSPLDMISGHWTNS-NTENHDAERRERKGWKVMIHDLSGSAVAAAF  248

Query  815  ITTPFVPSTGCAWVARSNPGTWLIVHPDGC-RPESWQPWGKLEAWRERGIRDSICCRFHV  639
            + TPFVPS GC  VARSNPG WLI+ PD     ESW PWG+LEAWRE G RD++C R H+
Sbjct  249  MATPFVPSMGCDRVARSNPGAWLILRPDPVSSSESWHPWGRLEAWRETGPRDTVCLRLHI  308

Query  638  LCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY-AAA  462
            L +  +    +L+S++ IS++KGGEFYID D+Q+          P      S+G++ +A+
Sbjct  309  LPEGQDA--GILVSDVAISSDKGGEFYIDMDRQMPVGI------PVGKPQGSTGEFCSAS  360

Query  461  LNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            L P  G FVM+C+VQGE G+CSK P VQLA ++VTCVEDAAIFMALAAAVDLSI+AC
Sbjct  361  LAPRVGRFVMNCKVQGE-GQCSK-PLVQLAVQHVTCVEDAAIFMALAAAVDLSIKAC  415



>ref|XP_002443918.1| hypothetical protein SORBIDRAFT_07g004370 [Sorghum bicolor]
 gb|EES13413.1| hypothetical protein SORBIDRAFT_07g004370 [Sorghum bicolor]
Length=443

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 162/246 (66%), Gaps = 31/246 (13%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLK---SFWSSSVGS-SDLEIERRERKGWKVTIHDLSGSAV  828
            +F CK  +   D R  Q DPL     +WSSS     D+E+ RRERKGWKV IHDLSGSAV
Sbjct  195  VFSCKFIR---DRRPSQSDPLGGGGQYWSSSSSEEKDMEMVRRERKGWKVVIHDLSGSAV  251

Query  827  AAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC-RPESWQPWGKLEAWRE----RGIRD  663
            AAAF+ TPFVP+ G   VARSNPG WLIV  D     +SWQPWG+LEAWR+     G +D
Sbjct  252  AAAFMATPFVPAPGGDTVARSNPGAWLIVRADTTGSSDSWQPWGRLEAWRDAAAASGGKD  311

Query  662  SICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprs  483
            ++  R H+L D H+  D +L+SE  +S++KGGEF+ID D+Q  +A               
Sbjct  312  TVRLRLHLLPDRHD--DCVLVSEAPLSSDKGGEFFIDMDRQAPSATAAEHC---------  360

Query  482  SGDYAAALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVD  309
                AA+L      GGFVMSCRV+GE  R S+ PFVQLA R+VTC+EDAA+F+ALAAAVD
Sbjct  361  ----AASLGAACAGGGFVMSCRVEGE-ARSSR-PFVQLAMRHVTCMEDAAMFVALAAAVD  414

Query  308  LSIEAC  291
            LS++AC
Sbjct  415  LSVKAC  420



>gb|ACN28488.1| unknown [Zea mays]
 gb|AFW57207.1| hypothetical protein ZEAMMB73_373927 [Zea mays]
Length=438

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 160/247 (65%), Gaps = 32/247 (13%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLK--SFWSSSVGS-SDLEIERRERKGWKVTIHDLSGSAVA  825
            +F CK  +   D R  Q DPL    +WSSS     D+E+ RRERK WKV IHDLSGSAVA
Sbjct  189  VFSCKFIR---DRRPSQSDPLGGGQYWSSSSSEEQDMEMVRRERKAWKVVIHDLSGSAVA  245

Query  824  AAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC-RPESWQPWGKLEAWRERGI------R  666
            AAF+ TPFVP+ G   VARSNPG WLIV  D     +SWQPWG+LEAWRE         +
Sbjct  246  AAFMATPFVPAPGGDTVARSNPGAWLIVRADTTGSSDSWQPWGRLEAWREAAAAAASSGK  305

Query  665  DSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpspr  486
            D++  R H+L D H+  D +L+SE  +S++KGGEF+ID D+Q  +A              
Sbjct  306  DTVRLRLHLLPDRHD--DCVLVSEAPLSSDKGGEFFIDMDRQAPSATAAEHC--------  355

Query  485  sSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAV  312
                 AA+L      GGFVMSCRV+GE  R S+ PFVQLA R+VTC+EDAA+F+ALAAAV
Sbjct  356  -----AASLGAACAGGGFVMSCRVEGE-ARSSR-PFVQLAMRHVTCMEDAAMFVALAAAV  408

Query  311  DLSIEAC  291
            DLS++AC
Sbjct  409  DLSVKAC  415



>dbj|BAJ98408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 154/248 (62%), Gaps = 23/248 (9%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLK-SFWSSSVGSSDLEIE----RRERKGWKVTIHDLSGSA  831
            +F CK  +     R  Q D L   +WSSS    + E E    RRERKGWKV IHDLSGSA
Sbjct  178  IFSCKFIRDV--RRATQPDHLGGKYWSSSGSGEEKETEMAGRRRERKGWKVAIHDLSGSA  235

Query  830  VAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC-RPESWQPWGKLEAWRE----RGIR  666
            VAAAF+ TPFVP+TG   VARSNPG WLIV  D     ESWQPWG+LEAWRE     G +
Sbjct  236  VAAAFMATPFVPATGSDTVARSNPGAWLIVRADTTGSSESWQPWGRLEAWRECAAPAGSK  295

Query  665  DSICCRFHVLCDSHEHRDD-LLMSEILISAEKGGEFYIDTDKQ--VRAAAHppptppplp  495
            D++C R H+L    E RD  +L+SE  +S +KGGEF ID D+   +   A     P    
Sbjct  296  DAVCLRLHLL---PERRDACVLVSETPLSCDKGGEFSIDMDRHSILPEDAVASAAPSSSY  352

Query  494  sprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAA  315
               S G+  A      GGFVMSC VQGE    S+PP V LA R+V C+EDAA+F+ALAAA
Sbjct  353  CAASMGESCAG-----GGFVMSCSVQGEAATSSRPPLVHLAARHVMCMEDAAMFLALAAA  407

Query  314  VDLSIEAC  291
            VDLS++AC
Sbjct  408  VDLSVKAC  415



>ref|NP_001061067.1| Os08g0163500 [Oryza sativa Japonica Group]
 dbj|BAC99812.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99909.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22981.1| Os08g0163500 [Oryza sativa Japonica Group]
 gb|EAZ05703.1| hypothetical protein OsI_27935 [Oryza sativa Indica Group]
 gb|EAZ41618.1| hypothetical protein OsJ_26152 [Oryza sativa Japonica Group]
 dbj|BAG87492.1| unnamed protein product [Oryza sativa Japonica Group]
Length=439

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 122/250 (49%), Positives = 153/250 (61%), Gaps = 35/250 (14%)
 Frame = -1

Query  995  LFHCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIE---RRERKGWKVTIHDLSGSAVA  825
            +F CK      D R    D L  +WSSS G  + E E   RRERKGWKV IHDLSGSAVA
Sbjct  183  IFSCK---FIRDRRGSHSDQL--YWSSS-GGEEKEAEMMRRRERKGWKVVIHDLSGSAVA  236

Query  824  AAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRP---------ESWQPWGKLEAWRERG  672
            AAF+ TPFV ++GC  VARSNPG WLI       P         ESWQPWG+LEAWR++G
Sbjct  237  AAFMATPFVAASGCDTVARSNPGAWLIARAGATAPGSTSSSAAVESWQPWGRLEAWRDQG  296

Query  671  ---IRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppp  501
                +D++C R  +L D  +    +L++E  + +++GGEF ID D+Q  A A        
Sbjct  297  GAARQDTVCLRLRLLPDGQDA--CMLVAETPLRSDRGGEFAIDMDRQAPALAAGAEHCAA  354

Query  500  lpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALA  321
                  +G          GGFVMSCRV+GE  R S+ P VQLA R+VTC+EDAA+F+ALA
Sbjct  355  SLGEACAG----------GGFVMSCRVEGE-SRSSR-PLVQLAMRHVTCMEDAAMFVALA  402

Query  320  AAVDLSIEAC  291
            AAVDLS++AC
Sbjct  403  AAVDLSVKAC  412



>ref|XP_002965215.1| hypothetical protein SELMODRAFT_230537 [Selaginella moellendorffii]
 gb|EFJ34053.1| hypothetical protein SELMODRAFT_230537 [Selaginella moellendorffii]
Length=436

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 137/215 (64%), Gaps = 5/215 (2%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            WS  +G  D + ER+ERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  211  WSGPLGGHDHK-ERKERKGWLIMIHDLSGSPVAAASMVTPFVPSAGSDRVSRSNPGAWLI  269

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD----SHEHRDDLLMSEILISAE  576
            + PD    +SW+PWG+LEAW+ERG +  +  RF ++ +       +    L+SE +IS+ 
Sbjct  270  LRPDSTSGDSWEPWGRLEAWKERGSKGGLGLRFQLVAENGGGGTANVGGALVSETVISSH  329

Query  575  KGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCS  396
             GGEF IDT +   A   P  TP   P      ++     P SGGFVMSC  +GE    S
Sbjct  330  SGGEFSIDTARFRPATPSPARTPVQSPRSSGDCNFINVGLPASGGFVMSCTTRGERQSSS  389

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              P VQLA R++TC EDAA+FMALAAAVDLSI+AC
Sbjct  390  GRPLVQLAMRHITCAEDAAVFMALAAAVDLSIDAC  424



>ref|XP_002962295.1| hypothetical protein SELMODRAFT_77561 [Selaginella moellendorffii]
 gb|EFJ37555.1| hypothetical protein SELMODRAFT_77561 [Selaginella moellendorffii]
Length=436

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 137/215 (64%), Gaps = 5/215 (2%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            WS  +G  D + ER+ERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  211  WSGPLGGHDHK-ERKERKGWLIMIHDLSGSPVAAASMVTPFVPSAGSDRVSRSNPGAWLI  269

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD----SHEHRDDLLMSEILISAE  576
            + PD    +SW+PWG+LEAW+ERG +  +  RF ++ +       +    L+SE +IS+ 
Sbjct  270  LRPDSTSGDSWEPWGRLEAWKERGSKGGLGLRFQLVAENGGGGTANVGGALVSETVISSH  329

Query  575  KGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCS  396
             GGEF IDT +   A   P  TP   P      ++     P SGGFVMSC  +GE    S
Sbjct  330  SGGEFSIDTARFRPATPSPARTPVQSPRSSGDCNFINVGLPASGGFVMSCTTRGERQSSS  389

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              P VQLA R++TC EDAA+FMALAAAVDLSI+AC
Sbjct  390  GRPLVQLAMRHITCAEDAAVFMALAAAVDLSIDAC  424



>ref|XP_001760212.1| predicted protein [Physcomitrella patens]
 gb|EDQ74968.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 138/214 (64%), Gaps = 29/214 (14%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S+ S +   +R+ERKGW V IHDLSGS VAAA + TPFVPS G  +VARSNPG WLI
Sbjct  214  WHTSLESRE---KRKERKGWLVMIHDLSGSPVAAASMVTPFVPSAGSDYVARSNPGAWLI  270

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD---SHEHRDDLLMSEILISAEK  573
            + P+    ++W+PWG+LEAWR+RG +D + CRF ++ +          +L SEI +SA+K
Sbjct  271  LRPESPGADNWRPWGRLEAWRDRGGKD-MGCRFQLMAEGGGVTGVSSGVLTSEITLSAKK  329

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSK  393
            GGEF +D  K  +                   + ++ ++PV   FVM C V+G+  R S 
Sbjct  330  GGEFTMDARKFTQ-------------------ESSSGISPVE-KFVMICGVRGD--RDSS  367

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             P VQ+A R+V+CVED A+F+ALAAAVDLS++AC
Sbjct  368  KPLVQVAMRHVSCVEDVAVFIALAAAVDLSVDAC  401



>gb|AIE44349.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44350.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44351.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44352.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44353.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44354.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44356.1| putative stress-induced protein, partial [Ostryopsis nobilis]
 gb|AIE44357.1| putative stress-induced protein, partial [Ostryopsis nobilis]
 gb|AIE44358.1| DUF1005 protein, partial [Ostryopsis nobilis]
Length=121

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 105/129 (81%), Gaps = 8/129 (6%)
 Frame = -1

Query  776  VARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMS  597
            VARSNPG WLIV PD CR ESWQPWGKLEAWRERGIRDS+CCRF +L +  E   +LLMS
Sbjct  1    VARSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIRDSVCCRFRLLSEGQEG-GELLMS  59

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQ  417
            EI I+AEKGGEF+ID+D+Q+RAAA       P+PSP+SSGD+ AAL PV GGFVMSCRVQ
Sbjct  60   EIFINAEKGGEFFIDSDRQMRAAA-----ASPIPSPQSSGDF-AALGPVVGGFVMSCRVQ  113

Query  416  GEGGRCSKP  390
            GE G+ SKP
Sbjct  114  GE-GKSSKP  121



>gb|AIE44355.1| putative stress-induced protein, partial [Ostryopsis intermedia]
Length=121

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 105/129 (81%), Gaps = 8/129 (6%)
 Frame = -1

Query  776  VARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMS  597
            VARSNPG WLIV PD CR ESWQPWGKLEAWRERGI+DS+CCRF +L +  E   +LLMS
Sbjct  1    VARSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIKDSVCCRFRLLSEGQEG-GELLMS  59

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQ  417
            EI I+AEKGGEF+ID+D+Q+RAAA       P+PSP+SSGD+ AAL PV GGFVMSCRVQ
Sbjct  60   EIFINAEKGGEFFIDSDRQMRAAA-----ASPIPSPQSSGDF-AALGPVVGGFVMSCRVQ  113

Query  416  GEGGRCSKP  390
            GE G+ SKP
Sbjct  114  GE-GKSSKP  121



>ref|XP_001778621.1| predicted protein [Physcomitrella patens]
 gb|EDQ56516.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 139/237 (59%), Gaps = 36/237 (15%)
 Frame = -1

Query  926  FWSSSVGSSDLEI---------ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWV  774
            F    VG+SD+           +R+ERKGW V IHDLSGS VAAA + TPFVPS G  +V
Sbjct  191  FSRDKVGTSDISSSSSSLEGREKRKERKGWLVMIHDLSGSPVAAASMVTPFVPSAGSDYV  250

Query  773  ARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD---SHEHRDDLL  603
            ARSNPG WLI+ P+    +SW+PWG+LE WRERG +  +  RF ++ +          +L
Sbjct  251  ARSNPGAWLILRPESSGADSWRPWGRLEVWRERGGK-GMGSRFKLMAEGGGVPGVGSGVL  309

Query  602  MSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGG------  441
             SE  +SA+KGGEF ID        A       P  +  +    A++L+P S G      
Sbjct  310  SSETFLSAKKGGEFTID--------ARRFKMEVPSGTSPAGVSRASSLSPKSSGELYSGS  361

Query  440  -------FVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
                   FVMSC V+G+  R S  P VQ+A R+V+CVED A+F+ALAAA+DLS++AC
Sbjct  362  GLHGVGEFVMSCGVRGD--RDSTKPLVQVAMRHVSCVEDVAVFIALAAAMDLSVDAC  416



>ref|XP_002992680.1| hypothetical protein SELMODRAFT_135747 [Selaginella moellendorffii]
 gb|EFJ06265.1| hypothetical protein SELMODRAFT_135747 [Selaginella moellendorffii]
Length=435

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 147/220 (67%), Gaps = 9/220 (4%)
 Frame = -1

Query  938  PLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNP  759
            P KS WS+S+ + D E ER+ERKGW V IHDLSGS VAAA I TPFVPS+G  +V+RSNP
Sbjct  204  PAKS-WSTSL-TGDRERERKERKGWLVMIHDLSGSPVAAASIVTPFVPSSGSDYVSRSNP  261

Query  758  GTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDS---HEHRDDLLMSEIL  588
            G WLI+ PD    +SW+PWG+LEAWRE+G +  +  RF ++ +          +L+SE +
Sbjct  262  GAWLILRPDSTGVDSWEPWGRLEAWREKGGKGGLGLRFQLVAEGGGITSVGSGILVSETV  321

Query  587  ISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN-PVSGGFVMSCRVQGE  411
            IS + GGEF IDT   VR       +     SP SSGD    L   V+GGFVMSC V GE
Sbjct  322  ISTQSGGEFSIDT---VRLRVEAASSSSSTESPHSSGDGFLGLGFQVAGGFVMSCPVHGE  378

Query  410  GGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              + +K   +Q+A R+VTCVEDAA+FMALAAA DLS++AC
Sbjct  379  RNKTNKGRCIQMAVRHVTCVEDAAVFMALAAAADLSMDAC  418



>gb|AIE44359.1| DUF1005 protein, partial [Corylus mandshurica]
Length=121

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 105/129 (81%), Gaps = 8/129 (6%)
 Frame = -1

Query  776  VARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMS  597
            VARSNPG WLIV PD CR ESWQPWGKLEAWRERGIRDS+CCRF +L +  E   +LLMS
Sbjct  1    VARSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIRDSVCCRFRLLSEGQEG-GELLMS  59

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQ  417
            EI I+AEKGGEF+ID+D+Q+RAAA       P+PSP+SSGD+ AAL PV GGFVMSCRVQ
Sbjct  60   EIFINAEKGGEFFIDSDRQMRAAA-----ASPIPSPQSSGDF-AALCPVVGGFVMSCRVQ  113

Query  416  GEGGRCSKP  390
            GE G+ SKP
Sbjct  114  GE-GKSSKP  121



>emb|CDM84004.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 131/215 (61%), Gaps = 21/215 (10%)
 Frame = -1

Query  935  LKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPG  756
            L+S+ S+  G  D   +R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+R+NPG
Sbjct  230  LRSWLSTLHGDGDKRTQRDQRKGWMVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPG  289

Query  755  TWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAE  576
             WLI+ P G  P SW+PW +LEAWRERG  D++  R  ++ DS      + +++  ISA+
Sbjct  290  AWLILQPTGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGPVECAVPIAQSSISAK  349

Query  575  KGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCS  396
            +GG+F ID       +                   A A  P +GGFVM   V+GE G+ S
Sbjct  350  RGGQFVIDPATFPEGS-------------------AGAAWPFAGGFVMGSTVEGE-GKAS  389

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            + P VQ+  ++V C+ D A+F+AL+AAVDL ++AC
Sbjct  390  R-PTVQVGVQHVACMGDVAVFIALSAAVDLCMDAC  423



>ref|XP_002980096.1| hypothetical protein SELMODRAFT_111932 [Selaginella moellendorffii]
 gb|EFJ18966.1| hypothetical protein SELMODRAFT_111932 [Selaginella moellendorffii]
Length=435

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = -1

Query  938  PLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNP  759
            P KS WS+ + + D E ER+ERKGW V IHDLSGS VAAA I TPFVPS+G  +V+RSNP
Sbjct  204  PAKS-WSTPL-TGDRERERKERKGWLVMIHDLSGSPVAAASIVTPFVPSSGSDYVSRSNP  261

Query  758  GTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDS---HEHRDDLLMSEIL  588
            G WLI+ PD    +SW+PWG+LEAWRE+G +  +  RF ++ +          +L+SE +
Sbjct  262  GAWLILRPDSTGVDSWEPWGRLEAWREKGGKGGLGLRFQLVAEGGGITSVGSGILVSETV  321

Query  587  ISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALN-PVSGGFVMSCRVQGE  411
            IS + GGEF IDT   VR       +     SP SSGD    L   V+GGFVMSC V GE
Sbjct  322  ISTQSGGEFSIDT---VRLRVEAASSSSSTESPHSSGDGFLGLGFQVAGGFVMSCPVHGE  378

Query  410  GGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              + +K   +Q+A R+VTCVEDAA+FMALAAA DLS++AC
Sbjct  379  RNKTNKGRCIQMAVRHVTCVEDAAVFMALAAAADLSMDAC  418



>ref|XP_010049600.1| PREDICTED: uncharacterized protein LOC104438202 [Eucalyptus grandis]
 gb|KCW82300.1| hypothetical protein EUGRSUZ_C03707 [Eucalyptus grandis]
Length=419

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 138/233 (59%), Gaps = 36/233 (15%)
 Frame = -1

Query  989  HCKCRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFIT  810
            +C+ R L  D+      P    W  ++ S + E   RERKGW VTIHDLSGS VAAA + 
Sbjct  203  NCRSRSLASDF------PSSRGWMRTL-SGERERHSRERKGWMVTIHDLSGSPVAAASMV  255

Query  809  TPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD  630
            TPFVPS G   V+RSNPG WLI+ P+G    SW+PWG+LEAWRERG  D +  +F ++ +
Sbjct  256  TPFVPSPGSDRVSRSNPGAWLILRPNGYSVSSWKPWGRLEAWRERGPTDGLGYKFELVTE  315

Query  629  SHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPV  450
                R  + ++E  +S ++GG+F ID    ++                         +PV
Sbjct  316  GGPTR-GIPIAEATLSVKRGGQFSIDVGSSLK-------------------------SPV  349

Query  449  SGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              GFVM+  V+ E G+ SK P VQ+  ++VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  350  K-GFVMASTVEAE-GKTSK-PAVQVGMQHVTCMPDAALFIALSAAIDLSMDAC  399



>dbj|BAJ91729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 131/215 (61%), Gaps = 21/215 (10%)
 Frame = -1

Query  935  LKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPG  756
            L+S+ S+  G +D   +R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+R+NPG
Sbjct  230  LRSWLSTLHGDADARAQRDQRKGWMVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPG  289

Query  755  TWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAE  576
             WLI+ P G    SW+PW +LEAWRERG  D++  R  ++ DS      + ++E  ISA+
Sbjct  290  AWLILQPTGAGASSWKPWARLEAWRERGPVDALGYRLELVFDSGPVECAVPIAESSISAK  349

Query  575  KGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCS  396
            +GG+F ID       +                   A A  P +GGFVM   V+GE G+ S
Sbjct  350  RGGQFVIDPATFPEGS-------------------AGAAWPFAGGFVMGSTVEGE-GKAS  389

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            + P VQ+  ++V C+ D A+F+AL+AAVDL ++AC
Sbjct  390  R-PTVQVGVQHVACMGDVAVFVALSAAVDLCMDAC  423



>ref|XP_009395733.1| PREDICTED: uncharacterized protein LOC103980924 [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 127/206 (62%), Gaps = 22/206 (11%)
 Frame = -1

Query  908  GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDG  729
            G  D EI   +RKGW VTIHDLSGS VAAA I TPFVPS G   V+RSNPG WLI+H  G
Sbjct  231  GERDHEIRWEQRKGWTVTIHDLSGSPVAAASIVTPFVPSPGSDRVSRSNPGAWLILHAIG  290

Query  728  CRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDT  549
                +W+PWG+LEAWRERG  D++  RF ++ D+  + + L ++E  +S  KGGEF ID 
Sbjct  291  PSTTNWKPWGRLEAWRERGPADALGLRFELVTDAGPN-NGLPIAESSLSVRKGGEFCIDP  349

Query  548  DKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAK  369
                                  +G       P  GGFVM+  V+G+ G+ SK P VQ+  
Sbjct  350  S-------------------VVAGAVMPGSWPFVGGFVMAAAVEGQ-GKASK-PTVQVGL  388

Query  368  RYVTCVEDAAIFMALAAAVDLSIEAC  291
            ++V+C+ D A+F+AL+AA+DLS++AC
Sbjct  389  QHVSCMADVALFIALSAAIDLSMDAC  414



>gb|KDO55858.1| hypothetical protein CISIN_1g017474mg [Citrus sinensis]
Length=371

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 128/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S D E   RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G 
Sbjct  168  SGDRERSGRERKGWMIMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGF  227

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ DS      + ++E  +S +KGG+F ID+ 
Sbjct  228  SVSSWKPWGRLEAWRERGAVDGLGYKFELVTDSTGPNSRISIAEATLSVKKGGKFCIDSR  287

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +  +                   + +PV G FVM   V+GEG + SKP  V++  +
Sbjct  288  ITRESLLN-------------------SRSPVKG-FVMGSTVEGEG-KVSKP-VVEVGVQ  325

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  326  HVTCMADAALFIALSAAIDLSMDAC  350



>ref|XP_004969897.1| PREDICTED: uncharacterized protein LOC101784603 [Setaria italica]
Length=448

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 130/218 (60%), Gaps = 24/218 (11%)
 Frame = -1

Query  935  LKSFWSSSV---GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARS  765
            L+S+ S ++   G       R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+R+
Sbjct  235  LRSWLSGTLHGDGRDGSRASREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRA  294

Query  764  NPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILI  585
            NPG+WLI+   G  P SW+PW +LEAWRERG  D++  R  ++ DS  H   + ++E  I
Sbjct  295  NPGSWLILQATGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGPHECAVPIAESSI  354

Query  584  SAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGG  405
            S ++GG+F ID      A                    A A  P +GGFVM   V+GE G
Sbjct  355  STKRGGQFVIDPATFPEAT-------------------AGAAWPFAGGFVMGSTVEGE-G  394

Query  404  RCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            R S+ P VQ+  + VTC+ D A+F+AL+AAVDL ++AC
Sbjct  395  RASR-PTVQVGVQRVTCMGDVAVFVALSAAVDLCMDAC  431



>ref|XP_009416467.1| PREDICTED: uncharacterized protein LOC103997060 [Musa acuminata 
subsp. malaccensis]
Length=442

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 128/214 (60%), Gaps = 26/214 (12%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS+G       R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  232  WFSSLGGERDHQRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLI  291

Query  743  VHPDG---CRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEK  573
            + P G       +W+PWG+LEAWRERG  D++  RF ++ D+  H   + ++E  +S  K
Sbjct  292  LRPIGGSTSAATNWKPWGRLEAWRERGPVDALGYRFELVPDTG-HIGGVPIAESSLSVRK  350

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSK  393
            GG+F ID                        GD  A   P  GGFVM   V+GE G+ SK
Sbjct  351  GGQFCIDPS--------------------VIGDMVAGQWPFDGGFVMGSTVEGE-GKASK  389

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             P VQ+  ++V+C+ D A+F+AL+AA+DLS++AC
Sbjct  390  -PSVQVGVQHVSCMADVALFIALSAAIDLSMDAC  422



>ref|XP_003620756.1| hypothetical protein MTR_6g090060 [Medicago truncatula]
 gb|AES76974.1| DUF1005 family protein [Medicago truncatula]
Length=423

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 127/199 (64%), Gaps = 28/199 (14%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW +T+HDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  231  RERKGWMITVHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPW  290

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ ++    + + ++E  ++ +KGG+F ID +        
Sbjct  291  GRLEAWRERGHVDGLGYKFELVTEN----NGIPIAESTMNVKKGGQFCIDYN--------  338

Query  521  ppptppplpsprsSGDYAAALN--PVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                           +Y    +  P   GFVMS  V+GE G+ SK PFVQ+  ++VTC+ 
Sbjct  339  ------------VMKEYYGLCSRLPPGKGFVMSSSVEGE-GKISK-PFVQVGAQHVTCMA  384

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AA+DLS++AC
Sbjct  385  DAALFVALSAAIDLSMDAC  403



>ref|XP_008242466.1| PREDICTED: uncharacterized protein LOC103340798 [Prunus mume]
Length=420

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 129/205 (63%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S D E   RERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  219  SGDRERPGRERKGWMITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGF  278

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID+ 
Sbjct  279  NVSSWKPWGRLEAWRERGPIDGLGYKFELVTDNGPS-SSITIAEGTMSVKKGGQFCIDSS  337

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +A +                   + +PV  GFVM   V+GE G+ SKP  VQ+  +
Sbjct  338  LMRDSALN-------------------SRSPVK-GFVMGSTVEGE-GKVSKPS-VQVGAQ  375

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS+++C
Sbjct  376  HVTCMADAALFVALSAAIDLSMDSC  400



>ref|XP_006451341.1| hypothetical protein CICLE_v10008480mg [Citrus clementina]
 gb|ESR64581.1| hypothetical protein CICLE_v10008480mg [Citrus clementina]
Length=409

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 128/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S D E   RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G 
Sbjct  206  SGDRERSGRERKGWMIMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGF  265

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ DS      + ++E  +S +KGG+F ID+ 
Sbjct  266  SVSSWKPWGRLEAWRERGAVDGLGYKFELVTDSTGPNSRISIAEATLSVKKGGKFCIDSR  325

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +  +                   + +PV G FVM   V+GEG + SKP  V++  +
Sbjct  326  ITRESLLN-------------------SRSPVKG-FVMGSTVEGEG-KVSKP-VVEVGVQ  363

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  364  HVTCMADAALFIALSAAIDLSMDAC  388



>ref|XP_008799780.1| PREDICTED: uncharacterized protein LOC103714350 [Phoenix dactylifera]
Length=429

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 124/208 (60%), Gaps = 23/208 (11%)
 Frame = -1

Query  908  GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDG  729
            GS    + R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G
Sbjct  225  GSERNHLRREQRKGWTVTIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPTG  284

Query  728  C--RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYI  555
                  +W+PWG+LEAWRERG  D++  RF ++ DS      + ++E   S  KGG F I
Sbjct  285  FSGSTPNWKPWGRLEAWRERGPVDALGYRFELVTDSGPS-GGIPIAESSFSVRKGGRFCI  343

Query  554  DTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQL  375
            D D  V                  +GD  +   P  GGFVM+  V+GE  R    P VQ+
Sbjct  344  DPDPGV------------------AGDTVSRSWPFVGGFVMAADVEGE--RKVSKPTVQV  383

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              ++V+C+ D A+F+AL+AAVDLSI+AC
Sbjct  384  GAQHVSCMADVALFIALSAAVDLSIDAC  411



>ref|XP_004157897.1| PREDICTED: uncharacterized LOC101219082, partial [Cucumis sativus]
Length=228

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW + ++DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  25   SGEREKPGRERKGWMIMVYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGF  84

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID  
Sbjct  85   SVSSWKPWGRLEAWRERGPIDGLGYKFELVADTGLA-TGIPIAEATMSVKKGGQFCIDR-  142

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            K VR                       + + V G FVM+  V+GE G+ SK P VQ+  +
Sbjct  143  KTVRDLT------------------INSKSTVKGSFVMASSVEGE-GKVSK-PIVQVGVQ  182

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  183  HVTCMADAALFVALSAAIDLSMDAC  207



>ref|XP_010042246.1| PREDICTED: uncharacterized protein LOC104431287 [Eucalyptus grandis]
Length=297

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/248 (41%), Positives = 141/248 (57%), Gaps = 34/248 (14%)
 Frame = -1

Query  1019  SLRIKVTYLFHCKCRKLF*DYRIPQVDPLKSFWSSSVG-----SSDLEIERRERKGWKVT  855
             + R + T  F  + R+    +   +   L S + SS G     S + E   RE KGW VT
Sbjct  59    TFRKESTVQFLAESREEIVGHGEWETRSLASDFPSSRGWMRTLSRERERHSREPKGWMVT  118

Query  854   IHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER  675
             IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PWG+LEAWRER
Sbjct  119   IHDLSGSPVAAASMVTPFVPSPGSDLVSRSNPGAWLILRPNGYSISSWKPWGRLEAWRER  178

Query  674   GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplp  495
             G  D +  +F ++ +    R  + ++E  +S +KGG+F ID    +++            
Sbjct  179   GPTDGLGYKFELVTEGGPTR-GIPIAEATMSVKKGGQFSIDVGSSLKS------------  225

Query  494   sprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAA  315
                          PV  GFVM+  V+ E G+ SK P VQ+  ++VTC+ DAA+F+AL+AA
Sbjct  226   -------------PVK-GFVMASTVEAE-GKTSK-PAVQVGVQHVTCMPDAALFIALSAA  269

Query  314   VDLSIEAC  291
              DLS++AC
Sbjct  270   FDLSMDAC  277



>emb|CDP03235.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 126/205 (61%), Gaps = 24/205 (12%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW + IHDLSGSAVAAA + TPFVPS G   V+RSNPG WLI+ P+G 
Sbjct  225  SGEREKSGRERKGWMIMIHDLSGSAVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGP  284

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  RF ++ DS      + ++E  +S ++GG+F ID  
Sbjct  285  SVSSWKPWGRLEAWRERGPVDGLGYRFALVTDSG-LTSGVPIAEGTMSVKRGGQFCIDNA  343

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            ++                     D   +L     GFVM   V+ E G+ SK P VQ+  R
Sbjct  344  RK---------------------DSVLSLVLPVRGFVMGSSVEAE-GKVSK-PMVQVGVR  380

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  381  HVTCMADAALFVALSAAIDLSMDAC  405



>gb|KHG29270.1| hypothetical protein F383_14119 [Gossypium arboreum]
Length=418

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 131/205 (64%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E + RERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G 
Sbjct  215  SGEKERQGRERKGWMIMIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGF  274

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ ++  + + + ++E  +S +KGG+F ID  
Sbjct  275  SVSSWKPWGRLEAWRERGPIDGLGYKFELVTENGPN-NGIPIAEATMSIKKGGQFCIDRR  333

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                 +A                   ++ +PV  GFVM   V+GE G+ SK P VQ+  +
Sbjct  334  VSRDPSA------------------LSSRSPVK-GFVMGATVEGE-GKVSK-PVVQVGMQ  372

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  373  HVTCMADAALFIALSAAIDLSMDAC  397



>ref|XP_004287493.1| PREDICTED: uncharacterized protein LOC101301714 [Fragaria vesca 
subsp. vesca]
Length=421

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 131/205 (64%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  219  SGERERPGRERKGWMITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGF  278

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGGEF ID+ 
Sbjct  279  SVNNWKPWGRLEAWRERGPVDGLGYKFELVTDNGPS-SSITIAEATLSMKKGGEFCIDS-  336

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            + +R                   +Y+ +  PV  GFVM   V+GE G+ SK P VQ+  +
Sbjct  337  RLLRDQGL---------------NYSRS--PVK-GFVMGSSVEGE-GKVSK-PMVQVGVQ  376

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  377  HVTCMADAALFVALSAAIDLSMDAC  401



>emb|CDY06823.1| BnaC01g09220D [Brassica napus]
Length=425

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 21/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S ++GG+F ID     R +
Sbjct  288  PWGRLEAWRERGAVDGLGYKFELVTDNTSTSTGVPIAEGTMSTKQGGKFIIDR----RVS  343

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  344  GQ--------------GESPARSSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  386

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  387  DAALFVALSAAVDLSVDAC  405



>ref|XP_010232287.1| PREDICTED: uncharacterized protein LOC100822437 [Brachypodium 
distachyon]
Length=450

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 129/217 (59%), Gaps = 23/217 (11%)
 Frame = -1

Query  935  LKSFWSSSVGS--SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSN  762
            L+S+ S+  G    D    R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+R+N
Sbjct  238  LRSWLSTLHGGDGGDARARREQRKGWMVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRAN  297

Query  761  PGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILIS  582
            PG WLI+ P G  P SW+PW +LEAWRERG  D++  R  ++ DS      + ++E  IS
Sbjct  298  PGAWLILQPTGAGPSSWKPWARLEAWRERGPIDALGYRLELVFDSGPVECAVPIAESSIS  357

Query  581  AEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGR  402
             ++GG+F ID       A                   A A  P +GGFVM   V+GE G+
Sbjct  358  TKRGGQFVIDPATFPEGA-------------------AGASWPFAGGFVMGSTVEGE-GK  397

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             S+ P VQ+  ++ +C+ D A+F+AL+AAVDL ++AC
Sbjct  398  ASR-PTVQVGVQHASCMGDVAVFVALSAAVDLCMDAC  433



>ref|XP_007202154.1| hypothetical protein PRUPE_ppa006267mg [Prunus persica]
 gb|EMJ03353.1| hypothetical protein PRUPE_ppa006267mg [Prunus persica]
Length=420

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 128/205 (62%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S D E   RERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  219  SGDRERPGRERKGWMITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGF  278

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID+ 
Sbjct  279  SVSSWKPWGRLEAWRERGPIDGLGYKFELVTDNGPS-SSITIAEGTMSVKKGGQFCIDSS  337

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +A +                   + +PV  GFV    V+GE G+ SKP  VQ+  +
Sbjct  338  LMRDSALN-------------------SRSPVK-GFVTGSTVEGE-GKVSKPS-VQVGVQ  375

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  376  HVTCMADAALFVALSAAIDLSMDAC  400



>ref|XP_010924447.1| PREDICTED: uncharacterized protein LOC105047284 [Elaeis guineensis]
Length=441

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 126/213 (59%), Gaps = 25/213 (12%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W    GS    + R +RKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  232  WFGCFGSERSHVRREQRKGWTITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLI  291

Query  743  VHPDGC--RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKG  570
            +   G      +W+PWG+LEAWRERG  D++  RF ++ D+    + + ++E  +S  KG
Sbjct  292  LRATGSSGSTPNWKPWGRLEAWRERGPVDALGYRFEIVTDAAPT-ERVPIAESSLSVRKG  350

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKP  390
            G+F ID                       +GD  +   P  G FVM   V+GE G+ SK 
Sbjct  351  GQFSIDPS--------------------VAGDVVSTSEPFVGAFVMVSTVEGE-GKVSK-  388

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P VQ+  ++V+C+ D A+F+AL+AAVDLS++AC
Sbjct  389  PMVQVGVQHVSCMADVALFIALSAAVDLSMDAC  421



>gb|KDP33775.1| hypothetical protein JCGZ_07346 [Jatropha curcas]
Length=422

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 127/203 (63%), Gaps = 23/203 (11%)
 Frame = -1

Query  893  EIER--RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRP  720
            E ER  RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G   
Sbjct  220  EKERAGRERKGWMIMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSV  279

Query  719  ESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQ  540
             SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S  KGG+F ID+   
Sbjct  280  SSWKPWGRLEAWRERGPIDGLGYKFELVTDNGGPSRGIPIAEATLSVRKGGQFCIDSRIM  339

Query  539  VRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYV  360
              +  +                  ++ +PV  GFVM   V+GE G+ SK P VQ+  ++V
Sbjct  340  KDSGLN------------------SSRSPVK-GFVMDSTVEGE-GKVSK-PVVQVGMQHV  378

Query  359  TCVEDAAIFMALAAAVDLSIEAC  291
            TC+ DAA+F+AL+AA+DLS++AC
Sbjct  379  TCMADAALFIALSAAIDLSMDAC  401



>ref|XP_007152956.1| hypothetical protein PHAVU_004G174300g [Phaseolus vulgaris]
 gb|ESW24950.1| hypothetical protein PHAVU_004G174300g [Phaseolus vulgaris]
Length=420

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 23/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  227  RERKGWMVTIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPW  286

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ ++    + + ++E  ++ +KGG+F ID  K +R    
Sbjct  287  GRLEAWRERGPIDGLGYKFELVAENGPG-NGIPIAEATMNVKKGGQFCIDY-KVMR----  340

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D   +      GFVM   V+GE G+ SK P VQ+  ++VTC+ DA
Sbjct  341  ---------------DSGLSSRLPGKGFVMGSSVEGE-GKVSK-PLVQVGAQHVTCMADA  383

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  384  ALFIALSAAIDLSMDAC  400



>ref|XP_008795504.1| PREDICTED: uncharacterized protein LOC103711219 [Phoenix dactylifera]
Length=442

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 125/213 (59%), Gaps = 25/213 (12%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W   +GS      R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  233  WFGCLGSERNHRRRDKRKGWTVTIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLI  292

Query  743  VHPDGCRPES--WQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKG  570
            +   G    +  W+PWG+LEAWRERG  +++  RF ++ DS    D + ++E  +S  KG
Sbjct  293  LRATGFSGSTANWKPWGRLEAWRERGPVNTLGYRFELVTDSGPT-DRVPIAESSLSVRKG  351

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKP  390
            G+F ID                       +GD  +   P  GGFVM   V GE G+ SK 
Sbjct  352  GQFSIDPS--------------------VAGDVVSRSEPFVGGFVMGSTVNGE-GKVSK-  389

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P VQ+   +V+C+ D A+F+ALAAAVDLS++AC
Sbjct  390  PTVQVGLHHVSCMADVALFIALAAAVDLSMDAC  422



>ref|XP_009766756.1| PREDICTED: uncharacterized protein LOC104218054 [Nicotiana sylvestris]
Length=418

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 28/199 (14%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGSAVAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  226  RERKGWMIIIYDLSGSAVAAASVITPFVPSPGSDRVSRSNPGAWLILQPNGSCVSSWKPW  285

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D       + ++E  +S +KGG+F ID   +  A   
Sbjct  286  GRLEAWRERGPVDGLGYKFELVTDIG-LTSGVPIAEGTMSMKKGGQFCIDNTIKDSA---  341

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKP--PFVQLAKRYVTCVE  348
                              ++L+P+  GFVM   V+GEG    KP  P VQ+  R+VTC+ 
Sbjct  342  -----------------LSSLSPIR-GFVMGSSVEGEG----KPSAPTVQVGVRHVTCMA  379

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AA+DLS++AC
Sbjct  380  DAALFIALSAAIDLSMDAC  398



>ref|XP_008458969.1| PREDICTED: uncharacterized protein LOC103498220 [Cucumis melo]
Length=421

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 129/206 (63%), Gaps = 24/206 (12%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW + ++DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  218  SGEREKPGRERKGWMIMVYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGF  277

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ DS      + ++E  +S +KGG+F ID  
Sbjct  278  SVSSWKPWGRLEAWRERGPIDGLGYKFELVADSGLA-TGIPIAEATMSVKKGGQFCIDR-  335

Query  545  KQVRAAAHppptppplpsprsSGDYAA-ALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAK  369
            K VR                   D+   + + V G FVM+  V+GE G+ SK P VQ+  
Sbjct  336  KTVR-------------------DFTTNSKSTVKGSFVMASSVEGE-GKVSK-PIVQVGV  374

Query  368  RYVTCVEDAAIFMALAAAVDLSIEAC  291
            ++VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  375  QHVTCMADAALFVALSAAIDLSMDAC  400



>ref|XP_009352575.1| PREDICTED: uncharacterized protein LOC103943924 [Pyrus x bretschneideri]
Length=420

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S D E   RERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  219  SGDTEKPWRERKGWMITIHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGF  278

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID+ 
Sbjct  279  SISSWKPWGRLEAWRERGPIDGLGYKFELVTDNGPS-SSITIAEGTLSVKKGGQFCIDSR  337

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +                      + +PV  GFV    V+GE G+ SK P VQ+  +
Sbjct  338  LNRDSGLK-------------------SRSPVK-GFVTGSTVEGE-GKVSK-PVVQVGVQ  375

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  376  HVTCMADAALFVALSAAIDLSMDAC  400



>ref|XP_006852767.1| hypothetical protein AMTR_s00033p00137950 [Amborella trichopoda]
 gb|ERN14234.1| hypothetical protein AMTR_s00033p00137950 [Amborella trichopoda]
Length=454

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 142/225 (63%), Gaps = 20/225 (9%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S G SD E   RERKGW +TIHDLSGS VAAA + TPFVPS G   V+R+NPG WLI
Sbjct  217  WLGSRGGSDCERPVRERKGWAITIHDLSGSPVAAASMVTPFVPSPGSDRVSRTNPGAWLI  276

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD---SHEHRDDLLMSEILISAE  576
            + P DG    +W+PW +LEAWRERG  D++  RFH+L +   +      +L++E  +SA 
Sbjct  277  LRPGDG----TWKPWARLEAWRERGAHDALGYRFHLLSESSSTASMNSSILLAESSLSAS  332

Query  575  KGGEFYIDTD------KQVRAAAHppptppplpsprsSGDYAAALNPVSG----GFVMSC  426
            KGG+F ID         Q      P    P   SPRSS D+  AL PV      GFVMS 
Sbjct  333  KGGKFTIDIGIASTGMAQSNGRVTPGTVSPVCSSPRSSADFGHALWPVVQHGLRGFVMSS  392

Query  425  RVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             V+GE GRCSK PFV +  ++V C+EDAA ++ALAAA+DLS++AC
Sbjct  393  SVEGE-GRCSK-PFVHIGVQHVACMEDAAAYVALAAAIDLSMDAC  435



>ref|XP_008367920.1| PREDICTED: uncharacterized protein LOC103431533 [Malus domestica]
Length=239

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 122/197 (62%), Gaps = 23/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G    SW+PW
Sbjct  46   RERKGWMITIHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPW  105

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID+     +   
Sbjct  106  GRLEAWRERGPIDGLGYKFELVTDNGPS-SSITIAEGTMSVKKGGQFCIDSRLNRDSGLK  164

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                               + +PV  GFV    V+G  G+ SK P VQ+  ++VTC+ DA
Sbjct  165  -------------------SRSPVK-GFVTGSTVEGX-GKVSK-PVVQVGVQHVTCMADA  202

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  203  ALFVALSAAIDLSMDAC  219



>ref|XP_007012983.1| Uncharacterized protein TCM_037753 [Theobroma cacao]
 gb|EOY30602.1| Uncharacterized protein TCM_037753 [Theobroma cacao]
Length=416

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 128/205 (62%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E + RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  215  SGERERQGRERKGWMIMIYDLSGSPVAAASVITPFVPSPGSDRVSRSNPGAWLILRPHGF  274

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ ++    + + ++E  +S +KGG+F I  D
Sbjct  275  SVSSWKPWGRLEAWRERGPIDGLGYKFELVTENGPT-NGIPIAESTMSVKKGGQFCI--D  331

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            K+V                    D A +L     GFVM   V+ E G+ SK P VQ+  +
Sbjct  332  KRVSR------------------DSALSLRSPVKGFVMGSTVEAE-GKVSK-PVVQVGMQ  371

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  372  HVTCMADAALFIALSAAIDLSMDAC  396



>ref|XP_011093657.1| PREDICTED: uncharacterized protein LOC105173566 [Sesamum indicum]
Length=419

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 125/197 (63%), Gaps = 24/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + ++DLSGSAVAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  227  RERKGWMIIVYDLSGSAVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGVSISSWKPW  286

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ + +     + ++E  ++ +KGG F ID  ++  A + 
Sbjct  287  GRLEAWRERGPVDGLGYKFELITN-NGLTSGVPIAEGTMNIKKGGRFCIDNSRKDSALSF  345

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                                L+PV  GFVM   V+GE G+ SK P VQ+  ++VTC  DA
Sbjct  346  --------------------LSPVR-GFVMGSSVEGE-GKVSK-PVVQVGVQHVTCTADA  382

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AAVDLS++AC
Sbjct  383  ALFVALSAAVDLSMDAC  399



>ref|XP_010249469.1| PREDICTED: uncharacterized protein LOC104592027 [Nelumbo nucifera]
Length=417

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 125/205 (61%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            +SD +   RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  216  ASDRDRPGRERKGWMIMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPQGF  275

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+  +   + ++E  +S  KGG+F IDT 
Sbjct  276  SVSSWKPWGRLEAWRERGPIDGLGYKFELVTDTGTN-SGISIAEATMSIRKGGQFCIDTS  334

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                                  GD A++      GF+M   V+GE G+ SK P VQ+  +
Sbjct  335  --------------------LVGDTASSSWSSRRGFIMGSTVEGE-GKVSK-PVVQVGVQ  372

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VT   DAA+F+AL+AA+DLS++AC
Sbjct  373  HVTSTADAALFIALSAAIDLSMDAC  397



>ref|XP_009602498.1| PREDICTED: uncharacterized protein LOC104097612 [Nicotiana tomentosiformis]
Length=418

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 125/199 (63%), Gaps = 28/199 (14%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGSAVAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  226  RERKGWMIIIYDLSGSAVAAASVITPFVPSPGSDRVSRSNPGAWLILRPNGSCVSSWKPW  285

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D       + ++E  +S ++GG+F ID   +  A   
Sbjct  286  GRLEAWRERGPVDGLGYKFELVTDIG-LTSGVPIAEGTMSMKRGGQFCIDNTVKDSA---  341

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKP--PFVQLAKRYVTCVE  348
                              ++L+P+  GFVM   V+GEG    KP  P VQ+  R+VTC+ 
Sbjct  342  -----------------LSSLSPIR-GFVMGSSVEGEG----KPSAPTVQVGVRHVTCMA  379

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AA+DLS++AC
Sbjct  380  DAALFIALSAAIDLSMDAC  398



>gb|KHG26934.1| hypothetical protein F383_08453 [Gossypium arboreum]
Length=422

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 128/203 (63%), Gaps = 24/203 (12%)
 Frame = -1

Query  893  EIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPES  714
            E + RERKGW V I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G    S
Sbjct  222  ERQGRERKGWMVMIYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSS  281

Query  713  WQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYID--TDKQ  540
            W+PWG+LEAWRERG  D +  +F ++ D+    + + ++E  +S +KGG F ID    K 
Sbjct  282  WKPWGRLEAWRERGPVDGLGYKFELVTDNGPS-NGVPIAEATMSVKKGGLFCIDRRVSKS  340

Query  539  VRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYV  360
              AA+                   ++ +P+  GFVM   V+GE G+ SK P VQ+  ++V
Sbjct  341  DSAAS------------------TSSRSPIK-GFVMGSTVEGE-GKVSK-PMVQVGIQHV  379

Query  359  TCVEDAAIFMALAAAVDLSIEAC  291
            TC+ DAA+F+AL+AA+DLS++AC
Sbjct  380  TCMADAALFIALSAAIDLSMDAC  402



>ref|XP_008387423.1| PREDICTED: uncharacterized protein LOC103449874 [Malus domestica]
Length=418

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 127/205 (62%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S+D E   RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G 
Sbjct  217  SADRERPGRERKGWMITIHDLSGSPVAAASMITPFVASPGTDRVSRSNPGAWLILRPHGF  276

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGGEF ID+ 
Sbjct  277  SISSWKPWGRLEAWRERGPIDGLGYKFELVTDNGPS-SSITIAEGTMSVKKGGEFCIDSR  335

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +  +                   + +PV  GFV    V+GE G+ SK P VQ+  +
Sbjct  336  LNRDSGLN-------------------SRSPVK-GFVTGSTVEGE-GKVSK-PVVQVGVQ  373

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  374  HVTCMADAALFVALSAAIDLSMDAC  398



>ref|XP_010915009.1| PREDICTED: uncharacterized protein LOC105040251 [Elaeis guineensis]
 ref|XP_010915015.1| PREDICTED: uncharacterized protein LOC105040251 [Elaeis guineensis]
Length=448

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 25/213 (12%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS    + R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+RSN G WLI
Sbjct  239  WFSSFGSERNHLRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNAGAWLI  298

Query  743  VHPDGC--RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKG  570
            + P G      +W+PWG+LEAWRERG  D++  RF ++ DS      + ++E  +S  KG
Sbjct  299  LQPTGFSGSTPNWKPWGRLEAWRERGPVDALGYRFELVTDSGP-TGGIPIAESSLSVRKG  357

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKP  390
            G+F I                    +P   GD  +   P  GGFVM   V+GE G+ SK 
Sbjct  358  GQFCI--------------------APGVIGDGISRSWPSVGGFVMGSIVEGE-GKVSK-  395

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P VQ+  ++V+C+ D A+F+AL+AAVDLS++AC
Sbjct  396  PTVQVGAQHVSCMADVALFIALSAAVDLSMDAC  428



>gb|KGN60567.1| hypothetical protein Csa_2G000750 [Cucumis sativus]
Length=421

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW + ++DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  218  SGEREKPGRERKGWMIMVYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGF  277

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID  
Sbjct  278  SVSSWKPWGRLEAWRERGPIDGLGYKFELVADTGLA-TGIPIAEATMSVKKGGQFCIDR-  335

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            K VR                       + + V G FVM+  V+GE G+ SK P VQ+  +
Sbjct  336  KTVRDLT------------------INSKSTVKGSFVMASSVEGE-GKVSK-PIVQVGVQ  375

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  376  HVTCMADAALFVALSAAIDLSMDAC  400



>ref|XP_004141026.1| PREDICTED: uncharacterized protein LOC101219082 [Cucumis sativus]
Length=421

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW + ++DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  218  SGEREKPGRERKGWMIMVYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGF  277

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID  
Sbjct  278  SVSSWKPWGRLEAWRERGPIDGLGYKFELVADTGLA-TGIPIAEATMSVKKGGQFCIDR-  335

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            K VR                       + + V G FVM+  V+GE G+ SK P VQ+  +
Sbjct  336  KTVRDLT------------------INSKSTVKGSFVMASSVEGE-GKVSK-PIVQVGVQ  375

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  376  HVTCMADAALFVALSAAIDLSMDAC  400



>ref|XP_001754636.1| predicted protein [Physcomitrella patens]
 gb|EDQ80606.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 140/222 (63%), Gaps = 14/222 (6%)
 Frame = -1

Query  926  FWSSSVGSSDLEIE-RRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTW  750
            F+S + GS   + E RRERKGW V IHDLSGS VAAA + TPFVPS G  +VARSNPG W
Sbjct  205  FFSDAWGSKSEDREKRRERKGWLVMIHDLSGSPVAAASMVTPFVPSAGSDYVARSNPGAW  264

Query  749  LIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD---SHEHRDDLLMSEILISA  579
            LI+ P+    ++W+PWG+LEAWR+RG +D I CRF ++ +          +L SE ++SA
Sbjct  265  LILRPESPGADNWRPWGRLEAWRDRGGKD-IGCRFQLMAEGGGVTGVSSGVLTSETILSA  323

Query  578  EKGGEFYIDTDKQVR------AAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQ  417
            +KGG+F ID  +  +      +    P      P       +   L+ V G FVMSC V+
Sbjct  324  KKGGDFTIDARRFKQEVSLGPSPVESPRRNSLSPRSSGELSFGLGLHAV-GEFVMSCGVR  382

Query  416  GEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            G+  R S  P VQ+A R+V+CVED A+F+ALAAAVDLS+ AC
Sbjct  383  GD--RNSSKPLVQVAMRHVSCVEDVAVFVALAAAVDLSVYAC  422



>ref|XP_002514196.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48150.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 125/205 (61%), Gaps = 21/205 (10%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G 
Sbjct  218  SGEKERAGRERKGWMIMIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGF  277

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRERG  D +  +  ++ D+      + ++E  +   KGG+F ID+ 
Sbjct  278  SVSNWKPWGRLEAWRERGPLDGLGYKVELVTDNGGPSGGIPIAEGTMGMRKGGQFCIDSR  337

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                +                     ++ +PV  GFVM   V+GE G+ SK P VQ+  +
Sbjct  338  IMKDSG------------------LLSSRSPVK-GFVMGATVEGE-GKVSK-PVVQIGVQ  376

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  377  HVTCMADAALFIALSAAIDLSMDAC  401



>ref|XP_010688362.1| PREDICTED: uncharacterized protein LOC104902329 [Beta vulgaris 
subsp. vulgaris]
Length=426

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 122/198 (62%), Gaps = 24/198 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G    +W+PW
Sbjct  231  RERKGWMIMIYDLSGSPVAAASVITPFVPSPGSDRVSRSNPGAWLILRPHGSHVNNWKPW  290

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDT-DKQVRAAA  525
            G+LEAWRERG  D +  +F ++ +    R  + ++E  +S +KGG+F ID  D  +    
Sbjct  291  GRLEAWRERGPVDGLGYKFELVTEDGPTRTGIPIAEATMSIKKGGKFCIDKRDSSL----  346

Query  524  HppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVED  345
                            +     +PV G FVM   V+GEG + SKP  VQ+  ++VTC+ D
Sbjct  347  ----------------EEVMVRSPVRG-FVMGSTVEGEG-KISKP-LVQVGMQHVTCMAD  387

Query  344  AAIFMALAAAVDLSIEAC  291
            A +F+AL+AA+DLS++AC
Sbjct  388  AGLFVALSAAIDLSMDAC  405



>gb|KFK29490.1| hypothetical protein AALP_AA7G141200 [Arabis alpina]
Length=424

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 125/199 (63%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D +     + +++  +S ++GG+F ID     R +
Sbjct  288  PWGRLEAWRERGTIDGLGYKFELVSD-NSTSTGIPIAQGTMSTKQGGKFSIDR----RVS  342

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  343  GQ--------------GESPARSSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  385

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  386  DAALFVALSAAVDLSVDAC  404



>ref|XP_010267102.1| PREDICTED: uncharacterized protein LOC104604464 [Nelumbo nucifera]
Length=417

 Score =   159 bits (403),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 121/197 (61%), Gaps = 23/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G    SW+PW
Sbjct  224  RERKGWMIMIYDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPQGFSVSSWKPW  283

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D+  +   +  +E  +S  KGG+F IDT+        
Sbjct  284  GRLEAWRERGPADGLGYKFELVTDTGTN-TGVPFAESTMSVRKGGQFCIDTN--------  334

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                          GD A++ +    GFVM   V+GE G+ SK P VQ+  ++V    DA
Sbjct  335  ------------LVGDTASSSSSSRRGFVMGSTVEGE-GKVSK-PVVQVGVQHVKSTADA  380

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  381  ALFVALSAAIDLSMDAC  397



>ref|XP_002867413.1| hypothetical protein ARALYDRAFT_913577 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43672.1| hypothetical protein ARALYDRAFT_913577 [Arabidopsis lyrata subsp. 
lyrata]
Length=424

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D +     + ++E  +S ++GG+F ID     R +
Sbjct  288  PWGRLEAWRERGAIDGLGYKFELVRD-NSTSTGIPIAEGTMSTKQGGKFSIDR----RVS  342

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  343  GQ--------------GESPAISSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  385

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  386  DAALFVALSAAVDLSVDAC  404



>ref|XP_010438312.1| PREDICTED: uncharacterized protein LOC104721933 [Camelina sativa]
Length=425

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  229  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  288

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D +     + ++E  +S ++GG+F ID     R +
Sbjct  289  PWGRLEAWRERGAIDGLGYKFELVRD-NSTSTGIPIAEGTMSTKQGGKFSIDR----RVS  343

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  344  GQ--------------GESPAISSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  386

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  387  DAALFVALSAAVDLSVDAC  405



>ref|XP_010433108.1| PREDICTED: uncharacterized protein LOC104717264 [Camelina sativa]
Length=425

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  229  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  288

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D +     + ++E  +S ++GG+F ID     R +
Sbjct  289  PWGRLEAWRERGAIDGLGYKFELVRD-NSTSTGIPIAEGTMSTKQGGKFSIDR----RVS  343

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  344  GQ--------------GESPAISSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  386

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  387  DAALFVALSAAVDLSVDAC  405



>ref|XP_003530524.1| PREDICTED: uncharacterized protein LOC100811541 isoform X1 [Glycine 
max]
 ref|XP_006584805.1| PREDICTED: uncharacterized protein LOC100811541 isoform X2 [Glycine 
max]
Length=424

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 130/214 (61%), Gaps = 23/214 (11%)
 Frame = -1

Query  932  KSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGT  753
            +S W  S  + + E + R+RKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG 
Sbjct  214  RSGWRRS-STGEKEHQGRDRKGWMIMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGA  272

Query  752  WLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEK  573
            WLI+ P+G    SW+PWG+LEAWRERG  D +  +  +  D+    + + ++E  +S +K
Sbjct  273  WLILRPNGASESSWKPWGRLEAWRERGPVDGLGYKVELFSDNGP-ANRIPIAEGTMSVKK  331

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSK  393
            GG+F ID  K ++ A                     +  P   GFVM   V GE G+ SK
Sbjct  332  GGQFCIDY-KVIKDAG------------------LGSRLPGEEGFVMGSTVDGE-GKVSK  371

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             P VQ+  ++VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  372  -PVVQVGAQHVTCMADAALFIALSAAIDLSMDAC  404



>ref|XP_010447867.1| PREDICTED: uncharacterized protein LOC104730404 [Camelina sativa]
Length=474

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 123/199 (62%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  278  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  337

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D +     + ++E  +S ++GG+F ID        
Sbjct  338  PWGRLEAWRERGAIDGLGYKFELVRD-NSTSTGIPIAEGTMSTKQGGKFSID--------  388

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  389  ----------RRVSGQGESPAISSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  435

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  436  DAALFVALSAAVDLSVDAC  454



>ref|NP_194660.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB79689.1| putative protein [Arabidopsis thaliana]
 gb|AAM13213.1| unknown protein [Arabidopsis thaliana]
 gb|AAO30065.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85617.1| uncharacterized protein AT4G29310 [Arabidopsis thaliana]
Length=424

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D +     + ++E  +S ++GG+F ID     R +
Sbjct  288  PWGRLEAWRERGAIDGLGYKFELVRD-NSTSTGIPIAEGTMSTKQGGKFSIDR----RVS  342

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  343  GQ--------------GESPAISSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  385

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  386  DAALFVALSAAVDLSVDAC  404



>ref|XP_007160272.1| hypothetical protein PHAVU_002G307300g [Phaseolus vulgaris]
 gb|ESW32266.1| hypothetical protein PHAVU_002G307300g [Phaseolus vulgaris]
Length=419

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 122/205 (60%), Gaps = 22/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            + D E + +ERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G 
Sbjct  217  TGDRERQGKERKGWMIMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGA  276

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +  +  DS    + + ++E  +S +KGG+F ID  
Sbjct  277  SVSSWKPWGRLEAWRERGPVDGLGYKVELFSDSGP-ANRVPIAEGTVSVKKGGQFCIDYK  335

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
                A                         P   GFVM   V GE G+ SK P VQ+  +
Sbjct  336  VMKDAGLGWRL-------------------PGEEGFVMGSSVDGE-GKVSK-PVVQVGAQ  374

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            ++TC+ DAA+F+AL+AA+DLS++AC
Sbjct  375  HITCMADAALFIALSAAIDLSMDAC  399



>ref|XP_003525292.1| PREDICTED: uncharacterized protein LOC100785838 [Glycine max]
Length=423

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 127/214 (59%), Gaps = 23/214 (11%)
 Frame = -1

Query  932  KSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGT  753
            +S W  S  + + E + R+RKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG 
Sbjct  213  RSGWRRST-TGEKEHQGRDRKGWMIMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGA  271

Query  752  WLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEK  573
            WLI+ P+G    SW+PWG+LEAWRERG  D +  +  +  D+    + + ++E  +S +K
Sbjct  272  WLILRPNGASESSWKPWGRLEAWRERGPVDGLGYKVELFSDNGP-ANRIPIAEGTMSVKK  330

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSK  393
            GG+F ID      A                      +  P   GFVM   V GE G+ SK
Sbjct  331  GGQFCIDYKVMKDAG-------------------LGSRLPGEEGFVMGSTVDGE-GKVSK  370

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             P VQ+  ++VTC+ DAA+F+AL+A+VDLS++AC
Sbjct  371  -PVVQVGAQHVTCMADAALFIALSASVDLSMDAC  403



>ref|XP_010110868.1| hypothetical protein L484_006983 [Morus notabilis]
 gb|EXC28687.1| hypothetical protein L484_006983 [Morus notabilis]
Length=415

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 124/209 (59%), Gaps = 33/209 (16%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S + E   RERKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  216  SGEREKPGRERKGWMVTIHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGF  275

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEH----RDDLLMSEILISAEKGGEFY  558
               SW+PWG+LEAWRERG  D +  +F ++     H      ++ ++E  +S +KGG F 
Sbjct  276  SLSSWKPWGRLEAWRERGPVDGLGYKFELVVADANHCGPTTGNIPIAEATMSMKKGGLFS  335

Query  557  IDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQ  378
            I                            ++  +PV  GFVM   V+GE G+ SK P VQ
Sbjct  336  IVN--------------------------SSTRSPVK-GFVMGSTVEGE-GKVSK-PVVQ  366

Query  377  LAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +  ++VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  367  VGVQHVTCMADAALFVALSAAIDLSMDAC  395



>ref|XP_003530182.1| PREDICTED: uncharacterized protein LOC100790306 [Glycine max]
Length=429

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 126/197 (64%), Gaps = 22/197 (11%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  234  RERKGWMIIIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGACVSSWKPW  293

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ ++    + + ++E  ++ +KGG+F ID  K +R +  
Sbjct  294  GRLEAWRERGPVDGLGYKFELVIENGP-TNGIPIAEATMNVKKGGQFCIDY-KVMRDS--  349

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                          G   + L     GFVM   V+GE G+ SK P VQ+  ++VTC+ DA
Sbjct  350  --------------GLLGSRLQ--GKGFVMGSTVEGE-GKVSK-PVVQVGAQHVTCMADA  391

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AAVDLS++AC
Sbjct  392  ALFIALSAAVDLSMDAC  408



>ref|XP_006412853.1| hypothetical protein EUTSA_v10025288mg [Eutrema salsugineum]
 gb|ESQ54306.1| hypothetical protein EUTSA_v10025288mg [Eutrema salsugineum]
Length=424

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 124/197 (63%), Gaps = 22/197 (11%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+PW
Sbjct  230  RERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPW  289

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D +     + ++E  ++ ++GG+F ID     R +  
Sbjct  290  GRLEAWRERGAIDGLGYKFELVRD-NSTSTGIPIAEGTMNTKQGGKFSIDR----RVSGQ  344

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                          G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ DA
Sbjct  345  --------------GESPARSSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMADA  387

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AAVDLS++AC
Sbjct  388  ALFVALSAAVDLSVDAC  404



>ref|XP_002456333.1| hypothetical protein SORBIDRAFT_03g034120 [Sorghum bicolor]
 gb|EES01453.1| hypothetical protein SORBIDRAFT_03g034120 [Sorghum bicolor]
Length=450

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 131/218 (60%), Gaps = 24/218 (11%)
 Frame = -1

Query  935  LKSFWSSSV---GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARS  765
            L+S+ SS++   G       R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+R+
Sbjct  237  LRSWLSSTLHGEGRDGAHSRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRA  296

Query  764  NPGTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILI  585
            NPG+WLI+   G  P SW+PW +LEAWRERG  D++  R  ++ DS  H   + ++E  I
Sbjct  297  NPGSWLILQATGAGPSSWKPWARLEAWRERGPVDALGYRLELVFDSGPHECAVPIAESSI  356

Query  584  SAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGG  405
            S ++GG+F ID                           A A  P +GGFVM   V+GE G
Sbjct  357  STKRGGQFVIDP-------------------ATFPEAAAGAAWPFAGGFVMGSTVEGE-G  396

Query  404  RCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            R S+ P VQ+  ++VTC+ D A+F+AL+AAVDL ++AC
Sbjct  397  RASR-PTVQVGVQHVTCMGDVAVFVALSAAVDLCMDAC  433



>ref|XP_006283793.1| hypothetical protein CARUB_v10004884mg [Capsella rubella]
 gb|EOA16691.1| hypothetical protein CARUB_v10004884mg [Capsella rubella]
Length=424

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F ++ D+     + + +E  +S + GG+F I  D++V   
Sbjct  288  PWGRLEAWRERGAIDGLGYKFELVRDNSTSTGNPI-AEGTMSTKLGGKFSI--DRRVSG-  343

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  344  ---------------QGESPAISSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  385

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  386  DAALFVALSAAVDLSVDAC  404



>ref|XP_010526420.1| PREDICTED: uncharacterized protein LOC104803996 [Tarenaya hassleriana]
Length=420

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 127/206 (62%), Gaps = 25/206 (12%)
 Frame = -1

Query  908  GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDG  729
            G +  + + +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G
Sbjct  220  GETREKKQAKERKGWMITIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHG  279

Query  728  CRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDT  549
                SW+PWG+LEAWRERG  D +   F ++ D +     + ++E  +S ++GG+F ID+
Sbjct  280  NSVSSWKPWGRLEAWRERGAIDGLGYSFELVRD-NTTTTRIPIAEGTMSVKRGGKFSIDS  338

Query  548  DKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAK  369
             K  R                         +PV  GFVM   V+GE G+ SK P V++  
Sbjct  339  -KLTREIQRS--------------------SPVK-GFVMGSSVEGE-GKVSK-PVVEVGA  374

Query  368  RYVTCVEDAAIFMALAAAVDLSIEAC  291
            ++VTC+ DAA+F+AL+AAVDLS++AC
Sbjct  375  QHVTCMADAALFVALSAAVDLSMDAC  400



>ref|XP_002283391.1| PREDICTED: uncharacterized protein LOC100245695 [Vitis vinifera]
Length=417

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 131/205 (64%), Gaps = 23/205 (11%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S++ E   RERKGW + I+DLSGS VA+A + TPFVPS G   V+RSNPG WLI+ P G 
Sbjct  216  SNERERPGRERKGWMIMIYDLSGSPVASASMITPFVPSPGSDRVSRSNPGAWLILRPHGF  275

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRERG  D +  +F ++ DS      + ++E  ++ ++GG+F ID+ 
Sbjct  276  SVSSWKPWGRLEAWRERGPIDGLGYKFELVTDSGPT-SGIPIAESTMNIKRGGQFCIDS-  333

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKR  366
            + +R +                    ++L P+  GFVM   V+GE G+ SK P VQ+  +
Sbjct  334  RIMRDST------------------LSSLLPLR-GFVMGSTVEGE-GKVSK-PVVQVGVQ  372

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  373  HVTCMADAALFIALSAAIDLSMDAC  397



>emb|CDY48610.1| BnaA01g07550D [Brassica napus]
Length=424

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 123/199 (62%), Gaps = 22/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F  L  ++     + ++E  ++  +GG+F ID     R +
Sbjct  288  PWGRLEAWRERGAVDGLGYKFE-LVTNNSTSTGVPIAEGTMNTRQGGKFIIDR----RVS  342

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VTC+ 
Sbjct  343  GQ--------------GESPARSSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTCMA  385

Query  347  DAAIFMALAAAVDLSIEAC  291
            DAA+F+AL+AAVDLS++AC
Sbjct  386  DAALFVALSAAVDLSVDAC  404



>ref|XP_009597038.1| PREDICTED: uncharacterized protein LOC104093034 [Nicotiana tomentosiformis]
Length=419

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 119/197 (60%), Gaps = 23/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            +ERKGW + I+DLSGSAVAAA + TPFVPS G   V+RSN G WLI+ P+G    SW+PW
Sbjct  226  KERKGWMIIIYDLSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGASVSSWKPW  285

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID   +      
Sbjct  286  GRLEAWRERGPVDGLGYKFELVTDTGLTSAAIPIAEGTMSMKKGGQFCIDNTVK------  339

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D   + N    GFVM   V+GEG   +  P VQ+  ++V C+ DA
Sbjct  340  ---------------DSVLSSNSPIRGFVMVSTVEGEGK--TSVPTVQVGVQHVKCMADA  382

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  383  ALFVALSAAIDLSMDAC  399



>ref|XP_008337614.1| PREDICTED: uncharacterized protein LOC103400735 [Malus domestica]
Length=418

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 121/197 (61%), Gaps = 23/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P G    SW+PW
Sbjct  225  RERKGWMITIHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPW  284

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID+     +   
Sbjct  285  GRLEAWRERGPIDGLGYKFELVTDNGPS-SSITIAEGTMSVKKGGQFCIDSRLNRDSGLK  343

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                               + +PV  GFV    V+G  G+ SK P VQ+  ++VTC  DA
Sbjct  344  -------------------SRSPVK-GFVTGSTVEGX-GKVSK-PVVQVGVQHVTCXADA  381

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  382  ALFVALSAAIDLSMDAC  398



>ref|XP_006356806.1| PREDICTED: uncharacterized protein LOC102599523 [Solanum tuberosum]
Length=448

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 143/217 (66%), Gaps = 14/217 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  221  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ DS      ++++E  +S  KGG
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGSADGLGYRFELIPDSAA--TGIVLAESTLSCSKGG  333

Query  566  EFYID--TDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGG-R  402
            +F ID  T       + P  +  P  SPR SGD+   L P  +  GFVMS  V+GEGG +
Sbjct  334  KFVIDLGTSVSTNGKSTPVNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSANVEGEGGSK  393

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            CSK P V+++ ++V C EDAA F+AL+AA+DLSI+AC
Sbjct  394  CSK-PTVEVSVQHVNCTEDAAAFVALSAAIDLSIDAC  429



>ref|XP_004238051.1| PREDICTED: uncharacterized protein LOC101246921 [Solanum lycopersicum]
Length=448

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 143/217 (66%), Gaps = 14/217 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WL+
Sbjct  221  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLV  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ DS      ++++E  +S  KGG
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGSADGLGYRFELIPDSAAA--GIVLAESTLSCSKGG  333

Query  566  EFYID--TDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGG-R  402
            +F ID  T       + P  +  P  SPR SGD+   L P  +  GFVMS  V+GEGG +
Sbjct  334  KFVIDLGTSVSTNGKSTPVNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSANVEGEGGSK  393

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            CSK P V+++ ++V C EDAA F+AL+AA+DLSI+AC
Sbjct  394  CSK-PTVEVSVQHVNCTEDAAAFVALSAAIDLSIDAC  429



>ref|XP_002301131.1| hypothetical protein POPTR_0002s11320g [Populus trichocarpa]
 gb|EEE80404.1| hypothetical protein POPTR_0002s11320g [Populus trichocarpa]
Length=445

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 141/216 (65%), Gaps = 17/216 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG+WLI
Sbjct  223  WLSSFGS-ERERPLKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLI  281

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D+        ++++E  +S+ K
Sbjct  282  LRPGDG----TWKPWGRLEAWRERGSSDGLGYRFELIPDTKGSMSAASIVLAESTLSSHK  337

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRC  399
            GG+F ID       A        P+ SPR SGDY   L P  +  GFVMS  V GE G+C
Sbjct  338  GGKFVIDL-----GAGSNGRATSPVGSPRGSGDYGHGLWPYCMYRGFVMSASVDGE-GKC  391

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SK P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  392  SK-PGVEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  426



>ref|XP_002285542.1| PREDICTED: uncharacterized protein LOC100245533 [Vitis vinifera]
Length=447

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 141/216 (65%), Gaps = 12/216 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   RERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  220  WLSSFGS-ERERPGRERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  278

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       +++SE  + + K
Sbjct  279  LRPGDG----TWKPWGRLEAWRERGSSDGLGYRFELIPDTNGGMGAAGIVLSESTLGSNK  334

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRC  399
            GG+F ID        A P     P  SPRSSGD+   L P     GFVMS  V+GE G+C
Sbjct  335  GGKFVIDLGGGSNGRATPGSATSPACSPRSSGDFGYGLWPYCSYRGFVMSATVEGE-GKC  393

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SKP  V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  394  SKPS-VEISVQHVNCTEDAAAFVALAAAVDLSMDAC  428



>ref|XP_004251646.1| PREDICTED: uncharacterized protein LOC101262285 [Solanum lycopersicum]
Length=423

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 120/197 (61%), Gaps = 24/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGSAVAAA + TPFVPS G   V+RSN G WLI+ P+G    SW+ W
Sbjct  231  RERKGWMIIIYDLSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGACVSSWKHW  290

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+L+AWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID   +      
Sbjct  291  GRLQAWRERGPVDGLGYKFELVTDTG-LTSTIPIAEGTMSMKKGGQFCIDNTVK------  343

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D A + N    GFVM   V+GEG   +  P VQ+  ++VTC+ DA
Sbjct  344  ---------------DTALSTNSPIRGFVMVSNVEGEGKIST--PMVQVGVQHVTCMADA  386

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  387  ALFIALSAAIDLSMDAC  403



>ref|XP_006353504.1| PREDICTED: uncharacterized protein LOC102579879 [Solanum tuberosum]
Length=423

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 120/197 (61%), Gaps = 24/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGSAVAAA + TPFVPS G   V+RSN G WLI+ P+G    SW+ W
Sbjct  231  RERKGWMIIIYDLSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGACVSSWKHW  290

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+L+AWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID   +      
Sbjct  291  GRLQAWRERGPVDGLGYKFELVTDTG-LTSTIPIAEGTMSMKKGGQFCIDNTVK------  343

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D A + N    GFVM   V+GEG   +  P VQ+  ++VTC+ DA
Sbjct  344  ---------------DTALSTNSPIRGFVMVSNVEGEGKIST--PMVQVGVQHVTCMADA  386

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+AL+AA+DLS++AC
Sbjct  387  ALFIALSAAIDLSMDAC  403



>gb|KDP41556.1| hypothetical protein JCGZ_15963 [Jatropha curcas]
Length=449

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 143/216 (66%), Gaps = 12/216 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VA A + TPFV S G   V+RSNPG+WLI
Sbjct  222  WLSSFGS-ERERPGKERKGWSLTVHDLSGSPVATASMVTPFVASPGSDRVSRSNPGSWLI  280

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  + + K
Sbjct  281  LRPGDG----TWKPWGRLEAWRERGASDGLGYRFELIPDTNGGMSAAGIVLAESTMRSNK  336

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRC  399
            GGEF ID        + P  +  P+ SPRSSGD+   L P  +  GFVMS  V+GE G+C
Sbjct  337  GGEFIIDLGANSNGRSTPVNSMSPVCSPRSSGDFGYGLWPFCMYRGFVMSASVEGE-GKC  395

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SKP  VQ++ ++V C EDAA F+ALAAA+DLS++AC
Sbjct  396  SKPS-VQVSVQHVNCTEDAAAFVALAAAIDLSMDAC  430



>ref|XP_010061596.1| PREDICTED: uncharacterized protein LOC104449221 [Eucalyptus grandis]
 gb|KCW68587.1| hypothetical protein EUGRSUZ_F02199 [Eucalyptus grandis]
Length=464

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 142/215 (66%), Gaps = 11/215 (5%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   RERKGW +T+HDLSGS VA A + TPFV S G   V+RSNPG+WLI
Sbjct  236  WLSSFGS-EREKPGRERKGWSITVHDLSGSPVATASMVTPFVASPGSDRVSRSNPGSWLI  294

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  DS+ CRF ++ DS      +++SE  +S++ GG
Sbjct  295  LRPGDG----TWKPWGRLEAWRERGGSDSLGCRFEIIPDSAGAGAGVVVSESTLSSKSGG  350

Query  566  EFYIDTDKQ-VRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCS  396
             F ID         A P     P  SPRSSGD+   L P  +  GFVM+  V+GE G+CS
Sbjct  351  RFQIDLGSNGGNGRATPGSAGSPACSPRSSGDFGHGLWPYCMYRGFVMAAGVEGE-GKCS  409

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            K P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  410  K-PTVEVSVQHVGCTEDAAAFVALAAAVDLSMDAC  443



>ref|XP_009406176.1| PREDICTED: uncharacterized protein LOC103989135 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 126/222 (57%), Gaps = 34/222 (15%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S+G+   +  R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+RS+PG WLI
Sbjct  233  WFGSLGAKKNQRRREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSDPGAWLI  292

Query  743  VH-----------PDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMS  597
            +                   +W+PWG+LEAWRERG  D++ CRF ++ D+      + ++
Sbjct  293  LRAIVPPSSSSSSSSSSSSTNWKPWGRLEAWRERGAVDALGCRFELVPDTGPI-GGVPIA  351

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQ  417
            E  +S  KGG F ID                        GD  A   P  GGFVM   V+
Sbjct  352  ESSLSVRKGGHFCIDPS--------------------VIGDVVAGPWPFLGGFVMGSTVE  391

Query  416  GEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            GE G+ SK P VQ+  ++V+C+ D A+F+AL+AA+DLS++AC
Sbjct  392  GE-GKASK-PSVQVGVQHVSCMADVALFIALSAAIDLSMDAC  431



>emb|CAN62368.1| hypothetical protein VITISV_001847 [Vitis vinifera]
Length=457

 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 141/216 (65%), Gaps = 12/216 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   RERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  220  WLSSFGS-ERERPGRERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  278

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       +++SE  + + K
Sbjct  279  LRPGDG----TWKPWGRLEAWRERGSSDGLGYRFELIPDTNGGMGAAGIVLSESTLGSNK  334

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRC  399
            GG+F ID        A P     P  SPRSSGD+   L P     GFVMS  V+GE G+C
Sbjct  335  GGKFVIDLGGGSNGRATPGSATSPACSPRSSGDFGYGLWPYCSYRGFVMSATVEGE-GKC  393

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SKP  V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  394  SKPS-VEISVQHVNCTEDAAAFVALAAAVDLSMDAC  428



>ref|XP_009757179.1| PREDICTED: uncharacterized protein LOC104210073 [Nicotiana sylvestris]
Length=419

 Score =   154 bits (389),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 23/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW + I+DLSGSAVAAA + TPFVPS G   V+RSN G WLI+ P+G    SW+PW
Sbjct  226  RERKGWMIIIYDLSGSAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGASVSSWKPW  285

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D+      + ++E  +S +KGG+F ID   +      
Sbjct  286  GRLEAWRERGPVDGLGYKFELVTDTGLTSAAIPIAEGTMSMKKGGQFCIDNTVK------  339

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D   + N    GFVM   V+GEG   +  P +Q+  ++V  + DA
Sbjct  340  ---------------DSVLSSNSPIRGFVMVSTVEGEGK--TSVPTIQVGVQHVKSMADA  382

Query  341  AIFMALAAAVDLSIEAC  291
            A+F++L+AA+DLS++AC
Sbjct  383  ALFISLSAAIDLSMDAC  399



>ref|XP_004136235.1| PREDICTED: uncharacterized protein LOC101220969 [Cucumis sativus]
 ref|XP_004168124.1| PREDICTED: uncharacterized protein LOC101227231 [Cucumis sativus]
 gb|KGN60303.1| hypothetical protein Csa_3G894510 [Cucumis sativus]
Length=444

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 138/215 (64%), Gaps = 10/215 (5%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  217  WLSSFGS-ERERPGKERKGWSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  275

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEKG  570
            + P     ++W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  ++  KG
Sbjct  276  LRPGD---DTWKPWGRLEAWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESALNINKG  332

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCS  396
            G+F ID        + P     P  SPRSSGDY   L P  V  GFVM   V+GE G+CS
Sbjct  333  GKFLIDLGGSSNGRSTPVNPMSPACSPRSSGDYGYGLWPYCVYRGFVMGASVEGE-GKCS  391

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            K P V++  ++V C ED A F+ALAAA+DLSI+AC
Sbjct  392  K-PRVEVGVQHVNCTEDVAAFVALAAAIDLSIDAC  425



>ref|XP_002510019.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52206.1| conserved hypothetical protein [Ricinus communis]
Length=441

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 141/214 (66%), Gaps = 15/214 (7%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W S+ GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  221  WLSTFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++     ++++E  +S +KGG
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGASDGLGYRFELIPDTNAA--GIVLAESTLSLKKGG  333

Query  566  EFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSK  393
             F ID        ++      P+ SPR SGD+   L P  V  GFVMS  V+GE G+CSK
Sbjct  334  NFVIDLGVNSNGRSN---AASPVCSPRGSGDFGYGLWPYCVYRGFVMSASVEGE-GKCSK  389

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  VQ++ ++V C EDAA F+ALAA VDLS++AC
Sbjct  390  PS-VQVSVQHVNCTEDAAAFVALAATVDLSMDAC  422



>ref|XP_009410899.1| PREDICTED: uncharacterized protein LOC103992782 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 122/211 (58%), Gaps = 27/211 (13%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S+G       R +RKGW VTIHDLSGS VAAA I TPFV S G   V+RSNPG WLI
Sbjct  254  WFGSLGGERDHESREQRKGWTVTIHDLSGSPVAAASIVTPFVASPGSDRVSRSNPGAWLI  313

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            +   G     W+PWG+LEAWRE+G  D++  RF ++ D+  +R    + E  +S  KGG 
Sbjct  314  LRAVGPSATDWKPWGRLEAWREKGPVDALGYRFELMTDAGPNR-GFPIVESSLSMRKGGR  372

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPF  384
            F ID     ++                         P +GGFVM+  V+G+ G+ SK P 
Sbjct  373  FCIDPGVVEKS------------------------GPFAGGFVMAATVEGQ-GKVSK-PT  406

Query  383  VQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            VQ+  ++V+C+ D A+F+AL+AA+DLS +AC
Sbjct  407  VQVGVQHVSCMADVALFIALSAAIDLSGDAC  437



>ref|XP_011017042.1| PREDICTED: uncharacterized protein LOC105120505 [Populus euphratica]
Length=445

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 140/216 (65%), Gaps = 17/216 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFVPS G   V+RSNPG+WLI
Sbjct  223  WLSSFGS-ERERPLKERKGWSITVHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLI  281

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D+        ++++E  +S+ K
Sbjct  282  LRPGDG----TWKPWGRLEAWRERGSSDGLGYRFELIPDTKGSMSAASIVLAESTLSSHK  337

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRC  399
            GG+F ID                P+ SPR SGDY   L P  +  GFVMS  V GE G+C
Sbjct  338  GGKFVIDL-----GGGSNGRATSPVGSPRGSGDYGHGLWPYCMYRGFVMSASVDGE-GKC  391

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SK P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  392  SK-PGVEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  426



>emb|CDP00983.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 141/227 (62%), Gaps = 22/227 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  227  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  285

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ DS      ++++E  +S+ KGG
Sbjct  286  LRPGDG----TWKPWGRLEAWRERGSADGLGYRFELIPDSAAA-AGIVLAESTLSSSKGG  340

Query  566  EFYIDTDKQVRAAAHppptppplp---------sprsSGDYAAALNP--VSGGFVMSCRV  420
            +F ID      A                     SPRSSGD+   L P  V  GFVMS RV
Sbjct  341  KFVIDLGSGSPAGGAGGTANGRATPGSVASPACSPRSSGDFGYGLWPYCVYRGFVMSARV  400

Query  419  QGEG----GRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             GEG     +C++PP V+++ ++V C EDAA ++AL+AAVDLS++AC
Sbjct  401  AGEGDGRKSKCNRPPTVEVSVQHVNCTEDAAAYVALSAAVDLSMDAC  447



>ref|XP_006646307.1| PREDICTED: uncharacterized protein LOC102706623 [Oryza brachyantha]
Length=356

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 131/216 (61%), Gaps = 22/216 (10%)
 Frame = -1

Query  935  LKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPS-TGCAWVARSNP  759
            L+S+ S+  G  D +  R +RKGW VTIHDLSGS VAAA + TPFVPS  G   V+R+NP
Sbjct  145  LRSWLSTLHGDRDAQARREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPAGSGRVSRANP  204

Query  758  GTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISA  579
            G+WLI+ P G  P SW+PW +LEAWRERG  D++  R  ++ DS      + ++E  IS 
Sbjct  205  GSWLILQPTGAGPASWKPWARLEAWRERGPVDALGYRLELVFDSGPTECAVPIAESSIST  264

Query  578  EKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRC  399
            ++GG+F ID       A                   A A  P SGGFVM   V+GE GR 
Sbjct  265  KRGGQFVIDPATFPVGA-------------------AGAPWPFSGGFVMGSTVEGE-GRT  304

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S+ P +Q+  ++ TC+ D A+F+ALAAAVDL ++AC
Sbjct  305  SR-PTLQVGVQHATCMGDVALFVALAAAVDLCMDAC  339



>ref|XP_009335470.1| PREDICTED: uncharacterized protein LOC103928190 [Pyrus x bretschneideri]
Length=444

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 140/213 (66%), Gaps = 13/213 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   RERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  224  WLSSFGS-ERERHGRERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  282

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D +  RF ++ D+      ++++E  +S  KGG+
Sbjct  283  LRPGD---NTWKPWGRLEAWRERGGADGLGYRFELIPDTSGA--GVVLAESTLSLNKGGK  337

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKP  390
            F +D       +++      P  SPR SGD+   L P  +  GFVMS +VQGE GRCSKP
Sbjct  338  FVLDLGS---GSSNRAGPNSPGCSPRGSGDFGYGLWPFCMYRGFVMSAKVQGE-GRCSKP  393

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  394  A-VEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  425



>gb|KHN16657.1| hypothetical protein glysoja_002754 [Glycine soja]
Length=189

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 116/190 (61%), Gaps = 22/190 (12%)
 Frame = -1

Query  860  VTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWR  681
            + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PWG+LEAWR
Sbjct  2    IMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAWR  61

Query  680  ERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppp  501
            ERG  D +  +  +  D+    + + ++E  +S +KGG+F ID  K ++ A         
Sbjct  62   ERGPVDGLGYKVELFSDNGP-ANRIPIAEGTMSVKKGGQFCIDY-KVIKDAG--------  111

Query  500  lpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALA  321
                        +  P   GFVM   V GE G+ SK P VQ+  ++VTC+ DAA+F+AL+
Sbjct  112  ----------LGSRLPGEEGFVMGSTVDGE-GKVSK-PVVQVGAQHVTCMADAALFIALS  159

Query  320  AAVDLSIEAC  291
            AA+DLS++AC
Sbjct  160  AAIDLSMDAC  169



>gb|KHM99820.1| hypothetical protein glysoja_017518 [Glycine soja]
Length=189

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 116/190 (61%), Gaps = 22/190 (12%)
 Frame = -1

Query  860  VTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWR  681
            + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PWG+LEAWR
Sbjct  2    IMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAWR  61

Query  680  ERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppp  501
            ERG  D +  +  +  D+    + + ++E  +S +KGG+F ID  K ++ A         
Sbjct  62   ERGPVDGLGYKVELFSDNGPA-NRIPIAEGTMSVKKGGQFCIDY-KVIKDAG--------  111

Query  500  lpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALA  321
                        +  P   GFVM   V GE G+ SK P VQ+  ++VTC+ DAA+F+AL+
Sbjct  112  ----------LGSRLPGEEGFVMGSTVDGE-GKVSK-PVVQVGAQHVTCMADAALFIALS  159

Query  320  AAVDLSIEAC  291
            A+VDLS++AC
Sbjct  160  ASVDLSMDAC  169



>ref|XP_009128862.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103853708 
[Brassica rapa]
Length=429

 Score =   152 bits (383),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 121/204 (59%), Gaps = 27/204 (13%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
            + RERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P G    SW+
Sbjct  228  QARERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWK  287

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PWG+LEAWRERG  D +  +F  L  ++     + ++E  +S  +GG+F ID        
Sbjct  288  PWGRLEAWRERGAVDGLGYKFE-LVTNNSTSTGVPIAEGTMSTRQGGKFIID--------  338

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVT---  357
                            G+  A  +PV  GFVM   V+GE G+ SK P V +  ++VT   
Sbjct  339  ----------RRVSGQGESPARSSPVK-GFVMGSSVEGE-GKVSK-PVVHVGAQHVTAQH  385

Query  356  --CVEDAAIFMALAAAVDLSIEAC  291
              C+ DAA+F+AL+AAVDLS++AC
Sbjct  386  VICMADAALFVALSAAVDLSVDAC  409



>ref|XP_008466095.1| PREDICTED: uncharacterized protein LOC103503621 [Cucumis melo]
 ref|XP_008466096.1| PREDICTED: uncharacterized protein LOC103503621 [Cucumis melo]
Length=444

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 137/215 (64%), Gaps = 10/215 (5%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  217  WLSSFGS-ERERPGKERKGWSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  275

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEKG  570
            + P     ++W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  ++  KG
Sbjct  276  LRPGD---DTWKPWGRLEAWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESALNINKG  332

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCS  396
            G+F ID        + P     P  SPRSSGDY     P  V  GFVM   V+GE G+CS
Sbjct  333  GKFLIDLGGSSNGRSTPVNPMSPACSPRSSGDYGYGPWPYCVYRGFVMGASVEGE-GKCS  391

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            K P V++  ++V C ED A F+ALAAA+DLSI+AC
Sbjct  392  K-PRVEVGVQHVNCTEDVAAFVALAAAIDLSIDAC  425



>ref|XP_010245617.1| PREDICTED: uncharacterized protein LOC104589117 [Nelumbo nucifera]
Length=442

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 137/209 (66%), Gaps = 13/209 (6%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGC  726
            S+ E   RERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P DG 
Sbjct  223  SERERPGRERKGWSVTVHDLSGSPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPGDG-  281

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSH--EHRDDLLMSEILISAEKGGEFYID  552
               +W+PWG+LEAWRERG  D +  RF V+ D++     D ++++E  +   KGG+F ID
Sbjct  282  ---TWKPWGRLEAWRERGSNDGLGYRFEVMSDTNGGMSADGIVLAESTLGTGKGGKFVID  338

Query  551  TDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKPPFVQ  378
                 R+      +  P  SP+SSGD+   L P  +  GFVMS  V+GE G+CSK P V+
Sbjct  339  MSGSGRSTP--ASSNSPACSPKSSGDFGYGLWPYCMYRGFVMSSTVEGE-GKCSK-PTVE  394

Query  377  LAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            ++ ++V C EDAA F+ALAAA+DLS++AC
Sbjct  395  VSVQHVNCTEDAAAFVALAAAMDLSMDAC  423



>ref|XP_002306517.2| hypothetical protein POPTR_0005s19380g [Populus trichocarpa]
 gb|EEE93513.2| hypothetical protein POPTR_0005s19380g [Populus trichocarpa]
Length=448

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 137/207 (66%), Gaps = 11/207 (5%)
 Frame = -1

Query  893  EIER--RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRP  720
            EIER  +ERKGW +T+HDLSGS VAAA + TPFVPS G   V+RSNPG+WLI+ P     
Sbjct  228  EIERPLKERKGWSITVHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPGA---  284

Query  719  ESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEKGGEFYIDTD  546
             +W+PWG+LE+WRERG  D +  RF ++ D++       ++++E  +S+ KGG+F ID  
Sbjct  285  GTWKPWGRLESWRERGSSDGLGYRFELIPDTNGTMSAASIVLAESTLSSHKGGKFVIDLG  344

Query  545  KQVRAAAHppptppplpsprsSGDYAAAL--NPVSGGFVMSCRVQGEGGRCSKPPFVQLA  372
                    P  +  P+ SPR  GD+   L  N +  GFVMS  V+GE G+CSK P V++ 
Sbjct  345  ACSNGRTTPANSASPVCSPRGGGDHGYGLWPNCMHRGFVMSASVEGE-GKCSK-PGVEVG  402

Query  371  KRYVTCVEDAAIFMALAAAVDLSIEAC  291
             ++V C EDAA F+ALAAAVDLS++AC
Sbjct  403  VQHVNCTEDAAAFVALAAAVDLSMDAC  429



>ref|XP_003516376.1| PREDICTED: uncharacterized protein LOC100805866 [Glycine max]
Length=428

 Score =   151 bits (382),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 122/198 (62%), Gaps = 24/198 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQP  705
            RERKGW + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+   +G    SW+P
Sbjct  233  RERKGWMIMIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRTNNGASVSSWKP  292

Query  704  WGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAA  525
            WG+LEAWRERG  D +  +F ++ ++    + + ++E  ++ +KGG+F ID  K +R   
Sbjct  293  WGRLEAWRERGPVDGLGYKFELVTENGPA-NGIPIAEATMNVKKGGQFCIDY-KVMR---  347

Query  524  HppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVED  345
                            D          GFVM   V+GE G+ SK P VQ+  ++VTC+ D
Sbjct  348  ----------------DSGLGSRLKGKGFVMGSTVEGE-GKVSK-PVVQVGAQHVTCMAD  389

Query  344  AAIFMALAAAVDLSIEAC  291
            AA+F+AL+AA+DLS++AC
Sbjct  390  AALFIALSAAIDLSMDAC  407



>ref|NP_001143291.1| hypothetical protein [Zea mays]
 gb|ACG30371.1| hypothetical protein [Zea mays]
 tpg|DAA57717.1| TPA: hypothetical protein ZEAMMB73_937139 [Zea mays]
Length=447

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 21/199 (11%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQ  708
             R +RKGW VTIHDLSGS VAAA + TPFVPS G   V+R+NPG WLI+   G  P SW+
Sbjct  253  RREQRKGWTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLILQATGAGPSSWK  312

Query  707  PWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAA  528
            PW +LEAWRERG  D++  R  ++ DS  H   + ++E  IS ++GG+F ID      AA
Sbjct  313  PWARLEAWRERGPVDALGYRLELVFDSGAHECAVPIAESSISTKRGGQFVIDPATFPEAA  372

Query  527  AHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVE  348
            A                            FVM   V+GE  R +  P VQ+  ++V C+ 
Sbjct  373  AGAAWPLAGG-------------------FVMGSTVEGE--RRASRPTVQVGVQHVACMG  411

Query  347  DAAIFMALAAAVDLSIEAC  291
            D A+F+AL+AAVDL ++AC
Sbjct  412  DVAVFVALSAAVDLCMDAC  430



>gb|KHN40365.1| hypothetical protein glysoja_000863 [Glycine soja]
Length=190

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 120/190 (63%), Gaps = 22/190 (12%)
 Frame = -1

Query  860  VTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWR  681
            + IHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PWG+LEAWR
Sbjct  2    IIIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGACVSSWKPWGRLEAWR  61

Query  680  ERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppp  501
            ERG  D +  +F ++ ++    + + ++E  ++ +KGG+F ID  K +R +         
Sbjct  62   ERGPVDGLGYKFELVIENGP-TNGIPIAEATMNVKKGGQFCIDY-KVMRDS---------  110

Query  500  lpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALA  321
                   G   + L     GFVM   V+GE G+ SK P VQ+  ++VTC+ DAA+F+AL+
Sbjct  111  -------GLLGSRLQ--GKGFVMGSTVEGE-GKVSK-PVVQVGAQHVTCMADAALFIALS  159

Query  320  AAVDLSIEAC  291
            AAVDLS++AC
Sbjct  160  AAVDLSMDAC  169



>ref|XP_008352747.1| PREDICTED: uncharacterized protein LOC103416271 [Malus domestica]
Length=444

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 140/213 (66%), Gaps = 13/213 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  224  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  282

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D +  RF ++ D+      ++++E  IS  KGG+
Sbjct  283  LRPGD---NTWKPWGRLEAWRERGGADGLGYRFELIPDTSGA--GIVLAESTISLNKGGK  337

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKP  390
            F +D       +++      P  SPR SGD+   L P  +  GFVMS +V+GE GRCSK 
Sbjct  338  FVLDLGS---GSSNRLGPISPGCSPRGSGDFGYGLWPYCMXRGFVMSAKVEGE-GRCSK-  392

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  393  PAVEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  425



>ref|NP_001044201.1| Os01g0740400 [Oryza sativa Japonica Group]
 dbj|BAD86950.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06115.1| Os01g0740400 [Oryza sativa Japonica Group]
Length=302

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 128/216 (59%), Gaps = 22/216 (10%)
 Frame = -1

Query  935  LKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPS-TGCAWVARSNP  759
            L+S+ S+  G  D +  R +RKGW VTIHDLSGS VA A + TPFVPS  G   V+R+NP
Sbjct  91   LRSWLSTLHGDRDAQARREQRKGWTVTIHDLSGSPVAMASMVTPFVPSPAGSGRVSRANP  150

Query  758  GTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISA  579
            G WLI+ P G  P SW+PW +LEAWRERG  D++  R  ++ DS      + ++E  IS 
Sbjct  151  GAWLILQPTGAGPASWKPWARLEAWRERGPVDALGYRLELVFDSGPTECAVPIAESSIST  210

Query  578  EKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRC  399
            ++GG+F ID       A                   A A  P +GGFVM    +GE GR 
Sbjct  211  KRGGQFVIDPATFPVGA-------------------AGAAWPFAGGFVMGSTAEGE-GRA  250

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S+P  VQ+  ++ TC+ D A+F+ALAAAVDL ++AC
Sbjct  251  SRPT-VQVGVQHATCMGDVALFVALAAAVDLCMDAC  285



>ref|XP_009759768.1| PREDICTED: uncharacterized protein LOC104212246 [Nicotiana sylvestris]
Length=444

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 139/216 (64%), Gaps = 16/216 (7%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  221  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  DS+  RF ++ DS      ++++E  +S  KGG
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGSADSLGYRFELIPDSAAA--GIVLAESTLSCRKGG  333

Query  566  EFYIDTDKQVRAAAHppptppplp--sprsSGDYAAALNP--VSGGFVMSCRVQGEGGRC  399
            +F ID    V       P     P  SPR SGD+   L P  +  GFVMS  V+GE   C
Sbjct  334  KFVIDLGTSVSTNGKLTPGNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSASVEGE---C  390

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SKP  V+++ ++V C EDAA ++AL+AA+DLSI+AC
Sbjct  391  SKPT-VEVSVQHVNCTEDAAAYVALSAAIDLSIDAC  425



>ref|XP_009357220.1| PREDICTED: uncharacterized protein LOC103947956 [Pyrus x bretschneideri]
Length=444

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 140/213 (66%), Gaps = 13/213 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RS+PG+WLI
Sbjct  224  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSHPGSWLI  282

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D +  RF ++ D+      ++++E  IS  KGG+
Sbjct  283  LRPGD---NTWKPWGRLEAWRERGGADGLGYRFELIPDTSGA--GIVLAESTISLNKGGK  337

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVS--GGFVMSCRVQGEGGRCSKP  390
            F +D       +++      P  SPR SGD+   L P S   GFVMS +V+GE GRCSK 
Sbjct  338  FVLDLGS---GSSNRLGPNSPGCSPRGSGDFGYGLWPYSMYRGFVMSAKVEGE-GRCSK-  392

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  393  PAVEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  425



>ref|XP_008339055.1| PREDICTED: uncharacterized protein LOC103402092 [Malus domestica]
Length=444

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 139/213 (65%), Gaps = 13/213 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  224  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  282

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D    RF ++ D+      ++++E  IS  KGG+
Sbjct  283  LRPGD---NTWKPWGRLEAWRERGGADGXGYRFELIPDTSGA--GIVLAESTISLNKGGK  337

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKP  390
            F +D       +++      P  SPR SGD+   L P  +  GFVMS +V+GE GRCSK 
Sbjct  338  FVLDLGS---GSSNRLGPISPGCSPRGSGDFGYGLWPYCMXRGFVMSAKVEGE-GRCSK-  392

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  393  PAVEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  425



>ref|XP_004503501.1| PREDICTED: uncharacterized protein LOC101489321 [Cicer arietinum]
Length=423

 Score =   149 bits (375),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 127/215 (59%), Gaps = 29/215 (13%)
 Frame = -1

Query  929  SFWSSSV-GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGT  753
            S W  S+ G  +  ++  ERKGW + IHDLSGS VAAA + TPFVPS G   V+RSN G 
Sbjct  215  SRWRKSLRGDREQSVQGNERKGWMIVIHDLSGSPVAAASMITPFVPSPGSNRVSRSNAGA  274

Query  752  WLIVHPDGCRP-ESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAE  576
            WLI+ P+G     SW+PWG+LEAWRERG  D +  +  +  D+    + + ++E  +S +
Sbjct  275  WLILRPNGASTVSSWKPWGRLEAWRERGSIDGLGYKVELFSDNGP-VNAITIAEGTMSVK  333

Query  575  KGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCS  396
            KGG+F ID+                L S    G+          GFVM   V GE G+ S
Sbjct  334  KGGKFCIDS--------------AILGSKWLPGE----------GFVMGSTVSGE-GKVS  368

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            K P VQ+  R+VTC+ DAA+F+AL+AA+DLS++AC
Sbjct  369  K-PVVQVGARHVTCMPDAALFIALSAAIDLSMDAC  402



>ref|XP_004299850.1| PREDICTED: uncharacterized protein LOC101308766 [Fragaria vesca 
subsp. vesca]
Length=453

 Score =   149 bits (376),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 141/217 (65%), Gaps = 13/217 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   RERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG WLI
Sbjct  225  WLSSFGS-ERERPGRERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLI  283

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +WQPWG+LEAWRERG  D +  RF ++ D++       ++++E  +S  K
Sbjct  284  LRPGDG----TWQPWGRLEAWRERGGADGLGYRFELIPDTNGGMSAGGIVLAESTLSLNK  339

Query  572  GGEFYIDTDKQVRAAAHppptppplp-sprsSGDYAAALNP--VSGGFVMSCRVQGEGGR  402
            GG+F +D      +    P  P     SP+SSGD+   L P  +  GFVMS RV+GE  R
Sbjct  340  GGKFVLDLGSNSGSGNKAPVVPNSPACSPKSSGDFGYGLWPYCLYRGFVMSARVEGE-RR  398

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            CSK P V+++ ++VTC EDAA ++ALAAAVDL ++AC
Sbjct  399  CSK-PTVEVSVQHVTCTEDAAAYVALAAAVDLCMDAC  434



>ref|XP_009595727.1| PREDICTED: uncharacterized protein LOC104091979 [Nicotiana tomentosiformis]
Length=444

 Score =   149 bits (376),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 138/216 (64%), Gaps = 16/216 (7%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  221  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  DS+  RF ++ DS      ++++E  +S  K G
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGSADSLGYRFELIPDSAA--TGIVLAESTLSCSKAG  333

Query  566  EFYIDTDKQVRAAAHppptppplp--sprsSGDYAAALNP--VSGGFVMSCRVQGEGGRC  399
            +F ID    V       P     P  SPR SGD+   L P  +  GFVMS  V+GE   C
Sbjct  334  KFVIDLGTSVSTNGKLTPGNSTSPACSPRGSGDFGYGLWPYCMYRGFVMSASVEGE---C  390

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SK P V+++ ++V C EDAA ++AL+AAVDLSI+AC
Sbjct  391  SK-PTVEVSVQHVNCTEDAAAYVALSAAVDLSIDAC  425



>ref|XP_007018388.1| Formin-like protein 18 [Theobroma cacao]
 gb|EOY15613.1| Formin-like protein 18 [Theobroma cacao]
Length=445

 Score =   149 bits (376),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 141/215 (66%), Gaps = 13/215 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  221  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PW +LEAWRERG  D +  RF ++ D       ++++E  +S+ KGG
Sbjct  280  LRPGDG----TWKPWARLEAWRERGSSDGLGYRFELIPDMSAA--AIVLAESTLSSGKGG  333

Query  566  EFYIDT-DKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCS  396
            +F ID         A P     P  SPRSSGD+   L P  V  GFVMS RV+GE G+CS
Sbjct  334  KFVIDLGGGGTNGRATPGSATSPACSPRSSGDFGYGLWPFCVYRGFVMSARVEGE-GKCS  392

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            K P V+++ ++V C EDAA F+ALAAAVDLS++AC
Sbjct  393  K-PCVEVSVQHVNCTEDAAAFVALAAAVDLSMDAC  426



>gb|EAY75765.1| hypothetical protein OsI_03678 [Oryza sativa Indica Group]
Length=446

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 128/216 (59%), Gaps = 22/216 (10%)
 Frame = -1

Query  935  LKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPS-TGCAWVARSNP  759
            L+S+ S+  G  D +  R +RKGW VTIHDLSGS VA A + TPFVPS  G   V+R+NP
Sbjct  235  LRSWLSTLHGDRDAQARREQRKGWTVTIHDLSGSPVAMASMVTPFVPSPAGSGRVSRANP  294

Query  758  GTWLIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISA  579
            G WLI+ P G  P SW+PW +LEAWRERG  D++  R  ++ DS      + ++E  IS 
Sbjct  295  GAWLILQPTGAGPASWKPWARLEAWRERGPVDALGYRLELVFDSGPTECAVPIAESSIST  354

Query  578  EKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRC  399
            ++GG+F ID       A                   A A  P +GGFVM    +GE GR 
Sbjct  355  KRGGQFVIDPATFPVGA-------------------AGAAWPFAGGFVMGSTAEGE-GRA  394

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S+ P VQ+  ++ TC+ D A+F+ALAAAVDL ++AC
Sbjct  395  SR-PTVQVGVQHATCMGDVALFVALAAAVDLCMDAC  429



>ref|XP_004501082.1| PREDICTED: uncharacterized protein LOC101496773 [Cicer arietinum]
Length=453

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 140/221 (63%), Gaps = 17/221 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+ SNPG+WLI
Sbjct  221  WLSSFGS-ERERSGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  +S  K
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGGSDGLGYRFELMPDTNGGMSAGGMVITESTLSLNK  335

Query  572  GGEFYIDTDKQV-----RAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQG  414
            GG+F ID   +         A P     P  SPR SGDY   L P  V  GFVMS  V+G
Sbjct  336  GGKFVIDLSSRCGGGGSNGRATPGNASSPACSPRGSGDYGYGLWPYCVYRGFVMSASVEG  395

Query  413  EGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            E GRCSK P V+++  +V C EDAA F+ALAAAVDLS++AC
Sbjct  396  E-GRCSK-PTVEVSVPHVNCTEDAAAFVALAAAVDLSVDAC  434



>gb|EYU36412.1| hypothetical protein MIMGU_mgv1a006276mg [Erythranthe guttata]
Length=450

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 137/216 (63%), Gaps = 11/216 (5%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +TIHDLSGS VA A + TPFVP  G   V+RSNPG WLI
Sbjct  223  WLSSFGS-ERERPGKERKGWSITIHDLSGSPVAVASMVTPFVPLPGSDKVSRSNPGCWLI  281

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ DS      ++++E  +S  KGG
Sbjct  282  LRPGDG----TWKPWGRLEAWRERGASDGLGYRFELILDSAAA-AGIVLAESALSCSKGG  336

Query  566  EFYIDTDKQVRAAAHppptppplp--sprsSGDYAAALNPVSG--GFVMSCRVQGEGGRC  399
            +F ID +      +  P +    P  SPR SGD+   L P S   GFVMS  V+G G   
Sbjct  337  KFVIDLNGGGGTPSGTPRSGGASPGCSPRGSGDFGNGLWPYSAYRGFVMSACVEGNGRGK  396

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +  P V+++ ++VTC EDAA F+AL+AA+DLS++AC
Sbjct  397  TVGPVVEVSVQHVTCTEDAAAFVALSAALDLSMDAC  432



>ref|XP_011078236.1| PREDICTED: uncharacterized protein LOC105162032 [Sesamum indicum]
Length=415

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 125/197 (63%), Gaps = 24/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW V I+DLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  223  RERKGWMVVIYDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILSPNGVSISSWKPW  282

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++  +      + ++E  +S +KGG+F ID  ++      
Sbjct  283  GRLEAWRERGPVDGLGYKFELITHAG-LTSGIPIAEGTMSVKKGGKFCIDNSRK------  335

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D A +L   S GFVM   V+GE G+CSK P VQ+  ++VTC+ DA
Sbjct  336  ---------------DSALSLVLPSRGFVMGSSVEGE-GKCSK-PVVQVGVQHVTCMADA  378

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+ALAAA+DLS++AC
Sbjct  379  ALFVALAAAIDLSMDAC  395



>ref|XP_008219142.1| PREDICTED: uncharacterized protein LOC103319390 [Prunus mume]
Length=447

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 13/213 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  227  WLGSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  285

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D +  RF ++ D+      ++++E  +S  KGG+
Sbjct  286  LRPGD---NTWKPWGRLEAWRERGGSDGLGYRFELIPDTSGA--GIVLAESTLSLNKGGK  340

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKP  390
            F +D       +   P    P  SPR SGD+   L P  +  GFVMS +V+GE GRCSKP
Sbjct  341  FVLDLGS---GSGTRPVPNSPGCSPRGSGDFGYGLWPYCLYRGFVMSAKVEGE-GRCSKP  396

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              V+++ ++V C EDAA ++ALAAAVDLS++AC
Sbjct  397  A-VEVSVQHVNCTEDAAAYVALAAAVDLSMDAC  428



>ref|XP_007222135.1| hypothetical protein PRUPE_ppa005719mg [Prunus persica]
 gb|EMJ23334.1| hypothetical protein PRUPE_ppa005719mg [Prunus persica]
Length=447

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 138/213 (65%), Gaps = 13/213 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  227  WLGSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  285

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D +  RF ++ D+      ++++E  +S  KGG+
Sbjct  286  LRPGD---NTWKPWGRLEAWRERGGSDGLGYRFELIPDTSGA--GIVLAESTLSLNKGGK  340

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKP  390
            F +D       +   P    P  SPR SGD+   L P  +  GFVMS +V+GE GRCSKP
Sbjct  341  FVLDLGS---GSGTRPVPNSPGCSPRGSGDFGYGLWPYCLYRGFVMSAKVEGE-GRCSKP  396

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              V+++ ++V C EDAA ++ALAAAVDLS++AC
Sbjct  397  A-VEVSVQHVNCTEDAAAYVALAAAVDLSMDAC  428



>ref|XP_003573437.1| PREDICTED: uncharacterized protein LOC100828811 [Brachypodium 
distachyon]
 ref|XP_010234360.1| PREDICTED: uncharacterized protein LOC100828811 [Brachypodium 
distachyon]
 ref|XP_010234361.1| PREDICTED: uncharacterized protein LOC100828811 [Brachypodium 
distachyon]
Length=454

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 126/207 (61%), Gaps = 23/207 (11%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC-RPESWQP  705
            RERKGWKV +HDLSG+AVAAAF+ TPFVP+TG   VARSNPG WLIV  D     +SWQP
Sbjct  225  RERKGWKVAVHDLSGTAVAAAFMATPFVPATGRDTVARSNPGAWLIVRADTTGSSDSWQP  284

Query  704  WGKLEAWRE-------RGIRDSICCRFHVLCDSHEHRDD--LLMSEILISAEKGGEFYID  552
            WG+LEAWRE       +G   +  C   +     + R+D  +L+SE  +S EKGGEF ID
Sbjct  285  WGRLEAWREDPPAPGTKGKDSAAACLLRLRLLPEQQREDACVLVSETPLSCEKGGEFSID  344

Query  551  TDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLA  372
             D+   +                          + GGFVMSCRV GE      P  V++A
Sbjct  345  MDRHSSSEEPEEEA------------AEYCAAGMGGGFVMSCRVHGE-ASGGPPVVVRVA  391

Query  371  KRYVTCVEDAAIFMALAAAVDLSIEAC  291
             R+VTC+EDAA+F+ALAAAVDLS++AC
Sbjct  392  ARHVTCMEDAAMFLALAAAVDLSVKAC  418



>ref|XP_010104534.1| hypothetical protein L484_025508 [Morus notabilis]
 gb|EXC01135.1| hypothetical protein L484_025508 [Morus notabilis]
Length=442

 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 141/216 (65%), Gaps = 17/216 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  220  WLGSFGS-ERERPIKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  278

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P +G    +W+PWG+LEAWRERG  D +  RF ++ D+        +++SE  ++++K
Sbjct  279  LRPAEG----TWKPWGRLEAWRERGGSDGLGYRFELVPDAGGGVSAAGIVLSESTLNSQK  334

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRC  399
            GG+F ID        +       P  SPRSSGD+   L P     GFVMS +V+GE GRC
Sbjct  335  GGKFVIDLGSSRAGGS-----GSPACSPRSSGDFGYGLWPYCAYRGFVMSAKVEGE-GRC  388

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SKP  V+++ ++V C EDAA F+ALAAA+DLS++AC
Sbjct  389  SKPT-VEMSVQHVGCTEDAAAFVALAAAIDLSMDAC  423



>gb|EYU30689.1| hypothetical protein MIMGU_mgv1a0070432mg, partial [Erythranthe 
guttata]
Length=220

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 122/197 (62%), Gaps = 24/197 (12%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            RERKGW   ++DLSGSAVAAA + TPFVPS G   V+RSNPG WLI+ P+G    SW+PW
Sbjct  28   RERKGWMFIVYDLSGSAVAAASMVTPFVPSPGSDRVSRSNPGAWLILCPNGVSISSWKPW  87

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAWRERG  D +  +F ++ D+        ++E  +S +KGGEF ID  +       
Sbjct  88   GRLEAWRERGPTDGLRYKFELITDAG-LTSGAPIAEGTVSVKKGGEFSIDNSRS------  140

Query  521  ppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
                           D A +    + GFVM   V+GE G+ SK P VQ+  ++VTC+ DA
Sbjct  141  ---------------DSALSFLLKNRGFVMGSSVEGE-GKVSK-PVVQVGVQHVTCMADA  183

Query  341  AIFMALAAAVDLSIEAC  291
            A+F+ALAAAVDLS++AC
Sbjct  184  ALFVALAAAVDLSMDAC  200



>emb|CDY63745.1| BnaC05g07770D [Brassica napus]
Length=435

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 148/245 (60%), Gaps = 24/245 (10%)
 Frame = -1

Query  995  LFHCK--CR----KLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGS  834
            +F CK  CR    +      +P    +   W +S GS + E   +ERKGW +T+HDLSGS
Sbjct  188  VFTCKFSCRNTGDRTMRSRSLPPETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSGS  246

Query  833  AVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRDS  660
             VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W+PWG+LEAWRER G  D 
Sbjct  247  PVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGDG----TWKPWGRLEAWRERGGATDG  302

Query  659  ICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsS  480
            +  RF ++ D       ++++E  IS+ +GG+F I+      A +            R S
Sbjct  303  LGYRFELIPDGSSG-AGIVLTESSISSHRGGKFSIELGSSPTAGS------VSRTRRRGS  355

Query  479  GDYAAALNPVSG--GFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDL  306
            GDY   L   SG  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DL
Sbjct  356  GDYGYGLWLGSGYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDL  413

Query  305  SIEAC  291
            S++AC
Sbjct  414  SMDAC  418



>emb|CDY57930.1| BnaA06g37990D [Brassica napus]
Length=437

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 146/245 (60%), Gaps = 23/245 (9%)
 Frame = -1

Query  995  LFHCK--CR----KLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGS  834
            +F CK  CR    +      +P    +   W +S GS + E   +ERKGW +T+HDLSGS
Sbjct  188  VFTCKFSCRNTSDRTMRSRSLPPETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSGS  246

Query  833  AVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRDS  660
             VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W+PWG+LEAWRER G  D 
Sbjct  247  PVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGDG----TWKPWGRLEAWRERGGATDG  302

Query  659  ICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsS  480
            +  RF ++ D       ++++E  IS+ +GG+F I+      A +              S
Sbjct  303  LGYRFELIPDGSSG-AGIVLTESSISSHRGGKFSIELGSSPTAGS-----VSRTRRRSGS  356

Query  479  GDYAAALNPVSG--GFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDL  306
            GDY   L   SG  GFVMS  V+GE G+CSK P V+++  +V+C+EDAA ++AL+AA+DL
Sbjct  357  GDYGYGLWLGSGYKGFVMSASVEGE-GKCSK-PCVEVSVHHVSCMEDAAAYVALSAAIDL  414

Query  305  SIEAC  291
            S++AC
Sbjct  415  SMDAC  419



>ref|XP_010692653.1| PREDICTED: uncharacterized protein LOC104905738 [Beta vulgaris 
subsp. vulgaris]
Length=461

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 141/223 (63%), Gaps = 19/223 (9%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W S+ GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG+WLI
Sbjct  227  WLSTFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLI  285

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P      +W+PWG+LEAWRERG  D +  +F ++ D + +   ++++E  ++  KGG+
Sbjct  286  LRPG---EGTWKPWGRLEAWRERGANDGLGYKFELISDMNANV-GVVLAESTLNTSKGGK  341

Query  563  FYID----------TDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRV  420
            F ID          ++     +     +P   P    SGD+  +L P +   GFVM+ RV
Sbjct  342  FSIDLGCAQFNNSNSNSNASGSNRGTRSPGCSPRRGGSGDFGTSLWPYNAYRGFVMAARV  401

Query  419  QGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +GE G+CSK P V+++ ++V+C ED A ++ALAAAVDLSI+AC
Sbjct  402  EGE-GKCSK-PTVEVSVQHVSCTEDVAAYVALAAAVDLSIDAC  442



>ref|XP_011074314.1| PREDICTED: uncharacterized protein LOC105159071 [Sesamum indicum]
Length=455

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 139/220 (63%), Gaps = 15/220 (7%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S GS + E   +ERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI
Sbjct  223  WLTSFGS-ERERPGKERKGWSITIHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLI  281

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ DS      ++++E  +S  KGG
Sbjct  282  LRPGDG----TWKPWGRLEAWRERGAGDGLGYRFELIPDSAAA-AGIVLAESTLSCSKGG  336

Query  566  EFYIDTDKQVRAAAHppptppplp---sprsSGDYAAALNP--VSGGFVMSCRVQGEG--  408
            +F ID +          P         SPRSSGD+   L P  +  GFVMS  V+GEG  
Sbjct  337  KFVIDLNGNGNGTPTGTPKSAAASPGCSPRSSGDFGYGLWPYCMYRGFVMSASVEGEGRS  396

Query  407  GRC-SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            GR  +  P V+++ ++V+C EDAA F+AL+AA+DLSI+AC
Sbjct  397  GRGKTAAPQVEVSVQHVSCTEDAAAFVALSAALDLSIDAC  436



>ref|XP_007137270.1| hypothetical protein PHAVU_009G113400g [Phaseolus vulgaris]
 gb|ESW09264.1| hypothetical protein PHAVU_009G113400g [Phaseolus vulgaris]
Length=449

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 142/227 (63%), Gaps = 15/227 (7%)
 Frame = -1

Query  947  QVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVAR  768
            Q +P    W SS GS + E   +ERKGW + +HDLSGS VAAA + TPFV S G   V+ 
Sbjct  211  QSEPGGRSWLSSFGS-ERERPGKERKGWSIMVHDLSGSPVAAASMVTPFVASPGSDRVSC  269

Query  767  SNPGTWLIVHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMS  597
            SNPG+WLI+ P DG    +W+PWGKLEAWRERG  D +  RF ++ D++       ++++
Sbjct  270  SNPGSWLILRPSDG----TWKPWGKLEAWRERGGSDGLGYRFELIPDTNGGMSAAGIVLA  325

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptppplp---sprsSGDYAAALNP--VSGGFVM  432
            E  +S+ KGG+F ID   +   +              SPRSSGDY   L P  +  GFVM
Sbjct  326  ESTLSSYKGGKFVIDMSCRTGGSNGRVTPGSATSPACSPRSSGDYGYGLWPYCMYRGFVM  385

Query  431  SCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S  V+GE G+CSK P V+++  +V C EDAA F+ALAAAVDLS++AC
Sbjct  386  SASVEGE-GKCSK-PRVEVSVPHVNCTEDAAAFVALAAAVDLSVDAC  430



>ref|XP_003526511.1| PREDICTED: uncharacterized protein LOC100805268 [Glycine max]
Length=456

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 141/225 (63%), Gaps = 21/225 (9%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+ SNPG+WLI
Sbjct  220  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLI  278

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  +S  K
Sbjct  279  LRPSDG----TWKPWGRLEAWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESTLSNNK  334

Query  572  GGEFYIDT---------DKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSC  426
            GG+F ID          +      A P     P  SPRSSGDY   L P  +  GFVMS 
Sbjct  335  GGKFVIDLSCRNGNVSGNGGSNGRATPGSATSPACSPRSSGDYGYGLWPYCMYRGFVMSA  394

Query  425  RVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             V+GE GRCSK P V+++  +V C EDAA F+ALAAAVDLS++AC
Sbjct  395  SVEGE-GRCSK-PTVEVSVPHVNCTEDAAAFVALAAAVDLSVDAC  437



>gb|EYU34216.1| hypothetical protein MIMGU_mgv1a006107mg [Erythranthe guttata]
Length=457

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 139/218 (64%), Gaps = 16/218 (7%)
 Frame = -1

Query  923  WSSSVGSSDLEIER--RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTW  750
            W SS+GS   E ER  +ERKGW +T+HDLSGS VAAA + TPFV S G   V+RSNPG W
Sbjct  227  WLSSLGS---ERERVVKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCW  283

Query  749  LIVHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKG  570
            LI+ P      +W+PWG+LEAWRERG  D+I  +F ++ DS      +++++  IS  KG
Sbjct  284  LILRPGD---STWKPWGRLEAWRERGSADAIGYKFELIPDSASAAAGIVLADSKISCSKG  340

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNP---VSGGFVMSCRVQGEG--G  405
            G+F ID      A+        P+ SP  SGD+   L P   +  GFVM+  V+GEG  G
Sbjct  341  GKFIIDNGN---ASGGGSNAGSPVCSPHGSGDFGYGLWPYCSMYRGFVMAASVEGEGYNG  397

Query  404  RCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            + +  P V+++ + V C+EDAA F+ALAAA+DLS++AC
Sbjct  398  KTAAAPLVEVSVQQVKCLEDAAAFVALAAALDLSVDAC  435



>ref|XP_011011605.1| PREDICTED: uncharacterized protein LOC105116107 [Populus euphratica]
Length=448

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 134/208 (64%), Gaps = 9/208 (4%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCR  723
            S+ E   +ERKGW +T+HDLSGS VAAA + TPFVPS G   V+RSNPG+WLI+ P    
Sbjct  227  SERERPLKERKGWSITVHDLSGSPVAAASMVTPFVPSRGSDRVSRSNPGSWLILRPGA--  284

Query  722  PESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEKGGEFYIDT  549
              +W+PWG+LE+WRER   D +  RF ++ D++       +L++E  +S+ KGG+F ID 
Sbjct  285  -GTWKPWGRLESWRERSSSDGLGYRFELIPDTNGTMSAASILLAECTLSSHKGGKFVIDL  343

Query  548  DKQVRAAAHppptppplpsprsSGDYAAAL--NPVSGGFVMSCRVQGEGGRCSKPPFVQL  375
                     P  +  P+ SPR SGD+   L  N +  GFVMS  V+GE G+CSK   V++
Sbjct  344  GACSNGRTTPENSASPVCSPRGSGDHGYGLWPNCLHSGFVMSASVEGE-GKCSK-LGVEV  401

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
               +V C EDAA F+ALAAAVDLS++AC
Sbjct  402  GVPHVNCTEDAAAFVALAAAVDLSMDAC  429



>ref|XP_010266771.1| PREDICTED: uncharacterized protein LOC104604209 [Nelumbo nucifera]
Length=448

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 132/202 (65%), Gaps = 13/202 (6%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQP  705
            RERKGW +T+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P DG    +W+P
Sbjct  235  RERKGWSITVHDLSGSPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPGDG----TWKP  290

Query  704  WGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEKGGEFYIDTDKQVRA  531
            WG+LEAWRERG  D +  RF ++ D++       ++++E  +   KGG+F IDT    R+
Sbjct  291  WGRLEAWRERGGSDGLGYRFELMPDTNGSMSAAGIVLAESTLGTSKGGKFVIDTSGFGRS  350

Query  530  AAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVT  357
                  +  P  SPR SGD+   L P  +  GFVMS  V GE G+CSK P V+++ ++V 
Sbjct  351  TP--ANSSSPACSPRCSGDFGYGLWPYCMYRGFVMSSTVVGE-GKCSK-PVVEVSVQHVN  406

Query  356  CVEDAAIFMALAAAVDLSIEAC  291
            C EDAA F+ALAAAVDLS++AC
Sbjct  407  CTEDAAAFVALAAAVDLSMDAC  428



>emb|CDY20666.1| BnaC08g13920D [Brassica napus]
Length=447

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 144/244 (59%), Gaps = 17/244 (7%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRI-----PQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSG  837
            +F CK  CR    D  I     P    +   W +S GS + E   +ERKGW +T+HDLSG
Sbjct  193  VFTCKFSCRNTTGDRTIRSRSLPTETSVPRSWLNSFGS-ERERPNKERKGWSITVHDLSG  251

Query  836  SAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRD  663
            S VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W+PWG+LEAWRER G  D
Sbjct  252  SPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDG----TWKPWGRLEAWRERGGATD  307

Query  662  SICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprs  483
             +  RF ++ D       ++++E  IS+ +GG+F I+       +           S  +
Sbjct  308  GLGYRFELILDGSSG-AGIVLAESSISSHRGGKFSIELGSSPTGSGVGRTRSRGGGSGGA  366

Query  482  SGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLS  303
            S   +     V  GFVM+  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AAVDLS
Sbjct  367  SPANSPRGGSVQKGFVMAASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAVDLS  424

Query  302  IEAC  291
            ++AC
Sbjct  425  MDAC  428



>ref|XP_003522725.1| PREDICTED: uncharacterized protein LOC100775992 isoform 1 [Glycine 
max]
Length=457

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 141/226 (62%), Gaps = 22/226 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+ SNPG+WLI
Sbjct  220  WLSSFGS-ERERPGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLI  278

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  +S+ K
Sbjct  279  LRPSDG----TWKPWGRLEAWRERGGSDGLGYRFELIPDTNGGMSAAGIVLAESTLSSNK  334

Query  572  GGEFYIDTD----------KQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMS  429
            GG+F ID                  A P     P  SPRSSGDY   L P  +  GFVMS
Sbjct  335  GGKFVIDLSCRNAVNGSGNGGSNGRATPGSATSPACSPRSSGDYGYGLWPYCMYRGFVMS  394

Query  428  CRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              V+GE GRCSK P V+++  +V C EDAA F+ALAAAVDLS++AC
Sbjct  395  ASVEGE-GRCSK-PTVEVSVPHVNCTEDAAAFVALAAAVDLSVDAC  438



>ref|XP_003603662.1| hypothetical protein MTR_3g110630 [Medicago truncatula]
 gb|AES73913.1| DUF1005 family protein [Medicago truncatula]
Length=454

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 141/222 (64%), Gaps = 18/222 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW +T+HDLSGS VAAA + TPFV S G   V+ SNPG+WLI
Sbjct  221  WLSSFGS-ERERTGKERKGWSITVHDLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLI  279

Query  743  VHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRD--DLLMSEILISAEK  573
            + P DG    +W+PWG+LEAWRERG  D +  RF ++ D++       ++++E  +S  +
Sbjct  280  LRPGDG----TWKPWGRLEAWRERGGSDGLGYRFELMPDTNGSMSAGGIVIAESTLSLTR  335

Query  572  GGEFYIDTDKQV------RAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQ  417
            GG+F +D   +          A P     P+ SPR SGDY   L P  +  GFVMS  V+
Sbjct  336  GGKFVLDLSSRCGGGGGSNGRATPGNATSPVCSPRGSGDYGYGLWPYCMYRGFVMSASVE  395

Query  416  GEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            GE GRCSK P V+++  +V C EDAA F+ALAAAVDLS++AC
Sbjct  396  GE-GRCSK-PTVEVSVPHVNCTEDAAAFVALAAAVDLSVDAC  435



>ref|XP_003610647.1| hypothetical protein MTR_5g005420 [Medicago truncatula]
 gb|AES93605.1| DUF1005 family protein [Medicago truncatula]
Length=417

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 127/211 (60%), Gaps = 13/211 (6%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S+ ++    +RKGW +TIHDLSGS VA A + TPFVPS G   V++SNPG WLI+ PDG 
Sbjct  201  SNPVQFPSMDRKGWSITIHDLSGSPVACASMVTPFVPSPGSQRVSKSNPGAWLIIKPDG-  259

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRE G  +S+  RF VL  +    D + ++   IS++ GG+F ID  
Sbjct  260  -DGTWKPWGRLEAWREPGYSNSVGYRFDVLPAT---ADPVTLAGCSISSQNGGKFTIDVT  315

Query  545  KQVRAAAHpp------ptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPF  384
              V     P             P   S  D++     +  GFVMS R  GE  +CSKP  
Sbjct  316  SGVTPVNTPNGSWDLGSGSGSRPGSGSGSDFSLENQFLYSGFVMSARFDGE-KKCSKPE-  373

Query  383  VQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  374  VEVGVKHVTCTEDAAAFVALAAAMDLSMDAC  404



>gb|AFK43684.1| unknown [Medicago truncatula]
Length=417

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 127/211 (60%), Gaps = 13/211 (6%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            S+ ++    +RKGW +TIHDLSGS VA A + TPFVPS G   V++SNPG WLI+ PDG 
Sbjct  201  SNPVQFPSMDRKGWSITIHDLSGSPVACASMVTPFVPSPGSQRVSKSNPGAWLIIKPDG-  259

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRE G  +S+  RF VL  +    D + ++   IS++ GG+F ID  
Sbjct  260  -DGTWKPWGRLEAWREPGYSNSVGYRFDVLPAT---ADPVTLAGCSISSQNGGKFTIDVT  315

Query  545  KQVRAAAHpp------ptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPF  384
              V     P             P   S  D++     +  GFVMS R  GE  +CSKP  
Sbjct  316  SGVTPVNTPNGSWDLGSGSGSRPGSGSGSDFSLENQFLYSGFVMSARFDGE-KKCSKPE-  373

Query  383  VQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  374  VEVGVKHVTCTEDAAAFVALAAAMDLSMDAC  404



>emb|CDY31054.1| BnaA08g26040D [Brassica napus]
Length=447

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 143/244 (59%), Gaps = 17/244 (7%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRI-----PQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSG  837
            +F CK  CR    D  I     P    +   W +S GS + E   +ERKGW +T+HDLSG
Sbjct  193  VFTCKFSCRNTTGDRTIRSRSLPTETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSG  251

Query  836  SAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRD  663
            S VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W PWG+LEAWRER G  D
Sbjct  252  SPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDG----TWNPWGRLEAWRERGGATD  307

Query  662  SICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprs  483
             +  RF ++ D       ++++E  IS+ +GG+F I+       +           S  +
Sbjct  308  GLGYRFELILDGSSG-AGIVLAESSISSHRGGKFSIELGSSPTGSGVGRTRSRGGGSGGA  366

Query  482  SGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLS  303
            S   +     V  GFVM+  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AAVDLS
Sbjct  367  SPANSPRGGSVQKGFVMAASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAVDLS  424

Query  302  IEAC  291
            ++AC
Sbjct  425  MDAC  428



>ref|XP_007041415.1| Gb:AAC34331.1 [Theobroma cacao]
 gb|EOX97246.1| Gb:AAC34331.1 [Theobroma cacao]
Length=464

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 133/217 (61%), Gaps = 18/217 (8%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCR  723
            ++ E   +ERKGW +T+HDLSGS VA A + TPFVPS G   V+RSNPG WLI+ P GC 
Sbjct  233  TEKEQSSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLILRP-GC-  290

Query  722  PESWQPWGKLEAWRERGIRDSICCRFHVLCDSH--EHRDDLLMSEILISAEKGGEFYIDT  549
              +W+PWG+LEAWRE G  D++  RF +  D +         ++  ++S + GG+F +D 
Sbjct  291  -GTWKPWGRLEAWREPGFTDALGYRFDLFHDDYIAATSTTATLASSILSTKLGGKFTMDM  349

Query  548  DKQVRAAAHppptpp--------plpsprsSGDYAAALNPVS---GGFVMSCRVQGEGGR  402
               V A     P           P     S   +AA+++P S   GGFVMS  V+G  G+
Sbjct  350  TTNVAATPSTSPQSSCDFGSGSRPGSGSGSDFGFAASISPQSLYRGGFVMSSTVEG-AGK  408

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            CSKP  V++  ++VTC EDAA+F+ALAAA+DLS++AC
Sbjct  409  CSKPE-VEVGVQHVTCTEDAAVFVALAAAMDLSVDAC  444



>ref|XP_009144481.1| PREDICTED: uncharacterized protein LOC103868126 [Brassica rapa]
Length=447

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 143/244 (59%), Gaps = 17/244 (7%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRI-----PQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSG  837
            +F CK  CR    D  I     P    +   W +S GS + E   +ERKGW +T+HDLSG
Sbjct  193  VFTCKFSCRNTTGDRTIRSRSLPTETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSG  251

Query  836  SAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRD  663
            S VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W+PWG+LEAWRER G  D
Sbjct  252  SPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDG----TWKPWGRLEAWRERGGATD  307

Query  662  SICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprs  483
             +  RF ++ D       ++++E  IS+ +GG+F I+                   S  +
Sbjct  308  GLGYRFELILDGSSG-AGIVLAESSISSHRGGKFSIELGSSPTGGGVGRTRSRGGGSGGA  366

Query  482  SGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLS  303
            S   +     V  GFVM+  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AAVDLS
Sbjct  367  SPANSPRGGSVQKGFVMAASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAVDLS  424

Query  302  IEAC  291
            ++AC
Sbjct  425  MDAC  428



>ref|XP_006307457.1| hypothetical protein CARUB_v10009083mg [Capsella rubella]
 gb|EOA40355.1| hypothetical protein CARUB_v10009083mg [Capsella rubella]
Length=460

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 141/240 (59%), Gaps = 26/240 (11%)
 Frame = -1

Query  953  IPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWV  774
            +P    +   W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V
Sbjct  211  LPTETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRV  269

Query  773  ARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMS  597
            +RSNPG+WLI+ P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++
Sbjct  270  SRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLA  325

Query  596  EILISAEKGGEFYID----------------TDKQVRAAAHppptppplpsprsSGDYAA  465
            E  IS+ KGG+F I+                  ++  +        P       SGDY  
Sbjct  326  ESTISSHKGGKFSIELGSSSSSSPTGGVNRSRSRRGGSGGSGGGASPANSPRGGSGDYGY  385

Query  464  ALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             L P  V  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++AC
Sbjct  386  GLWPWNVYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDAC  443



>ref|XP_009148322.1| PREDICTED: uncharacterized protein LOC103871783 [Brassica rapa]
Length=451

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 107/255 (42%), Positives = 149/255 (58%), Gaps = 28/255 (11%)
 Frame = -1

Query  995  LFHCK--CR----KLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGS  834
            +F CK  CR    +      +P    +   W +S GS + E   +ERKGW +T+HDLSGS
Sbjct  188  VFTCKFSCRNTSDRTMRSRSLPPETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSGS  246

Query  833  AVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRDS  660
             VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W+PWG+LEAWRER G  D 
Sbjct  247  PVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGDG----TWKPWGRLEAWRERGGATDG  302

Query  659  ICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAA----------Hpppt  510
            +  RF ++ D       ++++E  IS+ +GG+F I+      A +              T
Sbjct  303  LGYRFELIPDGSSG-AGIVLTESSISSHRGGKFSIELGSSPTAGSVSRTRRRSGGSSGGT  361

Query  509  ppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAI  336
             P       SGDY   L   SG  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA 
Sbjct  362  SPASSPRGGSGDYGYGLWLGSGYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAA  419

Query  335  FMALAAAVDLSIEAC  291
            ++AL+AA+DLS++AC
Sbjct  420  YVALSAAIDLSMDAC  434



>gb|KFK43302.1| hypothetical protein AALP_AA1G106600 [Arabis alpina]
Length=462

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 147/260 (57%), Gaps = 33/260 (13%)
 Frame = -1

Query  995  LFHCK--CR----KLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGS  834
            +F CK  CR    +      +P    +   W +S GS + E   +ERKGW +T+HDLSGS
Sbjct  191  VFTCKFSCRNTGDRTMRSRSLPPESSIPRSWLNSFGS-ERERPGKERKGWSITVHDLSGS  249

Query  833  AVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLEAWRER-GIRDS  660
             VA A I TPFV S G   V+RSNPG+WLI+ P DG    +W+PWG+LEAWRER G  D 
Sbjct  250  PVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDG----TWKPWGRLEAWRERGGATDG  305

Query  659  ICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHpp------------  516
            +  RF ++ D       ++++E  IS+ +GG+F I+      +  +              
Sbjct  306  LGYRFELIPDGSSG-AGIVLAESTISSHRGGKFSIELGSSPTSGVNRTRSRRGGSSGSGG  364

Query  515  ---ptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCV  351
                  P       SGDY   L P  V  GFVMS  V+GE G+CSK P V+++ ++V C+
Sbjct  365  SGGGASPANSPRGGSGDYGYGLWPWSVYKGFVMSASVEGE-GKCSK-PCVEVSVQHVICM  422

Query  350  EDAAIFMALAAAVDLSIEAC  291
            EDAA ++AL+AA+DLS++AC
Sbjct  423  EDAAAYVALSAAIDLSMDAC  442



>ref|XP_010458327.1| PREDICTED: uncharacterized protein LOC104739608 isoform X2 [Camelina 
sativa]
 ref|XP_010475861.1| PREDICTED: uncharacterized protein LOC104755214 [Camelina sativa]
Length=461

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 141/240 (59%), Gaps = 26/240 (11%)
 Frame = -1

Query  953  IPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWV  774
            +P    +   W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V
Sbjct  212  LPTDTSVSRSWLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGSDRV  270

Query  773  ARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMS  597
            +RSNPG+WLI+ P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++
Sbjct  271  SRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLA  326

Query  596  EILISAEKGGEFYID----------------TDKQVRAAAHppptppplpsprsSGDYAA  465
            E  IS+ KGG+F I+                  ++  +        P       SGDY  
Sbjct  327  ESTISSHKGGKFSIELGSSSSSSPTGGVNRSRSRRGGSGGSGGGASPANSPRGGSGDYGY  386

Query  464  ALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             L P  V  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++AC
Sbjct  387  GLWPWNVYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDAC  444



>ref|XP_010490593.1| PREDICTED: uncharacterized protein LOC104768341 [Camelina sativa]
Length=461

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 137/231 (59%), Gaps = 27/231 (12%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V+RSNPG+WLI
Sbjct  221  WLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLI  279

Query  743  VHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++E  IS+ KGG
Sbjct  280  LRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLAESTISSHKGG  335

Query  566  EF-----------------YIDTDKQVRAAAHppptppplpsprsSGDYAAALNP--VSG  444
            +F                 Y    ++  +        P       SGDY   L P  V  
Sbjct  336  KFSIELGSSSSSSSPTGGVYRSRSRRGGSGGSGGGASPANSPKGGSGDYGYGLWPWNVYK  395

Query  443  GFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++AC
Sbjct  396  GFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDAC  444



>ref|XP_011078480.1| PREDICTED: uncharacterized protein LOC105162206 [Sesamum indicum]
Length=451

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 138/224 (62%), Gaps = 12/224 (5%)
 Frame = -1

Query  947  QVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVAR  768
            Q+ P +  W SS GS + E   +ERKGW +TIHDLSGS VA A + TPFV   G   V R
Sbjct  216  QISPARG-WLSSFGS-ERERPGKERKGWSITIHDLSGSPVAVASMVTPFVAGPGSDRVTR  273

Query  767  SNPGTWLIVHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEI  591
            SN G WLI+ P DG    +W+PWG+LEAWR+RG  D +  RF ++ +S      ++++E 
Sbjct  274  SNSGCWLILRPGDG----TWKPWGRLEAWRDRGSADGLGYRFELVHNSAAS-SGIVLAES  328

Query  590  LISAEKGGEFYIDTDKQ-VRAAAHppptppplpsprsSGDYAAALNPVS--GGFVMSCRV  420
             +S  KGG+F ID +     A         P+ SPRSSGD+  AL P S   GFVMS +V
Sbjct  329  TLSCSKGGKFIIDLNGNGATAMKPGSAAATPVCSPRSSGDFGYALWPYSLYKGFVMSAKV  388

Query  419  QGEGGRCSKPPF-VQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +GEG      P  V++  + V C+EDAA F+AL+AA+DLS++AC
Sbjct  389  EGEGHSGKTAPLMVEVGVQQVNCMEDAAAFVALSAALDLSMDAC  432



>ref|XP_006486865.1| PREDICTED: uncharacterized protein LOC102617316 [Citrus sinensis]
Length=468

 Score =   141 bits (355),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 134/228 (59%), Gaps = 23/228 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W S+ GS + +   +ERKGW +TIHDLSGS VA A + TPFVPS G   V+RSNPG WLI
Sbjct  227  WLSAFGS-ERDQSSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLI  285

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD-SHEHRDDLLMSEILISAEKGG  567
            + P  C   +W+PWG+LEAWRE G  D +  RF +L D    +     ++   IS+ KGG
Sbjct  286  LRPGNC---TWKPWGRLEAWREPGNSDLLGYRFDLLHDTISSNSSSTTVANANISSTKGG  342

Query  566  EFYIDTDKQVRAA-AHppptp-----------pplpsprsSGDYAAALN--PV--SGGFV  435
            +F ID    V     H P +               P   S  D+A      P+  S GFV
Sbjct  343  KFTIDMANSVSTTPVHSPQSSCDFGSGSWSGPGSRPGSGSGSDFAFCCTGPPILQSRGFV  402

Query  434  MSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            MS  V+G GG+CSKP  V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  403  MSATVEG-GGKCSKPE-VEVGVQHVTCTEDAAAFVALAAAMDLSVDAC  448



>gb|KDO49502.1| hypothetical protein CISIN_1g012226mg [Citrus sinensis]
Length=468

 Score =   140 bits (354),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 134/228 (59%), Gaps = 23/228 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W S+ GS + +   +ERKGW +TIHDLSGS VA A + TPFVPS G   V+RSNPG WLI
Sbjct  227  WLSAFGS-EKDQSSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLI  285

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD-SHEHRDDLLMSEILISAEKGG  567
            + P  C   +W+PWG+LEAWRE G  D +  RF +L D    +     ++   IS+ KGG
Sbjct  286  LRPGNC---TWKPWGRLEAWREPGNSDLLGYRFDLLHDTISSNSSSTTVANANISSTKGG  342

Query  566  EFYIDTDKQVRAA-AHppptp-----------pplpsprsSGDYAAALN--PV--SGGFV  435
            +F ID    V     H P +               P   S  D+A      P+  S GFV
Sbjct  343  KFTIDMASSVSTTPVHSPQSSCDFGSGSWSGPGSRPGSGSGSDFAFCCTGPPILQSRGFV  402

Query  434  MSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            MS  V+G GG+CSKP  V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  403  MSATVEG-GGKCSKPE-VEVGVQHVTCTEDAAAFVALAAAMDLSVDAC  448



>ref|XP_006422727.1| hypothetical protein CICLE_v10028366mg [Citrus clementina]
 gb|ESR35967.1| hypothetical protein CICLE_v10028366mg [Citrus clementina]
Length=469

 Score =   140 bits (354),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 134/228 (59%), Gaps = 23/228 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W S+ GS + +   +ERKGW +TIHDLSGS VA A + TPFVPS G   V+RSNPG WLI
Sbjct  227  WLSAFGS-EKDQSSKERKGWSITIHDLSGSPVAMASMVTPFVPSPGSDRVSRSNPGAWLI  285

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCD-SHEHRDDLLMSEILISAEKGG  567
            + P  C   +W+PWG+LEAWRE G  D +  RF +L D    +     ++   IS+ KGG
Sbjct  286  LRPGNC---TWKPWGRLEAWREPGNSDLLGYRFDLLHDTISSNSSSTTVANANISSTKGG  342

Query  566  EFYIDTDKQVRAA-AHppptp-----------pplpsprsSGDYAAALN--PV--SGGFV  435
            +F ID    V     H P +               P   S  D+A      P+  S GFV
Sbjct  343  KFTIDMASSVSTTPVHSPQSSCDFGSGSWSGPGSRPGSGSGSDFAFCCTGPPILQSRGFV  402

Query  434  MSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            MS  V+G GG+CSKP  V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  403  MSATVEG-GGKCSKPE-VEVGVQHVTCTEDAAAFVALAAAMDLSVDAC  448



>ref|NP_172473.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC34331.1| Unknown protein [Arabidopsis thaliana]
 gb|AAR92283.1| At1g10020 [Arabidopsis thaliana]
 gb|AAS99692.1| At1g10020 [Arabidopsis thaliana]
 gb|AEE28529.1| uncharacterized protein AT1G10020 [Arabidopsis thaliana]
Length=461

 Score =   140 bits (354),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 140/241 (58%), Gaps = 27/241 (11%)
 Frame = -1

Query  953  IPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWV  774
            +P    +   W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V
Sbjct  211  LPTETSVSRSWLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRV  269

Query  773  ARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMS  597
            +RSNPG+WLI+ P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++
Sbjct  270  SRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLA  325

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptpp-----------------plpsprsSGDYA  468
            E  IS+ +GG+F I+      +++                               SGDY 
Sbjct  326  ESTISSHRGGKFSIELGSSPSSSSPTSVVNRSRSRRGGSSGSGGGASPANSPRGGSGDYG  385

Query  467  AALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEA  294
              L P  V  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++A
Sbjct  386  YGLWPWNVYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDA  443

Query  293  C  291
            C
Sbjct  444  C  444



>ref|XP_002892543.1| hypothetical protein ARALYDRAFT_888260 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68802.1| hypothetical protein ARALYDRAFT_888260 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 140/241 (58%), Gaps = 27/241 (11%)
 Frame = -1

Query  953  IPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWV  774
            +P    +   W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V
Sbjct  211  LPTETSVPRSWLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRV  269

Query  773  ARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMS  597
            +RSNPG+WLI+ P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++
Sbjct  270  SRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLA  325

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptpp-----------------plpsprsSGDYA  468
            E  IS+ +GG+F I+      +++                               SGDY 
Sbjct  326  ESTISSHRGGKFSIELGSSSSSSSPTSGVNRSRSHRGGSSGSGGGASPANSPRGGSGDYG  385

Query  467  AALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEA  294
              L P  V  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++A
Sbjct  386  YGLWPWNVYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDA  443

Query  293  C  291
            C
Sbjct  444  C  444



>ref|XP_010544039.1| PREDICTED: uncharacterized protein LOC104816779 [Tarenaya hassleriana]
Length=456

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 139/223 (62%), Gaps = 19/223 (9%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V+RSNPG+WLI
Sbjct  222  WLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLI  280

Query  743  VHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P       W+PWG+LEAWRER G  + +  RF ++ D       ++++E  IS+ KGG
Sbjct  281  LRPGN---GIWKPWGRLEAWRERGGATEGLGYRFELIPDGSSG-AGIVLAESNISSHKGG  336

Query  566  EFYIDT---------DKQVRAAAHppptppplpsprsSGDYAAALNP--VSGGFVMSCRV  420
            +F I+           K+  +         P  SPR SGD+   L P  +  GFVMS  V
Sbjct  337  KFVIELGSSTSINGGTKRSHSRGSGSGAASPSCSPRGSGDFGFGLWPWCLYRGFVMSATV  396

Query  419  QGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +GE G+CSK P V+++ ++VTC+EDAA ++AL+AA+DLS++AC
Sbjct  397  EGE-GKCSK-PCVEVSVQHVTCMEDAAAYVALSAAIDLSMDAC  437



>dbj|BAJ89116.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 132/211 (63%), Gaps = 13/211 (6%)
 Frame = -1

Query  914  SVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP  735
            SV  ++ E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P
Sbjct  108  SVAQTEREAAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRP  167

Query  734  DGCRPESWQPWGKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
             G    +W+PWG+LE WRER   G  DS+  RF +L    +H   + +++  I+A KGG+
Sbjct  168  AG--DGAWEPWGRLECWRERGGAGSSDSLGYRFDLLVPGVDH--AVPIADSTIAASKGGK  223

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPF  384
            F +D    + AA        P  SPR SGD++        GFVMS  V+GE GRCSK P 
Sbjct  224  FALD----LTAAQPLSRGSTPGCSPRGSGDFSQWPLGNYRGFVMSAAVEGE-GRCSK-PT  277

Query  383  VQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            V++   +V C EDAA F+ALAAAVDLS++AC
Sbjct  278  VEVGVAHVGCAEDAAAFVALAAAVDLSMDAC  308



>ref|XP_008801663.1| PREDICTED: uncharacterized protein LOC103715709 [Phoenix dactylifera]
 ref|XP_008801664.1| PREDICTED: uncharacterized protein LOC103715710 [Phoenix dactylifera]
Length=442

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 132/215 (61%), Gaps = 20/215 (9%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WL+
Sbjct  226  WLSSFGS-ERERPLKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLV  284

Query  743  VHPDGCRPESWQPWGKLEAWRER--GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKG  570
            + P G    +W+PWG+LEAWRER  G  D I  RF ++ D+      + ++E  +S  KG
Sbjct  285  LRPGG---GTWKPWGRLEAWRERGGGASDGIGFRFQLVPDTAMG-AGVPLAESTVSTGKG  340

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRCS  396
            G+F ID                P  SPR S D+ A   P SG  GFVMS  V GE G+CS
Sbjct  341  GKFTIDL---------TGAGWSPRGSPRRSADFGAGPWPFSGYRGFVMSSTVDGE-GKCS  390

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +P  V++  ++V C EDAA F+ALAA+VDLS++AC
Sbjct  391  RPS-VEVGVQHVGCAEDAAAFVALAASVDLSMDAC  424



>ref|XP_010539384.1| PREDICTED: uncharacterized protein LOC104813482 [Tarenaya hassleriana]
Length=426

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 120/206 (58%), Gaps = 32/206 (16%)
 Frame = -1

Query  893  EIERR---ERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPD-GC  726
            E+ +R   ERKGW + ++DLSGSAVAAA + TPFVPS G   V+R+NPG WLI+ P  G 
Sbjct  230  EVNKRQVKERKGWMIIVYDLSGSAVAAASMATPFVPSPGSDRVSRANPGAWLILQPHCGL  289

Query  725  RPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDT  549
               SW+PWG+LEAWRER G  D +  RF ++ D       + ++E  +S + GG F ID 
Sbjct  290  SVGSWKPWGRLEAWRERGGSDDGLGYRFELVTDVGG--GGISIAEGTMSVKHGGRFCIDG  347

Query  548  DKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAK  369
             +                            +PV  GFVMS  V+GE GR SK P V++A 
Sbjct  348  RRS----------------------SPDPRSPVR-GFVMSATVEGE-GRVSK-PAVEVAA  382

Query  368  RYVTCVEDAAIFMALAAAVDLSIEAC  291
             +V    DAA+F+AL+AA+DLSI+AC
Sbjct  383  EHVGSTADAALFVALSAAIDLSIDAC  408



>ref|XP_010943312.1| PREDICTED: uncharacterized protein LOC105061065 [Elaeis guineensis]
Length=442

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 129/215 (60%), Gaps = 20/215 (9%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WL+
Sbjct  226  WLSSFGS-ERERPMKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLV  284

Query  743  VHPDGCRPESWQPWGKLEAWRER--GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKG  570
            + P G    +W+PWG+LEAWRER  G+ D I  RF ++ D+      + ++E  +S  KG
Sbjct  285  LRPGG---GTWKPWGRLEAWRERGGGVSDGIGYRFQLVPDT-AMSAGVPLAESTVSTSKG  340

Query  569  GEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRCS  396
            G+F ID      +    P              + A   P SG  GFVMS  V+GE G+CS
Sbjct  341  GKFTIDLTGAGGSPGGSPRGSG---------HFGAGPWPFSGYRGFVMSSTVEGE-GKCS  390

Query  395  KPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +P  V++   +V C EDAA F+ALAAAVDLS++AC
Sbjct  391  RPS-VEIGVHHVGCTEDAAAFVALAAAVDLSMDAC  424



>ref|XP_009407691.1| PREDICTED: uncharacterized protein LOC103990325 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 141/256 (55%), Gaps = 19/256 (7%)
 Frame = -1

Query  1025  FQSLRIKVTYLFHCK--CRKLF*DY----RIPQVDPLKSF-WSSSVGSSDLEIERRERKG  867
             FQ    +   +F C   CR  F D+    R  Q +P     W SS GS + E   +ERKG
Sbjct  190   FQVQGNRRQPVFTCSFSCRHNFGDWNWRSRSTQSEPSSPRRWRSSFGS-ERERPGKERKG  248

Query  866   WKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESWQPWGKLE  690
             W V +HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P DG    +WQPWG+LE
Sbjct  249   WSVKVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPVDG----TWQPWGRLE  304

Query  689   AWRERG--IRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYID-TDKQVRAAAHp  519
             AWRERG    D +  RF +L D+      + ++E  ISA KGG+F ID T       A  
Sbjct  305   AWRERGGPAGDGLGYRFELLPDTAVG-PGVSLAESTISASKGGKFAIDLTGAGGNPLART  363

Query  518   pptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAA  339
               +             + + +P   GFVMS  V GEG   S  P V++  ++V C EDAA
Sbjct  364   SSSSGRGGKLGRGLSLSPSPSPAYRGFVMSSTVIGEG--RSGRPAVEVGVQHVGCAEDAA  421

Query  338   IFMALAAAVDLSIEAC  291
              F+ALAAAVDLS++AC
Sbjct  422   AFVALAAAVDLSMDAC  437



>ref|XP_006417503.1| hypothetical protein EUTSA_v10007581mg [Eutrema salsugineum]
 gb|ESQ35856.1| hypothetical protein EUTSA_v10007581mg [Eutrema salsugineum]
Length=461

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 139/230 (60%), Gaps = 26/230 (11%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V+RSNPG+WLI
Sbjct  220  WLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLI  278

Query  743  VHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P  C   +W+PWG+LEAWRER G+ D +  RF ++ D       ++++E  IS+ +GG
Sbjct  279  LRPGDC---TWKPWGRLEAWRERGGVTDGLGYRFELIPDGSSG-AGIVLAESTISSHRGG  334

Query  566  EFYID----------------TDKQVRAAAHppptppplpsprsSGDYAAALNP--VSGG  441
            +F I+                +               P  SPR SGDY   + P  V  G
Sbjct  335  KFSIELRSSSSSPPGGVNRSRSRSGGSGGGSSGGGASPSNSPRGSGDYGNGVWPWSVYKG  394

Query  440  FVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            FVMS  V+ E G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++AC
Sbjct  395  FVMSASVEAE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDAC  442



>ref|XP_006355293.1| PREDICTED: uncharacterized protein LOC102593921 [Solanum tuberosum]
Length=427

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 125/208 (60%), Gaps = 12/208 (6%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            ++D E  R+ERKGW VTIHDLSGS +AAA + TPFVPS G   V+RSNPG WLI+ PD  
Sbjct  212  TADNETRRKERKGWLVTIHDLSGSPIAAASMVTPFVPSQGSNKVSRSNPGAWLILRPD--  269

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+L+AW E  I   +  RF ++ D     D + +    IS + GG+F ID  
Sbjct  270  -QGTWKPWGRLQAWLE--ISGKLGYRFEIIPDGAN--DAITLVNSTISTKNGGKFSIDIS  324

Query  545  KQVRAAAHppptppplpsprsSGDYAAALN---PVSGGFVMSCRVQGEGGRCSKPPFVQL  375
                  A    +        S  D+ ++ +    +  GFVMS  V+G+ G+CSKP  V +
Sbjct  325  NVAIPMASAHSSFDFSSVSGSWSDFGSSGSWGQILYRGFVMSSTVKGD-GKCSKPEVV-V  382

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              ++V+C EDAA F+ LAAA+DLS++AC
Sbjct  383  GAQHVSCSEDAAAFVVLAAAMDLSMDAC  410



>ref|XP_007157186.1| hypothetical protein PHAVU_002G049700g [Phaseolus vulgaris]
 gb|ESW29180.1| hypothetical protein PHAVU_002G049700g [Phaseolus vulgaris]
Length=416

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 8/197 (4%)
 Frame = -1

Query  878  ERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWG  699
            ERKGW +T+HDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ PDG    +W+PWG
Sbjct  214  ERKGWSITVHDLSGSPVAAASMATPFVPSPGSQRVSRSNPGAWLIIRPDG--DGTWKPWG  271

Query  698  KLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHp  519
            +LEAWRE    +++  RF +L  +    D + ++   IS++ GG+F ID    V   + P
Sbjct  272  RLEAWREPNNSNAVGYRFQILPATA---DPVTLAASTISSQHGGKFTIDATSGVTPLSTP  328

Query  518  pptppplpsprsSGDYAAALNP-VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDA  342
              +        SS D      P  S GFVMS  V GE G+CSKP  V++  ++VTC EDA
Sbjct  329  RGSWDLGSGSGSSLDSGLEAIPFFSKGFVMSATVDGE-GKCSKPE-VEVGVQHVTCTEDA  386

Query  341  AIFMALAAAVDLSIEAC  291
            A F+ALAAA+DLS++AC
Sbjct  387  AAFVALAAALDLSMDAC  403



>ref|XP_010458326.1| PREDICTED: uncharacterized protein LOC104739608 isoform X1 [Camelina 
sativa]
Length=462

 Score =   139 bits (349),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 137/231 (59%), Gaps = 27/231 (12%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV S G   V RSNPG+WLI
Sbjct  222  WLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVASPGSDRVRRSNPGSWLI  280

Query  743  VHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            + P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++E  I++ +GG
Sbjct  281  LRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLAESTINSHRGG  336

Query  566  EFYID-----------------TDKQVRAAAHppptppplpsprsSGDYAAALNP--VSG  444
            +F I+                   ++  +        P       SGDY   L P  V  
Sbjct  337  KFSIELGSSSSSSSPTGGVNRSRSRRGGSGGSGGGASPANSPRGGSGDYGYGLWPWNVYK  396

Query  443  GFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++AC
Sbjct  397  GFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDAC  445



>ref|XP_004511326.1| PREDICTED: uncharacterized protein LOC101500065 [Cicer arietinum]
Length=420

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 123/200 (62%), Gaps = 11/200 (6%)
 Frame = -1

Query  878  ERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWG  699
            +RKGW +T+HDLSGS VA A + TPFVPS G   V++SNPG WLI+ P+G    +W+PWG
Sbjct  215  DRKGWSITVHDLSGSPVACASMVTPFVPSPGSQRVSKSNPGAWLIIRPEG--DGTWKPWG  272

Query  698  KLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHp  519
            +LEAWRE G  +++  RF VL  +    D + ++   IS++ GG+F ID    +  A+ P
Sbjct  273  RLEAWREPGNSNAVGYRFDVLPAT---TDPVTLAACTISSQNGGKFTIDVTSGITPASTP  329

Query  518  ppt----ppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCV  351
              +               D+      +  GFVMS +  GE  +CSKP  V++  ++VTC 
Sbjct  330  NGSWDLGSSSRTESGFGSDFMLDHQFLYRGFVMSAKFDGE-KKCSKPE-VEVGVKHVTCA  387

Query  350  EDAAIFMALAAAVDLSIEAC  291
            EDAA F+ALAAA+DLS++AC
Sbjct  388  EDAAAFVALAAAMDLSMDAC  407



>ref|XP_004150270.1| PREDICTED: uncharacterized protein LOC101221491 [Cucumis sativus]
Length=454

 Score =   138 bits (348),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 126/208 (61%), Gaps = 12/208 (6%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGC  726
            S+ +   +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P DG 
Sbjct  242  SERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRPVDG-  300

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRE G  DSI  RF +L  +        ++   IS+  GG+F ID  
Sbjct  301  ---SWRPWGRLEAWRESGGSDSIGYRFELLPATSAA---ATLANSTISSGSGGKFTIDMT  354

Query  545  KQVRAAAHpppt---ppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQL  375
                 A  P  +        S   SGD+         GFVMS  V+G   + S+ P V++
Sbjct  355  GSASPAISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKK-SRRPEVEV  413

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            A ++VTC EDAA+F+ALAAAVDLS++AC
Sbjct  414  AVQHVTCTEDAAVFVALAAAVDLSMDAC  441



>gb|KGN52731.1| hypothetical protein Csa_4G000030 [Cucumis sativus]
Length=458

 Score =   138 bits (348),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 126/208 (61%), Gaps = 12/208 (6%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGC  726
            S+ +   +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P DG 
Sbjct  246  SERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRPVDG-  304

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRE G  DSI  RF +L  +        ++   IS+  GG+F ID  
Sbjct  305  ---SWRPWGRLEAWRESGGSDSIGYRFELLPATSAA---ATLANSTISSGSGGKFTIDMT  358

Query  545  KQVRAAAHpppt---ppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQL  375
                 A  P  +        S   SGD+         GFVMS  V+G   + S+ P V++
Sbjct  359  GSASPAISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKK-SRRPEVEV  417

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            A ++VTC EDAA+F+ALAAAVDLS++AC
Sbjct  418  AVQHVTCTEDAAVFVALAAAVDLSMDAC  445



>ref|XP_004156872.1| PREDICTED: uncharacterized LOC101221491 [Cucumis sativus]
Length=458

 Score =   138 bits (348),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 126/208 (61%), Gaps = 12/208 (6%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGC  726
            S+ +   +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P DG 
Sbjct  246  SERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRPVDG-  304

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRE G  DSI  RF +L  +        ++   IS+  GG+F ID  
Sbjct  305  ---SWRPWGRLEAWRESGGSDSIGYRFELLPATSAA---ATLANSTISSGSGGKFTIDMT  358

Query  545  KQVRAAAHpppt---ppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQL  375
                 A  P  +        S   SGD+         GFVMS  V+G   + S+ P V++
Sbjct  359  GSASPAISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKK-SRRPEVEV  417

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            A ++VTC EDAA+F+ALAAAVDLS++AC
Sbjct  418  AVQHVTCTEDAAVFVALAAAVDLSMDAC  445



>ref|XP_009399078.1| PREDICTED: uncharacterized protein LOC103983571 [Musa acuminata 
subsp. malaccensis]
Length=472

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 132/217 (61%), Gaps = 16/217 (7%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WL+
Sbjct  248  WISSFGS-ERERPGKERKGWSVTVHDLSGSPVALASMVTPFVASHGTDRVSRSNPGAWLV  306

Query  743  VHP-DGCRPESWQPWGKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAE  576
            + P DG    +W+PWG+LEAWRER   G  D +  RF +L D+      + ++E  +SA 
Sbjct  307  LRPGDG----TWKPWGRLEAWRERGGSGASDGLGYRFELLPDA-AMGAGINLAESTLSAT  361

Query  575  KGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGR  402
            KGG+F ID      A      +  P  SPR SGD+  AL P     GFVMS  V GEG  
Sbjct  362  KGGKFTIDLTSA--AGTPLSRSTSPGCSPRGSGDFGYALWPFPSYRGFVMSSTVAGEG--  417

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             S  P V++  + V C EDAA F+ALAAA+DLS++AC
Sbjct  418  RSGRPTVEVGVQQVGCTEDAAAFVALAAAIDLSMDAC  454



>dbj|BAF00981.1| hypothetical protein [Arabidopsis thaliana]
Length=461

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 139/241 (58%), Gaps = 27/241 (11%)
 Frame = -1

Query  953  IPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWV  774
            +P    +   W +S GS + E   +ERKGW +T+HDLSGS VA A I TPFV   G   V
Sbjct  211  LPTETSVSRSWLNSFGS-ERERPGKERKGWSITVHDLSGSPVAMASIVTPFVAFPGTDRV  269

Query  773  ARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER-GIRDSICCRFHVLCDSHEHRDDLLMS  597
            +RSNPG+WLI+ P  C   +W+PWG+LEAWRER G  D +  RF ++ D       ++++
Sbjct  270  SRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGATDGLGYRFELIPDGSSG-AGIVLA  325

Query  596  EILISAEKGGEFYIDTDKQVRAAAHppptpp-----------------plpsprsSGDYA  468
            E  IS+ +GG+F I+      +++                               SGDY 
Sbjct  326  ESTISSHRGGKFSIELGSSPSSSSPTSVVNRSRSRRGGSSGSGGGASPANSPRGGSGDYG  385

Query  467  AALNP--VSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEA  294
              L P  V  GFVMS  V+GE G+CSK P V+++ ++V+C+EDAA ++AL+AA+DLS++A
Sbjct  386  YGLWPWNVYKGFVMSASVEGE-GKCSK-PCVEVSVQHVSCMEDAAAYVALSAAIDLSMDA  443

Query  293  C  291
            C
Sbjct  444  C  444



>ref|XP_003557619.1| PREDICTED: uncharacterized protein LOC100825031 [Brachypodium 
distachyon]
Length=463

 Score =   138 bits (347),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 131/227 (58%), Gaps = 17/227 (7%)
 Frame = -1

Query  941  DPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSN  762
            DP    W +S GS D E   +ERKGW VT+HDLSGS VA A + TPFV   G   V+RSN
Sbjct  224  DPGTRNWLTSFGS-DRERLGKERKGWSVTVHDLSGSPVALASMVTPFVAIPGSDRVSRSN  282

Query  761  PGTWLIVHP-DGCRPESWQPWGKLEAWRERGIR----DSICCRFHVLCDSHE--HRDDLL  603
            PG WL++ P DG    +W+PWG+LE WRERG      DS+  RF +L   H       + 
Sbjct  283  PGAWLVLRPGDG----TWKPWGRLECWRERGASAAGGDSLGYRFELLLPDHPTGMGTGVS  338

Query  602  MSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPV---SGGFVM  432
            ++E  I + +GG F ID            P   P  S   +G  AAAL       GGFVM
Sbjct  339  VAESAIPSSRGGRFAIDLTAAQPFGRSGSPACSPRGSGDLTGYAAAALGSCCHGRGGFVM  398

Query  431  SCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S  VQGE GRCS+ P V++   +V C EDAA F+ALAAAVDLS++AC
Sbjct  399  SAAVQGE-GRCSR-PTVEVGVAHVGCAEDAAAFVALAAAVDLSMDAC  443



>ref|XP_008372951.1| PREDICTED: uncharacterized protein LOC103436305 [Malus domestica]
Length=485

 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 126/214 (59%), Gaps = 21/214 (10%)
 Frame = -1

Query  908  GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDG  729
            G +  E   +ERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P+ 
Sbjct  271  GGTHKEQXAKERKGWSITIHDLSGSPVAAASMVTPFVASPGSHRVSRSNPGAWLILRPNE  330

Query  728  CRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDT  549
                +WQPWG+LEAW ERG  D++  RF +         +  ++   + A+ GG+F ID 
Sbjct  331  G---TWQPWGRLEAWLERGGSDNVGYRFEL--------QNSTLANSTLGAKNGGKFSIDL  379

Query  548  DKQVRAAAHpppt------ppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSK  393
               +  A  P  +          P   S  D+   L P  V  GFVMS  V+G  G+CSK
Sbjct  380  TSSLTPANSPHSSFDLGSGSSSRPGSGSGSDFGFGLLPSLVQRGFVMSSTVEGV-GKCSK  438

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  V++  ++VTC EDAA ++ALAAA+DLS++AC
Sbjct  439  PE-VEVGVQHVTCTEDAAAYVALAAAMDLSMDAC  471



>ref|XP_009801206.1| PREDICTED: uncharacterized protein LOC104246980 [Nicotiana sylvestris]
Length=435

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 125/205 (61%), Gaps = 19/205 (9%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            +ERKGW +TIHDLSGS +AAA + TPFVPS G + V+RSNPG WLI+ P      +W+PW
Sbjct  225  KERKGWSITIHDLSGSPIAAASMVTPFVPSQGSSNVSRSNPGAWLILRPGN---GTWKPW  281

Query  701  GKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAH  522
            G+LEAW+ERG    +  RF ++ D     D + +S   IS + GG+F +D          
Sbjct  282  GRLEAWQERG--GDLGYRFEIIPDGAT--DAITLSNSTISTKNGGKFGVDITNGATPLTS  337

Query  521  ppptppplpsprsSGDYAAALNPVSG--------GFVMSCRVQGEGGRCSKPPFVQLAKR  366
            P  +        S  D+ +A  P SG        GFVMS  V+GE G+CSKP  V +  +
Sbjct  338  PNSSFDLCSGSGSGSDFGSA--PGSGSWAQLLYRGFVMSSTVEGE-GKCSKPEVV-VGVQ  393

Query  365  YVTCVEDAAIFMALAAAVDLSIEAC  291
            +V CVEDAA F+ALAAA+DLS++AC
Sbjct  394  HVNCVEDAAAFVALAAAMDLSMDAC  418



>ref|XP_004981601.1| PREDICTED: uncharacterized protein LOC101765126 [Setaria italica]
Length=435

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 139/240 (58%), Gaps = 27/240 (11%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAA  822
            +F CK  CR    D R P + P +   S            +ERKGW VT+HDLSGS VA 
Sbjct  198  MFTCKFGCRSNS-DLRRPGMQPEREGASG-----------KERKGWSVTVHDLSGSPVAM  245

Query  821  AFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER---GIRDSICC  651
            A + TPFVPS G   V+RSNPG WLI+ P G    +W+PW +LE WRER   G  DS+  
Sbjct  246  ASMVTPFVPSPGTDRVSRSNPGAWLILRPAG--DGAWEPWARLECWRERGGAGASDSLGY  303

Query  650  RFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY  471
            RF +L    +H   + +++  I + KGG+F ID    + AA        P  SPR SGD+
Sbjct  304  RFDLLLPGVDH--AVPLADSSIPSSKGGKFAID----LTAAQPLSRGGTPGCSPRGSGDF  357

Query  470  AAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +        GFVMS  VQGE GRCSK P V++   ++ C EDAA F+ALAAAVDLS++AC
Sbjct  358  SNWPLGNYRGFVMSAAVQGE-GRCSK-PTVEVGVAHIGCAEDAAAFVALAAAVDLSMDAC  415



>ref|XP_008454429.1| PREDICTED: uncharacterized protein LOC103494838 [Cucumis melo]
Length=452

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 124/208 (60%), Gaps = 12/208 (6%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGC  726
            S+ +   +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P DG 
Sbjct  240  SERDQSAKERKGWSITIHDLSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRPVDG-  298

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               SW+PWG+LEAWRE G  DSI  RF +L  +        ++   IS+  GG F ID  
Sbjct  299  ---SWRPWGRLEAWRESGGSDSIGYRFELLPATSAA---ATLANSTISSGSGGRFTIDMT  352

Query  545  KQVRAAAHpppt---ppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQL  375
                 A  P  +        S   SGD+         GFVMS  V+G   + S+ P V++
Sbjct  353  GSASPAISPNGSFDLGSGTGSRPGSGDFGYLTGYQYKGFVMSTMVEGMKKK-SRRPEVEV  411

Query  374  AKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              ++VTC EDAA+F+ALAAAVDLS++AC
Sbjct  412  GVQHVTCTEDAAVFVALAAAVDLSMDAC  439



>gb|KCW56839.1| hypothetical protein EUGRSUZ_I02507, partial [Eucalyptus grandis]
Length=408

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 126/218 (58%), Gaps = 13/218 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S+  SD +   +ERKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  177  WIPSLVGSDKDSHSKERKGWSVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLI  236

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P+     +W+PWG+LEAW E G  D +  RF +L ++       + +   IS + GG+
Sbjct  237  IRPEHG---TWRPWGRLEAWLEHGSSDMLSHRFELLPNTTTATTGTVANSS-ISIKNGGK  292

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAAL-------NPVSGGFVMSCRVQGEGG  405
            F ID    V   + P  +        S     +         N V GGFVMS  +QG   
Sbjct  293  FTIDLTNSVSPMSSPSSSMDLGGGSWSGSGSGSDFVGLGLWPNSVPGGFVMSSTMQGV-N  351

Query  404  RCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            + SKP  V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  352  KASKPQ-VEVGVQHVTCTEDAAAFVALAAAIDLSMDAC  388



>ref|XP_002274843.1| PREDICTED: uncharacterized protein LOC100254836 [Vitis vinifera]
Length=423

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 119/200 (60%), Gaps = 19/200 (10%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESW  711
            + +ERKGW +TIHDLSG  VAAA +T PFVPS G   V RSNPG WLI+ P DG    +W
Sbjct  221  DSKERKGWSITIHDLSGCPVAAASMTNPFVPSPGSGRVKRSNPGAWLILRPEDG----TW  276

Query  710  QPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRA  531
            +PWG+LEAWRE    D +  RF +L D+      LL S  L S +KGG+F ID+  +   
Sbjct  277  KPWGRLEAWRE---PDGLGHRFELLPDATGGPAVLLASSTL-STKKGGKFTIDSSSRNFP  332

Query  530  AAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCV  351
            A  P               Y         GFVMS  V GE GRCS P  V++  ++VTC 
Sbjct  333  ATTPRGACESGTRSWVESVYR--------GFVMSSTVGGE-GRCSTPE-VEVGVKHVTCT  382

Query  350  EDAAIFMALAAAVDLSIEAC  291
            EDAA F+ALAAA+DLS++AC
Sbjct  383  EDAAAFVALAAAMDLSMDAC  402



>ref|XP_008776853.1| PREDICTED: uncharacterized protein LOC103696910 [Phoenix dactylifera]
Length=442

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 130/216 (60%), Gaps = 22/216 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W SS GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WL+
Sbjct  226  WLSSFGS-ERERPIKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLV  284

Query  743  VHP-DGCRPESWQPWGKLEAWRER--GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEK  573
            + P DG    +W+PW +LEAWRER  G  D +  RF ++ D+       L +E  +S  K
Sbjct  285  LRPGDG----TWKPWARLEAWRERGGGTSDGLGYRFQLVPDTAVSAGAPL-AECTVSTSK  339

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGGRC  399
            GG+F ID      + A  P             D+ A   P SG  GFVMS  V+GE G+C
Sbjct  340  GGKFTIDLTGAGGSPAGSPRGSI---------DFGAGPWPFSGYRGFVMSSTVEGE-GKC  389

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S+P  V++  ++V C EDAA F+ALAAAVDLS++AC
Sbjct  390  SRPS-VEVGVQHVGCTEDAAAFVALAAAVDLSMDAC  424



>gb|EAY92004.1| hypothetical protein OsI_13693 [Oryza sativa Indica Group]
Length=444

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 131/203 (65%), Gaps = 17/203 (8%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P G    SW+PW
Sbjct  233  KERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAG--DGSWEPW  290

Query  701  GKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYID-TDKQVR  534
            G+LE WRER   G  DS+  RF +L    +H   + ++E  I+A KGG+F ID T  Q +
Sbjct  291  GRLECWRERGGAGASDSLGYRFDLLLPGVDH--AVPLAESSIAASKGGKFAIDLTSMQPQ  348

Query  533  AAAHppptppplpsprsSGDYAA-ALNPVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYV  360
            +         P  SPR SGD++   L+  S  GFVMS  VQGE GRCSK P V++   +V
Sbjct  349  SRG-----GTPGCSPRGSGDFSQWPLSSYSYRGFVMSSSVQGE-GRCSK-PTVEVGVPHV  401

Query  359  TCVEDAAIFMALAAAVDLSIEAC  291
             C EDAA F+ALAAAVDLS++AC
Sbjct  402  GCAEDAAAFVALAAAVDLSMDAC  424



>emb|CBI25109.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 119/200 (60%), Gaps = 19/200 (10%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-DGCRPESW  711
            + +ERKGW +TIHDLSG  VAAA +T PFVPS G   V RSNPG WLI+ P DG    +W
Sbjct  221  DSKERKGWSITIHDLSGCPVAAASMTNPFVPSPGSGRVKRSNPGAWLILRPEDG----TW  276

Query  710  QPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRA  531
            +PWG+LEAWRE    D +  RF +L D+      LL S  L S +KGG+F ID+  +   
Sbjct  277  KPWGRLEAWRE---PDGLGHRFELLPDATGGPAVLLASSTL-STKKGGKFTIDSSSRNFP  332

Query  530  AAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCV  351
            A  P               Y         GFVMS  V GE GRCS P  V++  ++VTC 
Sbjct  333  ATTPRGACESGTRSWVESVYR--------GFVMSSTVGGE-GRCSTPE-VEVGVKHVTCT  382

Query  350  EDAAIFMALAAAVDLSIEAC  291
            EDAA F+ALAAA+DLS++AC
Sbjct  383  EDAAAFVALAAAMDLSMDAC  402



>ref|XP_010030891.1| PREDICTED: uncharacterized protein LOC104420809, partial [Eucalyptus 
grandis]
Length=480

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 126/218 (58%), Gaps = 13/218 (6%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W  S+  SD +   +ERKGW VTIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI
Sbjct  249  WIPSLVGSDKDSHSKERKGWSVTIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLI  308

Query  743  VHPDGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGE  564
            + P+     +W+PWG+LEAW E G  D +  RF +L ++       + +   IS + GG+
Sbjct  309  IRPEHG---TWRPWGRLEAWLEHGSSDMLSHRFELLPNTTTATTGTVANSS-ISIKNGGK  364

Query  563  FYIDTDKQVRAAAHppptppplpsprsSGDYAAAL-------NPVSGGFVMSCRVQGEGG  405
            F ID    V   + P  +        S     +         N V GGFVMS  +QG   
Sbjct  365  FTIDLTNSVSPMSSPSSSMDLGGGSWSGSGSGSDFVGLGLWPNSVPGGFVMSSTMQGV-N  423

Query  404  RCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            + SKP  V++  ++VTC EDAA F+ALAAA+DLS++AC
Sbjct  424  KASKPQ-VEVGVQHVTCTEDAAAFVALAAAIDLSMDAC  460



>ref|XP_003630690.1| hypothetical protein MTR_8g102270 [Medicago truncatula]
Length=208

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 115/202 (57%), Gaps = 30/202 (15%)
 Frame = -1

Query  887  ERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPE---  717
            +  ERKGW + IHDLSGS VAAA + TPFVPS     V+RSN G W+I+   G       
Sbjct  13   QGNERKGWMIVIHDLSGSPVAAASMITPFVPSPSSDRVSRSNAGAWVILRAIGGSTVSSC  72

Query  716  SWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQV  537
            SW+ WG LEAWRERG  D +  +  +  D+    + + ++E  +S +KGG+F ID+    
Sbjct  73   SWKSWGHLEAWRERGPIDGLGYKVELFSDNGP-VNAIPIAEGTVSVKKGGKFCIDS----  127

Query  536  RAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVT  357
                        L S    G+          GFVM   V GE G+ SK P VQ+  R+VT
Sbjct  128  ----------AILGSKWLPGE----------GFVMGSTVSGE-GKVSK-PVVQVGVRHVT  165

Query  356  CVEDAAIFMALAAAVDLSIEAC  291
            C+ DAA+F+AL+AA+DLS++AC
Sbjct  166  CMPDAALFIALSAAIDLSMDAC  187



>ref|XP_004230673.1| PREDICTED: uncharacterized protein LOC101258701 [Solanum lycopersicum]
Length=436

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 125/213 (59%), Gaps = 19/213 (9%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            +SD EI  +ERKGW +T+HDLSGS VAAA + TPFVPS G   V++SNPG+WLI+ P   
Sbjct  218  TSDREISVKERKGWSITVHDLSGSPVAAASMVTPFVPSQGSDRVSKSNPGSWLILRPGD-  276

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRER     +  RF ++ D     D + +    IS +KGG+  ID  
Sbjct  277  --NTWKPWGRLEAWRER--NGELGYRFEIIPDGAT--DAITLVNSTISTKKGGKIGIDII  330

Query  545  KQVRAAAHppptppplpsprsSGDYAAALNPVSG--------GFVMSCRVQGEGGRCSKP  390
                A     P      S  S         P SG        GFVMS  V GE G+C+KP
Sbjct  331  NG--ATPLTSPNSSFDLSSGSGSGSDFGSQPGSGSWAQLLYRGFVMSGTVGGE-GKCTKP  387

Query  389  PFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              V++  ++V+C EDAA F+ALAAA+DLSI+AC
Sbjct  388  E-VEVGVQHVSCAEDAAAFVALAAAMDLSIDAC  419



>ref|XP_004292055.1| PREDICTED: uncharacterized protein LOC101308741 [Fragaria vesca 
subsp. vesca]
Length=438

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 128/217 (59%), Gaps = 24/217 (11%)
 Frame = -1

Query  911  VGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP-  735
            +GS+  E   +ERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P 
Sbjct  223  MGSNQKEQSAKERKGWSLTIHDLSGSPVAAASMVTPFVASPGSQRVSRSNPGAWLILRPE  282

Query  734  DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYI  555
            DG    +W+PWG+LEAW ERG  D++  +F +L          +++   +SA  GG+F I
Sbjct  283  DG----TWKPWGRLEAWLERGGSDTVGYKFELL--------STILANSTVSASNGGKFTI  330

Query  554  DTDKQVRAA-------AHppptppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGR  402
            D    +               +    P   S  D+   L P  +  GFVMS  V+G  G+
Sbjct  331  DLTSSLTPVNSPHSSFDFGSGSGSSRPGSGSGSDFGFGLIPQLLQRGFVMSSTVEGI-GK  389

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            CSKP  V++  ++VTC EDAA ++ALAAA+DLS++AC
Sbjct  390  CSKPE-VEVGVQHVTCTEDAAAYVALAAAMDLSMDAC  425



>ref|XP_007201076.1| hypothetical protein PRUPE_ppa006838mg [Prunus persica]
 gb|EMJ02275.1| hypothetical protein PRUPE_ppa006838mg [Prunus persica]
Length=393

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 126/214 (59%), Gaps = 21/214 (10%)
 Frame = -1

Query  908  GSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDG  729
            G +  E   +ERKGW +TIHDLSGS VAAA + TPFV S G   V+RSNPG WLI+ P+ 
Sbjct  179  GGAHKEQSGKERKGWSITIHDLSGSPVAAASMVTPFVASPGSHCVSRSNPGAWLILRPN-  237

Query  728  CRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDT  549
                +WQPWG+LE+W ERG  D++  RF +         +  ++   + A+ GG+F ID 
Sbjct  238  --EGTWQPWGRLESWLERGGSDTVGYRFEL--------QNTTLANSTLGAKTGGKFSIDL  287

Query  548  DKQVRAAAHpppt------ppplpsprsSGDYAAALNP--VSGGFVMSCRVQGEGGRCSK  393
               +  A  P  +          P   S  D+   L P  +  GFVMS  V+G  G+CSK
Sbjct  288  TSSLTPANSPHSSFDFGSGTGSRPGSGSGSDFGFGLFPQLIQRGFVMSSTVEGV-GKCSK  346

Query  392  PPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            P  V++  ++VTC EDAA ++ALAAA+DLS++AC
Sbjct  347  PE-VEVGVQHVTCTEDAAAYVALAAAMDLSMDAC  379



>ref|XP_010941977.1| PREDICTED: uncharacterized protein LOC105060083 [Elaeis guineensis]
Length=442

 Score =   135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 131/216 (61%), Gaps = 22/216 (10%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +S GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WL+
Sbjct  226  WLASFGS-ERERPIKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLV  284

Query  743  VHP-DGCRPESWQPWGKLEAWRER--GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEK  573
            + P DG    +W+PW +LEAWRER  G  D +  RFH++ D+      + ++E  +S  +
Sbjct  285  LRPGDG----TWKPWARLEAWRERGGGTSDGLGYRFHLVPDT-AMSAGVPLAESTVSTSR  339

Query  572  GGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVS--GGFVMSCRVQGEGGRC  399
            GG+F ID      + A  P             ++ A   P S   GFVMS  V+GE G+C
Sbjct  340  GGKFTIDLTGAGGSPAGSPRGSA---------EFGAGPWPFSWYRGFVMSSTVEGE-GKC  389

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            S+P  V++  ++V C EDAA F+ALAAA+DLS++AC
Sbjct  390  SRPS-VEVGVQHVGCTEDAAAFVALAAAIDLSMDAC  424



>ref|XP_011088149.1| PREDICTED: uncharacterized protein LOC105169457 [Sesamum indicum]
Length=426

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 126/216 (58%), Gaps = 17/216 (8%)
 Frame = -1

Query  914  SVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHP  735
            S G++D E   +ERKGW +TIHDLSGS VAAA + TPFVPS G   V+RSNPG WLI+ P
Sbjct  203  SSGAADNEQPLKERKGWSITIHDLSGSPVAAASMVTPFVPSPGTNRVSRSNPGAWLILRP  262

Query  734  DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYI  555
                  +W+PWG+LEAWRER   D +  RF ++ D     D + ++   IS + GG+F I
Sbjct  263  GH---GTWKPWGRLEAWRERSNGDHLGYRFDLIPDGGI--DTIPLANSSISTKTGGKFSI  317

Query  554  D--------TDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRC  399
            D        T                     S     A L  +  GFVMS  V+G+ G+C
Sbjct  318  DITTGPTPMTSPNSSFDLSSGSGSGSDLGSTSGSGSWAHL--LYRGFVMSSTVEGD-GKC  374

Query  398  SKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            SKP  V++  ++V+C EDAA F+ALAAA+DLS++AC
Sbjct  375  SKPD-VEVGVQHVSCTEDAAAFVALAAAMDLSMDAC  409



>gb|ACF82838.1| unknown [Zea mays]
Length=435

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 137/240 (57%), Gaps = 27/240 (11%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAA  822
            +F CK  CR    D R P + P +   S+           +ERKGW VT+HDL GSAVA 
Sbjct  198  MFTCKFGCRSNS-DLRRPGMQPERDAASA-----------KERKGWSVTVHDLKGSAVAM  245

Query  821  AFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER---GIRDSICC  651
            A + TPFVPS G   V+RSNPG WLI+ P G    SW+PW +LE WRER   G  DS+  
Sbjct  246  ASMVTPFVPSPGTDRVSRSNPGAWLILRPAG--DGSWEPWARLECWRERGGAGASDSLGY  303

Query  650  RFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY  471
             F +L    +H   + +++  I +  GG+F ID    + AA        P  SPR SGD 
Sbjct  304  HFALLVPGADH--AVALADSSIPSSNGGKFAID----LTAAQPLSRGGTPGCSPRGSGDL  357

Query  470  AAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +        GFVMS  VQGE GRCSK P V++   ++ C EDAA F+ALAAAVDLS++AC
Sbjct  358  SNWPLGNYRGFVMSAAVQGE-GRCSK-PTVEVGVAHIGCAEDAAAFVALAAAVDLSMDAC  415



>gb|EAZ28736.1| hypothetical protein OsJ_12756 [Oryza sativa Japonica Group]
Length=444

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 130/203 (64%), Gaps = 17/203 (8%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P G    SW+PW
Sbjct  233  KERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAG--DGSWEPW  290

Query  701  GKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYID-TDKQVR  534
            G+LE WRER   G  DS+  RF +L    +H   + ++E  I+A KGG+F ID T  Q +
Sbjct  291  GRLECWRERGGAGASDSLGYRFDLLLPGVDH--AVPLAESSIAASKGGKFAIDLTSMQPQ  348

Query  533  AAAHppptppplpsprsSGDYAA-ALNPVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYV  360
            +         P  SPR SGD++   L   S  GFVMS  VQGE GRCSK P V++   +V
Sbjct  349  SRG-----GTPGCSPRGSGDFSQWPLASYSYRGFVMSSSVQGE-GRCSK-PTVEVGVPHV  401

Query  359  TCVEDAAIFMALAAAVDLSIEAC  291
             C EDAA F+ALAAAVDLS++AC
Sbjct  402  GCAEDAAAFVALAAAVDLSMDAC  424



>ref|XP_003558723.1| PREDICTED: uncharacterized protein LOC100826176 [Brachypodium 
distachyon]
Length=442

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 132/212 (62%), Gaps = 13/212 (6%)
 Frame = -1

Query  917  SSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVH  738
            S V  ++ E   +ERKGW VT+HDLSGS VA A + TPFV S+G   V+RSNPG WLI+ 
Sbjct  221  SMVPKTEREAAGKERKGWSVTVHDLSGSPVALASMVTPFVASSGSDRVSRSNPGAWLILR  280

Query  737  PDGCRPESWQPWGKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGG  567
            P G    +W+PWG+LE WRER   G  DS+  RF +L    +H   + +++  I+A KGG
Sbjct  281  PAG--DGAWEPWGRLECWRERGGAGSSDSLGYRFDLLVPGVDH--AVPIADSTIAASKGG  336

Query  566  EFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGRCSKPP  387
            +F +D    + AA        P  SPR SGD +        GFVMS  V+GE GRCSK P
Sbjct  337  KFALD----LTAAHPLSRGGTPGCSPRGSGDLSQWPLGSYRGFVMSAAVEGE-GRCSK-P  390

Query  386  FVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             V++   +V C EDAA F+ALAAAVDLS++AC
Sbjct  391  TVEVGVAHVGCAEDAAAFVALAAAVDLSMDAC  422



>ref|XP_002463817.1| hypothetical protein SORBIDRAFT_01g006730 [Sorghum bicolor]
 gb|EER90815.1| hypothetical protein SORBIDRAFT_01g006730 [Sorghum bicolor]
Length=436

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 138/240 (58%), Gaps = 26/240 (11%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAA  822
            +F CK  CR    D R P + P +   +S+          +ERKGW VT+HDL GS VA 
Sbjct  198  MFTCKFGCRSNS-DLRRPGMQPERDAGASA----------KERKGWSVTVHDLKGSPVAM  246

Query  821  AFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER---GIRDSICC  651
            A + TPFVPS G   V+RSNPG WLI+ P G    +W+PW +LE WRER   G  DS+  
Sbjct  247  ASMVTPFVPSPGTDRVSRSNPGAWLILRPAG--DGAWEPWARLECWRERGGAGASDSLGY  304

Query  650  RFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY  471
             F +L    +H   + +++  I + KGG+F ID    + AA        P  SPR SGD 
Sbjct  305  HFDLLVPGADHA--VALADSSIPSSKGGKFAID----LTAAQPLSRGGTPGCSPRGSGDL  358

Query  470  AAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +        GFVMS  VQGE GRCSK P V++   ++ C EDAA F+ALAAAVDLS++AC
Sbjct  359  SNWPLGNYRGFVMSAAVQGE-GRCSK-PTVEVGVAHIGCAEDAAAFVALAAAVDLSMDAC  416



>gb|AAP68894.1| unknown protein [Oryza sativa Japonica Group]
Length=404

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 17/203 (8%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P G    SW+PW
Sbjct  193  KERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAG--DGSWEPW  250

Query  701  GKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYID-TDKQVR  534
            G+LE WRER   G  +S+  RF +L    +H   + ++E  I+A KGG+F ID T  Q +
Sbjct  251  GRLECWRERGGAGASNSLGYRFDLLLPGVDH--AVPLAESSIAASKGGKFAIDLTSMQPQ  308

Query  533  AAAHppptppplpsprsSGDYAA-ALNPVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYV  360
            +         P  SPR SGD++   L   S  GFVMS  VQGE GRCSK P V++   +V
Sbjct  309  SRG-----GTPGCSPRGSGDFSQWPLASYSYRGFVMSSSVQGE-GRCSK-PTVEVGVPHV  361

Query  359  TCVEDAAIFMALAAAVDLSIEAC  291
             C EDAA F+ALAAAVDLS++AC
Sbjct  362  GCAEDAAAFVALAAAVDLSMDAC  384



>tpg|DAA51652.1| TPA: hypothetical protein ZEAMMB73_809833 [Zea mays]
Length=435

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 137/240 (57%), Gaps = 27/240 (11%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAA  822
            +F CK  CR    D R P + P +   S+           +ERKGW VT+HDL GSAVA 
Sbjct  198  MFTCKFGCRSNS-DLRRPGMQPERDAASA-----------KERKGWSVTVHDLKGSAVAM  245

Query  821  AFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER---GIRDSICC  651
            A + TPFVPS G   V+RSNPG WLI+ P G    +W+PW +LE WRER   G  DS+  
Sbjct  246  ASMVTPFVPSPGTDRVSRSNPGAWLILRPAG--DGAWEPWARLECWRERGGAGASDSLGY  303

Query  650  RFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY  471
             F +L    +H   + +++  I +  GG+F ID    + AA        P  SPR SGD 
Sbjct  304  HFALLVPGADHA--VALADSSIPSSNGGKFVID----LTAAQPLSRGGTPGCSPRGSGDL  357

Query  470  AAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +        GFVMS  VQGE GRCSK P V++   ++ C EDAA F+ALAAAVDLS++AC
Sbjct  358  SNWPLGNYRGFVMSAAVQGE-GRCSK-PTVEVGVAHIGCAEDAAAFVALAAAVDLSMDAC  415



>ref|XP_004955420.1| PREDICTED: uncharacterized protein LOC101777215 [Setaria italica]
Length=471

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 130/218 (60%), Gaps = 18/218 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W +  GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI
Sbjct  245  WLAKFGS-ERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGGWLI  303

Query  743  VHP-DGCRPESWQPWGKLEAWRER----GIRDSICCRFHVLCDSHEHRDDLLMSEILISA  579
            + P DG    +W PWG+LE WRER       DS+  RF ++ D       + ++E  +  
Sbjct  304  LRPVDG----TWTPWGRLECWRERGGAGAGGDSLGYRFELVPDHTNSGVGVCVAESGVPV  359

Query  578  EKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSG--GFVMSCRVQGEGG  405
             KGG F ID    + AA     +  P  SPR SGD+   L P     GFVMS  VQGE G
Sbjct  360  SKGGRFAID----LTAAQPFGRSGSPGCSPRGSGDFGHGLWPFGSFRGFVMSAAVQGE-G  414

Query  404  RCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            RCSK P V++   +V C EDAA F+ALAAAVDLS++AC
Sbjct  415  RCSK-PTVEVGVAHVGCAEDAAAFVALAAAVDLSMDAC  451



>gb|ACG44256.1| hypothetical protein [Zea mays]
Length=435

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 137/240 (57%), Gaps = 27/240 (11%)
 Frame = -1

Query  995  LFHCK--CRKLF*DYRIPQVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAA  822
            +F CK  CR    D R P + P +   S+           +ERKGW VT+HDL GSAVA 
Sbjct  198  MFTCKFGCRSNS-DLRRPGMQPERDAASA-----------KERKGWSVTVHDLKGSAVAM  245

Query  821  AFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPWGKLEAWRER---GIRDSICC  651
            A + TPFVPS G   V+RSNPG WLI+ P G    +W+PW +LE WRER   G  DS+  
Sbjct  246  ASMVTPFVPSPGTDRVSRSNPGAWLILRPAG--DGAWEPWARLECWRERGGAGASDSLGY  303

Query  650  RFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDY  471
             F +L    +H   + +++  I +  GG+F ID    + AA        P  SPR SGD 
Sbjct  304  HFALLIPGADH--AVALADSSIPSSNGGKFAID----LTAAQPLSRGGTPGCSPRGSGDL  357

Query  470  AAALNPVSGGFVMSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            +        GFVMS  VQGE GRCSK P V++   ++ C EDAA F+ALAAAVDLS++AC
Sbjct  358  SNWPLGNYRGFVMSAAVQGE-GRCSK-PTVEVGVAHIGCAEDAAAFVALAAAVDLSMDAC  415



>ref|NP_188602.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02555.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN12962.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF02152.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAE99219.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76275.1| uncharacterized protein AT3G19680 [Arabidopsis thaliana]
Length=491

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 122/228 (54%), Gaps = 31/228 (14%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            +S+ E   +ERKGW +T+HDLSGS VA A + TPFVPS G   V RS+PG WLI+ PDGC
Sbjct  252  NSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGC  311

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRE G  D++  RF +  D        + +   IS + GG F ID  
Sbjct  312  ---TWKPWGRLEAWREAGYSDTLGYRFELFQDGIA---TAVSASSSISLKNGGSFVIDVT  365

Query  545  KQVRAAAHppptppplpsprsSGDYAA---ALNPVSG--------------------GFV  435
                  A  P T P       SG  A    A  P SG                    GFV
Sbjct  366  GGTSTTASTPTTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLPQHPSAAAQNRGFV  425

Query  434  MSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            MS  V+G G R    P V++   +VTC EDAA  +ALAAAVDLS++AC
Sbjct  426  MSATVEGVGKRSK--PEVEVGVTHVTCTEDAAAHVALAAAVDLSLDAC  471



>gb|AAL60032.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 122/228 (54%), Gaps = 31/228 (14%)
 Frame = -1

Query  905  SSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGC  726
            +S+ E   +ERKGW +T+HDLSGS VA A + TPFVPS G   V RS+PG WLI+ PDGC
Sbjct  252  NSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGC  311

Query  725  RPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTD  546
               +W+PWG+LEAWRE G  D++  RF +  D        + +   IS + GG F ID  
Sbjct  312  ---TWKPWGRLEAWREAGYSDTLGYRFELFQDGIA---TAVSASSSISLKNGGSFVIDVT  365

Query  545  KQVRAAAHppptppplpsprsSGDYAA---ALNPVSG--------------------GFV  435
                  A  P T P       SG  A    A  P SG                    GFV
Sbjct  366  GGTSTTASTPTTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLPQHPSAAAQNRGFV  425

Query  434  MSCRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            MS  V+G G R    P V++   +VTC EDAA  +ALAAAVDLS++AC
Sbjct  426  MSATVEGVGKRSK--PEVEVGVTHVTCTEDAAAHVALAAAVDLSLDAC  471



>ref|NP_001051414.1| Os03g0773000 [Oryza sativa Japonica Group]
 gb|AAP68895.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99103.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13328.1| Os03g0773000 [Oryza sativa Japonica Group]
Length=444

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 17/203 (8%)
 Frame = -1

Query  881  RERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCRPESWQPW  702
            +ERKGW VT+HDLSGS VA A + TPFV S G   V+RSNPG WLI+ P G    SW+PW
Sbjct  233  KERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRPAG--DGSWEPW  290

Query  701  GKLEAWRER---GIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYID-TDKQVR  534
            G+LE WRER   G  +S+  RF +L    +H   + ++E  I+A KGG+F ID T  Q +
Sbjct  291  GRLECWRERGGAGASNSLGYRFDLLLPGVDH--AVPLAESSIAASKGGKFAIDLTSMQPQ  348

Query  533  AAAHppptppplpsprsSGDYAA-ALNPVS-GGFVMSCRVQGEGGRCSKPPFVQLAKRYV  360
            +         P  SPR SGD++   L   S  GFVMS  VQGE GRCSK P V++   +V
Sbjct  349  SRG-----GTPGCSPRGSGDFSQWPLASYSYRGFVMSSSVQGE-GRCSK-PTVEVGVPHV  401

Query  359  TCVEDAAIFMALAAAVDLSIEAC  291
             C EDAA F+ALAAAVDLS++AC
Sbjct  402  GCAEDAAAFVALAAAVDLSMDAC  424



>gb|KFK39297.1| hypothetical protein AALP_AA3G226300 [Arabis alpina]
Length=489

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 122/226 (54%), Gaps = 30/226 (13%)
 Frame = -1

Query  902  SDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLIVHPDGCR  723
            S+ E   +ERKGW +T+HDLSGS VA A + TPFVPS G   V RS+PG WLI+ PDGC 
Sbjct  252  SEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGC-  310

Query  722  PESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEILISAEKGGEFYIDTDK  543
              +W+PWG+LEAWRE G  D++  RF +  D        + +   IS + GG F ID   
Sbjct  311  --TWKPWGRLEAWRETGYSDTLGYRFELFQDGIA---TAVSASSSISLKNGGSFAIDVTG  365

Query  542  QVRAAAHppptpppl--psprsSGDYAAALNPVSG--------------------GFVMS  429
               AA+ P  +P         SS     A  P SG                    GFVMS
Sbjct  366  GTTAASTPSTSPQGSWDLGSGSSAGSRPASRPGSGSGSDFGYLLPQHPSLAAQNRGFVMS  425

Query  428  CRVQGEGGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
              V+G G R    P V++   +VTC EDAA  +ALAAAVDLS++AC
Sbjct  426  ATVEGVGKRSK--PEVEVGVTHVTCTEDAAAHVALAAAVDLSLDAC  469



>ref|XP_008671026.1| PREDICTED: uncharacterized protein LOC103648311 [Zea mays]
 tpg|DAA42726.1| TPA: hypothetical protein ZEAMMB73_556847 [Zea mays]
Length=455

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 131/220 (60%), Gaps = 22/220 (10%)
 Frame = -1

Query  947  QVDPLKSFWSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVAR  768
            Q DP    W + +GS + E   +ERKGW VT+HDLSGS VA A + TPFV S G   V+R
Sbjct  236  QSDPGARNWLAKLGS-ERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDHVSR  294

Query  767  SNPGTWLIVHP-DGCRPESWQPWGKLEAWRERGIRDSICCRFHVLCDSHEHRDDLLMSEI  591
            S+PG WLI+ P DG    +W PWG+LE WR RG  D++  RF ++         + ++E 
Sbjct  295  SSPGAWLILRPADG----TWAPWGRLECWRGRG--DTLGYRFELVPGHATGGAGVCVAEA  348

Query  590  LISAEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGE  411
             + A +GG F ID    + AAA             SSGD    + P  GGFVMS  VQGE
Sbjct  349  SVPASRGGRFAID----LTAAAQ-------PFWCSSSGDMGHGIWPF-GGFVMSAAVQGE  396

Query  410  GGRCSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
             GRCS+ P V++   +V C EDAA F+ALAAAVDLS++AC
Sbjct  397  -GRCSR-PTVEVGVAHVGCAEDAAAFVALAAAVDLSMDAC  434



>ref|NP_001058837.1| Os07g0133500 [Oryza sativa Japonica Group]
 dbj|BAC78571.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC82946.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30606.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20751.1| Os07g0133500 [Oryza sativa Japonica Group]
 gb|EAZ38604.1| hypothetical protein OsJ_22992 [Oryza sativa Japonica Group]
 dbj|BAG97653.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 130/217 (60%), Gaps = 17/217 (8%)
 Frame = -1

Query  923  WSSSVGSSDLEIERRERKGWKVTIHDLSGSAVAAAFITTPFVPSTGCAWVARSNPGTWLI  744
            W ++ GS D E   +ERKGW VT+HDLSGS VA A + TPFV S G   V++SNPG WL+
Sbjct  237  WLTAFGS-DRERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVSKSNPGAWLV  295

Query  743  VHP-DGCRPESWQPWGKLEAWRERG----IRDSICCRFH-VLCDSHEHRDDLLMSEILIS  582
            + P DG    +W+PWG+LE WRERG      DS+  RF  VL D       + ++E  I 
Sbjct  296  LRPGDG----TWKPWGRLECWRERGAGAAAGDSLGYRFELVLPDPTGMGVGVSVAESTIP  351

Query  581  AEKGGEFYIDTDKQVRAAAHppptppplpsprsSGDYAAALNPVSGGFVMSCRVQGEGGR  402
            A KGG F ID    + A      +  P  SP  SGDY         GFVMS  VQGE G+
Sbjct  352  ASKGGRFAID----LTATQQFGRSGSPACSPCGSGDYGMWPFGSCRGFVMSAAVQGE-GK  406

Query  401  CSKPPFVQLAKRYVTCVEDAAIFMALAAAVDLSIEAC  291
            CS+ P V++  + V C EDAA F+ALAAAVDLS++AC
Sbjct  407  CSR-PAVEVGVQNVGCAEDAAAFVALAAAVDLSMDAC  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2689904046432