BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24746_g1_i3 len=1201 path=[3728:0-108 1232:109-138 1262:139-172
1296:173-226 1350:227-292 1416:293-329 1453:330-468 1592:469-523
1647:524-572 1696:573-599 1723:600-609 1733:610-668 1792:669-688
1812:689-712 1836:713-763 1887:764-798 4101:799-808 1932:809-839
1963:840-995 2119:996-1009 2133:1010-1200]

Length=1201
                                                                      Score     E

gb|EYU36148.1|  hypothetical protein MIMGU_mgv1a011053mg                439   6e-150   
ref|XP_006488017.1|  PREDICTED: probable xyloglucan endotransgluc...    436   8e-149   
ref|XP_006424466.1|  hypothetical protein CICLE_v10028945mg             436   9e-149   
emb|CDP07041.1|  unnamed protein product                                433   6e-148   
ref|XP_008226948.1|  PREDICTED: probable xyloglucan endotransgluc...    433   1e-147   
ref|XP_008226469.1|  PREDICTED: probable xyloglucan endotransgluc...    430   2e-146   
ref|XP_011088791.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    429   4e-146   
gb|ABK30788.1|  xyloglucan endotransglycosylase 1                       427   2e-145   Litchi chinensis [litchi]
ref|XP_002523709.1|  Xyloglucan endotransglucosylase/hydrolase pr...    426   3e-145   Ricinus communis
ref|XP_007205463.1|  hypothetical protein PRUPE_ppa007943mg             426   5e-144   
ref|XP_009765915.1|  PREDICTED: probable xyloglucan endotransgluc...    423   9e-144   
ref|XP_009619507.1|  PREDICTED: probable xyloglucan endotransgluc...    423   1e-143   
ref|XP_010267216.1|  PREDICTED: probable xyloglucan endotransgluc...    420   9e-143   
ref|XP_010031407.1|  PREDICTED: probable xyloglucan endotransgluc...    420   1e-142   
ref|XP_009345745.1|  PREDICTED: probable xyloglucan endotransgluc...    419   2e-142   
ref|XP_007150148.1|  hypothetical protein PHAVU_005G130900g             419   4e-142   
gb|KHN21066.1|  Putative xyloglucan endotransglucosylase/hydrolas...    419   6e-142   
ref|XP_006349017.1|  PREDICTED: probable xyloglucan endotransgluc...    417   1e-141   
ref|XP_009335973.1|  PREDICTED: probable xyloglucan endotransgluc...    417   1e-141   
ref|NP_001233819.1|  xyloglucan endotransglucosylase-hydrolase XT...    417   2e-141   
ref|XP_007132324.1|  hypothetical protein PHAVU_011G085200g             417   2e-141   
gb|ABU93486.1|  xyloglucan endotraglucosylase/hydrolase                 416   4e-141   Vigna angularis [azuki bean]
emb|CAA48324.1|  cellulase                                              416   4e-141   Tropaeolum majus
ref|XP_007016865.1|  Xyloglucan endotransglucosylase/hydrolase pr...    417   1e-140   
ref|XP_003539787.1|  PREDICTED: probable xyloglucan endotransgluc...    415   1e-140   
ref|XP_002269285.1|  PREDICTED: probable xyloglucan endotransgluc...    415   1e-140   Vitis vinifera
ref|XP_004506064.1|  PREDICTED: probable xyloglucan endotransgluc...    415   1e-140   
ref|XP_009356929.1|  PREDICTED: probable xyloglucan endotransgluc...    414   2e-140   
ref|NP_001241497.1|  uncharacterized protein LOC100776165 precursor     414   2e-140   
ref|XP_004287556.1|  PREDICTED: probable xyloglucan endotransgluc...    413   5e-140   
gb|AAK51119.1|  xyloglucan endo-transglycosylase                        412   1e-139   Carica papaya [mamon]
ref|XP_006366092.1|  PREDICTED: probable xyloglucan endotransgluc...    412   1e-139   
ref|XP_008359637.1|  PREDICTED: probable xyloglucan endotransgluc...    412   2e-139   
pdb|2UWC|A  Chain A, Crystal Structure Of Nasturtium Xyloglucan H...    410   3e-139   
ref|XP_010535628.1|  PREDICTED: probable xyloglucan endotransgluc...    411   4e-139   
gb|KHN06880.1|  Putative xyloglucan endotransglucosylase/hydrolas...    410   5e-139   
ref|XP_003540201.1|  PREDICTED: probable xyloglucan endotransgluc...    410   7e-139   
pdb|2UWA|A  Chain A, Crystal Structure Of The Nasturtium Seedling...    409   8e-139   
ref|XP_011089954.1|  PREDICTED: probable xyloglucan endotransgluc...    410   1e-138   
ref|XP_004515909.1|  PREDICTED: probable xyloglucan endotransgluc...    410   1e-138   
gb|EYU37038.1|  hypothetical protein MIMGU_mgv1a021958mg                409   1e-138   
gb|KHN09532.1|  Putative xyloglucan endotransglucosylase/hydrolas...    409   2e-138   
gb|AES88539.2|  xyloglucan endotransglucosylase/hydrolase family ...    409   2e-138   
gb|KHN21488.1|  Putative xyloglucan endotransglucosylase/hydrolas...    409   3e-138   
ref|NP_001240151.1|  uncharacterized protein LOC100796768 precursor     409   4e-138   
pdb|2VH9|A  Chain A, Crystal Structure Of Nxg1-Deltayniig In Comp...    408   6e-138   
ref|NP_001241974.1|  uncharacterized protein LOC100796698 precursor     407   1e-137   
emb|CDX75009.1|  BnaA05g07550D                                          407   1e-137   
ref|XP_009143551.1|  PREDICTED: probable xyloglucan endotransgluc...    407   2e-137   
emb|CDY33199.1|  BnaC04g08400D                                          405   9e-137   
gb|ABU93485.1|  xyloglucan endotraglucosylase/hydrolase                 405   1e-136   Vigna angularis [azuki bean]
ref|XP_003597276.1|  Xyloglucan endotransglycosylase                    405   2e-136   
ref|XP_010505232.1|  PREDICTED: probable xyloglucan endotransgluc...    404   2e-136   
ref|XP_007162780.1|  hypothetical protein PHAVU_001G179900g             404   2e-136   
ref|XP_010516915.1|  PREDICTED: probable xyloglucan endotransgluc...    404   2e-136   
gb|AFK34415.1|  unknown                                                 404   2e-136   
ref|XP_010509425.1|  PREDICTED: probable xyloglucan endotransgluc...    404   3e-136   
ref|XP_003625695.1|  Xyloglucan endotransglucosylase/hydrolase          403   4e-136   
gb|KEH42168.1|  xyloglucan endotransglucosylase/hydrolase family ...    403   7e-136   
ref|XP_006410858.1|  hypothetical protein EUTSA_v10016912mg             404   7e-136   
ref|XP_006294559.1|  hypothetical protein CARUB_v10023595mg             404   8e-136   
ref|XP_004494070.1|  PREDICTED: probable xyloglucan endotransgluc...    402   8e-136   
ref|XP_008385521.1|  PREDICTED: probable xyloglucan endotransgluc...    402   1e-135   
ref|XP_009377030.1|  PREDICTED: probable xyloglucan endotransgluc...    402   1e-135   
pdb|2UWB|A  Chain A, Crystal Structure Of The Nasturtium Seedling...    401   1e-135   
ref|XP_009390370.1|  PREDICTED: probable xyloglucan endotransgluc...    402   2e-135   
gb|KHG09774.1|  putative xyloglucan endotransglucosylase/hydrolas...    401   2e-135   
ref|XP_008369544.1|  PREDICTED: probable xyloglucan endotransgluc...    401   2e-135   
ref|XP_007202396.1|  hypothetical protein PRUPE_ppa009437mg             401   3e-135   
ref|NP_181224.1|  probable xyloglucan endotransglucosylase/hydrol...    401   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027440.1|  Xyloglucan endotransglucosylase/hydrolase 32...    402   4e-135   
ref|XP_008241393.1|  PREDICTED: probable xyloglucan endotransgluc...    400   6e-135   
ref|NP_001280929.1|  probable xyloglucan endotransglucosylase/hyd...    400   6e-135   
ref|XP_010509424.1|  PREDICTED: probable xyloglucan endotransgluc...    400   8e-135   
ref|XP_002881475.1|  hypothetical protein ARALYDRAFT_482667             400   1e-134   
ref|XP_011094597.1|  PREDICTED: probable xyloglucan endotransgluc...    399   2e-134   
ref|XP_010243244.1|  PREDICTED: probable xyloglucan endotransgluc...    399   2e-134   
ref|XP_003554394.1|  PREDICTED: probable xyloglucan endotransgluc...    399   2e-134   
ref|XP_009133100.1|  PREDICTED: probable xyloglucan endotransgluc...    399   3e-134   
ref|XP_010918611.1|  PREDICTED: probable xyloglucan endotransgluc...    399   3e-134   
ref|XP_003542521.1|  PREDICTED: probable xyloglucan endotransgluc...    399   3e-134   
gb|KFK36563.1|  hypothetical protein AALP_AA4G139600                    399   3e-134   
ref|XP_010050769.1|  PREDICTED: probable xyloglucan endotransgluc...    398   4e-134   
ref|XP_010527991.1|  PREDICTED: probable xyloglucan endotransgluc...    397   1e-133   
ref|XP_006354379.1|  PREDICTED: probable xyloglucan endotransgluc...    397   2e-133   
gb|KHF98411.1|  putative xyloglucan endotransglucosylase/hydrolas...    396   2e-133   
emb|CDY67349.1|  BnaCnng54620D                                          396   3e-133   
ref|XP_004487062.1|  PREDICTED: probable xyloglucan endotransgluc...    396   3e-133   
ref|XP_009141612.1|  PREDICTED: probable xyloglucan endotransgluc...    395   6e-133   
ref|XP_010689134.1|  PREDICTED: probable xyloglucan endotransgluc...    395   6e-133   
ref|XP_011006618.1|  PREDICTED: probable xyloglucan endotransgluc...    395   8e-133   
emb|CDY31016.1|  BnaC03g55190D                                          394   1e-132   
ref|XP_002323501.1|  xyloglucan endotransglucosylase/hydrolase pr...    394   1e-132   Populus trichocarpa [western balsam poplar]
ref|XP_009611819.1|  PREDICTED: probable xyloglucan endotransgluc...    394   1e-132   
ref|XP_004246615.1|  PREDICTED: probable xyloglucan endotransgluc...    394   1e-132   
ref|XP_006428458.1|  hypothetical protein CICLE_v10012353mg             394   2e-132   
ref|XP_008442717.1|  PREDICTED: probable xyloglucan endotransgluc...    394   2e-132   
ref|XP_006381392.1|  xyloglucan endotransglucosylase/hydrolase pr...    394   2e-132   
ref|XP_009398020.1|  PREDICTED: probable xyloglucan endotransgluc...    394   2e-132   
ref|XP_007016866.1|  Xyloglucan endotransglucosylase/hydrolase 32...    392   3e-132   
gb|KDP29175.1|  hypothetical protein JCGZ_16564                         393   3e-132   
ref|XP_006491659.1|  PREDICTED: probable xyloglucan endotransgluc...    393   4e-132   
ref|XP_002519471.1|  Xyloglucan endotransglucosylase/hydrolase pr...    393   6e-132   Ricinus communis
gb|KHG06305.1|  putative xyloglucan endotransglucosylase/hydrolas...    393   6e-132   
ref|XP_006291596.1|  hypothetical protein CARUB_v10017750mg             393   6e-132   
ref|XP_011015586.1|  PREDICTED: probable xyloglucan endotransgluc...    392   8e-132   
ref|XP_004161263.1|  PREDICTED: probable xyloglucan endotransgluc...    392   1e-131   
ref|XP_004137842.1|  PREDICTED: probable xyloglucan endotransgluc...    392   1e-131   
ref|XP_011032301.1|  PREDICTED: probable xyloglucan endotransgluc...    392   2e-131   
ref|XP_009150317.1|  PREDICTED: probable xyloglucan endotransgluc...    391   2e-131   
ref|XP_004304471.1|  PREDICTED: probable xyloglucan endotransgluc...    391   2e-131   
dbj|BAB78506.1|  Xyloglucan endo-transglycosylase                       391   2e-131   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_002275862.1|  PREDICTED: probable xyloglucan endotransgluc...    391   3e-131   Vitis vinifera
gb|KHN39069.1|  Putative xyloglucan endotransglucosylase/hydrolas...    391   4e-131   
ref|XP_008465400.1|  PREDICTED: probable xyloglucan endotransgluc...    392   5e-131   
ref|XP_002313534.2|  xyloglucan endotransglucosylase/hydrolase pr...    390   5e-131   Populus trichocarpa [western balsam poplar]
ref|XP_010908974.1|  PREDICTED: probable xyloglucan endotransgluc...    390   5e-131   
ref|XP_009772755.1|  PREDICTED: probable xyloglucan endotransgluc...    390   7e-131   
emb|CDX99172.1|  BnaA06g18630D                                          390   7e-131   
ref|XP_006419084.1|  hypothetical protein EUTSA_v10002627mg             390   9e-131   
gb|KHG21816.1|  putative xyloglucan endotransglucosylase/hydrolas...    390   9e-131   
ref|XP_003535142.1|  PREDICTED: probable xyloglucan endotransgluc...    389   1e-130   
gb|ACD03222.1|  xyloglucan endotransglucosylase/hydrolase 12            389   2e-130   Actinidia eriantha
ref|XP_008805707.1|  PREDICTED: probable xyloglucan endotransgluc...    389   2e-130   
ref|XP_008799509.1|  PREDICTED: probable xyloglucan endotransgluc...    389   2e-130   
ref|XP_010696289.1|  PREDICTED: probable xyloglucan endotransgluc...    388   5e-130   
ref|XP_010098793.1|  putative xyloglucan endotransglucosylase/hyd...    387   6e-130   
ref|XP_011018780.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
gb|KDP43978.1|  hypothetical protein JCGZ_05445                         387   1e-129   
ref|XP_002877376.1|  hypothetical protein ARALYDRAFT_484893             387   1e-129   
ref|XP_009149823.1|  PREDICTED: probable xyloglucan endotransgluc...    386   2e-129   
emb|CDY29731.1|  BnaAnng03530D                                          386   3e-129   
ref|XP_010045311.1|  PREDICTED: probable xyloglucan endotransgluc...    386   5e-129   
ref|XP_004147295.1|  PREDICTED: probable xyloglucan endotransgluc...    384   5e-129   
gb|AEX07607.1|  xyloglucosyl transferase 3                              385   6e-129   
ref|XP_008462950.1|  PREDICTED: probable xyloglucan endotransgluc...    385   8e-129   
gb|KGN64814.1|  hypothetical protein Csa_1G109370                       384   1e-128   
ref|XP_004163686.1|  PREDICTED: probable xyloglucan endotransgluc...    384   1e-128   
emb|CBI30149.3|  unnamed protein product                                382   3e-128   
ref|XP_010111835.1|  putative xyloglucan endotransglucosylase/hyd...    390   9e-128   
ref|XP_009386049.1|  PREDICTED: probable xyloglucan endotransgluc...    382   9e-128   
ref|XP_009394629.1|  PREDICTED: probable xyloglucan endotransgluc...    381   2e-127   
ref|NP_190085.1|  xyloglucan endotransglucosylase/hydrolase             381   2e-127   Arabidopsis thaliana [mouse-ear cress]
emb|CAA63553.1|  xyloglucan endo-transglycosylase                       380   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418099.1|  PREDICTED: probable xyloglucan endotransgluc...    378   4e-126   
ref|XP_010503152.1|  PREDICTED: probable xyloglucan endotransgluc...    377   1e-125   
gb|KGN46873.1|  hypothetical protein Csa_6G147660                       376   2e-125   
ref|XP_004145761.1|  PREDICTED: probable xyloglucan endotransgluc...    376   3e-125   
ref|XP_009413141.1|  PREDICTED: probable xyloglucan endotransgluc...    374   1e-124   
ref|XP_010425930.1|  PREDICTED: probable xyloglucan endotransgluc...    373   3e-124   
ref|XP_010514834.1|  PREDICTED: probable xyloglucan endotransgluc...    372   7e-124   
emb|CCH26634.1|  putative xyloglucan endotransglucosylase/hydrolase     372   7e-124   
ref|XP_004160069.1|  PREDICTED: probable xyloglucan endotransgluc...    372   9e-124   
ref|XP_006833493.1|  hypothetical protein AMTR_s00082p00180450          371   2e-123   
ref|XP_009382126.1|  PREDICTED: probable xyloglucan endotransgluc...    370   3e-123   
emb|CDP15274.1|  unnamed protein product                                369   4e-123   
dbj|BAC45131.1|  putative xyloglucan endo-transglycosylase              369   9e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007144347.1|  hypothetical protein PHAVU_007G148500g             371   1e-122   
gb|EPS62787.1|  hypothetical protein M569_12004                         368   3e-122   
ref|XP_008779033.1|  PREDICTED: probable xyloglucan endotransgluc...    367   5e-122   
ref|XP_004983770.1|  PREDICTED: probable xyloglucan endotransgluc...    368   5e-122   
gb|EAZ16868.1|  hypothetical protein OsJ_32344                          367   8e-122   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79406.1|  hypothetical protein OsI_34534                          367   8e-122   Oryza sativa Indica Group [Indian rice]
ref|NP_001065209.2|  Os10g0545500                                       367   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048699.1|  Os03g0108300                                       365   8e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418263.1|  PREDICTED: probable xyloglucan endotransgluc...    364   1e-120   
ref|XP_006662567.1|  PREDICTED: probable xyloglucan endotransgluc...    362   6e-120   
ref|XP_003563122.1|  PREDICTED: probable xyloglucan endotransgluc...    362   1e-119   
gb|EAZ03861.1|  hypothetical protein OsI_25995                          361   2e-119   Oryza sativa Indica Group [Indian rice]
emb|CCH26633.1|  putative xyloglucan endotransglucosylase/hydrolase     360   4e-119   
ref|XP_010940514.1|  PREDICTED: probable xyloglucan endotransgluc...    360   4e-119   
ref|XP_008787464.1|  PREDICTED: probable xyloglucan endotransgluc...    359   6e-119   
ref|XP_010935831.1|  PREDICTED: probable xyloglucan endotransgluc...    359   7e-119   
gb|ACS13755.1|  xyloglucan xyloglucosyl transferase                     359   1e-118   Hordeum vulgare [barley]
ref|XP_002467558.1|  hypothetical protein SORBIDRAFT_01g030140          358   3e-118   Sorghum bicolor [broomcorn]
ref|XP_009418633.1|  PREDICTED: probable xyloglucan endotransgluc...    357   4e-118   
ref|NP_001148432.1|  xyloglucan endotransglucosylase/hydrolase pr...    353   4e-116   Zea mays [maize]
tpg|DAA46166.1|  TPA: xyloglucan endotransglucosylase/hydrolase p...    354   5e-116   
ref|XP_004957690.1|  PREDICTED: probable xyloglucan endotransgluc...    352   6e-116   
ref|XP_009396171.1|  PREDICTED: probable xyloglucan endotransgluc...    349   6e-115   
tpg|DAA62696.1|  TPA: xyloglucan endotransglucosylase/hydrolase p...    349   1e-114   
ref|XP_004986046.1|  PREDICTED: probable xyloglucan endotransgluc...    349   1e-114   
ref|XP_002460690.1|  hypothetical protein SORBIDRAFT_02g033240          349   2e-114   Sorghum bicolor [broomcorn]
dbj|BAJ88307.1|  predicted protein                                      347   8e-114   
ref|NP_001151883.1|  LOC100285520 precursor                             347   1e-113   Zea mays [maize]
gb|AAN62784.1|  Putative cellulase                                      342   1e-112   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132709.1|  uncharacterized protein LOC100194192 precursor     343   1e-112   Zea mays [maize]
dbj|BAJ93467.1|  predicted protein                                      342   5e-112   
ref|XP_009396169.1|  PREDICTED: probable xyloglucan endotransgluc...    343   6e-112   
ref|NP_001141552.1|  uncharacterized protein LOC100273667 precursor     343   7e-112   Zea mays [maize]
ref|NP_001148998.1|  xyloglucan endotransglucosylase/hydrolase pr...    338   1e-110   Zea mays [maize]
gb|EMT14079.1|  Putative xyloglucan endotransglucosylase/hydrolas...    333   1e-108   
ref|XP_003559007.1|  PREDICTED: probable xyloglucan endotransgluc...    333   3e-108   
ref|XP_002466013.1|  hypothetical protein SORBIDRAFT_01g050070          327   1e-105   Sorghum bicolor [broomcorn]
dbj|BAD22925.1|  putative xyloglucan endo-transglycosylase              321   2e-103   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ25136.1|  hypothetical protein OsJ_08934                          307   3e-98    Oryza sativa Japonica Group [Japonica rice]
emb|CAA48325.1|  cellulase                                              290   3e-93    Tropaeolum majus
gb|AAT40137.1|  putative xyloglucan endotransglycosylase                288   2e-92    Bassia scoparia [burning bush]
gb|EAZ39802.1|  hypothetical protein OsJ_24243                          284   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658556.1|  PREDICTED: probable xyloglucan endotransgluc...    282   1e-89    
gb|KDO39060.1|  hypothetical protein CISIN_1g043947mg                   277   3e-88    
gb|ABK22838.1|  unknown                                                 279   1e-87    Picea sitchensis
gb|ABK21200.1|  unknown                                                 279   1e-87    Picea sitchensis
gb|ABK22090.1|  unknown                                                 272   3e-85    Picea sitchensis
gb|EPS73223.1|  hypothetical protein M569_01533                         268   2e-84    
tpg|DAA46168.1|  TPA: hypothetical protein ZEAMMB73_368676              272   2e-84    
gb|ABK23544.1|  unknown                                                 270   7e-84    Picea sitchensis
ref|XP_009396170.1|  PREDICTED: probable xyloglucan endotransgluc...    268   2e-83    
ref|NP_001189692.1|  probable xyloglucan endotransglucosylase/hyd...    246   3e-76    
ref|XP_006576235.1|  PREDICTED: uncharacterized protein LOC100796...    244   7e-76    
ref|XP_006592278.1|  PREDICTED: probable xyloglucan endotransgluc...    244   2e-75    
ref|XP_006592712.1|  PREDICTED: probable xyloglucan endotransgluc...    242   1e-74    
ref|XP_010505233.1|  PREDICTED: probable xyloglucan endotransgluc...    241   3e-74    
ref|XP_006593441.1|  PREDICTED: uncharacterized protein LOC100796...    241   4e-74    
ref|XP_006604581.1|  PREDICTED: probable xyloglucan endotransgluc...    240   5e-74    
gb|EYU29882.1|  hypothetical protein MIMGU_mgv1a0118912mg               236   4e-72    
ref|XP_010243245.1|  PREDICTED: probable xyloglucan endotransgluc...    235   7e-72    
ref|XP_010243246.1|  PREDICTED: probable xyloglucan endotransgluc...    234   2e-71    
gb|AFK41967.1|  unknown                                                 233   2e-71    
ref|XP_010243247.1|  PREDICTED: probable xyloglucan endotransgluc...    233   4e-71    
ref|XP_011006619.1|  PREDICTED: probable xyloglucan endotransgluc...    232   5e-71    
ref|XP_011015587.1|  PREDICTED: probable xyloglucan endotransgluc...    230   3e-70    
ref|XP_009349873.1|  PREDICTED: probable xyloglucan endotransgluc...    230   3e-70    
gb|EMT25877.1|  hypothetical protein F775_52572                         231   3e-69    
gb|AAT90325.1|  xyloglucan endotransglycosylase                         225   1e-68    Prunus armeniaca
ref|XP_006650958.1|  PREDICTED: probable xyloglucan endotransgluc...    223   7e-67    
gb|ADE76197.1|  unknown                                                 222   1e-66    
ref|XP_010514835.1|  PREDICTED: probable xyloglucan endotransgluc...    221   1e-66    
ref|XP_006848333.1|  hypothetical protein AMTR_s00013p00167480          221   5e-66    
gb|AFK39336.1|  unknown                                                 217   2e-65    
gb|KEH40692.1|  xyloglucan endotransglucosylase/hydrolase family ...    220   2e-64    
gb|EMS47743.1|  putative xyloglucan endotransglucosylase/hydrolas...    217   2e-64    
ref|XP_009621666.1|  PREDICTED: probable xyloglucan endotransgluc...    219   5e-64    
ref|XP_007222502.1|  hypothetical protein PRUPE_ppa008275mg             218   2e-63    
gb|ACD03223.1|  xyloglucan endotransglucosylase/hydrolase 13            216   1e-62    Actinidia deliciosa [Chinese gooseberry]
ref|XP_009621345.1|  PREDICTED: probable xyloglucan endotransgluc...    216   1e-62    
ref|XP_010043929.1|  PREDICTED: probable xyloglucan endotransgluc...    216   1e-62    
dbj|BAK07675.1|  predicted protein                                      216   1e-62    
gb|AAK30204.1|AF349963_1  endoxyloglucan transferase                    216   2e-62    Daucus carota [carrots]
ref|XP_009777519.1|  PREDICTED: probable xyloglucan endotransgluc...    215   2e-62    
ref|XP_010066550.1|  PREDICTED: probable xyloglucan endotransgluc...    214   4e-62    
ref|XP_009763784.1|  PREDICTED: probable xyloglucan endotransgluc...    214   6e-62    
ref|XP_006355045.1|  PREDICTED: probable xyloglucan endotransgluc...    214   6e-62    
ref|XP_008795338.1|  PREDICTED: probable xyloglucan endotransgluc...    214   6e-62    
ref|XP_009409244.1|  PREDICTED: probable xyloglucan endotransgluc...    213   1e-61    
ref|XP_008373536.1|  PREDICTED: probable xyloglucan endotransgluc...    213   2e-61    
ref|XP_008220940.1|  PREDICTED: probable xyloglucan endotransgluc...    213   2e-61    
ref|XP_004297402.1|  PREDICTED: probable xyloglucan endotransgluc...    212   3e-61    
gb|ADE42489.1|  xyloglucan endotransglucosylase/hydrolase 2             211   5e-61    
ref|XP_002462345.1|  hypothetical protein SORBIDRAFT_02g024120          212   6e-61    Sorghum bicolor [broomcorn]
ref|XP_008652681.1|  PREDICTED: probable xyloglucan endotransgluc...    212   7e-61    
ref|XP_006364060.1|  PREDICTED: probable xyloglucan endotransgluc...    211   9e-61    
gb|KHN25480.1|  Putative xyloglucan endotransglucosylase/hydrolas...    211   9e-61    
ref|XP_006649185.1|  PREDICTED: probable xyloglucan endotransgluc...    207   9e-61    
ref|XP_003555818.1|  PREDICTED: probable xyloglucan endotransgluc...    211   1e-60    
emb|CAA16756.1|  xyloglucan endo-transglycosylase-like protein          211   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002976477.1|  hypothetical protein SELMODRAFT_56624              208   1e-60    
ref|XP_011070536.1|  PREDICTED: probable xyloglucan endotransgluc...    211   1e-60    
gb|ADE42491.1|  xyloglucan endotransglucosylase/hydrolase 2             209   1e-60    
ref|XP_009351584.1|  PREDICTED: probable xyloglucan endotransgluc...    211   1e-60    
ref|XP_003529235.1|  PREDICTED: probable xyloglucan endotransgluc...    211   1e-60    
ref|XP_008389143.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    211   1e-60    
gb|AFW63928.1|  hypothetical protein ZEAMMB73_893886                    206   2e-60    
emb|CDM81332.1|  unnamed protein product                                209   2e-60    
emb|CDX78912.1|  BnaA01g09790D                                          211   2e-60    
ref|XP_008365814.1|  PREDICTED: probable xyloglucan endotransgluc...    210   2e-60    
emb|CDX99402.1|  BnaC01g11500D                                          210   2e-60    
ref|XP_004236920.1|  PREDICTED: probable xyloglucan endotransgluc...    210   2e-60    
gb|EPS65144.1|  hypothetical protein M569_09632                         213   2e-60    
ref|XP_002973430.1|  hypothetical protein SELMODRAFT_56616              207   2e-60    
ref|XP_010271956.1|  PREDICTED: probable xyloglucan endotransgluc...    209   3e-60    
emb|CDP05491.1|  unnamed protein product                                211   3e-60    
ref|XP_004162296.1|  PREDICTED: probable xyloglucan endotransgluc...    209   3e-60    
ref|XP_004297401.1|  PREDICTED: probable xyloglucan endotransgluc...    209   3e-60    
ref|XP_008466948.1|  PREDICTED: probable xyloglucan endotransgluc...    209   4e-60    
ref|XP_010913577.1|  PREDICTED: probable xyloglucan endotransgluc...    209   4e-60    
ref|NP_001049503.1|  Os03g0239000                                       209   4e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EAY89191.1|  hypothetical protein OsI_10687                          209   5e-60    Oryza sativa Indica Group [Indian rice]
gb|KFK44960.1|  hypothetical protein AALP_AA1G325900                    209   5e-60    
ref|XP_011000931.1|  PREDICTED: probable xyloglucan endotransgluc...    207   6e-60    
ref|XP_007045473.1|  Xyloglucan endotransglucosylase/hydrolase 28       209   6e-60    
tpg|DAA46167.1|  TPA: hypothetical protein ZEAMMB73_368676              205   8e-60    
ref|XP_007210518.1|  hypothetical protein PRUPE_ppa007685mg             209   8e-60    
ref|XP_004142816.1|  PREDICTED: probable xyloglucan endotransgluc...    208   8e-60    
ref|XP_009107996.1|  PREDICTED: probable xyloglucan endotransgluc...    209   9e-60    
ref|XP_009405165.1|  PREDICTED: probable xyloglucan endotransgluc...    208   1e-59    
gb|EMT07251.1|  Xyloglucan endotransglucosylase/hydrolase protein 3     206   1e-59    
ref|XP_007223169.1|  hypothetical protein PRUPE_ppa009090mg             207   1e-59    
ref|XP_004985060.1|  PREDICTED: probable xyloglucan endotransgluc...    208   1e-59    
ref|XP_004514368.1|  PREDICTED: probable xyloglucan endotransgluc...    208   1e-59    
ref|XP_009414090.1|  PREDICTED: probable xyloglucan endotransgluc...    208   2e-59    
ref|XP_007019688.1|  Xyloglucan:xyloglucosyl transferase 33             207   2e-59    
ref|XP_009380067.1|  PREDICTED: probable xyloglucan endotransgluc...    208   2e-59    
ref|XP_002981828.1|  hypothetical protein SELMODRAFT_115266             204   2e-59    
ref|XP_011070344.1|  PREDICTED: probable xyloglucan endotransgluc...    208   2e-59    
ref|XP_008221789.1|  PREDICTED: probable xyloglucan endotransgluc...    206   2e-59    
emb|CDP20286.1|  unnamed protein product                                207   2e-59    
ref|XP_010544004.1|  PREDICTED: probable xyloglucan endotransgluc...    207   2e-59    
ref|XP_006415244.1|  hypothetical protein EUTSA_v10008109mg             207   3e-59    
ref|XP_010105548.1|  putative xyloglucan endotransglucosylase/hyd...    207   4e-59    
ref|XP_002982797.1|  hypothetical protein SELMODRAFT_117370             203   4e-59    
gb|EMT08504.1|  Putative xyloglucan endotransglucosylase/hydrolas...    206   4e-59    
emb|CDY01577.1|  BnaC07g35670D                                          207   4e-59    
ref|XP_002973138.1|  hypothetical protein SELMODRAFT_232041             204   4e-59    
ref|XP_009390348.1|  PREDICTED: probable xyloglucan endotransgluc...    206   5e-59    
ref|XP_009136983.1|  PREDICTED: probable xyloglucan endotransgluc...    207   5e-59    
gb|KHG29510.1|  putative xyloglucan endotransglucosylase/hydrolas...    206   5e-59    
ref|XP_010906322.1|  PREDICTED: probable xyloglucan endotransgluc...    206   6e-59    
dbj|BAA88668.1|  ETAG-A3                                                206   6e-59    
ref|XP_010478638.1|  PREDICTED: probable xyloglucan endotransgluc...    206   7e-59    
ref|XP_009390346.1|  PREDICTED: probable xyloglucan endotransgluc...    206   7e-59    
ref|XP_009132429.1|  PREDICTED: probable xyloglucan endotransgluc...    206   7e-59    
gb|KDP38168.1|  hypothetical protein JCGZ_04811                         206   8e-59    
emb|CDY60254.1|  BnaCnng35910D                                          206   8e-59    
ref|XP_006303176.1|  hypothetical protein CARUB_v10009628mg             206   9e-59    
emb|CDY35550.1|  BnaA05g16360D                                          206   1e-58    
ref|XP_010240917.1|  PREDICTED: probable xyloglucan endotransgluc...    204   1e-58    
gb|EMT07252.1|  Putative xyloglucan endotransglucosylase/hydrolas...    204   1e-58    
ref|XP_009391747.1|  PREDICTED: probable xyloglucan endotransgluc...    205   1e-58    
ref|XP_010553506.1|  PREDICTED: probable xyloglucan endotransgluc...    205   1e-58    
emb|CDY20621.1|  BnaC08g14370D                                          204   1e-58    
ref|XP_010674965.1|  PREDICTED: probable xyloglucan endotransgluc...    205   1e-58    
gb|EPS58610.1|  xyloglucan endotransglucosylase/hydrolase 13            204   1e-58    
emb|CDY29941.1|  BnaC05g28950D                                          206   1e-58    
ref|XP_010499761.1|  PREDICTED: probable xyloglucan endotransgluc...    205   2e-58    
ref|XP_008798384.1|  PREDICTED: probable xyloglucan endotransgluc...    205   2e-58    
ref|NP_174496.1|  probable xyloglucan endotransglucosylase/hydrol...    205   2e-58    
gb|AAB18365.1|  xyloglucan endotransglycosylase-related protein         205   2e-58    
ref|XP_010527818.1|  PREDICTED: probable xyloglucan endotransgluc...    205   2e-58    
emb|CDX81665.1|  BnaC08g39360D                                          204   2e-58    
ref|XP_002890971.1|  hypothetical protein ARALYDRAFT_473398             205   2e-58    
emb|CDY33745.1|  BnaA09g45510D                                          204   3e-58    
ref|XP_004136205.1|  PREDICTED: probable xyloglucan endotransgluc...    205   3e-58    
ref|XP_002529962.1|  Xyloglucan endotransglucosylase/hydrolase pr...    203   3e-58    
ref|XP_007158788.1|  hypothetical protein PHAVU_002G182000g             204   3e-58    
ref|XP_002263411.1|  PREDICTED: probable xyloglucan endotransgluc...    204   3e-58    
ref|XP_009117879.1|  PREDICTED: probable xyloglucan endotransgluc...    204   3e-58    
ref|XP_004513237.1|  PREDICTED: probable xyloglucan endotransgluc...    204   3e-58    
gb|AGZ15408.1|  xyloglucan endotransglucosylase/hydrolase protein 28    204   3e-58    
ref|XP_006448095.1|  hypothetical protein CICLE_v10015872mg             204   4e-58    
ref|XP_003570869.1|  PREDICTED: probable xyloglucan endotransgluc...    204   4e-58    
ref|XP_002527547.1|  Xyloglucan endotransglucosylase/hydrolase pr...    204   4e-58    
ref|XP_004163204.1|  PREDICTED: probable xyloglucan endotransgluc...    204   4e-58    
ref|XP_002451458.1|  hypothetical protein SORBIDRAFT_04g002290          205   4e-58    
ref|XP_009144434.1|  PREDICTED: probable xyloglucan endotransgluc...    203   5e-58    
ref|XP_006849428.1|  hypothetical protein AMTR_s00024p00025540          203   5e-58    
gb|AFR46578.1|  xyloglucan endotransglucosylase/hydrolase 9             202   5e-58    
emb|CDY20956.1|  BnaA08g25690D                                          203   5e-58    
gb|KFK43745.1|  hypothetical protein AALP_AA1G167300                    203   6e-58    
gb|KDO60844.1|  hypothetical protein CISIN_1g019909mg                   204   6e-58    
ref|XP_008238168.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    204   7e-58    
ref|XP_002867966.1|  predicted protein                                  204   7e-58    
ref|XP_010554388.1|  PREDICTED: probable xyloglucan endotransgluc...    203   7e-58    
ref|XP_006469297.1|  PREDICTED: probable xyloglucan endotransgluc...    203   8e-58    
ref|XP_004504585.1|  PREDICTED: probable xyloglucan endotransgluc...    203   9e-58    
ref|XP_009344136.1|  PREDICTED: probable xyloglucan endotransgluc...    204   9e-58    
gb|AGV54504.1|  xyloglucan endotransglucosylase/hydrolase protein...    203   1e-57    
emb|CDY20620.1|  BnaC08g14380D                                          202   1e-57    
ref|XP_009390870.1|  PREDICTED: probable xyloglucan endotransgluc...    203   1e-57    
gb|EPS58974.1|  xyloglucan endotransglucosylase/hydrolase 14            201   1e-57    
dbj|BAK04928.1|  predicted protein                                      203   1e-57    
ref|XP_003632454.1|  PREDICTED: putative xyloglucan endotransgluc...    201   1e-57    
ref|XP_009373460.1|  PREDICTED: probable xyloglucan endotransgluc...    203   1e-57    
gb|KFK43349.1|  hypothetical protein AALP_AA1G114300                    202   2e-57    
ref|XP_010434473.1|  PREDICTED: probable xyloglucan endotransgluc...    203   2e-57    
gb|AAM67311.1|  endoxyloglucan transferase, putative                    202   2e-57    
ref|XP_008341063.1|  PREDICTED: probable xyloglucan endotransgluc...    203   2e-57    
gb|KFK33417.1|  hypothetical protein AALP_AA5G010000                    202   2e-57    
ref|XP_006438421.1|  hypothetical protein CICLE_v10032164mg             201   2e-57    
ref|XP_006416979.1|  hypothetical protein EUTSA_v10008160mg             202   2e-57    
ref|XP_010476541.1|  PREDICTED: probable xyloglucan endotransgluc...    202   2e-57    
ref|XP_007153190.1|  hypothetical protein PHAVU_003G014400g             202   3e-57    
gb|AGT17403.1|  hypothetical protein SHCRBa_230_N09_R_40                202   3e-57    
gb|KDP30712.1|  hypothetical protein JCGZ_15540                         202   3e-57    
gb|EYU45258.1|  hypothetical protein MIMGU_mgv1a008549mg                203   3e-57    
ref|XP_010663022.1|  PREDICTED: probable xyloglucan endotransgluc...    202   3e-57    
ref|XP_010911228.1|  PREDICTED: probable xyloglucan endotransgluc...    201   4e-57    
ref|XP_009348482.1|  PREDICTED: probable xyloglucan endotransgluc...    202   4e-57    
ref|XP_004228752.1|  PREDICTED: probable xyloglucan endotransgluc...    201   4e-57    
ref|NP_172925.1|  probable xyloglucan endotransglucosylase/hydrol...    201   4e-57    
ref|XP_010449431.1|  PREDICTED: probable xyloglucan endotransgluc...    202   4e-57    
ref|XP_003638758.1|  Xyloglucan endotransglycosylase/hydrolase          201   5e-57    
ref|XP_008466018.1|  PREDICTED: probable xyloglucan endotransgluc...    201   5e-57    
ref|NP_001045764.1|  Os02g0127800                                       201   5e-57    
ref|XP_008340024.1|  PREDICTED: probable xyloglucan endotransgluc...    200   6e-57    
ref|XP_009414788.1|  PREDICTED: probable xyloglucan endotransgluc...    201   7e-57    
gb|ABM91072.1|  xyloglucan endotransglycosylase/hydrolase precurs...    201   7e-57    
ref|XP_010539209.1|  PREDICTED: probable xyloglucan endotransgluc...    201   8e-57    
ref|XP_010439782.1|  PREDICTED: probable xyloglucan endotransgluc...    201   8e-57    
ref|NP_193634.1|  probable xyloglucan endotransglucosylase/hydrol...    201   9e-57    
gb|EAZ21594.1|  hypothetical protein OsJ_05221                          201   9e-57    
gb|ABK23987.1|  unknown                                                 199   9e-57    
ref|XP_006305074.1|  hypothetical protein CARUB_v10009442mg             202   1e-56    
gb|EYU22485.1|  hypothetical protein MIMGU_mgv1a023829mg                199   1e-56    
gb|ABK24235.1|  unknown                                                 201   1e-56    
ref|XP_006285076.1|  hypothetical protein CARUB_v10006389mg             201   1e-56    
ref|XP_010458984.1|  PREDICTED: probable xyloglucan endotransgluc...    200   2e-56    
ref|XP_002465580.1|  hypothetical protein SORBIDRAFT_01g041510          200   2e-56    
ref|XP_006417453.1|  hypothetical protein EUTSA_v10008234mg             199   2e-56    
ref|XP_010044645.1|  PREDICTED: probable xyloglucan endotransgluc...    199   2e-56    
ref|XP_010496847.1|  PREDICTED: probable xyloglucan endotransgluc...    199   2e-56    
ref|XP_006354588.1|  PREDICTED: probable xyloglucan endotransgluc...    200   2e-56    
ref|XP_003576504.1|  PREDICTED: probable xyloglucan endotransgluc...    199   2e-56    
gb|ABK92940.1|  unknown                                                 199   2e-56    
ref|XP_002311545.1|  xyloglucan endotransglycosylase family protein     199   2e-56    
ref|XP_010491392.1|  PREDICTED: probable xyloglucan endotransgluc...    199   3e-56    
ref|XP_010424960.1|  PREDICTED: probable xyloglucan endotransgluc...    199   3e-56    
ref|XP_002518990.1|  Xyloglucan endotransglucosylase/hydrolase pr...    199   3e-56    
ref|XP_006291465.1|  hypothetical protein CARUB_v10017602mg             199   3e-56    
ref|XP_010088654.1|  putative xyloglucan endotransglucosylase/hyd...    200   3e-56    
ref|XP_009101303.1|  PREDICTED: probable xyloglucan endotransgluc...    199   3e-56    
ref|XP_002892825.1|  hypothetical protein ARALYDRAFT_471659             199   3e-56    
ref|NP_001234470.1|  xyloglucan endotransglucosylase-hydrolase XT...    199   4e-56    
ref|XP_006453405.1|  hypothetical protein CICLE_v10010151mg             197   4e-56    
ref|XP_010677382.1|  PREDICTED: probable xyloglucan endotransgluc...    199   4e-56    
ref|XP_010261561.1|  PREDICTED: probable xyloglucan endotransgluc...    199   4e-56    
ref|XP_008806512.1|  PREDICTED: xyloglucan endotransglucosylase/h...    197   4e-56    
gb|ABK23681.1|  unknown                                                 199   4e-56    
gb|ACD03224.1|  xyloglucan endotransglucosylase/hydrolase 14            199   4e-56    
ref|XP_010475924.1|  PREDICTED: probable xyloglucan endotransgluc...    198   4e-56    
ref|XP_009804856.1|  PREDICTED: probable xyloglucan endotransgluc...    199   4e-56    
ref|XP_009795133.1|  PREDICTED: probable xyloglucan endotransgluc...    198   5e-56    
ref|XP_010458404.1|  PREDICTED: probable xyloglucan endotransgluc...    198   5e-56    
gb|ABA54988.1|  xyloglucan endotransglycosylase hydrolase               197   5e-56    
ref|XP_010667998.1|  PREDICTED: probable xyloglucan endotransgluc...    197   5e-56    
gb|AFG46271.1|  hypothetical protein 2_3698_01                          192   6e-56    
dbj|BAO02542.1|  endo-(1,4)-beta-D-glucanase ortholog                   198   6e-56    
ref|XP_009607215.1|  PREDICTED: probable xyloglucan endotransgluc...    199   6e-56    
ref|XP_009417676.1|  PREDICTED: probable xyloglucan endotransgluc...    198   7e-56    
gb|KHN25980.1|  Putative xyloglucan endotransglucosylase/hydrolas...    198   7e-56    
ref|XP_002875095.1|  endoxyloglucan transferase                         198   8e-56    
emb|CDY03100.1|  BnaC07g21270D                                          198   8e-56    
ref|XP_010271176.1|  PREDICTED: probable xyloglucan endotransgluc...    198   8e-56    
ref|XP_011024575.1|  PREDICTED: probable xyloglucan endotransgluc...    198   9e-56    
emb|CDY70985.1|  BnaAnng35740D                                          198   9e-56    
gb|KDO60846.1|  hypothetical protein CISIN_1g019909mg                   197   9e-56    
emb|CDY17630.1|  BnaA06g34490D                                          198   9e-56    
ref|XP_003561836.1|  PREDICTED: probable xyloglucan endotransgluc...    197   1e-55    
gb|KHG00933.1|  putative xyloglucan endotransglucosylase/hydrolas...    198   1e-55    
ref|XP_002315842.1|  xyloglucan endotransglycosylase family protein     197   1e-55    
ref|XP_010513916.1|  PREDICTED: probable xyloglucan endotransgluc...    197   1e-55    
ref|XP_010667960.1|  PREDICTED: xyloglucan endotransglucosylase/h...    196   1e-55    
ref|XP_002285140.1|  PREDICTED: probable xyloglucan endotransgluc...    197   1e-55    
gb|ABM91070.1|  xyloglucan endotransglycosylase/hydrolase precurs...    198   1e-55    
ref|XP_002304356.2|  hypothetical protein POPTR_0003s09590g             198   1e-55    
ref|XP_003524850.1|  PREDICTED: probable xyloglucan endotransgluc...    197   1e-55    
gb|KHN28876.1|  Putative xyloglucan endotransglucosylase/hydrolas...    197   1e-55    
ref|XP_006651207.1|  PREDICTED: probable xyloglucan endotransgluc...    196   1e-55    
ref|XP_011021731.1|  PREDICTED: probable xyloglucan endotransgluc...    197   2e-55    
ref|XP_003531138.1|  PREDICTED: probable xyloglucan endotransgluc...    197   2e-55    
ref|NP_001146328.1|  uncharacterized protein LOC100279904 precursor     197   2e-55    
gb|AFW66656.1|  hypothetical protein ZEAMMB73_269375                    197   2e-55    
ref|XP_010053644.1|  PREDICTED: probable xyloglucan endotransgluc...    197   2e-55    
gb|AAM63851.1|  putative endoxyloglucan transferase                     196   2e-55    
ref|XP_009623898.1|  PREDICTED: probable xyloglucan endotransgluc...    196   2e-55    
ref|NP_172525.1|  probable xyloglucan endotransglucosylase/hydrol...    196   2e-55    
ref|XP_009129188.1|  PREDICTED: probable xyloglucan endotransgluc...    197   2e-55    
ref|XP_010276803.1|  PREDICTED: probable xyloglucan endotransgluc...    197   2e-55    
ref|XP_003516952.1|  PREDICTED: probable xyloglucan endotransgluc...    197   2e-55    
ref|XP_009804330.1|  PREDICTED: probable xyloglucan endotransgluc...    196   3e-55    
ref|XP_011086549.1|  PREDICTED: probable xyloglucan endotransgluc...    196   3e-55    
ref|XP_010913492.1|  PREDICTED: putative xyloglucan endotransgluc...    195   3e-55    
ref|XP_010496455.1|  PREDICTED: probable xyloglucan endotransgluc...    196   3e-55    
gb|KHN10598.1|  Putative xyloglucan endotransglucosylase/hydrolas...    196   3e-55    
ref|XP_007153638.1|  hypothetical protein PHAVU_003G052400g             196   4e-55    
ref|XP_004300192.1|  PREDICTED: probable xyloglucan endotransgluc...    196   4e-55    
gb|ADE76299.1|  unknown                                                 195   4e-55    
gb|EPS64838.1|  xyloglucan endotransglucosylase/hydrolase 14            196   4e-55    
ref|XP_011018473.1|  PREDICTED: probable xyloglucan endotransgluc...    196   4e-55    
ref|XP_006368348.1|  xyloglucan endotransglycosylase 2 family pro...    196   5e-55    
gb|EYU40279.1|  hypothetical protein MIMGU_mgv1a009338mg                196   6e-55    
ref|XP_011071081.1|  PREDICTED: probable xyloglucan endotransgluc...    195   7e-55    
ref|XP_004954728.1|  PREDICTED: probable xyloglucan endotransgluc...    196   8e-55    
ref|XP_010100482.1|  putative xyloglucan endotransglucosylase/hyd...    195   8e-55    
emb|CAN74084.1|  hypothetical protein VITISV_018042                     195   8e-55    
ref|XP_004512469.1|  PREDICTED: probable xyloglucan endotransgluc...    196   9e-55    
ref|XP_010682574.1|  PREDICTED: probable xyloglucan endotransgluc...    195   1e-54    
ref|XP_002264995.1|  PREDICTED: probable xyloglucan endotransgluc...    194   1e-54    
ref|XP_002892577.1|  hypothetical protein ARALYDRAFT_471170             194   1e-54    
ref|XP_004142294.1|  PREDICTED: probable xyloglucan endotransgluc...    195   1e-54    
ref|XP_010519083.1|  PREDICTED: probable xyloglucan endotransgluc...    194   1e-54    
gb|KDP26566.1|  hypothetical protein JCGZ_17724                         194   1e-54    
gb|KHN04842.1|  Putative xyloglucan endotransglucosylase/hydrolas...    195   1e-54    
gb|ABD98046.1|  xyloglucan endotransglycosylase                         193   1e-54    
ref|XP_010267753.1|  PREDICTED: probable xyloglucan endotransgluc...    194   2e-54    
gb|KEH19982.1|  xyloglucan endotransglucosylase/hydrolase family ...    194   2e-54    
ref|XP_010227807.1|  PREDICTED: putative xyloglucan endotransgluc...    193   2e-54    
ref|XP_004956750.1|  PREDICTED: probable xyloglucan endotransgluc...    195   2e-54    
gb|AIL30514.1|  xyloglucan endotransglucosylase-hydrolase XTH5          195   2e-54    
ref|XP_006355979.1|  PREDICTED: probable xyloglucan endotransgluc...    194   2e-54    
ref|XP_002444082.1|  hypothetical protein SORBIDRAFT_07g007020          193   2e-54    
ref|XP_008454733.1|  PREDICTED: probable xyloglucan endotransgluc...    194   2e-54    
ref|XP_004509833.1|  PREDICTED: probable xyloglucan endotransgluc...    194   2e-54    
ref|XP_004238674.1|  PREDICTED: probable xyloglucan endotransgluc...    194   2e-54    
gb|AFK36629.1|  unknown                                                 193   2e-54    
ref|XP_011086421.1|  PREDICTED: probable xyloglucan endotransgluc...    195   2e-54    
ref|XP_007040721.1|  Xyloglucan endotransglucosylase/hydrolase pr...    195   2e-54    
gb|ACU19067.1|  unknown                                                 194   2e-54    
ref|XP_010055251.1|  PREDICTED: probable xyloglucan endotransgluc...    195   2e-54    
gb|AFK37086.1|  unknown                                                 193   3e-54    



>gb|EYU36148.1| hypothetical protein MIMGU_mgv1a011053mg [Erythranthe guttata]
Length=294

 Score =   439 bits (1128),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 209/287 (73%), Positives = 244/287 (85%), Gaps = 3/287 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQA-PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            IIFLF   +NAQ  PPSPGY PS+++GS+GFNQG+RNLWGP+HQ +DQG L+IWLD++  
Sbjct  10   IIFLFPLRSNAQGGPPSPGYNPSSRIGSIGFNQGYRNLWGPQHQRVDQGALTIWLDRS-S  68

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL  Y SGY GA+IKLQ+GYTAGVIT LYLSN E HP  HDEIDIEFLGTT GKP
Sbjct  69   GSGFKSLNPYSSGYFGAAIKLQSGYTAGVITSLYLSNNEAHPGNHDEIDIEFLGTTVGKP  128

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y LQTNVY++GSGDG NIIGRE++ +LWFDPT+DFH+YAILWNP+EIIFFVDDVPIR Y 
Sbjct  129  YVLQTNVYVRGSGDG-NIIGREMQIHLWFDPTKDFHNYAILWNPTEIIFFVDDVPIRRYA  187

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDATFP R M+ YGSIWDAS+WATENGKYKADY +QPF G+Y +FK++GC AN  +AC
Sbjct  188  RKSDATFPLRPMWAYGSIWDASTWATENGKYKADYNHQPFYGRYNNFKLSGCNANGRSAC  247

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP  GSPTGST LS QQ AAMAWVQ+N++ YDYC+++ RDH  TPEC
Sbjct  248  RPATGSPTGSTGLSRQQYAAMAWVQRNYQFYDYCRDSQRDHRLTPEC  294



>ref|XP_006488017.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Citrus sinensis]
Length=296

 Score =   436 bits (1120),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 201/282 (71%), Positives = 237/282 (84%), Gaps = 2/282 (1%)
 Frame = -2

Query  966  FTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFK  787
             +S +N Q PPSPGYYPS+++ S+GF+Q FRNLWGP+HQ  DQGTL+IWLD +  GSGFK
Sbjct  17   ISSVSNGQGPPSPGYYPSSRINSIGFDQAFRNLWGPQHQRADQGTLTIWLDSS-SGSGFK  75

Query  786  SLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQT  607
            SL SY SGY GASIKLQ GYTAGVIT LYLSN + HP  HDE+DIEFLGTTP KPYTLQT
Sbjct  76   SLHSYRSGYFGASIKLQPGYTAGVITSLYLSNNQDHPGNHDEVDIEFLGTTPDKPYTLQT  135

Query  606  NVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA  427
            NVY++GSGDG  +IGRE+RF+LWFDPTQDFHHYA+LW PSE+IFFVDDVPIR YPRKSDA
Sbjct  136  NVYIRGSGDG-RLIGRELRFHLWFDPTQDFHHYAVLWTPSELIFFVDDVPIRRYPRKSDA  194

Query  426  TFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG  247
            TFP R MY+YGSIWDASSWATE G+YKADY+YQPF+G+Y++FK+ GC A+ S+ C P P 
Sbjct  195  TFPLRPMYLYGSIWDASSWATEEGRYKADYKYQPFVGQYRNFKIAGCTADGSSGCHPPPA  254

Query  246  SPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            SP+GS  LS QQ+AAM WVQ+N+  Y+YC +  RDHT+ PEC
Sbjct  255  SPSGSGVLSQQQVAAMQWVQRNYLVYNYCYDPKRDHTEIPEC  296



>ref|XP_006424466.1| hypothetical protein CICLE_v10028945mg [Citrus clementina]
 gb|ESR37706.1| hypothetical protein CICLE_v10028945mg [Citrus clementina]
 gb|KDO60259.1| hypothetical protein CISIN_1g022492mg [Citrus sinensis]
Length=296

 Score =   436 bits (1120),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 199/282 (71%), Positives = 238/282 (84%), Gaps = 2/282 (1%)
 Frame = -2

Query  966  FTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFK  787
             +S +N Q PPSPGYYPS+++ S+GF+Q FRNLWGP+HQ +DQGTL++WLD +  GSGFK
Sbjct  17   ISSVSNGQGPPSPGYYPSSRINSIGFDQAFRNLWGPQHQRVDQGTLTVWLDSS-SGSGFK  75

Query  786  SLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQT  607
            SL SY SGY GASIKLQ GYTAGVIT LYLSN + HP  HDE+DIEFLGT PGKPYTLQT
Sbjct  76   SLHSYRSGYFGASIKLQPGYTAGVITSLYLSNNQDHPGNHDEVDIEFLGTIPGKPYTLQT  135

Query  606  NVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA  427
            NVY++GSGDG  +IGRE+RF+LWFDPTQDFHHYA+LW+PSE+IFFVDDVPIR YPRKSDA
Sbjct  136  NVYIRGSGDG-RLIGRELRFHLWFDPTQDFHHYAVLWSPSELIFFVDDVPIRRYPRKSDA  194

Query  426  TFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG  247
            TFP R MY+YGSIWDASSWATE G+YKADY+YQPF+G+Y++FK+ GC A+  + C P P 
Sbjct  195  TFPLRPMYLYGSIWDASSWATEEGRYKADYKYQPFVGQYRNFKIAGCTADGPSGCHPPPA  254

Query  246  SPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            SP+GS  LS QQ+AAM WVQ+N+  Y+YC +  RDHT+ PEC
Sbjct  255  SPSGSGVLSQQQVAAMQWVQRNYLVYNYCYDPKRDHTEIPEC  296



>emb|CDP07041.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   433 bits (1114),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 238/286 (83%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            I+FL   SN    PPSPGYYPS++V SLGFNQGFR LWGP++Q +DQG+L+IWLD++ G 
Sbjct  10   IVFLLPPSNAQGDPPSPGYYPSSRVASLGFNQGFRTLWGPQNQRVDQGSLTIWLDRSSG-  68

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL  Y SGY GA++KLQ GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY
Sbjct  69   SGFKSLNRYRSGYFGAAVKLQPGYTAGVITSFYLSNNEDYPGYHDEIDIEFLGTTTDKPY  128

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVYM+GSGDG NI+GRE++F+LWFDPT+DFH YAILW+P+EIIFFVDDVPIR YPR
Sbjct  129  TLQTNVYMRGSGDG-NIVGREMKFHLWFDPTKDFHDYAILWSPNEIIFFVDDVPIRRYPR  187

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M+VYGSIWDASSWATE GKYKADY+YQPF+G+Y +FK+ GC  N +  CR
Sbjct  188  KSDATFPLRPMWVYGSIWDASSWATEEGKYKADYQYQPFVGRYNNFKLGGCTTNGAATCR  247

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            PI  SP G + LS+QQ AAMAW+Q+N+K YDYC + +RDHT TPEC
Sbjct  248  PISASPAGPSGLSSQQYAAMAWIQRNYKVYDYCADPSRDHTHTPEC  293



>ref|XP_008226948.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Prunus mume]
Length=293

 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 206/288 (72%), Positives = 242/288 (84%), Gaps = 4/288 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            I FL  SSN+AQ PPSPGY PS+K+ ++GF+QGFRNLWGPEHQ+LDQG ++IWLD +  G
Sbjct  8    IFFLMFSSNSAQGPPSPGYNPSSKISTVGFDQGFRNLWGPEHQNLDQGAVTIWLDSS-SG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL  Y SGY GA++KLQ GYTAGVIT  YLSN E+HP  HDEIDIEFLGTTPGKPY
Sbjct  67   SGFKSLHPYRSGYFGAAVKLQPGYTAGVITSFYLSNNEEHPGNHDEIDIEFLGTTPGKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG NIIGRE +F+LWFDPTQDFH+YAI+WNP+EIIF VDDVPIR Y R
Sbjct  127  TLQTNVYIRGSGDG-NIIGREKKFHLWFDPTQDFHNYAIVWNPTEIIFLVDDVPIRRYQR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN--TSTA  265
            K DATFP R M+ YGSIWDAS+WATE+GKYKADY YQPFIG+Y +FK+ GC A+  T+T+
Sbjct  186  KGDATFPLRPMWAYGSIWDASTWATEDGKYKADYNYQPFIGRYNNFKLGGCTADGHTTTS  245

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            C+P   SP+G+T LS QQ +AM WVQ+N+  YDYCQ+  RDHTQTPEC
Sbjct  246  CQPPSASPSGATGLSQQQNSAMEWVQRNYLVYDYCQDPKRDHTQTPEC  293



>ref|XP_008226469.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Prunus mume]
Length=293

 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 242/288 (84%), Gaps = 4/288 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            I FL  SSN+AQ PPSPGY PS+K+ ++GF+Q FRNLWGP+HQ+LDQG L+IWLD +  G
Sbjct  8    IFFLMFSSNSAQGPPSPGYNPSSKISTVGFDQVFRNLWGPKHQNLDQGALTIWLDSS-SG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL  Y SGY GA++KLQ GYTAGVIT  YLSN E+HP  HDEIDIEFLGTTPGKPY
Sbjct  67   SGFKSLHPYRSGYFGAAVKLQPGYTAGVITSFYLSNNEEHPGNHDEIDIEFLGTTPGKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG NIIGRE +F+LWFDPTQDFH+YAI+WNP+EIIF VDDVPIR Y R
Sbjct  127  TLQTNVYIRGSGDG-NIIGREKKFHLWFDPTQDFHNYAIVWNPTEIIFLVDDVPIRRYQR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN--TSTA  265
            KSDATFP R M+ YGSIWDAS+WATE+GKYKADY YQPFIG+Y +FK+ GC A+  T+T+
Sbjct  186  KSDATFPLRPMWAYGSIWDASTWATEDGKYKADYNYQPFIGRYNNFKLGGCTADGPTTTS  245

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            C+P   SP+G+T LS QQ +AM WVQ+N+  YDYC++  RDHTQTPEC
Sbjct  246  CQPPSASPSGATGLSQQQNSAMEWVQRNYLVYDYCRDPKRDHTQTPEC  293



>ref|XP_011088791.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Sesamum indicum]
Length=292

 Score =   429 bits (1102),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 235/286 (82%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
             +F+F   N AQ PPSPGYYPS+++GS+GF+ GF NLWGP+HQSLD GTL+IWLD+T  G
Sbjct  9    FLFMFPFCNKAQGPPSPGYYPSSRIGSVGFHHGFTNLWGPQHQSLDHGTLTIWLDRT-SG  67

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL  Y SGY GA+IKLQ GYTAGVIT LYLSN E+HP EHDEIDIEFLGTT  KPY
Sbjct  68   SGFKSLNPYSSGYFGAAIKLQPGYTAGVITSLYLSNNEEHPGEHDEIDIEFLGTTEDKPY  127

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTNVY++GSGDG NIIGRE++F+LWFDPTQDFH           +FFVDDVPIR YPR
Sbjct  128  VLQTNVYIRGSGDG-NIIGREMKFHLWFDPTQDFHDXXXXXXXXXXVFFVDDVPIRRYPR  186

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M+VYGSIWDASSWATENGKYKADY +QPF+GKYKDFK+ GCAAN +T+CR
Sbjct  187  KSDATFPSRPMWVYGSIWDASSWATENGKYKADYSHQPFVGKYKDFKIGGCAANAATSCR  246

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            PI GSP+GS  LS+QQ+AA+ + Q N+K YDYCQ+  RDH  TPEC
Sbjct  247  PISGSPSGSIGLSHQQLAALMYAQNNYKVYDYCQDPERDHRLTPEC  292



>gb|ABK30788.1| xyloglucan endotransglycosylase 1 [Litchi chinensis]
Length=294

 Score =   427 bits (1097),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/287 (71%), Positives = 237/287 (83%), Gaps = 3/287 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQA-PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            +I + +S+  AQ  PPSPGY PS++V SLGFNQGF+NLWGP+HQ LDQ TL+IWLD++ G
Sbjct  10   LILMISSNTGAQGGPPSPGYNPSSRVSSLGFNQGFKNLWGPQHQRLDQDTLTIWLDQSSG  69

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
             SGFKSL+SY SGY GA++KLQ GYTAGVIT LYLSN + HP  HDEID EFLG T GKP
Sbjct  70   -SGFKSLQSYRSGYFGAAMKLQPGYTAGVITSLYLSNNQDHPGNHDEIDFEFLGNTTGKP  128

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG NIIGRE+RF+LWFDPTQDFH+YAILW PSEIIF  DDVPIR YP
Sbjct  129  YTLQTNVYIRGSGDG-NIIGRELRFHLWFDPTQDFHNYAILWTPSEIIFLADDVPIRRYP  187

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDATFP R MY+YGSIWDASSWATE+GKYKADY+YQPF+G+YK+FK+ GC A+   +C
Sbjct  188  RKSDATFPLRPMYLYGSIWDASSWATEDGKYKADYQYQPFVGRYKNFKLGGCTADAPASC  247

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P   SP+GS  LS QQIAAM WVQ+N+  Y+YC +  RDHT  PEC
Sbjct  248  TPPSASPSGSGGLSQQQIAAMQWVQRNYLVYNYCSDPKRDHTLVPEC  294



>ref|XP_002523709.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF38649.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=293

 Score =   426 bits (1096),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 237/283 (84%), Gaps = 3/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            + +SS+ AQ PPSPGYYP +++ S+GF+QG+RNLWGP+HQ LDQGTL+IWLD +  GSG+
Sbjct  14   MTSSSSIAQTPPSPGYYPGSRISSIGFDQGYRNLWGPQHQRLDQGTLTIWLDSS-SGSGY  72

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KSL+ Y SGY GASIKLQ GYTAGVIT  YLSN E +P  HDEIDIEFLGTTPGKPYTLQ
Sbjct  73   KSLQPYRSGYFGASIKLQPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTPGKPYTLQ  132

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNVY+KGSGDG  IIGRE++F+LWFDPTQDFH YAI+W P+EIIFFVDDVPIR YPRKSD
Sbjct  133  TNVYIKGSGDG-KIIGREMKFHLWFDPTQDFHQYAIMWTPNEIIFFVDDVPIRRYPRKSD  191

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
            +TFP R M++YGSIWDASSWATE+GKYKADY YQPFIG+Y++FK++GC  N S  CRP  
Sbjct  192  STFPLRPMWIYGSIWDASSWATEDGKYKADYSYQPFIGRYQNFKISGCTTNGSPTCRPPS  251

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP GS  LS QQ + M WVQ+N+  YDYC++  RDHTQTPEC
Sbjct  252  TSPFGSG-LSQQQYSTMEWVQRNYLAYDYCRDPKRDHTQTPEC  293



>ref|XP_007205463.1| hypothetical protein PRUPE_ppa007943mg [Prunus persica]
 gb|EMJ06662.1| hypothetical protein PRUPE_ppa007943mg [Prunus persica]
Length=351

 Score =   426 bits (1094),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 240/288 (83%), Gaps = 4/288 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            I FL  SSN+AQ PP PGY PS+K+ ++GF+QGFRNLWG EHQ+LDQG L+IWLD +  G
Sbjct  66   IFFLMFSSNSAQGPPPPGYNPSSKISTVGFDQGFRNLWGLEHQNLDQGALTIWLDSS-SG  124

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL  Y SGY GA++KLQ GYTAGVIT  YLSN E+HP  HDEIDIEFLGTTPGKPY
Sbjct  125  SGFKSLHPYRSGYFGAAVKLQPGYTAGVITSFYLSNNEEHPGNHDEIDIEFLGTTPGKPY  184

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGD  NIIGRE +F+LWFDPTQDFH+YAI+WNP+EIIF VDDVPIR Y R
Sbjct  185  TLQTNVYIRGSGDA-NIIGREKKFHLWFDPTQDFHNYAIVWNPTEIIFLVDDVPIRRYQR  243

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN--TSTA  265
            KSDATFP R M+ YGSIWDAS+WATE+GKYKADY YQPF+G+Y +FK+ GC A+  T+T+
Sbjct  244  KSDATFPLRPMWAYGSIWDASTWATEDGKYKADYSYQPFVGRYNNFKLGGCTADGSTTTS  303

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            C+P   SP+G+T LS QQ +AM WVQ+N+  YDYC++  RDHTQTPEC
Sbjct  304  CQPPSASPSGATGLSQQQYSAMEWVQRNYLVYDYCRDPKRDHTQTPEC  351



>ref|XP_009765915.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Nicotiana sylvestris]
Length=294

 Score =   423 bits (1087),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 204/277 (74%), Positives = 233/277 (84%), Gaps = 2/277 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            AQ PPSPGYYPS+KV SLGF+Q FRNLWGP+HQSLDQ  L+IWLDKT GGSGFKSLK+Y 
Sbjct  19   AQGPPSPGYYPSSKVQSLGFSQCFRNLWGPQHQSLDQSALTIWLDKTTGGSGFKSLKNYR  78

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY G S+KLQ GYTAG+IT  YLSN + +P  HDEIDIEFLGTTP KPYTLQTNVY++G
Sbjct  79   SGYFGTSVKLQPGYTAGIITSFYLSNNQDYPGNHDEIDIEFLGTTPNKPYTLQTNVYIRG  138

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD GNIIGRE++F+LWFDPTQ +H+YAILWNP+EIIFFVDDVPIR YPRK+DATFPQR 
Sbjct  139  SGD-GNIIGREMKFHLWFDPTQAYHNYAILWNPNEIIFFVDDVPIRRYPRKNDATFPQRP  197

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC-RPIPGSPTGS  232
            MYVYGSIWDASSWATE G+ KADYRYQPFIGKY +FK+ GC AN +  C R    S + +
Sbjct  198  MYVYGSIWDASSWATEEGRIKADYRYQPFIGKYNNFKIAGCTANENPWCGRSPSSSSSRA  257

Query  231  TRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              LS QQ+AAM WVQ+N+K YDYC++  RDHT TPEC
Sbjct  258  GGLSRQQMAAMLWVQRNYKVYDYCRDPRRDHTHTPEC  294



>ref|XP_009619507.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Nicotiana tomentosiformis]
Length=295

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/281 (73%), Positives = 238/281 (85%), Gaps = 2/281 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            +S+NAQ P SPGYYPS+KV SLGFNQGFRNLWGP+HQSLDQ  L+IWLDKT GGSGFKSL
Sbjct  16   NSSNAQGPLSPGYYPSSKVQSLGFNQGFRNLWGPQHQSLDQSALTIWLDKTSGGSGFKSL  75

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            ++Y SGY G S+KLQ GYTAG+IT  YLSN + +P  HDEIDIEFLGTTP KPYTLQTNV
Sbjct  76   ENYRSGYFGTSVKLQPGYTAGIITSFYLSNNQDYPGNHDEIDIEFLGTTPNKPYTLQTNV  135

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGD GNIIGRE++F+LWFDPT+ +H+YAILW+P+EIIFFVDDVPIR YPRK+DATF
Sbjct  136  YIRGSGD-GNIIGREMKFHLWFDPTKAYHNYAILWDPNEIIFFVDDVPIRRYPRKNDATF  194

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC-RPIPGS  244
            PQR MYVYGSIWDASSWATE G+ KADYRYQPF+GKY +FK+ GC AN +  C R    S
Sbjct  195  PQRPMYVYGSIWDASSWATEEGRIKADYRYQPFVGKYNNFKIAGCTANANPWCGRSPSSS  254

Query  243  PTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+ +  LS QQIAAM WVQ+N+K YDYC++  RDHT TPEC
Sbjct  255  PSRAGGLSRQQIAAMLWVQRNYKVYDYCRDPRRDHTHTPEC  295



>ref|XP_010267216.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Nelumbo nucifera]
Length=294

 Score =   420 bits (1080),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 198/283 (70%), Positives = 235/283 (83%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +F+ +NNAQ+PPSPGYYPS+K  S+GF  GFRNLWGP+H  +DQ  L+IWLD +  GSGF
Sbjct  12   MFSPTNNAQSPPSPGYYPSSKFSSMGFYDGFRNLWGPQHMRVDQNALTIWLDSS-SGSGF  70

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KSL+ + SGY GASIKLQ GYTAGVIT  YLSN + +P  HDEIDIEFLGTT GKPY LQ
Sbjct  71   KSLRPFRSGYFGASIKLQPGYTAGVITSFYLSNNQDYPGYHDEIDIEFLGTTFGKPYILQ  130

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNVY+KGSGDG  IIGRE+RF+LWFDPTQDFHHYAILW+P++IIFFVDDVPIR YPRKS+
Sbjct  131  TNVYIKGSGDG-RIIGREMRFHLWFDPTQDFHHYAILWSPNDIIFFVDDVPIRRYPRKSE  189

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
            ATFP R M+VYGSIWDASSWATE+GKYKADY YQPFIG+Y +FK++GC++++   CRP+ 
Sbjct  190  ATFPTRPMWVYGSIWDASSWATEDGKYKADYHYQPFIGRYTNFKISGCSSSSPAWCRPVS  249

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP  S  LS QQ +AM WVQ N+  YDYC++  RDH+QTPEC
Sbjct  250  ASPNPSGGLSGQQYSAMRWVQSNYLVYDYCKDPRRDHSQTPEC  292



>ref|XP_010031407.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Eucalyptus grandis]
 ref|XP_010031408.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Eucalyptus grandis]
 gb|KCW50699.1| hypothetical protein EUGRSUZ_J00383 [Eucalyptus grandis]
Length=303

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/287 (71%), Positives = 238/287 (83%), Gaps = 5/287 (2%)
 Frame = -2

Query  978  IIFLFTS-SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            I+  FTS S +AQ PPSPGYYPS++ GS+GF+QGFRNLWGP+HQ LDQG+L+IWLDK+  
Sbjct  21   IMIGFTSPSISAQGPPSPGYYPSSRFGSIGFDQGFRNLWGPQHQRLDQGSLTIWLDKS-A  79

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL+ Y SGY  ASIKLQ GYTAGV T  YLSN E HP  HDEIDIEFLGTTPGKP
Sbjct  80   GSGFKSLRPYQSGYFSASIKLQPGYTAGVDTSFYLSNNEAHPGNHDEIDIEFLGTTPGKP  139

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNV+++GSGDG N+IGRE++F+LWFDPTQ+FH+YAILW PSEIIF VDDVPIR YP
Sbjct  140  YTLQTNVFVRGSGDG-NVIGREMKFHLWFDPTQNFHNYAILWTPSEIIFLVDDVPIRRYP  198

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDAT+P R M+VYGSIWDAS WATENGKYKADY+Y PF+G+Y +F+++GCA+  S  C
Sbjct  199  RKSDATYPLRPMWVYGSIWDASPWATENGKYKADYQYAPFVGRYTNFRLSGCASGGS--C  256

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P   SP+G+  LS QQ +AMAWVQ+N   YDYC +  RDHT TPEC
Sbjct  257  NPPSVSPSGAGGLSRQQNSAMAWVQRNRMVYDYCSDPKRDHTHTPEC  303



>ref|XP_009345745.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Pyrus x bretschneideri]
Length=292

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 235/285 (82%), Gaps = 2/285 (1%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
            +FL  SS+ +Q PPSPGY PS+K+ +LGF+Q FRNLWGP+HQ+LD G L+IWLD +  GS
Sbjct  10   LFLMISSSISQGPPSPGYNPSSKISTLGFDQVFRNLWGPQHQNLDHGALTIWLDSS-SGS  68

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKSL  Y SGY GA+IKLQ GYTAGVIT  YLSN E+ P  HDEIDIEFLGTTP KPYT
Sbjct  69   GFKSLYPYRSGYFGAAIKLQPGYTAGVITSFYLSNNEELPGNHDEIDIEFLGTTPDKPYT  128

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNVY++GSGDG  IIGRE +F+LWFDP QDFH+YAI+WNP+EIIF VDDVPIR Y RK
Sbjct  129  LQTNVYIRGSGDG-TIIGREKQFHLWFDPAQDFHNYAIVWNPTEIIFLVDDVPIRRYQRK  187

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            SDATFP R M+ YGSIWDASSWATE GKYKADY+YQPFIGKYK+FK+ GC +++ T+C+P
Sbjct  188  SDATFPLRPMWAYGSIWDASSWATEGGKYKADYKYQPFIGKYKNFKLGGCKSDSPTSCQP  247

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               SP+G + LS QQ +AM WVQ+N+  YDYC ++ RDHTQTPEC
Sbjct  248  PSASPSGVSGLSQQQYSAMEWVQRNYLVYDYCNDSKRDHTQTPEC  292



>ref|XP_007150148.1| hypothetical protein PHAVU_005G130900g [Phaseolus vulgaris]
 gb|ESW22142.1| hypothetical protein PHAVU_005G130900g [Phaseolus vulgaris]
Length=302

 Score =   419 bits (1077),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 198/278 (71%), Positives = 229/278 (82%), Gaps = 2/278 (1%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKS  775
            + AQ PPSPGYYPS+K+  + F +GF+NLWGP+HQ LDQ +L+IWLD T+ GSGFKSL S
Sbjct  27   STAQGPPSPGYYPSSKISPVTFGEGFKNLWGPQHQKLDQESLTIWLD-TYTGSGFKSLHS  85

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY GA++KLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTT  KPY LQTNVY+
Sbjct  86   YRSGYFGAAVKLQPGYTAGVITSLYLSNNQDYPGNHDEIDIEFLGTTQDKPYVLQTNVYI  145

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NIIGRE+RF+LWFDPT+DFH+YAILW PSEIIF VDDVPIR YPRKSDATFP 
Sbjct  146  RGSGDG-NIIGREMRFHLWFDPTEDFHNYAILWEPSEIIFLVDDVPIRRYPRKSDATFPT  204

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+VYGSIWDASSWATE GKYKADY+YQPFIG+Y++FK+ GC    ST+C+P   SP+G
Sbjct  205  REMHVYGSIWDASSWATEGGKYKADYKYQPFIGQYQNFKLEGCTTEASTSCQPPSASPSG  264

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS QQ+AAM WVQ NH  YDYC +  RDHT TPEC
Sbjct  265  HGSLSPQQLAAMQWVQNNHLVYDYCHDPGRDHTLTPEC  302



>gb|KHN21066.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=302

 Score =   419 bits (1076),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 234/286 (82%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++     S++AQ PPSPGYYPS+K+  + F QGFRNLWGP+HQ LDQG+L+IWLD ++ G
Sbjct  19   VLSCVICSSSAQGPPSPGYYPSSKISPVSFYQGFRNLWGPQHQRLDQGSLTIWLD-SNSG  77

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTP KPY
Sbjct  78   SGFKSLHSYRSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPDKPY  137

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTNVY++GSGDG NIIGRE++F+LWFDPTQDFH+Y ILW PSEIIFFVDDVPIR YPR
Sbjct  138  VLQTNVYIRGSGDG-NIIGREMKFHLWFDPTQDFHNYGILWKPSEIIFFVDDVPIRRYPR  196

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS+AT+P R+MYVYGSIWDASSWATE+GKYKA+Y YQPF+G+YK+FK+ GC + +S +C+
Sbjct  197  KSEATYPSRSMYVYGSIWDASSWATEDGKYKANYNYQPFVGRYKNFKLQGCTSESSASCK  256

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+G   LS QQ  AM WVQ N+  Y+YC +  RDHT  PEC
Sbjct  257  PPSFSPSGFGSLSPQQFRAMQWVQNNYMVYNYCHDPRRDHTLIPEC  302



>ref|XP_006349017.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Solanum tuberosum]
Length=296

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 3/279 (1%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSY  772
            NAQ PPSPGYYPS++V SLGFNQGFRNLWGP+HQSLDQ TL+IWLDK  GGSGFKSLK+Y
Sbjct  19   NAQGPPSPGYYPSSRVQSLGFNQGFRNLWGPQHQSLDQSTLTIWLDKNSGGSGFKSLKNY  78

Query  771  GSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMK  592
             SGY G  IKLQ GYTAG+IT  YLSN + +P  HDEIDIEFLGTTP KPYTLQTNVY++
Sbjct  79   RSGYFGTYIKLQPGYTAGIITSFYLSNNQDYPGNHDEIDIEFLGTTPNKPYTLQTNVYIR  138

Query  591  GSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQR  412
            GSGD GNIIGRE++F+LWFDPT+D+H+YAILW+P+EIIFFVDDVPIR YP+K+DATFP+R
Sbjct  139  GSGD-GNIIGREMKFHLWFDPTKDYHNYAILWDPNEIIFFVDDVPIRRYPKKNDATFPER  197

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKY-KDFKVTGCAANTSTAC-RPIPGSPT  238
             MYVYGSIWDASSWATE G+ KADY+YQPF+GKY  +FK+ GCAA  S +C R    SP+
Sbjct  198  PMYVYGSIWDASSWATEEGRIKADYQYQPFVGKYSNNFKLAGCAAYESPSCRRAPSSSPS  257

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G   LS QQI AM WV +N+K YDYC++  RDHT TPEC
Sbjct  258  GGGGLSRQQIEAMLWVHRNYKVYDYCRDPKRDHTHTPEC  296



>ref|XP_009335973.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Pyrus x bretschneideri]
Length=292

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 236/285 (83%), Gaps = 2/285 (1%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
            +FL  SS+ +Q PP+PGY PS+K+ +LGF+Q FRNLWGP+HQ+LD G L+IWLD +  GS
Sbjct  10   LFLMISSSISQGPPTPGYNPSSKISTLGFDQVFRNLWGPQHQNLDHGALTIWLDSS-SGS  68

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKSL  Y SGY GA+IKLQ+GYTAGVIT  YLSN E+ P  HDEIDIEFLGTTP KPYT
Sbjct  69   GFKSLYPYRSGYFGAAIKLQSGYTAGVITSFYLSNNEELPGNHDEIDIEFLGTTPDKPYT  128

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNVY++GSGDG  IIGRE +F+LWFDP QDFH+YAI+WNP+EIIF VDDVPIR Y RK
Sbjct  129  LQTNVYIRGSGDG-TIIGREKQFHLWFDPAQDFHNYAIVWNPTEIIFLVDDVPIRRYQRK  187

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            SDATFP R M+ YGSIWDASSWATE GKYKADY+YQPFIGKYK+FK+ GC +++ T+C+P
Sbjct  188  SDATFPLRPMWAYGSIWDASSWATEGGKYKADYKYQPFIGKYKNFKLGGCKSDSPTSCQP  247

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               SP+G + LS QQ +AM WVQ+N+  YDYC ++ RDHTQTPEC
Sbjct  248  PFASPSGVSGLSQQQYSAMEWVQRNYLVYDYCNDSKRDHTQTPEC  292



>ref|NP_001233819.1| xyloglucan endotransglucosylase-hydrolase XTH6 precursor [Solanum 
lycopersicum]
 gb|AAS46242.1| xyloglucan endotransglucosylase-hydrolase XTH6 [Solanum lycopersicum]
Length=296

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 3/279 (1%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSY  772
            N+Q PPSPGYYPS++  S+GFNQGFRNLWGP+HQSLDQ TL+IWLDK  GGSGFKSLK+Y
Sbjct  19   NSQGPPSPGYYPSSRAQSIGFNQGFRNLWGPQHQSLDQSTLTIWLDKNSGGSGFKSLKNY  78

Query  771  GSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMK  592
             SGY G+SIKLQ G+TAG+IT  YLSN + +P  HDEIDIEFLGTTP KPYTLQTNVY++
Sbjct  79   RSGYFGSSIKLQPGFTAGIITSFYLSNNQDYPGNHDEIDIEFLGTTPNKPYTLQTNVYIR  138

Query  591  GSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQR  412
            GSGD GNIIGRE++F+LWFDPT+D+H+YAILW+P+EIIFFVDDVPIR YP+K+DATF QR
Sbjct  139  GSGD-GNIIGREMKFHLWFDPTKDYHNYAILWDPNEIIFFVDDVPIRRYPKKNDATFAQR  197

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKY-KDFKVTGCAANTSTAC-RPIPGSPT  238
             MYVYGSIWDASSWATE G+ KADYRYQPFIGKY  +FKV GCAA  S +C R    SP+
Sbjct  198  PMYVYGSIWDASSWATEEGRIKADYRYQPFIGKYSNNFKVEGCAAYESPSCRRAPSSSPS  257

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G   LS QQI AM WV +N+K YDYC++  RDHT TPEC
Sbjct  258  GGGGLSRQQIEAMLWVHRNYKVYDYCRDPRRDHTHTPEC  296



>ref|XP_007132324.1| hypothetical protein PHAVU_011G085200g [Phaseolus vulgaris]
 gb|ESW04318.1| hypothetical protein PHAVU_011G085200g [Phaseolus vulgaris]
Length=302

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 230/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++     S  AQ PPSPGYYPS+K+  + FNQGF+NLWGP+HQ +DQG+L+IWLD T  G
Sbjct  19   VLSCMIYSGCAQGPPSPGYYPSSKISPVSFNQGFKNLWGPQHQRIDQGSLTIWLD-TSSG  77

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTP KPY
Sbjct  78   SGFKSLHSYKSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPDKPY  137

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTNVY++GSGD  NI+GRE+RF+LWFDPTQDFH+Y ILW P+E+IFFVDDVP+R YPR
Sbjct  138  VLQTNVYIRGSGDV-NIVGREMRFHLWFDPTQDFHNYGILWKPTELIFFVDDVPVRRYPR  196

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS+AT+P R MYVYGSIWDAS+WATE GKYKADY+YQPFIG+YK+FK+ GC + +S +CR
Sbjct  197  KSEATYPTRPMYVYGSIWDASAWATEGGKYKADYKYQPFIGRYKNFKLQGCTSESSASCR  256

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P  GSP+G   LS QQ  AM WVQ N+  Y+YC +  RDH   PEC
Sbjct  257  PPSGSPSGFGSLSPQQFRAMQWVQNNYMVYNYCHDPRRDHNLIPEC  302



>gb|ABU93486.1| xyloglucan endotraglucosylase/hydrolase [Vigna angularis]
Length=301

 Score =   416 bits (1070),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 229/279 (82%), Gaps = 3/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S +AQ PPSPGYYPS+K+  + FNQGF+NLWGP+HQ +DQG+L+IWLD T  GSGFKSL 
Sbjct  26   SGSAQGPPSPGYYPSSKISPISFNQGFKNLWGPQHQRIDQGSLTIWLD-TSTGSGFKSLH  84

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
            SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTP KPY LQTNVY
Sbjct  85   SYKSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPDKPYVLQTNVY  144

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG NIIGRE+RF+LWFDPTQDFH+YA+LW PSE+IFFVDDVPIR YPRKS+AT+P
Sbjct  145  IRGSGDG-NIIGREMRFHLWFDPTQDFHNYAVLWKPSELIFFVDDVPIRRYPRKSEATYP  203

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R MYVYGSIWDASSWATE GKYKADYRYQPF+G+YK+F++ GC + +S +C P P + +
Sbjct  204  TRPMYVYGSIWDASSWATEGGKYKADYRYQPFVGRYKNFRLQGCTSESSASCHP-PSTSS  262

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G   LS QQ  AM WVQ N+  Y+YC +  RDH   PEC
Sbjct  263  GFGSLSPQQFRAMQWVQTNYMVYNYCHDPRRDHNLIPEC  301



>emb|CAA48324.1| cellulase [Tropaeolum majus]
Length=295

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 235/285 (82%), Gaps = 4/285 (1%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
            I +F+SS   Q PPSPGYYPS+++ SLGF+QG+ NLWGP+HQ +DQG+L+IWLD T  GS
Sbjct  15   ILMFSSSCLGQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDST-SGS  73

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKS+  Y SGY GA+IKLQ+GYTAGVIT  YLSN + +P +HDEIDIEFLGT PGKPYT
Sbjct  74   GFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYT  133

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNV+++GSGD  NIIGRE+R +LWFDPTQD+H+YAI W PSEIIFFVDDVPIR YPRK
Sbjct  134  LQTNVFIEGSGDY-NIIGREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRK  192

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            SDATFP R ++VYGS+WDASSWATENGKYKADYRYQPF+GKY+DFK+  C    +++C P
Sbjct  193  SDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNP  252

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               SP G  +LS QQ+AAM WVQKN+  Y+YC +  RDHT TPEC
Sbjct  253  ASVSPYG--QLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC  295



>ref|XP_007016865.1| Xyloglucan endotransglucosylase/hydrolase protein 32 isoform 
1 [Theobroma cacao]
 gb|EOY34484.1| Xyloglucan endotransglucosylase/hydrolase protein 32 isoform 
1 [Theobroma cacao]
Length=356

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 240/286 (84%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            + FL  SS NAQ PPSPGY PS++V S+ F+QGFRNLWGP+HQ +DQG+L+IWLDK+  G
Sbjct  73   LAFLIISSGNAQGPPSPGYSPSSRVSSVDFDQGFRNLWGPQHQRIDQGSLTIWLDKS-SG  131

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL+ Y SGY GA+IKLQ GYTAGVIT  YLSN E HP  HDEIDIEFLGTTP KPY
Sbjct  132  SGFKSLRPYQSGYFGAAIKLQPGYTAGVITSFYLSNNEDHPGNHDEIDIEFLGTTPDKPY  191

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++G+GDG NIIGRE+RF+LWFDPTQD+H+YAILW PSEI+FFVDDVPIR YPR
Sbjct  192  TLQTNVYIRGTGDG-NIIGREMRFHLWFDPTQDYHNYAILWTPSEIMFFVDDVPIRRYPR  250

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M+VYGSIWDASSWATENGKYKADY YQPFI +Y +FK++GC A+  T+CR
Sbjct  251  KSDATFPTRPMWVYGSIWDASSWATENGKYKADYNYQPFIARYTNFKLSGCNADGPTSCR  310

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+GS  LS QQ +AM WVQ N+  YDYC ++ RDHTQTPEC
Sbjct  311  PPSASPSGSDGLSQQQASAMNWVQGNYLVYDYCHDSKRDHTQTPEC  356



>ref|XP_003539787.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like isoform X1 [Glycine max]
Length=302

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 232/286 (81%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++     S++AQ PPSPGYYPS+K+  + F QGF NLWGP HQ LDQG+L+IWLD ++ G
Sbjct  19   VLSCVICSSSAQGPPSPGYYPSSKISPVSFYQGFTNLWGPRHQRLDQGSLTIWLD-SNSG  77

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTP KPY
Sbjct  78   SGFKSLHSYRSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPDKPY  137

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTNVY++GSGDG NIIGRE++F+LWFDPTQDFH+Y ILW PSEIIFFVDDVPIR YPR
Sbjct  138  VLQTNVYIRGSGDG-NIIGREMKFHLWFDPTQDFHNYGILWKPSEIIFFVDDVPIRRYPR  196

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS+AT+P R+MYVYGSIWDASSWATE+GKYKA+Y YQPF+G+YK+FK+ GC + +S +C+
Sbjct  197  KSEATYPSRSMYVYGSIWDASSWATEDGKYKANYNYQPFVGRYKNFKLQGCTSESSASCK  256

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+G   LS QQ  AM WVQ N+  Y+YC +  RDHT  PEC
Sbjct  257  PPSFSPSGFGSLSPQQFRAMQWVQNNYMVYNYCHDPRRDHTLIPEC  302



>ref|XP_002269285.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Vitis vinifera]
Length=293

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/286 (68%), Positives = 229/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L   S+NAQ PPSPGYYPS K  S+ F QGFRNLWGP+HQ +DQ  L+IWLD T  G
Sbjct  8    VLVLMVPSSNAQWPPSPGYYPSRKFRSMSFYQGFRNLWGPQHQRVDQNALTIWLDST-SG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS++ + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  67   SGFKSVRPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P +IIFFVDDVP+R YPR
Sbjct  127  TLQTNVYIRGSGDG-RIIGREMKFHLWFDPTKDFHHYAILWSPKDIIFFVDDVPVRRYPR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS  TFP R M++YGSIWDASSWATE+GKYKADYRYQPF+G+Y +FK +GC+A +  +CR
Sbjct  186  KSATTFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVGQYSNFKASGCSAYSPASCR  245

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S RL+ QQ  AM WVQ  H  Y+YC +  RDH+ TPEC
Sbjct  246  PVSASPYRSGRLTGQQYRAMQWVQSRHMVYNYCSDNKRDHSLTPEC  291



>ref|XP_004506064.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cicer arietinum]
Length=291

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 230/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L T  +NAQ PPSPGYYPS+K   + F QGFRNLWGP+HQ +DQ +L+IWLD ++ G
Sbjct  8    VLSLLTICSNAQGPPSPGYYPSSKTSPISFGQGFRNLWGPQHQRVDQTSLTIWLD-SNSG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTPGKPY
Sbjct  67   SGFKSLHSYKSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPGKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTNVY++GSGDG NIIGRE++F+LWFDPTQDFH+YAILW PSE+IF VDDVPIR YPR
Sbjct  127  VLQTNVYIRGSGDG-NIIGREIQFHLWFDPTQDFHNYAILWKPSELIFLVDDVPIRRYPR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDAT+P R MYVYGSIWDASSWATE+GKYKA+Y+YQPFIG+YK+FK+ GC   +S +C+
Sbjct  186  KSDATYPSRPMYVYGSIWDASSWATEDGKYKANYQYQPFIGRYKNFKLQGCTIQSSASCK  245

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   S  G   LS QQ  AM WVQ N+  Y+YC +  RDH   PEC
Sbjct  246  PPSTSSFGYGSLSPQQYVAMQWVQNNYMVYNYCHDPRRDHNLIPEC  291



>ref|XP_009356929.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Pyrus x bretschneideri]
Length=292

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 229/280 (82%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            SS+ AQ PPSPGY PS K+ +LGF+ GFR LWGP+HQ+LD GTL++WLD +  GSGFKSL
Sbjct  15   SSSIAQGPPSPGYNPSFKISTLGFDHGFRTLWGPQHQNLDHGTLTLWLDSS-SGSGFKSL  73

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
              Y SGY GA++KLQ GYTAGVIT  YLSN E+HP  HDEIDIEFLGTTP KPYTLQTNV
Sbjct  74   HPYRSGYFGAAVKLQPGYTAGVITSFYLSNNEEHPGNHDEIDIEFLGTTPDKPYTLQTNV  133

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG NIIGRE RF+LWFDPTQDFH+YAILWNP+EIIF VDDVPIR Y   SDATF
Sbjct  134  YIRGSGDG-NIIGREKRFHLWFDPTQDFHNYAILWNPTEIIFLVDDVPIRRYQGDSDATF  192

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+ YGSIWDASSWATE+GKYKADY+YQPFIGKY +FK+ GC +++   CRP   SP
Sbjct  193  PLRPMWAYGSIWDASSWATEDGKYKADYKYQPFIGKYNNFKLGGCKSDSPPLCRPPSASP  252

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             GS+ LS QQ +AM WVQ+N+  YDYC +  RDHTQTPEC
Sbjct  253  FGSSGLSQQQYSAMEWVQRNYLVYDYCHDPKRDHTQTPEC  292



>ref|NP_001241497.1| uncharacterized protein LOC100776165 precursor [Glycine max]
 gb|ACU23107.1| unknown [Glycine max]
 gb|KHN38712.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=302

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 232/286 (81%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++     S++AQ PPSPGYYPS+K+  + F QGFRNLWG +HQ LDQG+L+IWLD ++ G
Sbjct  19   VLSCVICSSSAQGPPSPGYYPSSKISPVSFYQGFRNLWGSQHQRLDQGSLTIWLD-SNSG  77

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTP KPY
Sbjct  78   SGFKSLHSYRSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPDKPY  137

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTNVY++GSGDG NIIGRE++F+LWFDPTQDFH+Y ILW P+EIIFFVDDVPIR YPR
Sbjct  138  VLQTNVYIRGSGDG-NIIGREMKFHLWFDPTQDFHNYGILWKPNEIIFFVDDVPIRRYPR  196

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDAT+P R MYVYGSIWDASSWATE+GKYKA+Y YQPF+G+YK+FK+ GC + +S +C+
Sbjct  197  KSDATYPSRPMYVYGSIWDASSWATEDGKYKANYNYQPFVGRYKNFKLQGCTSESSASCK  256

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+G   LS QQ  AM WVQ N+  Y+YC +  RDHT  PEC
Sbjct  257  PPSFSPSGFGSLSPQQFRAMQWVQNNYMVYNYCHDPRRDHTFIPEC  302



>ref|XP_004287556.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Fragaria vesca subsp. vesca]
Length=285

 Score =   413 bits (1061),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 198/290 (68%), Positives = 237/290 (82%), Gaps = 14/290 (5%)
 Frame = -2

Query  981  AIIFLF---TSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDK  811
            + I LF    +S++AQ PPSPGYYPS+K+ S+GF+QG+RNLWGP+HQ+ DQG LSIWLD+
Sbjct  7    SFILLFLINAASSSAQGPPSPGYYPSSKIRSMGFDQGYRNLWGPQHQNEDQGGLSIWLDR  66

Query  810  THGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTP  631
            +  GSGFKS++ YGSGY GA+IK+Q+GYTAGVIT  YLSN EQH  +HDEIDIEFLGTTP
Sbjct  67   S-SGSGFKSVRPYGSGYFGAAIKVQSGYTAGVITSFYLSNNEQHQTDHDEIDIEFLGTTP  125

Query  630  GKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIR  451
             KPY LQTNV+ KGSGDG  +IGRE RF+LWFDPT D+H+YAI++NP+EIIF VDDVPIR
Sbjct  126  DKPYVLQTNVWTKGSGDGNRLIGREHRFHLWFDPTHDYHNYAIVYNPTEIIFMVDDVPIR  185

Query  450  YYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTS  271
             YPRKSDATFP R M+VYGSIWDASSWATENGKYKADY YQPFIG+YKDFK+   +A   
Sbjct  186  RYPRKSDATFPLRPMWVYGSIWDASSWATENGKYKADYNYQPFIGRYKDFKLGPGSA---  242

Query  270  TACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
                    SP+G+T +S QQ  AM WVQ+N+K YDYC ++ RDH+QTPEC
Sbjct  243  -------ASPSGTTGMSRQQYTAMDWVQRNYKVYDYCTDSKRDHSQTPEC  285



>gb|AAK51119.1| xyloglucan endo-transglycosylase [Carica papaya]
Length=297

 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 231/284 (81%), Gaps = 2/284 (1%)
 Frame = -2

Query  972  FLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSG  793
            FL     ++Q PPSPGYYP+++  SLGF+QGFRN WGP+HQ ++QG L+IWLD T  GSG
Sbjct  16   FLLILMVSSQGPPSPGYYPTSRFPSLGFDQGFRNRWGPQHQRVEQGVLTIWLDST-SGSG  74

Query  792  FKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTL  613
            FKSL +Y SGY GA+IKLQ GYTAGVIT  YLSN E +P  HDEIDIEFLGTTPG+PYTL
Sbjct  75   FKSLHTYQSGYFGAAIKLQPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTPGEPYTL  134

Query  612  QTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS  433
            QTNV+++GSGD  NI+GREV+F+LWFDPTQDFH+YAILW PSEI+FFVDDVPIR YPRKS
Sbjct  135  QTNVFIRGSGDR-NIVGREVKFHLWFDPTQDFHNYAILWTPSEIVFFVDDVPIRRYPRKS  193

Query  432  DATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPI  253
            DATFP R M+VYGSIWDASSWAT++GKYKADY+YQPF+G+YK+FK+  C A+   +CRP 
Sbjct  194  DATFPLRTMWVYGSIWDASSWATDDGKYKADYQYQPFVGRYKNFKIAACRADGQASCRPP  253

Query  252  PGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              SP+G   LS QQ +AM W Q+N   Y+YC +  RDHT TPEC
Sbjct  254  SVSPSGFGVLSPQQESAMEWAQRNSLVYNYCLDPKRDHTPTPEC  297



>ref|XP_006366092.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Solanum tuberosum]
Length=293

 Score =   412 bits (1059),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/272 (72%), Positives = 228/272 (84%), Gaps = 2/272 (1%)
 Frame = -2

Query  936  PSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYI  757
            PSPGYYPS++VGSL F+QGFRNLWGP+HQSL+Q TL+IWLD  + GSGFKSL+ Y SGY 
Sbjct  24   PSPGYYPSSRVGSLHFSQGFRNLWGPQHQSLNQDTLTIWLDH-NSGSGFKSLRDYRSGYF  82

Query  756  GASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDG  577
            G S+KLQ GYTAG+IT  YLSN E  P  HDEIDIEFLGTTPGKPY LQTNVYMKGSGDG
Sbjct  83   GTSLKLQPGYTAGIITSFYLSNSEDFPGHHDEIDIEFLGTTPGKPYVLQTNVYMKGSGDG  142

Query  576  GNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVY  397
             +IIGRE++F+LWFDPT+ FH+YAILWNP+EIIFFVDDVPIR YP+KSDA FPQR MYVY
Sbjct  143  -HIIGREMQFHLWFDPTKGFHNYAILWNPNEIIFFVDDVPIRRYPKKSDAIFPQRPMYVY  201

Query  396  GSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSN  217
            GSIWDASSWATE+G+ KADY+YQPF+GKY +FK+ GC  N + +CRP  GSP+ S  LS 
Sbjct  202  GSIWDASSWATEDGRIKADYKYQPFVGKYNNFKIGGCTTNDNPSCRPPSGSPSRSGGLSR  261

Query  216  QQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            QQ  AM WVQ+N+K YDYC++  RD T TPEC
Sbjct  262  QQNDAMEWVQRNYKVYDYCRDPQRDRTHTPEC  293



>ref|XP_008359637.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Malus domestica]
Length=292

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 233/286 (81%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++FL  SS+ +Q  PSPGY  S+K+ +LGF Q FR LWGP+HQ+LD G L+IWLD +  G
Sbjct  9    LLFLMISSSISQGIPSPGYNLSSKISTLGFEQVFRXLWGPQHQNLDHGALTIWLDSS-SG  67

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL  Y SGY GA+IKLQ GYTAGVIT  YLSN E+ P  HDEIDIEFLGTTP KPY
Sbjct  68   SGFKSLYPYRSGYFGAAIKLQPGYTAGVITSFYLSNNEELPGNHDEIDIEFLGTTPDKPY  127

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE +F+LWFDP QDFH+YAI+WNP+EIIF VDDVPIR Y R
Sbjct  128  TLQTNVYIRGSGDG-TIIGREKQFHLWFDPAQDFHNYAIVWNPTEIIFLVDDVPIRTYQR  186

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M+ YGSIWDASSWATE GKYKADY+YQPFIGKYK+FK++GC +++ T+C+
Sbjct  187  KSDATFPLRPMWAYGSIWDASSWATEGGKYKADYKYQPFIGKYKNFKLSGCKSDSPTSCQ  246

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+G + LS QQ +AM WVQ+N+  YDYC ++ RDHTQTPEC
Sbjct  247  PPSASPSGVSGLSQQQYSAMEWVQRNYLVYDYCHDSKRDHTQTPEC  292



>pdb|2UWC|A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase 
Isoform Nxg2
 pdb|2UWC|B Chain B, Crystal Structure Of Nasturtium Xyloglucan Hydrolase 
Isoform Nxg2
Length=271

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/275 (71%), Positives = 229/275 (83%), Gaps = 4/275 (1%)
 Frame = -2

Query  945  QAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGS  766
            Q PPSPGYYPS+++ SLGF+QG+ NLWGP+HQ +DQG+L+IWLD T  GSGFKS+  Y S
Sbjct  1    QGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDST-SGSGFKSINRYRS  59

Query  765  GYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGS  586
            GY GA+IKLQ+GYTAGVIT  YLSN + +P +HDEIDIEFLGT PGKPYTLQTNV+++GS
Sbjct  60   GYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGS  119

Query  585  GDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAM  406
            GD  NIIGRE+R +LWFDPTQD+H+YAI W PSEIIFFVDDVPIR YPRKSDATFP R M
Sbjct  120  GDY-NIIGRELRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPM  178

Query  405  YVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTR  226
            +VYGS+WDASSWATENGKYKADYRYQPF+GKY+DFK+  C    +++C P   SP G  +
Sbjct  179  WVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYG--Q  236

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            LS QQ+AAM WVQKN+  Y+YC +  RDHT TPEC
Sbjct  237  LSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC  271



>ref|XP_010535628.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Tarenaya hassleriana]
Length=293

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 192/274 (70%), Positives = 230/274 (84%), Gaps = 4/274 (1%)
 Frame = -2

Query  942  APPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSG  763
            +PPSPGY+PS+++ S  F + FR+LWG +HQ ++Q T+++WLD++  GSGFKSL+ Y SG
Sbjct  24   SPPSPGYFPSSRISSSPFERVFRSLWGSQHQRVEQNTITLWLDRS-SGSGFKSLRPYKSG  82

Query  762  YIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSG  583
            Y GASIKLQ GYTAGV T LYLSN E HP++HDE+DIEFLGTTPGKPYTLQTNV+ +GSG
Sbjct  83   YFGASIKLQPGYTAGVDTSLYLSNNEDHPRDHDEVDIEFLGTTPGKPYTLQTNVFFRGSG  142

Query  582  DGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMY  403
            DG N+IGRE++FNLWFDPTQDFH+YAILWNPSEIIFFVDDVPIR Y RKS+ATFP R M+
Sbjct  143  DG-NVIGREMKFNLWFDPTQDFHNYAILWNPSEIIFFVDDVPIRRYERKSEATFPTRPMW  201

Query  402  VYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRL  223
            VYGSIWDAS WATENG+ KADYRYQPF+ KYKDFK+ GC A+ S  CRP   +P+GS  L
Sbjct  202  VYGSIWDASDWATENGRIKADYRYQPFVAKYKDFKIAGCTADGS--CRPPSAAPSGSGGL  259

Query  222  SNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S QQ AAMA+VQ+N+  Y+YC +  RDHTQTPEC
Sbjct  260  SQQQAAAMAFVQRNYMVYNYCHDPKRDHTQTPEC  293



>gb|KHN06880.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=280

 Score =   410 bits (1054),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/276 (72%), Positives = 226/276 (82%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            +Q PPSPGYYPS+K   + F++GFRNLWGP+HQ LDQ +L+IWLD ++ GSGFKSL SY 
Sbjct  7    SQGPPSPGYYPSSKTNPVSFDEGFRNLWGPQHQKLDQDSLTIWLD-SYSGSGFKSLHSYR  65

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KPY LQTNVY++G
Sbjct  66   SGYFGAAIKLQPGYTAGVITSLYLSNNQDYPGHHDEIDIEFLGTTPDKPYVLQTNVYIRG  125

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGDG NIIGRE+RF+LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP R 
Sbjct  126  SGDG-NIIGREMRFHLWFDPTQDFHNYAILWEPSEIIFLVDDVPIRRYPRKSDATFPSRE  184

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            MYVYGSIWDASSWATE GKYKADY YQPF G+YK+FK+ GC    ST+C+P   SP+G  
Sbjct  185  MYVYGSIWDASSWATEGGKYKADYNYQPFFGRYKNFKILGCTTEASTSCQPPSPSPSGYD  244

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             LS QQ AAM WVQ N+  YDYC +  RDHT TPEC
Sbjct  245  SLSPQQFAAMQWVQNNYLVYDYCHDPGRDHTLTPEC  280



>ref|XP_003540201.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like isoform X1 [Glycine max]
Length=302

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 200/276 (72%), Positives = 226/276 (82%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            +Q PPSPGYYPS+K   + F++GFRNLWGP+HQ LDQ +L+IWLD ++ GSGFKSL SY 
Sbjct  29   SQGPPSPGYYPSSKTNPVSFDEGFRNLWGPQHQKLDQDSLTIWLD-SYSGSGFKSLHSYR  87

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KPY LQTNVY++G
Sbjct  88   SGYFGAAIKLQPGYTAGVITSLYLSNNQDYPGHHDEIDIEFLGTTPDKPYVLQTNVYIRG  147

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGDG NIIGRE+RF+LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP R 
Sbjct  148  SGDG-NIIGREMRFHLWFDPTQDFHNYAILWEPSEIIFLVDDVPIRRYPRKSDATFPTRE  206

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            MYVYGSIWDASSWATE GKYKADY YQPF G+YK+FK+ GC    ST+C+P   SP+G  
Sbjct  207  MYVYGSIWDASSWATEGGKYKADYNYQPFFGRYKNFKILGCTTEASTSCQPPSPSPSGYD  266

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             LS QQ AAM WVQ N+  YDYC +  RDHT TPEC
Sbjct  267  SLSPQQFAAMQWVQNNYLVYDYCHDPGRDHTLTPEC  302



>pdb|2UWA|A Chain A, Crystal Structure Of The Nasturtium Seedling Xyloglucanase 
Isoform Nxg1
 pdb|2UWA|B Chain B, Crystal Structure Of The Nasturtium Seedling Xyloglucanase 
Isoform Nxg1
 pdb|2UWA|C Chain C, Crystal Structure Of The Nasturtium Seedling Xyloglucanase 
Isoform Nxg1
Length=274

 Score =   409 bits (1052),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 193/276 (70%), Positives = 229/276 (83%), Gaps = 4/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
             Q PPSPGYYPS+++ SLGF+QG+ NLWGP+HQ +DQG+L+IWLD T  GSGFKS+  Y 
Sbjct  3    VQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDST-SGSGFKSINRYR  61

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ+GYTAGVIT  YLSN + +P +HDEIDIEFLGT PGKPYTLQTNV+++G
Sbjct  62   SGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEG  121

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD  NIIGRE+R +LWFDPTQD+H+YAI W PSEIIFFVDDVPIR YPRKSDATFP R 
Sbjct  122  SGDY-NIIGREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRP  180

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            ++VYGS+WDASSWATENGKYKADYRYQPF+GKY+DFK+  C    +++C P   SP G  
Sbjct  181  LWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYG--  238

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +LS QQ+AAM WVQKN+  Y+YC +  RDHT TPEC
Sbjct  239  QLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC  274



>ref|XP_011089954.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Sesamum indicum]
Length=293

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 193/263 (73%), Positives = 222/263 (84%), Gaps = 2/263 (1%)
 Frame = -2

Query  909  KVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAG  730
            ++GS+GFNQGFRNLWGP+HQ LDQG L+IWLD++  GSGFKS+  Y SGY GA+IKLQ G
Sbjct  33   RIGSIGFNQGFRNLWGPQHQRLDQGALTIWLDRS-SGSGFKSVNPYSSGYFGAAIKLQTG  91

Query  729  YTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVR  550
            YTAGVIT  YLSN E+HP  HDEIDIEFLGTT  KPY LQTNVY++GSGDG NIIGRE++
Sbjct  92   YTAGVITSFYLSNNEEHPGNHDEIDIEFLGTTQDKPYVLQTNVYIRGSGDG-NIIGREMK  150

Query  549  FNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSW  370
            F+LWFDPT DFH+YAILWNPSEIIFFVDDVPIR YPRKSDATFP R M+VYGSIWDASSW
Sbjct  151  FHLWFDPTTDFHNYAILWNPSEIIFFVDDVPIRRYPRKSDATFPLRPMWVYGSIWDASSW  210

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWV  190
            ATENG+YKADY YQPF+GKY +FK++GC A +S +CRP  GSP+ S  LS QQ  AM WV
Sbjct  211  ATENGRYKADYNYQPFVGKYTNFKLSGCNAYSSASCRPASGSPSPSGGLSRQQYVAMEWV  270

Query  189  QKNHKEYDYCQNTNRDHTQTPEC  121
            Q+N+K YDYC++  RDH  TPEC
Sbjct  271  QRNYKIYDYCRDPQRDHRLTPEC  293



>ref|XP_004515909.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cicer arietinum]
Length=296

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 226/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+F    S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  
Sbjct  10   AILFFMVPSSNAYWPPSPGYWPSSKFKSMSFYKGFRNLWGPQHQSLDQHALTIWLDRT-S  68

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIKL  GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  69   GSGFKSVRPFRSGYFGASIKLHPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  128

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAILWNP EIIF VDDVPIR YP
Sbjct  129  YTLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKDFHHYAILWNPKEIIFLVDDVPIRRYP  187

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDATFP R M+VYGSIWDASSWATE+GKYKADYRYQPF+ +Y +FK +GC A     C
Sbjct  188  RKSDATFPLRPMWVYGSIWDASSWATEDGKYKADYRYQPFVARYTNFKASGCTAYAPLRC  247

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP  S  L+ QQ   M WVQ +H  Y+YC++  RDH  TPEC
Sbjct  248  HPVSASPYRSGGLTRQQHFTMRWVQSHHMIYNYCRDIKRDHRLTPEC  294



>gb|EYU37038.1| hypothetical protein MIMGU_mgv1a021958mg, partial [Erythranthe 
guttata]
Length=278

 Score =   409 bits (1051),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/274 (71%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  939  PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            PPSPGYYPS+++GS+ F+QGF N WGP+HQ LDQGTL++WLD++ G SGFKS+ SY SGY
Sbjct  6    PPSPGYYPSSRIGSIAFDQGFDNRWGPQHQRLDQGTLTVWLDRSSG-SGFKSVNSYSSGY  64

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             GA+IKL  GYTAGVIT LYLSN E++P  HDEIDIEFLGTT  KPY LQTNVYMKGSGD
Sbjct  65   FGAAIKLHPGYTAGVITSLYLSNNEEYPGNHDEIDIEFLGTTLDKPYVLQTNVYMKGSGD  124

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILW-NPSEIIFFVDDVPIRYYPRKSDATFPQRAMY  403
            G NI+GREVRF+LWFDPTQDFH+YAILW       FFVDDVPIR YP+ SD TFP + M 
Sbjct  125  GNNIVGREVRFHLWFDPTQDFHNYAILWIQLKSCEFFVDDVPIRRYPKTSDETFPLKPMS  184

Query  402  VYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRL  223
            VYGSIWDASSWATENGKYKADY YQPFIGKY +FK+ GCA N   +CRPI GS +G T L
Sbjct  185  VYGSIWDASSWATENGKYKADYTYQPFIGKYNNFKIGGCAVNGPASCRPITGSASGGTGL  244

Query  222  SNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S+QQ A+MA+VQ N+K YDYC ++ +DH  TPEC
Sbjct  245  SSQQYASMAYVQNNYKVYDYCSDSTKDHKSTPEC  278



>gb|KHN09532.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=293

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 230/287 (80%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+ L   S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  
Sbjct  7    AILILMVPSSNAYWPPSPGYWPSSKFRSMSFYKGFRNLWGPQHQSLDQNALTIWLDRT-S  65

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  66   GSGFKSVRPFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  125

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P EIIF VDDVPIR YP
Sbjct  126  YTLQTNVYIRGSGDG-RIIGREMKFHLWFDPTKDFHHYAILWSPKEIIFLVDDVPIRRYP  184

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF+ KY +FK +GC+A     C
Sbjct  185  RKSGATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFVAKYTNFKASGCSAYAPRWC  244

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP  S  LS QQ +AM WVQ+ H  Y+YCQ+  RDH+ TPEC
Sbjct  245  HPVSASPYRSGGLSRQQHSAMRWVQRYHMVYNYCQDPKRDHSLTPEC  291



>gb|AES88539.2| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=304

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 228/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
             ++ L    +NAQ PPSPGYYPS+K+  + F+QGFRNLWGP+HQ LDQ +L+IWLD ++ 
Sbjct  20   VVLSLTIFGSNAQGPPSPGYYPSSKISPISFSQGFRNLWGPQHQRLDQSSLTIWLD-SNS  78

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL SY SGY GA+IKL  GYTAGVIT LYLSN + HP  HDEIDIEFLGTTPGKP
Sbjct  79   GSGFKSLHSYKSGYFGAAIKLHPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPGKP  138

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y LQTNVYM+GSGDG NIIGRE++F+LWFDPTQDFH+YAILW PSEIIF VDDVPIR YP
Sbjct  139  YVLQTNVYMRGSGDG-NIIGREMQFHLWFDPTQDFHNYAILWKPSEIIFLVDDVPIRRYP  197

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDAT+P R MY+YGSIWDASSWATE+GKYKADY+YQPF+G+Y +FK+ GC   +  +C
Sbjct  198  RKSDATYPTRPMYLYGSIWDASSWATEDGKYKADYKYQPFVGRYTNFKLQGCTIQSPASC  257

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +    SP+G   LS QQ  AM WVQ  +  Y+YC +  R+H   PEC
Sbjct  258  QSPSVSPSGYGSLSPQQYMAMQWVQSKYMVYNYCHDPRRNHNLIPEC  304



>gb|KHN21488.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=292

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 199/278 (72%), Positives = 226/278 (81%), Gaps = 2/278 (1%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKS  775
            + +Q PPSPGYYPS+K+  + F +GFRNLWGP+HQ LDQ +L+IWLD ++ GSGFKSL S
Sbjct  17   STSQDPPSPGYYPSSKISPVSFGEGFRNLWGPQHQKLDQDSLTIWLD-SYSGSGFKSLHS  75

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY GA+IKLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KPY LQTNVY+
Sbjct  76   YRSGYFGAAIKLQPGYTAGVITSLYLSNNQDYPGHHDEIDIEFLGTTPDKPYVLQTNVYI  135

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NIIGRE+R +LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP 
Sbjct  136  RGSGDG-NIIGREMRIHLWFDPTQDFHNYAILWEPSEIIFLVDDVPIRRYPRKSDATFPS  194

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R MYVYGSIWDASSWATE GKYKADY YQPF G+YK+FK+ GC    ST+C+P   SP+G
Sbjct  195  REMYVYGSIWDASSWATEGGKYKADYNYQPFFGRYKNFKILGCTTEASTSCQPPSPSPSG  254

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS QQ AAM WVQ N+  YDYC +  RDHT TPEC
Sbjct  255  YDSLSPQQFAAMQWVQNNYLVYDYCHDPGRDHTLTPEC  292



>ref|NP_001240151.1| uncharacterized protein LOC100796768 precursor [Glycine max]
 gb|ACU22926.1| unknown [Glycine max]
Length=302

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 198/278 (71%), Positives = 226/278 (81%), Gaps = 2/278 (1%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKS  775
            + +Q PPSPGYYPS+K+  + F +GFRNLWGP+HQ LDQ +L+IWLD ++ GSGFKSL S
Sbjct  27   STSQDPPSPGYYPSSKISPVSFGEGFRNLWGPQHQKLDQDSLTIWLD-SYSGSGFKSLHS  85

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY GA+IKLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KPY LQTNVY+
Sbjct  86   YRSGYFGAAIKLQPGYTAGVITSLYLSNNQDYPGHHDEIDIEFLGTTPDKPYVLQTNVYV  145

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NIIGRE+R +LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP 
Sbjct  146  RGSGDG-NIIGREMRIHLWFDPTQDFHNYAILWEPSEIIFLVDDVPIRSYPRKSDATFPS  204

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R MYVYGSIWDASSWATE GKYKADY YQPF G+YK+FK+ GC    ST+C+P   SP G
Sbjct  205  REMYVYGSIWDASSWATEGGKYKADYNYQPFFGRYKNFKIQGCTTEASTSCQPPSPSPPG  264

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS QQ++AM WVQ N+  YDYC +  RDHT TPEC
Sbjct  265  YGSLSPQQLSAMQWVQNNYLVYDYCHDPGRDHTLTPEC  302



>pdb|2VH9|A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With 
Xllg, A Xyloglucan Derived Oligosaccharide
 pdb|2VH9|B Chain B, Crystal Structure Of Nxg1-Deltayniig In Complex With 
Xllg, A Xyloglucan Derived Oligosaccharide
Length=290

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 231/285 (81%), Gaps = 9/285 (3%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
            I +F+SS   Q PPSPGYYPS+++ SLGF+QG+ NLWGP+HQ +DQG+L+IWLD T  GS
Sbjct  15   ILMFSSSCLGQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDST-SGS  73

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKS+  Y SGY GA+IKLQ+GYTAGVIT  YLSN + +P +HDEIDIEFLGT PGKPYT
Sbjct  74   GFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYT  133

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNV+++GSGD      RE+R +LWFDPTQD+H+YAI W PSEIIFFVDDVPIR YPRK
Sbjct  134  LQTNVFIEGSGD------REMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRK  187

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            SDATFP R ++VYGS+WDASSWATENGKYKADYRYQPF+GKY+DFK+  C    +++C P
Sbjct  188  SDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNP  247

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               SP G  +LS QQ+AAM WVQKN+  Y+YC +  RDHT TPEC
Sbjct  248  ASVSPYG--QLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC  290



>ref|NP_001241974.1| uncharacterized protein LOC100796698 precursor [Glycine max]
 gb|ACU17768.1| unknown [Glycine max]
Length=293

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 230/287 (80%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+ L   S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  
Sbjct  7    AILILMVPSSNAYWPPSPGYWPSSKFRSMSFYKGFRNLWGPQHQSLDQNALTIWLDRT-S  65

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  66   GSGFKSVRPFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  125

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNV+++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P EIIF VDDVPIR YP
Sbjct  126  YTLQTNVHIRGSGDG-RIIGREMKFHLWFDPTKDFHHYAILWSPKEIIFLVDDVPIRRYP  184

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF+ KY +FK +GC+A     C
Sbjct  185  RKSGATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFVAKYTNFKASGCSAYAPRWC  244

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP  S  LS QQ +AM WVQ+ H  Y+YCQ+  RDH+ TPEC
Sbjct  245  HPVSASPYRSGGLSRQQHSAMRWVQRYHMVYNYCQDPKRDHSLTPEC  291



>emb|CDX75009.1| BnaA05g07550D [Brassica napus]
Length=299

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 227/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L  SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLLGSSVNAYWPPSPGYWPSSKVGSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGASIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT DFHHYAILWNP EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTSDFHHYAILWNPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATENGKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATENGKYKADYKYQPFTAKYTNFKAIGCTAYSSARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ +Q  AM WVQ ++  Y+YC++  RDH+ TPEC
Sbjct  252  PLSASPYRSGGLTRKQYQAMRWVQTHNMVYNYCKDYKRDHSLTPEC  297



>ref|XP_009143551.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Brassica rapa]
Length=299

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 227/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L  SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLLGSSVNAYWPPSPGYWPSSKVGSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGASIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT DFHHYAILWNP EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTSDFHHYAILWNPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATENGKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATENGKYKADYKYQPFTAKYTNFKAIGCTAYSSARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ +Q  AM WVQ ++  Y+YC++  RDH+ TPEC
Sbjct  252  PLSASPYRSGGLTRKQYQAMRWVQTHNMVYNYCKDYKRDHSLTPEC  297



>emb|CDY33199.1| BnaC04g08400D [Brassica napus]
Length=299

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 194/286 (68%), Positives = 226/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L  SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLLGSSVNAYWPPSPGYWPSSKVGSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGASIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT DFHHYAILWNP EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTSDFHHYAILWNPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATENGKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATENGKYKADYKYQPFTAKYTNFKAIGCTAYSSARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ +Q  AM WVQ ++  Y+YC++  RDH+  PEC
Sbjct  252  PLSASPYRSGGLTRKQYQAMRWVQTHNMVYNYCKDYKRDHSLIPEC  297



>gb|ABU93485.1| xyloglucan endotraglucosylase/hydrolase [Vigna angularis]
Length=293

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 228/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+ L   S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  
Sbjct  7    AILVLMAPSSNAYWPPSPGYWPSSKFSSMSFYKGFRNLWGPQHQSLDQNALTIWLDRT-S  65

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  66   GSGFKSVRPFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  125

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P EIIF VDDVPIR YP
Sbjct  126  YTLQTNVYIRGSGDG-RIIGREMKFHLWFDPTKDFHHYAILWSPKEIIFLVDDVPIRRYP  184

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF+ KY +FK +GC+A     C
Sbjct  185  RKSGATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFVAKYSNFKASGCSAYAPRWC  244

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP  S  L+ QQ  AM WVQ+    Y+YCQ+  RDH+ TPEC
Sbjct  245  HPVSASPYRSGGLTRQQNRAMRWVQRYLMVYNYCQDPKRDHSLTPEC  291



>ref|XP_003597276.1| Xyloglucan endotransglycosylase [Medicago truncatula]
 gb|AES67527.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=309

 Score =   405 bits (1040),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 224/280 (80%), Gaps = 3/280 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NA   PSPGYYPS+KV ++ F+Q FRNLWG +HQ LD G+LSIWLD T  GSGFKS  
Sbjct  32   SRNAGGAPSPGYYPSSKVSTISFDQEFRNLWGAQHQKLDHGSLSIWLDST-TGSGFKSYH  90

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
            SY SGY G ++KLQ GYTAGV T LYLSNIE H   HDEIDIEFLGTT  KPY LQTNVY
Sbjct  91   SYKSGYFGTAVKLQPGYTAGVNTNLYLSNIEDHKGTHDEIDIEFLGTTQDKPYVLQTNVY  150

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG NI GRE+RF+LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP
Sbjct  151  IRGSGDGKNI-GREMRFHLWFDPTQDFHNYAILWKPSEIIFLVDDVPIRRYPRKSDATFP  209

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R MYVYGSIWDAS+WATENGKYKA+Y YQPFIG+Y++FK+ GC  +++++CRP   SP 
Sbjct  210  SRPMYVYGSIWDASAWATENGKYKANYTYQPFIGRYQNFKLQGCTTDSTSSCRPPSVSPP  269

Query  237  G-STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G   +LS QQ  AM WVQKN+  YDYC +  RDHT TPEC
Sbjct  270  GYGGKLSRQQNVAMQWVQKNYLVYDYCHDPKRDHTLTPEC  309



>ref|XP_010505232.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Camelina sativa]
Length=301

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 229/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++  + SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  16   LLVFWGSSVNAYWPPSPGYWPSSKVSSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  74

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  75   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  134

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIFFVDD+PIR YP+
Sbjct  135  TLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKEFHHYAILWSPREIIFFVDDIPIRRYPK  193

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS  TFP R M++YGSIWDAS+WATENGKYKADY+YQPF  KY +FK  GC A +S+ CR
Sbjct  194  KSAYTFPLRPMWLYGSIWDASTWATENGKYKADYKYQPFTAKYTNFKAIGCTAYSSSRCR  253

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            PI  SP  S  LS QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  254  PISASPYRSGGLSRQQYQAMRWVQAHSMVYNYCKDYKRDHSLTPEC  299



>ref|XP_007162780.1| hypothetical protein PHAVU_001G179900g [Phaseolus vulgaris]
 gb|ESW34774.1| hypothetical protein PHAVU_001G179900g [Phaseolus vulgaris]
Length=293

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 225/287 (78%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+     S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  
Sbjct  7    AILIFMVPSSNAYWPPSPGYWPSSKFRSMSFYEGFRNLWGPQHQSLDQNALTIWLDRT-S  65

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS+K + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  66   GSGFKSVKPFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  125

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPTQDFHHYAILW+P EIIF VDDVPIR YP
Sbjct  126  YTLQTNVYIRGSGDG-RIIGREMKFHLWFDPTQDFHHYAILWSPKEIIFLVDDVPIRRYP  184

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF+ KY  FK +GC+A     C
Sbjct  185  RKSSATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFVAKYSRFKASGCSAYAPRWC  244

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP  S  L+ QQ   M WVQ+    Y+YCQ+  RDH+ TPEC
Sbjct  245  HPVSASPYRSGGLTRQQYRTMRWVQRYLMVYNYCQDPKRDHSLTPEC  291



>ref|XP_010516915.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Camelina sativa]
Length=301

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 229/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++  + SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  16   LLVFWGSSVNAYWPPSPGYWPSSKVSSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  74

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  75   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  134

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIFFVDD+PIR YP+
Sbjct  135  TLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKEFHHYAILWSPREIIFFVDDIPIRRYPK  193

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS  TFP R M++YGSIWDAS+WATENGKYKADY+YQPF  KY +FK  GC A +S+ CR
Sbjct  194  KSAYTFPLRPMWLYGSIWDASTWATENGKYKADYKYQPFTAKYTNFKAIGCTAYSSSRCR  253

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            PI  SP  S  LS QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  254  PISASPYRSGGLSRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  299



>gb|AFK34415.1| unknown [Medicago truncatula]
Length=304

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 227/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
             ++ L    +NAQ PPSPGYYPS+K+  + F+QGFRNLWGP+HQ LDQ +L+IWLD ++ 
Sbjct  20   VVLSLTIFGSNAQGPPSPGYYPSSKISPISFSQGFRNLWGPQHQGLDQSSLTIWLD-SNS  78

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL SY SGY GA+IKL  GYTAGVIT LYLSN + HP  HDEIDIEFLGTTPGKP
Sbjct  79   GSGFKSLHSYKSGYFGAAIKLHPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPGKP  138

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y LQTNVYM+GSGDG NIIGRE++F+LWFDPTQDFH+YAILW PSE+IF VDDVPIR YP
Sbjct  139  YVLQTNVYMRGSGDG-NIIGREMQFHLWFDPTQDFHNYAILWKPSEMIFLVDDVPIRRYP  197

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDAT+P R MY+YGSIWDASSWATE+GKYKADY+YQPF+G+Y +FK+ GC   +  +C
Sbjct  198  RKSDATYPTRPMYLYGSIWDASSWATEDGKYKADYKYQPFVGRYTNFKLQGCTIQSPASC  257

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +    SP+G   LS QQ  AM WVQ  +  Y+Y  +  R+H   PEC
Sbjct  258  QSPSVSPSGYGSLSPQQYMAMQWVQSKYMVYNYRHDPRRNHNLIPEC  304



>ref|XP_010509425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X2 [Camelina sativa]
Length=301

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 229/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++  + SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  16   LLVFWGSSVNAYWPPSPGYWPSSKVSSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  74

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  75   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  134

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIFFVDD+PIR YP+
Sbjct  135  TLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKEFHHYAILWSPREIIFFVDDIPIRRYPK  193

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS  TFP R M++YGSIWDAS+WATENGKYKADY+YQPF  KY +FK  GC A +S+ CR
Sbjct  194  KSAYTFPLRPMWLYGSIWDASTWATENGKYKADYKYQPFTAKYTNFKAIGCTAYSSSRCR  253

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  LS QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  254  PVSASPYRSGGLSRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  299



>ref|XP_003625695.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES81913.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=293

 Score =   403 bits (1036),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 228/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+FL T S+NA  PPSPGY+PS+K  S+ F +GF N WGP+HQ L+Q  L+IWLD+T  
Sbjct  7    AILFLMTFSSNAYWPPSPGYWPSSKFKSMNFYKGFTNRWGPQHQRLEQNALTIWLDRT-S  65

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  66   GSGFKSVRPFRSGYFGASIKLQPGYTAGVITSFYLSNNEAHPGYHDEVDIEFLGTTFGKP  125

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  I+GRE++F+LWFDPT+ FHHYAILW+P EIIF VDDVPIR YP
Sbjct  126  YTLQTNVYVRGSGDG-KIVGREMKFHLWFDPTKGFHHYAILWSPKEIIFLVDDVPIRRYP  184

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSD TFP R M++YGSIWDASSWATE+GKYKADYRYQPF+ KY +FK +GC A     C
Sbjct  185  RKSDTTFPIRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKASGCTAYAPRWC  244

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP GS  L++QQ  AM+WVQ+ H  Y+YC++  RDH  TPEC
Sbjct  245  HPVSASPYGSGGLNSQQNRAMSWVQRYHMVYNYCKDPKRDHRLTPEC  291



>gb|KEH42168.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=296

 Score =   403 bits (1035),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 227/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            A +F   SS+NA  PPSPGY+PS+KV S+ F  G+RNLWGP+HQS+DQ   +IWLD+T  
Sbjct  10   ASLFFMASSSNAYWPPSPGYWPSSKVRSMSFYNGYRNLWGPQHQSMDQHGTTIWLDRT-S  68

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS + + SGY GASIKL  GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  69   GSGFKSNRPFRSGYFGASIKLHPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  128

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPT+ FHHYAI+WNP E+IF VDD+PIR YP
Sbjct  129  YTLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKKFHHYAIVWNPKELIFLVDDMPIRRYP  187

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDATFP R M+VYGSIWDASSWATE+GKYKADY+YQPF+ KY +FK +GC A  S  C
Sbjct  188  RKSDATFPLRPMWVYGSIWDASSWATEDGKYKADYKYQPFVAKYTNFKASGCTAYASRWC  247

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP   SP  S  L+ QQ  +M+WVQ++H  Y+YCQ+  RDH  TPEC
Sbjct  248  RPATASPYRSGGLTRQQHWSMSWVQRHHMVYNYCQDPKRDHRLTPEC  294



>ref|XP_006410858.1| hypothetical protein EUTSA_v10016912mg [Eutrema salsugineum]
 gb|ESQ52311.1| hypothetical protein EUTSA_v10016912mg [Eutrema salsugineum]
Length=332

 Score =   404 bits (1038),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 227/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L +SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLDKT  G
Sbjct  47   LVLLGSSSVNANWPPSPGYWPSSKVGSLSFYKGFRNLWGPQHQRMDQNALTIWLDKT-SG  105

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  106  SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNSEAHPGFHDEVDIEFLGTTFGKPY  165

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT  FHHYAILW+P EIIF VDD+PIR YP+
Sbjct  166  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTSGFHHYAILWSPREIIFLVDDIPIRRYPK  224

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  225  KSAATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKAMGCTAYSSARCH  284

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ +Q  AM WVQ ++  Y+YC++  RDH+ TPEC
Sbjct  285  PLSASPYRSGGLTRKQYQAMRWVQTHNMVYNYCKDYKRDHSLTPEC  330



>ref|XP_006294559.1| hypothetical protein CARUB_v10023595mg [Capsella rubella]
 gb|EOA27457.1| hypothetical protein CARUB_v10023595mg [Capsella rubella]
Length=332

 Score =   404 bits (1038),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 227/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++  + SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  47   LLVFWGSSVNAYWPPSPGYWPSSKVGSLNFYKGFRNLWGPQHQKMDQNALTIWLDRT-SG  105

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  106  SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  165

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT++FHHYAILW+P EIIFFVDD+PIR YP+
Sbjct  166  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTKEFHHYAILWSPKEIIFFVDDIPIRRYPK  224

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS  TFP R M++YGSIWDASSWATENGKYKADY YQPF  KY +FK  GC A +S  CR
Sbjct  225  KSVYTFPLRPMWLYGSIWDASSWATENGKYKADYNYQPFTAKYTNFKAIGCTAYSSPRCR  284

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  285  PVSASPYRSGGLTRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  330



>ref|XP_004494070.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cicer arietinum]
Length=293

 Score =   402 bits (1034),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 226/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            I+ L T+S NA  PPSP Y+PS+K  S+ F +GF NLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  8    ILILMTTSCNAYWPPSPAYWPSSKFNSINFYKGFTNLWGPQHQRIDQNALTIWLDRT-SG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS++ + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  67   SGFKSVRPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGYHDEVDIEFLGTTFGKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  I+GRE++F+LWFDPT+DFHHYAILW+P EIIF VDDVPIR YPR
Sbjct  127  TLQTNVYIRGSGDG-KIVGREMKFHLWFDPTKDFHHYAILWSPKEIIFLVDDVPIRRYPR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M++YGSIWDASSWATE+GKYKADY+YQPF+ +Y +FK +GC A     C 
Sbjct  186  KSDATFPIRPMWLYGSIWDASSWATEDGKYKADYKYQPFVARYTNFKASGCTAFAPLWCH  245

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP GS  L++QQ  AM WVQ+    Y+YCQ+  RDH  TPEC
Sbjct  246  PVSASPYGSGGLTSQQYRAMRWVQRYQLAYNYCQDPKRDHRLTPEC  291



>ref|XP_008385521.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Malus domestica]
Length=292

 Score =   402 bits (1033),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 233/280 (83%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            SS+ AQ PPSPGY PS+K+ +LGF QGFR LWGP+HQ+LD GTL++WLD T  GSGFKSL
Sbjct  15   SSSIAQGPPSPGYNPSSKISTLGFYQGFRTLWGPQHQNLDHGTLTLWLD-TSSGSGFKSL  73

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
              Y SGY GA++KLQ GYTAGVIT  YLSN E+HP  HDEIDIEFLGTTPGKPYTLQTNV
Sbjct  74   HPYRSGYFGAAVKLQPGYTAGVITSFYLSNNEEHPGNHDEIDIEFLGTTPGKPYTLQTNV  133

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            YM+GSGDG NIIGRE RF+LWFDPTQDFH+YAI+WNP+EIIF VDDVPIR Y R+S ATF
Sbjct  134  YMRGSGDG-NIIGREKRFHLWFDPTQDFHNYAIVWNPTEIIFLVDDVPIRRYQRESYATF  192

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+ Y SIWDASSWATE+GKYKADY+YQPFIGKY +FK+ GC +++ T+CRP   SP
Sbjct  193  PLRPMWAYASIWDASSWATEDGKYKADYKYQPFIGKYNNFKLGGCKSDSPTSCRPPSASP  252

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +GS+ LS QQ +AM WVQ+N+  YDYC +  RDHT TPEC
Sbjct  253  SGSSGLSQQQYSAMEWVQRNYLVYDYCYDPKRDHTLTPEC  292



>ref|XP_009377030.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Pyrus x bretschneideri]
Length=292

 Score =   402 bits (1033),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/279 (68%), Positives = 224/279 (80%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            + NA  PPSPGY+PS+K  S+ F +GF+ LWGP+HQSLDQ  L++WLD T  GSGFKS++
Sbjct  14   ATNADWPPSPGYWPSSKFRSMSFYKGFKTLWGPQHQSLDQNALTVWLDST-TGSGFKSVR  72

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  73   PFRSGYFGASIKLQTGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVY  132

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P +IIF VDDVPIR Y RKS ATFP
Sbjct  133  IRGSGDG-RIIGREMKFHLWFDPTKNFHHYAILWSPKDIIFLVDDVPIRRYARKSVATFP  191

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ KY +FK +GC+A +   CRP+  SP 
Sbjct  192  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKASGCSAYSPAWCRPVSASPF  251

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S RL+ QQ   M WVQ NH  YDYC++  RDH++TPEC
Sbjct  252  RSGRLTRQQYRTMRWVQTNHLVYDYCRDPKRDHSKTPEC  290



>pdb|2UWB|A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant 
Xyloglucanase Isoform Nxg1-Delta-Yniig
 pdb|2UWB|B Chain B, Crystal Structure Of The Nasturtium Seedling Mutant 
Xyloglucanase Isoform Nxg1-Delta-Yniig
Length=267

 Score =   401 bits (1030),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/276 (68%), Positives = 225/276 (82%), Gaps = 9/276 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
             Q PPSPGYYPS+++ SLGF+QG+ NLWGP+HQ +DQG+L+IWLD T  GSGFKS+  Y 
Sbjct  1    VQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDST-SGSGFKSINRYR  59

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ+GYTAGVIT  YLSN + +P +HDEIDIEFLGT PGKPYTLQTNV+++G
Sbjct  60   SGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEG  119

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD      RE+R +LWFDPTQD+H+YAI W PSEIIFFVDDVPIR YPRKSDATFP R 
Sbjct  120  SGD------REMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRP  173

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            ++VYGS+WDASSWATENGKYKADYRYQPF+GKY+DFK+  C    +++C P   SP G  
Sbjct  174  LWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYG--  231

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +LS QQ+AAM WVQKN+  Y+YC +  RDHT TPEC
Sbjct  232  QLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC  267



>ref|XP_009390370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Musa acuminata subsp. malaccensis]
Length=307

 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 232/288 (81%), Gaps = 7/288 (2%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTH  805
            ++FL   S NAQ  PSPGY  S+K+ S  F QG+RNLWGP+HQS+  DQ ++++WLD++ 
Sbjct  25   LVFLVLHSANAQ--PSPGYPLSSKIRSSRFYQGYRNLWGPQHQSVSRDQSSVTVWLDRS-  81

Query  804  GGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGK  625
             GSGFKS++ Y +GY G SIKLQ+ YTAGV T  YLSN E HP  HDE+DIEFLGTTPGK
Sbjct  82   SGSGFKSIRPYRNGYFGTSIKLQSDYTAGVNTAFYLSNNEAHPGFHDEVDIEFLGTTPGK  141

Query  624  PYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYY  445
            PYTLQTNVY++GSGDG  +IGRE+RF+LWFDPT  FHHYAILWNP EIIFFVDDVPIR Y
Sbjct  142  PYTLQTNVYVRGSGDG-RVIGREMRFHLWFDPTAAFHHYAILWNPDEIIFFVDDVPIRRY  200

Query  444  PRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTA  265
             RK +ATFP R M+VYGSIWDASSWATENGKYKADYR+QPF+ ++ DFK+TGC+AN  ++
Sbjct  201  ARKIEATFPDRPMWVYGSIWDASSWATENGKYKADYRFQPFVARFTDFKITGCSANAPSS  260

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            CRP+P SP+G   LS +Q AAM W Q+NH  YDYC + +RDH+ TPEC
Sbjct  261  CRPVPASPSGYG-LSARQYAAMQWAQRNHMVYDYCHDYSRDHSLTPEC  307



>gb|KHG09774.1| putative xyloglucan endotransglucosylase/hydrolase 32 -like protein 
[Gossypium arboreum]
 gb|KHG10493.1| putative xyloglucan endotransglucosylase/hydrolase 32 -like protein 
[Gossypium arboreum]
Length=294

 Score =   401 bits (1031),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 227/287 (79%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            + + L  S    Q PPSPGY PST V +L F+Q FRNLWGP+HQ  DQ +++IWLDKT  
Sbjct  10   SFVMLSWSIAQGQGPPSPGYSPSTSVRTLKFDQVFRNLWGPQHQRADQDSITIWLDKT-S  68

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ Y SGY GA++KLQ GYTAGVIT  YLSN E HP  HDEIDIEFLGTTP + 
Sbjct  69   GSGFKSIQPYQSGYFGAAMKLQPGYTAGVITSFYLSNNEDHPGNHDEIDIEFLGTTPDEL  128

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY+KGSGDG N+IGRE++F+LWFDPTQDFH+YA LW PSEIIFFVDDVPIR Y 
Sbjct  129  YTLQTNVYIKGSGDG-NLIGREMKFHLWFDPTQDFHNYAALWTPSEIIFFVDDVPIRRYT  187

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS+ATFP R M+VYGSIWDAS+WAT+NG+YKA+Y YQPF+GKY +FK++GC A    +C
Sbjct  188  RKSEATFPTRPMWVYGSIWDASTWATDNGRYKANYNYQPFVGKYTNFKISGCIAGGPASC  247

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP   SP+ +  LS QQ+ AM WVQ+N+  YDYCQ+  RDH Q PEC
Sbjct  248  RPPSVSPSDTGSLSQQQLEAMNWVQRNYLVYDYCQDPKRDHGQIPEC  294



>ref|XP_008369544.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Malus domestica]
Length=292

 Score =   401 bits (1031),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 226/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L   + NA  PPSPGY+PS+K  S+ FN+GF+ LWGP+HQSL Q  L+IWLD+T G 
Sbjct  7    LLILLVPATNADWPPSPGYWPSSKFRSMSFNKGFKPLWGPQHQSLYQNALTIWLDRTTG-  65

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS++ + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  66   SGFKSVRPFRSGYFGASIKLQTGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPY  125

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDP+++FHHYAILW+P EIIF VDDVPIR Y R
Sbjct  126  TLQTNVYIRGSGDG-RIIGREMKFHLWFDPSKNFHHYAILWSPKEIIFLVDDVPIRRYAR  184

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC+A +   CR
Sbjct  185  KSVATFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKAGGCSAYSPAWCR  244

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ   M WVQ+NH  YDYC +  RDH++TPEC
Sbjct  245  PVSASPXRSGGLTRQQYRTMRWVQRNHLVYDYCXDPKRDHSKTPEC  290



>ref|XP_007202396.1| hypothetical protein PRUPE_ppa009437mg [Prunus persica]
 gb|EMJ03595.1| hypothetical protein PRUPE_ppa009437mg [Prunus persica]
Length=292

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 222/279 (80%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            ++NA  PPSPGY+PS+K  S+ F +GFR LWGP+HQSLDQ  L+IWLD+T  GSGFKS++
Sbjct  14   ASNANWPPSPGYWPSSKFRSMSFYKGFRTLWGPQHQSLDQHALTIWLDRT-SGSGFKSVR  72

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY G SIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  73   PFRSGYFGTSIKLQTGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVY  132

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT+ FHHYAILW+P EIIF VDDVPIR YPRKS ATFP
Sbjct  133  IRGSGDG-KIIGREMKFHLWFDPTKAFHHYAILWSPKEIIFLVDDVPIRRYPRKSVATFP  191

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC+A +   CRP+  SP 
Sbjct  192  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKAGGCSAYSPAWCRPVSASPF  251

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ   M WVQ NH  YDYC++  RDH+ TPEC
Sbjct  252  RSGGLTQQQYRVMRWVQTNHLVYDYCKDYKRDHSLTPEC  290



>ref|NP_181224.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 
[Arabidopsis thaliana]
 sp|Q9SJL9.1|XTH32_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 32; Short=At-XTH32; Short=XTH-32; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD31572.1| xyloglucan endotransglycosylase, putative [Arabidopsis thaliana]
 gb|AAK76514.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AAM66089.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AAM91780.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AEC09308.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 
[Arabidopsis thaliana]
Length=299

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 228/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L+ SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLWGSSVNAYWPPSPGYWPSSKVGSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT+DFHHYAILW+P EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTKDFHHYAILWSPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS +TFP R M++YGSIWDASSWATE+GKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSASTFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKALGCTAYSSARCY  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  252  PLSASPYRSGGLTRQQHQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  297



>ref|XP_007027440.1| Xyloglucan endotransglucosylase/hydrolase 32 isoform 1 [Theobroma 
cacao]
 gb|EOY07942.1| Xyloglucan endotransglucosylase/hydrolase 32 isoform 1 [Theobroma 
cacao]
Length=313

 Score =   402 bits (1032),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 219/279 (78%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NA  PPSPGY+PS+K   + F  GFRNLWGP HQS DQ  L+IWLD+T  GSGFKS++
Sbjct  35   STNADWPPSPGYWPSSKFRPMSFYNGFRNLWGPGHQSADQNALTIWLDRT-SGSGFKSVR  93

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  94   PFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  153

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPTQDFHHYAI W+P EIIF VDDVPIR YP+KS ATFP
Sbjct  154  IRGSGDG-KIIGREMKFHLWFDPTQDFHHYAIFWSPKEIIFLVDDVPIRRYPKKSAATFP  212

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC+A     CRP+  SP 
Sbjct  213  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKANGCSAYAPAWCRPVSASPF  272

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ  AM WVQ+NH  YDYC++  R+H  TPEC
Sbjct  273  RSGGLTRQQYRAMRWVQRNHMVYDYCKDPKRNHALTPEC  311



>ref|XP_008241393.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Prunus mume]
Length=292

 Score =   400 bits (1028),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 223/279 (80%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            ++NA  PPSPGY+PS+K  S+ F +GFR LWGP+HQSLDQ  L+IWLD+T  GSGFKS++
Sbjct  14   ASNADWPPSPGYWPSSKFRSMSFYKGFRTLWGPQHQSLDQHALTIWLDRT-SGSGFKSVR  72

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  73   PFRSGYFGASIKLQTGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVY  132

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT+ FHHYAILW+P EIIF VDDVPIR YPRKS ATFP
Sbjct  133  IRGSGDG-KIIGREMKFHLWFDPTKAFHHYAILWSPKEIIFLVDDVPIRRYPRKSVATFP  191

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M++YGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC+A +   CRP+  SP 
Sbjct  192  LRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKAGGCSAYSPARCRPVSASPF  251

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ   M WVQ +H  YDYC++  RDH+ TPEC
Sbjct  252  QSGGLTQQQYRVMRWVQTHHLVYDYCKDYKRDHSLTPEC  290



>ref|NP_001280929.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 
precursor [Malus domestica]
 ref|XP_008387537.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Malus domestica]
 gb|ACD03233.1| xyloglucan endotransglucosylase/hydrolase 9 [Malus domestica]
Length=292

 Score =   400 bits (1028),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 189/279 (68%), Positives = 223/279 (80%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            + NA  PPSPGY+PS+K  S+ F +GF+ LWGP+HQSLDQ  L++WLD T G SGFKS++
Sbjct  14   ATNADWPPSPGYWPSSKFRSMSFYKGFKTLWGPQHQSLDQNALTVWLDSTTG-SGFKSVR  72

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  73   PFRSGYFGASIKLQTGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVY  132

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIF VDDVPIR Y RKS ATFP
Sbjct  133  IRGSGDG-RIIGREMKFHLWFDPTKNFHHYAILWSPKEIIFLVDDVPIRRYARKSVATFP  191

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ KY +FK +GC+A +   CRP+  SP 
Sbjct  192  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKASGCSAYSPAWCRPVSASPF  251

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ   M WVQ NH  YDYC++  RDH++TPEC
Sbjct  252  RSGGLTRQQYRTMRWVQTNHLVYDYCRDPKRDHSKTPEC  290



>ref|XP_010509424.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Camelina sativa]
Length=309

 Score =   400 bits (1029),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 229/293 (78%), Gaps = 8/293 (3%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG-  802
            ++  + SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+T   
Sbjct  16   LLVFWGSSVNAYWPPSPGYWPSSKVSSLNFYKGFRNLWGPQHQRMDQNALTIWLDRTSVY  75

Query  801  ------GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLG  640
                  GSGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLG
Sbjct  76   LGFIIIGSGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLG  135

Query  639  TTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDV  460
            TT GKPYTLQTNVY++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIFFVDD+
Sbjct  136  TTFGKPYTLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKEFHHYAILWSPREIIFFVDDI  194

Query  459  PIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAA  280
            PIR YP+KS  TFP R M++YGSIWDAS+WATENGKYKADY+YQPF  KY +FK  GC A
Sbjct  195  PIRRYPKKSAYTFPLRPMWLYGSIWDASTWATENGKYKADYKYQPFTAKYTNFKAIGCTA  254

Query  279  NTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             +S+ CRP+  SP  S  LS QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  255  YSSSRCRPVSASPYRSGGLSRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  307



>ref|XP_002881475.1| hypothetical protein ARALYDRAFT_482667 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57734.1| hypothetical protein ARALYDRAFT_482667 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 227/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L+ SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLWGSSVNAYWPPSPGYWPSSKVSSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT+DFHHYAILW+P EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTKDFHHYAILWSPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS +TFP R M++YGSIWDASSWATE+GKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSASTFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKALGCTAYSSARCY  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  252  PLSASPYRSGGLTRQQHQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  297



>ref|XP_011094597.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Sesamum indicum]
Length=296

 Score =   399 bits (1026),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/278 (68%), Positives = 221/278 (79%), Gaps = 2/278 (1%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKS  775
            N  Q PP PGYYPST+  S+ F QG+RNLWGP HQS+D   ++IWLD+ + GSGFKS+K 
Sbjct  19   NAGQWPPLPGYYPSTRFRSMSFYQGYRNLWGPGHQSVDNNGITIWLDR-NSGSGFKSVKP  77

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            + SGY GAS+KLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY+
Sbjct  78   FRSGYFGASVKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYV  137

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  IIGRE++F+LWFDPTQDFHHYAILW+P EIIFFVDDVPIR YPRKS  TFP 
Sbjct  138  RGSGDG-RIIGREMKFHLWFDPTQDFHHYAILWSPKEIIFFVDDVPIRRYPRKSATTFPL  196

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+VYGSIWDASSWATE+GKYKADYRYQPF+GK+ +FK +GC A     C P+  SP  
Sbjct  197  RPMWVYGSIWDASSWATEDGKYKADYRYQPFVGKFTNFKASGCTAYAPAWCHPVSASPYR  256

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S RL+ QQ  AM WVQ ++  YDYC++  RDH+ TPEC
Sbjct  257  SGRLTGQQTRAMQWVQSHYMVYDYCRDYKRDHSLTPEC  294



>ref|XP_010243244.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Nelumbo nucifera]
Length=293

 Score =   399 bits (1025),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 223/279 (80%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NAQ PPSPGYYPS +  ++ F  GFRNLWGP+H  +DQ TL+IWLD +  GSGFKS++
Sbjct  15   SINAQWPPSPGYYPSHRFRTMRFYDGFRNLWGPQHMRIDQNTLTIWLDSS-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPTQDFHHYAILW+P +IIFFVDDVPIR YPRKSDATFP
Sbjct  134  IRGSGDG-RIIGREMKFHLWFDPTQDFHHYAILWSPKDIIFFVDDVPIRRYPRKSDATFP  192

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M++YGSIWDASSWATE+GKYKADY YQPF+G Y +FK +GC+A     CRP+  SP 
Sbjct  193  LRPMWLYGSIWDASSWATEDGKYKADYHYQPFVGWYTNFKASGCSAYAPARCRPVSASPY  252

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  LS +Q  AM WVQ+ H  YDYC++  R+H+ TPEC
Sbjct  253  PSGGLSRRQYWAMRWVQRYHLVYDYCKDPKREHSLTPEC  291



>ref|XP_003554394.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like isoform X1 [Glycine max]
 gb|KHN02311.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=293

 Score =   399 bits (1025),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/279 (69%), Positives = 223/279 (80%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  GSGFKS++
Sbjct  15   SSNAYWPPSPGYWPSSKFRSMSFYKGFRNLWGPQHQSLDQNALTIWLDRT-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPTQDFHHYAILW+P EIIF VDDVPIR YPRKS ATFP
Sbjct  134  IRGSGDG-RIIGREMKFHLWFDPTQDFHHYAILWSPKEIIFLVDDVPIRRYPRKSGATFP  192

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M++YGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC+A     C  +  SP 
Sbjct  193  LRPMWLYGSIWDASSWATEDGKYKADYRYQPFLAKYTNFKAGGCSAYAPRWCHLVSASPY  252

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ  AM WVQ+ H  Y+YCQ+  RDH+ TPEC
Sbjct  253  RSGGLTRQQYRAMRWVQRYHMVYNYCQDPKRDHSLTPEC  291



>ref|XP_009133100.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Brassica rapa]
 emb|CDY53271.1| BnaCnng24730D [Brassica napus]
Length=299

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 223/286 (78%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L  SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+   G
Sbjct  14   LLVLLGSSVNAYWPPSPGYWPSSKVVSLSFYKGFRNLWGPQHQRMDQNALTIWLDRV-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGASIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE+++ LWFDPT  FHHYAILWNP EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-RIIGREIKYRLWFDPTSGFHHYAILWNPREIIFLVDDIPIRIYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFSAKYTNFKAIGCTAYSSARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ  AM WVQ +   Y+YC++  RDH+ TPEC
Sbjct  252  PVSASPYRSGGLTRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPEC  297



>ref|XP_010918611.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Elaeis guineensis]
Length=292

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 221/274 (81%), Gaps = 5/274 (2%)
 Frame = -2

Query  936  PSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSG  763
            PSPGYYPS+K   + F QGF NLWGP+HQSL  DQ +L+IWLD T  GSGFKS++ + +G
Sbjct  20   PSPGYYPSSKFRPISFYQGFNNLWGPQHQSLSQDQSSLTIWLDST-SGSGFKSIRPFRNG  78

Query  762  YIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSG  583
            Y GAS+KLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTTPGKPYTLQTNVY++GSG
Sbjct  79   YFGASVKLQTGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTPGKPYTLQTNVYVRGSG  138

Query  582  DGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMY  403
            DG  IIGRE+RF+LWFDPT  FHHYAILWNP EIIFFVDDVPIR Y RK +ATFP R M+
Sbjct  139  DG-RIIGREMRFHLWFDPTAGFHHYAILWNPDEIIFFVDDVPIRRYARKDEATFPVRPMW  197

Query  402  VYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRL  223
            VYGSIWDASSWATE+GKYKADYRYQPF+ ++  F + GC+A   + CRPI  SP+GS RL
Sbjct  198  VYGSIWDASSWATEDGKYKADYRYQPFVARFTKFMIGGCSAYAPSNCRPIAASPSGS-RL  256

Query  222  SNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S+QQ AAM W Q N+  Y YCQ++ RDH+ TPEC
Sbjct  257  SSQQYAAMTWAQSNYMVYYYCQDSRRDHSLTPEC  290



>ref|XP_003542521.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Glycine max]
 gb|KHN48284.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=296

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 226/289 (78%), Gaps = 4/289 (1%)
 Frame = -2

Query  981  AIIF--LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKT  808
            AI+F  L  SS+NA  PPSPGY PS+K   + F +GFRNLWGP+HQS+DQ  L+IWLD +
Sbjct  8    AILFFMLMASSSNAYWPPSPGYRPSSKFRPVNFYRGFRNLWGPQHQSIDQNALTIWLDSS  67

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
              GSGFKS + + SGY GASIKL  GYTAGVIT  YLSN E HP  HDE+DIEFLGTT G
Sbjct  68   -SGSGFKSNRPFRSGYFGASIKLHPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFG  126

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            KPYTLQTNVY++GSGDG  IIGRE++F+LWFDPTQ+FHHYAILW+P EIIF VDD+PIR 
Sbjct  127  KPYTLQTNVYIRGSGDG-TIIGREMKFHLWFDPTQNFHHYAILWSPKEIIFLVDDIPIRR  185

Query  447  YPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTST  268
            YPRKS  TFP R M++YGSIWDASSWATE+GKYKADYRYQPF+ KY +F+  GC+A TS 
Sbjct  186  YPRKSAETFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFRAGGCSAYTSR  245

Query  267  ACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             CRP+  SP  S  L+ +Q  AM WVQK H  Y+YCQ+  RDH  TPEC
Sbjct  246  RCRPVSASPYRSGGLTRRQYWAMRWVQKYHMVYNYCQDHKRDHKLTPEC  294



>gb|KFK36563.1| hypothetical protein AALP_AA4G139600 [Arabis alpina]
Length=299

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 226/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L  SS NA  PPSPGY+PS+KVGSL F +GF+NLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLLGSSVNAYWPPSPGYWPSSKVGSLSFYKGFKNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  I+GRE++F LWFDPT  FHHYAILW+P EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIVGREMKFRLWFDPTSAFHHYAILWSPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATE+GKYKA+Y+YQPF  KY +FK  GC A +S  C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATEDGKYKANYKYQPFTAKYTNFKAIGCTAYSSARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            PI  SP  S  L+ QQ  AM WVQ ++  Y+YC++  RDH+ TPEC
Sbjct  252  PISASPYRSGGLTRQQYQAMRWVQTHNMVYNYCKDYKRDHSLTPEC  297



>ref|XP_010050769.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Eucalyptus grandis]
 gb|KCW89365.1| hypothetical protein EUGRSUZ_A01661 [Eucalyptus grandis]
Length=297

 Score =   398 bits (1023),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 223/277 (81%), Gaps = 2/277 (1%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSY  772
            NAQ PP+PGY+PS++  S+ F QGF+NLWGP+HQ +DQ  L+IWLD T  GSGFKS+K +
Sbjct  21   NAQWPPAPGYWPSSRFRSMSFYQGFKNLWGPQHQRVDQSALTIWLDST-SGSGFKSVKPF  79

Query  771  GSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMK  592
             SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY++
Sbjct  80   RSGYFGASIKLQPGYTAGVITSFYLSNGEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIR  139

Query  591  GSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQR  412
            GSGDG  IIGRE++F+LWFDPTQ FHHYAILW P+E+IF VDD+PIR YPRKS ATFP R
Sbjct  140  GSGDG-RIIGREMKFHLWFDPTQAFHHYAILWRPNELIFLVDDIPIRRYPRKSAATFPMR  198

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGS  232
             M++YGSIWDASSWATE+GKYKADYRYQPFI +Y +FK +GC+A +   CRP+  SP  S
Sbjct  199  PMWLYGSIWDASSWATEDGKYKADYRYQPFIARYTNFKASGCSAYSPAWCRPVSASPYRS  258

Query  231  TRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              L+ QQ   M WVQ +H  Y+YC+++ RDH+ TPEC
Sbjct  259  GGLTRQQYRVMRWVQAHHMVYNYCRDSRRDHSLTPEC  295



>ref|XP_010527991.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Tarenaya hassleriana]
Length=297

 Score =   397 bits (1020),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 223/284 (79%), Gaps = 2/284 (1%)
 Frame = -2

Query  972  FLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSG  793
             L +S  NA  PP PGY+PS+KV S+ F +GFRNLWGP+HQ +DQ  L+IWLD T  GSG
Sbjct  14   ILGSSLANAYWPPQPGYWPSSKVRSMSFYKGFRNLWGPQHQRMDQNALTIWLDST-SGSG  72

Query  792  FKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTL  613
            FKS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTL
Sbjct  73   FKSVKPFRSGYFGASIKLQQGYTAGVITAFYLSNSEAHPGFHDEVDIEFLGTTFGKPYTL  132

Query  612  QTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS  433
            QTNVY++GSGDG  IIGRE++F+LWFDPT+ FHHYA+LW+P +IIF VDD+PIR YPRKS
Sbjct  133  QTNVYVRGSGDG-KIIGREMKFHLWFDPTKAFHHYAVLWSPRDIIFLVDDIPIRRYPRKS  191

Query  432  DATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPI  253
              TFP R M++YGSIWDASSWATE+GKYKADYRYQPF+ +Y +FKV GC A +S  CRP+
Sbjct  192  AETFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAQYTNFKVIGCTAYSSPRCRPV  251

Query  252  PGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              SP  S  LS QQ  AM WVQ ++  Y+YC +  RDH+ TPEC
Sbjct  252  SASPYPSGGLSRQQYQAMRWVQSHNMVYNYCMDPKRDHSLTPEC  295



>ref|XP_006354379.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Solanum tuberosum]
Length=298

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 226/287 (79%), Gaps = 3/287 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQA-PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            + F+F  S NA   P SPGYYPSTK  S+ F QGF+NLWGP HQS+D   ++IWLD+ + 
Sbjct  11   LSFIFLHSTNANYWPISPGYYPSTKFKSMSFYQGFKNLWGPNHQSVDNNGINIWLDR-NS  69

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  70   GSGFKSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  129

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P EIIF VDDVPIR Y 
Sbjct  130  YTLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKDFHHYAILWSPREIIFLVDDVPIRRYA  188

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            R+SDATFP R M++YGSIWDASSWATENGKYKADY YQPF GK+ +FK +GC A +S  C
Sbjct  189  RRSDATFPLRPMWLYGSIWDASSWATENGKYKADYNYQPFFGKFTNFKASGCTAYSSRWC  248

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP+  SP  S  LS QQ  AM WV+ ++  YDYC++  RDH+ TPEC
Sbjct  249  RPVSASPYRSGGLSRQQRQAMNWVRSHYMVYDYCRDFKRDHSLTPEC  295



>gb|KHF98411.1| putative xyloglucan endotransglucosylase/hydrolase 32 -like protein 
[Gossypium arboreum]
Length=294

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/279 (69%), Positives = 220/279 (79%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NA  PPSPGY+PS+K   + F  GFRNLWGP HQSLDQ  L+IWLD+T  GSGFKS+K
Sbjct  15   SANAGWPPSPGYWPSSKFRPMSFYSGFRNLWGPGHQSLDQHALTIWLDRT-SGSGFKSVK  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+PSEIIF VDDVPIR YPRKS ATFP
Sbjct  134  IRGSGDG-KIIGREMKFHLWFDPTKNFHHYAILWSPSEIIFLVDDVPIRRYPRKSAATFP  192

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC A     CRP+  SP 
Sbjct  193  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKAGGCTAYAPAWCRPVSASPF  252

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ  AM WVQ+ H  Y+YC++  R+H  TPEC
Sbjct  253  RSGGLTRQQRRAMRWVQRYHMVYNYCKDPKRNHALTPEC  291



>emb|CDY67349.1| BnaCnng54620D [Brassica napus]
Length=299

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 223/286 (78%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
             + L  SS NA  PPSPGY+PS+KVGSL F +GF+NLWGP+HQ  DQ  L+IWLD+T  G
Sbjct  14   FLVLLGSSVNAYWPPSPGYWPSSKVGSLSFYKGFKNLWGPQHQRTDQNGLTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGASIKLQPGYTAGVITSLYLSNQEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT  FHHYAILWNP EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTSGFHHYAILWNPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF  KY +FK  GC A +   C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKAIGCTAYSPARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ +Q  AM WVQ ++  Y+YC++  RDH+ TPEC
Sbjct  252  PVSASPYRSGGLTRKQYQAMRWVQTHNMIYNYCKDYKRDHSLTPEC  297



>ref|XP_004487062.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cicer arietinum]
Length=302

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 229/288 (80%), Gaps = 6/288 (2%)
 Frame = -2

Query  972  FLFTS---SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
             LF+S   ++NA  PPSPGYYPS+KV ++ F+QGFRNLWGP+HQ LDQ +L+IWLD T  
Sbjct  17   LLFSSMIYNSNAHGPPSPGYYPSSKVSTVSFDQGFRNLWGPQHQKLDQQSLTIWLDTT-S  75

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL  Y SGY GA++KLQ GYTAGVIT  YLSN + +P  HDEIDIEFLGTTP KP
Sbjct  76   GSGFKSLHDYRSGYFGAAVKLQPGYTAGVITSFYLSNNQDYPGNHDEIDIEFLGTTPDKP  135

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y LQTNVY++GSGDG  IIGRE++F+LWFDPT+DFH+YAILW  SEIIF VDDVPIR YP
Sbjct  136  YVLQTNVYIRGSGDG-KIIGREIKFHLWFDPTKDFHNYAILWKSSEIIFLVDDVPIRRYP  194

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDATFP R MY+YGSIWDASSWAT+NG+YKA+Y YQPFIGKYK+FKV GC+  ++++C
Sbjct  195  RKSDATFPSRPMYLYGSIWDASSWATDNGRYKANYTYQPFIGKYKNFKVQGCSIESTSSC  254

Query  261  R-PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            R P        + LS +Q AAM WV  N+  Y+YC +  RDHT TPEC
Sbjct  255  RPPSGSPSGHGSGLSPKQFAAMQWVHNNYLVYNYCHDPKRDHTFTPEC  302



>ref|XP_009141612.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Brassica rapa]
Length=299

 Score =   395 bits (1016),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 222/286 (78%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
             + L  SS NA  PPSPGY+PS+KVGSL F +GF+NLWGP+HQ  DQ  L+IWLD+T  G
Sbjct  14   FLVLLGSSVNAYWPPSPGYWPSSKVGSLSFYKGFKNLWGPQHQRTDQNGLTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGASIKLQPGYTAGVITSLYLSNQEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F LWFDPT  FHHYAILWNP EIIF VDD+PIR YP+
Sbjct  133  TLQTNVYIRGSGDG-KIIGREMKFRLWFDPTSGFHHYAILWNPREIIFLVDDIPIRRYPK  191

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M++YGSIWDASSWATE+GKYKADY+YQPF  KY +FK  GC A +   C 
Sbjct  192  KSAATFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFAAKYTNFKAIGCTAYSPARCH  251

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+  Q  AM WVQ ++  Y+YC++  RDH+ TPEC
Sbjct  252  PVSASPYRSGGLTRNQYQAMRWVQTHNMIYNYCKDYKRDHSLTPEC  297



>ref|XP_010689134.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 226/286 (79%), Gaps = 4/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            II  F  S+ + A PSPGYYPS++V  L FNQ FR LWGP+HQS+ QGTL++WLD++  G
Sbjct  9    IISFFLYSHYSNAQPSPGYYPSSQVAPLSFNQAFRTLWGPQHQSVQQGTLTVWLDRS-SG  67

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSLK + SG    ++KLQ GYTAGVIT  YLSN E  P  HDEIDIEFLGTTPGKPY
Sbjct  68   SGFKSLKRFQSGLFSTAMKLQPGYTAGVITSFYLSNNEDFPGYHDEIDIEFLGTTPGKPY  127

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
             LQTN+Y++GSGDG  +IGRE++F LWFDPT+ FH+YAI W+PS+IIFFVDD+PIR YPR
Sbjct  128  VLQTNIYVRGSGDG-RLIGREMKFQLWFDPTKGFHNYAIFWSPSQIIFFVDDIPIRRYPR  186

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M+ YGSIWDASSWATE+GKYKA+Y YQPF+G+Y++FK+ GC +     CR
Sbjct  187  KSDATFPLRPMWAYGSIWDASSWATEDGKYKANYNYQPFVGQYRNFKIAGCTSG--GPCR  244

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
                SP+GS+ LS QQ+AAM W Q+NH  YDYC+++ RDH  TPEC
Sbjct  245  LPKVSPSGSSNLSPQQVAAMGWAQRNHLVYDYCRDSRRDHRLTPEC  290



>ref|XP_011006618.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Populus euphratica]
Length=294

 Score =   395 bits (1014),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 223/286 (78%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            +I +  SS+NAQ PPSPGY+P ++  S+ F QG+RNLWG  HQ +DQ  L+IWLD T  G
Sbjct  9    LILMAPSSSNAQWPPSPGYWPGSRFRSMSFYQGYRNLWGYSHQRVDQNALTIWLDST-SG  67

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  68   SGFKSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPY  127

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDPT+ FH+YAILW+P EIIF VDDVPIR YPR
Sbjct  128  TLQTNVYIRGSGDG-RIIGREMKFHLWFDPTKTFHYYAILWSPKEIIFLVDDVPIRRYPR  186

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS  TFP R M+VYGSIWDASSWATE+GKYK DYRYQPF+  Y +FK +GC+A +   C 
Sbjct  187  KSATTFPLRPMWVYGSIWDASSWATEDGKYKVDYRYQPFVASYTNFKASGCSAYSPAWCH  246

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ  +M WVQ++H  YDYC++  RDH+ TPEC
Sbjct  247  PVSASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPEC  292



>emb|CDY31016.1| BnaC03g55190D [Brassica napus]
Length=292

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 227/285 (80%), Gaps = 2/285 (1%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
              +  SS  +Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++ LDK+  GS
Sbjct  10   FLVLCSSGYSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRTEQDVITLLLDKS-SGS  68

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKSL+SY SGY GASIKLQ+GYTAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+
Sbjct  69   GFKSLRSYKSGYFGASIKLQSGYTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYS  128

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNV+++GSGD  N+IGRE++FNLWFDPTQDFHHYAILWNP++I+F+VDDVPIR Y RK
Sbjct  129  LQTNVFVRGSGDR-NVIGREMKFNLWFDPTQDFHHYAILWNPNQIVFYVDDVPIRTYDRK  187

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            ++A FP R M++YGSIWDAS WATENG+ KADYRYQPFI KY +FK+ GC A  S++C P
Sbjct  188  NEAIFPTRPMWLYGSIWDASDWATENGRIKADYRYQPFIAKYTNFKLAGCTAEGSSSCTP  247

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               SP G+  LS QQ+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  248  PSASPMGNRGLSQQQMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  292



>ref|XP_002323501.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Populus trichocarpa]
 gb|EEF05262.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Populus trichocarpa]
Length=294

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 222/283 (78%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  SS+NAQ PPSPGY+P ++  S+ F QG+RNLWG  HQ +DQ  L+IWLD T  GSGF
Sbjct  12   MVPSSSNAQWPPSPGYWPGSRFRSMSFYQGYRNLWGYSHQRVDQNALTIWLDST-SGSGF  70

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQ
Sbjct  71   KSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQ  130

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNVY++GSGDG  IIGRE++F+LWFDPT+ FH+YAILW+P EIIF VDDVP+R YPRKS 
Sbjct  131  TNVYIRGSGDG-RIIGREMKFHLWFDPTKTFHYYAILWSPKEIIFLVDDVPVRRYPRKSA  189

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
             TFP R M+VYGSIWDASSWATENGKYKADYRYQPF+  Y +FK +GC+A +   C P+ 
Sbjct  190  TTFPLRPMWVYGSIWDASSWATENGKYKADYRYQPFVASYTNFKASGCSAYSPAWCHPVS  249

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP  S  L+ QQ  +M WVQ++H  YDYC++  RDH+ TPEC
Sbjct  250  ASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPEC  292



>ref|XP_009611819.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Nicotiana tomentosiformis]
Length=296

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 225/283 (80%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  S+N    PPSPGYYPS+K  S+ F QGF+NLWGP HQ++D   ++IWLD+ + GSGF
Sbjct  14   VLPSTNAGYWPPSPGYYPSSKFKSMSFYQGFKNLWGPNHQNVDNNGINIWLDR-NSGSGF  72

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQ
Sbjct  73   KSIKPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGYHDEVDIEFLGTTFGKPYTLQ  132

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P EIIF VDDVPIR Y RKS 
Sbjct  133  TNVYIRGSGDG-KIIGREMKFHLWFDPTKDFHHYAILWSPREIIFLVDDVPIRRYARKSI  191

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
            ATFP R M++YGSIWDASSWATE+GKYKADYRYQPF GK+ +FK +GC A +S  C P+ 
Sbjct  192  ATFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFYGKFTNFKASGCTAYSSRWCHPVS  251

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP+ S RL+ QQ  AM WV  ++  YDYC+++ RDH+ TPEC
Sbjct  252  ASPSRSGRLTRQQRQAMNWVHSHYLAYDYCRDSKRDHSLTPEC  294



>ref|XP_004246615.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Solanum lycopersicum]
Length=298

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 226/287 (79%), Gaps = 3/287 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQA-PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            + F+F  S NA   P SPGYYPSTK  S+ F QGF+NLWGP HQS+D   ++IWLD+ + 
Sbjct  11   LCFIFLHSTNANYWPISPGYYPSTKFKSMSFYQGFKNLWGPNHQSVDNNGINIWLDR-NS  69

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  70   GSGFKSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  129

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIF VDDVPIR Y 
Sbjct  130  YTLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKNFHHYAILWSPREIIFLVDDVPIRRYA  188

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            R+SDATFP R M++YGSIWDASSWATENGKYKADY YQPF GK+ +FK +GC A +S  C
Sbjct  189  RRSDATFPLRPMWLYGSIWDASSWATENGKYKADYNYQPFYGKFTNFKASGCTAYSSRWC  248

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP+  SP  S  LS QQ  AM WV+ ++  YDYC++  RDH+ TPEC
Sbjct  249  RPVSASPYRSGGLSRQQRQAMNWVRSHYMVYDYCRDFKRDHSLTPEC  295



>ref|XP_006428458.1| hypothetical protein CICLE_v10012353mg [Citrus clementina]
 gb|ESR41698.1| hypothetical protein CICLE_v10012353mg [Citrus clementina]
Length=293

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 218/279 (78%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S+ A  PPSP Y+PS+K  S+ F +GFRNLWGP+HQ  +Q  L+IWLD +  GSGFKS+K
Sbjct  16   SSFAYWPPSPAYWPSSKFSSMSFYKGFRNLWGPQHQRDEQNALTIWLDSS-SGSGFKSVK  74

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  75   PFRSGYFGASIKLQHGYTAGVITAFYLSNNEAHPGRHDEVDIEFLGTTFGKPYTLQTNVY  134

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P E+IF VDDVPIR YPRKS ATFP
Sbjct  135  IRGSGDG-KIIGREMKFHLWFDPTKDFHHYAILWSPKELIFLVDDVPIRRYPRKSAATFP  193

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ +Y DFK  GC A     CRP+  SP 
Sbjct  194  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVARYTDFKACGCTAYAPAWCRPVSVSPF  253

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  LS QQ  AM WVQ +H  YDYC++  RDH  TPEC
Sbjct  254  HSGGLSRQQYWAMRWVQSHHLVYDYCRDQKRDHFLTPEC  292



>ref|XP_008442717.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Cucumis melo]
Length=295

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/276 (68%), Positives = 220/276 (80%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            A  PPSPG++PST+  S+ F +GFRNLWGP+HQSL Q TLSIWLD+T  GSGFKSL+ + 
Sbjct  20   ASWPPSPGFWPSTRFRSMEFYKGFRNLWGPQHQSLSQNTLSIWLDRT-TGSGFKSLRPFR  78

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT  KPYTLQTNVY++G
Sbjct  79   SGYFGASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFDKPYTLQTNVYVRG  138

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGDG  IIGRE++F+LWFDPT+DFHHYAILW P+EIIF VDD+PIR YPRKS  TFP R 
Sbjct  139  SGDG-RIIGREMKFHLWFDPTKDFHHYAILWRPNEIIFLVDDIPIRRYPRKSATTFPSRP  197

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            M++YGSIWDASSWATE+GKY+ADYRYQPF+ KY +FK  GC+A +   CRP+  SP  S 
Sbjct  198  MWLYGSIWDASSWATEDGKYRADYRYQPFVAKYTNFKAGGCSAYSPAWCRPVSASPFRSG  257

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             L+ QQ  AM WVQ +H  Y+YC +  RDH+ TPEC
Sbjct  258  GLTRQQRNAMKWVQSHHLVYNYCWDNKRDHSLTPEC  293



>ref|XP_006381392.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Populus trichocarpa]
 gb|ERP59189.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Populus trichocarpa]
Length=294

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 220/280 (79%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            SS+NAQ PPSPGY+PS++  S+ F QG+RNLWG  HQ +D   L+IWLD T  GSGFKS+
Sbjct  15   SSSNAQWPPSPGYWPSSRFRSMSFYQGYRNLWGYSHQRVDPNALTIWLDST-SGSGFKSV  73

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            K + SGY GAS+KLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNV
Sbjct  74   KPFRSGYFGASVKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNV  133

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIF VDDVPIR YPRKS ATF
Sbjct  134  YIRGSGDG-RIIGREMKFHLWFDPTKNFHHYAILWSPKEIIFLVDDVPIRRYPRKSAATF  192

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+VYGSIWDASSWATE GKYKADYRYQPF+  Y +FK  GC+A +   CRP+  SP
Sbjct  193  PLRPMWVYGSIWDASSWATEEGKYKADYRYQPFVASYTNFKAAGCSAYSPAWCRPVSASP  252

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              S  L+ QQ   M WVQ+ H  Y+YC++  RDH+ TPEC
Sbjct  253  FRSGGLTRQQYRTMRWVQRYHMVYNYCKDYKRDHSLTPEC  292



>ref|XP_009398020.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=290

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/288 (66%), Positives = 226/288 (78%), Gaps = 7/288 (2%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTH  805
            ++ L   S NAQ  PSPGYYPS+ +  L F QG+ NLWGP+HQS+  DQ +++IWLD++ 
Sbjct  8    LVLLMFHSINAQ--PSPGYYPSSGIKPLKFFQGYSNLWGPQHQSVSQDQSSVTIWLDRS-  64

Query  804  GGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGK  625
             GSGFKS + Y +GY GASIKLQ GYTAGV T  YLSN + HP  HDE+DIEFLGT PGK
Sbjct  65   SGSGFKSTRPYRNGYFGASIKLQRGYTAGVNTAFYLSNDQAHPGFHDEVDIEFLGTIPGK  124

Query  624  PYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYY  445
            PYTLQTNVY++GSGDG  IIGRE+RF+LWFDP  DFHHY ILWNP EIIFFVDDVPIR Y
Sbjct  125  PYTLQTNVYVRGSGDG-RIIGREMRFHLWFDPAADFHHYGILWNPEEIIFFVDDVPIRRY  183

Query  444  PRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTA  265
             RK +ATFP R M+VYGSIWDASSWATENGKYKADYRYQPF+ ++  FK+ GC+A     
Sbjct  184  ARKVEATFPDRPMWVYGSIWDASSWATENGKYKADYRYQPFVSRFTGFKIRGCSAFAPAG  243

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            CRP+P SP+G   LS QQ AAM WVQ+NH  Y+YC++ +RDH+ TPEC
Sbjct  244  CRPVPSSPSGYG-LSPQQRAAMQWVQRNHLVYNYCKDYSRDHSLTPEC  290



>ref|XP_007016866.1| Xyloglucan endotransglucosylase/hydrolase 32 isoform 2, partial 
[Theobroma cacao]
 gb|EOY34485.1| Xyloglucan endotransglucosylase/hydrolase 32 isoform 2, partial 
[Theobroma cacao]
Length=251

 Score =   392 bits (1006),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 215/255 (84%), Gaps = 4/255 (2%)
 Frame = -2

Query  885  QGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITC  706
            QGFRNLWGP+HQ +DQG+L+IWLDK+  GSGFKSL+ Y SGY GA+IKLQ GYTAGVIT 
Sbjct  1    QGFRNLWGPQHQRIDQGSLTIWLDKS-SGSGFKSLRPYQSGYFGAAIKLQPGYTAGVITS  59

Query  705  LYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPT  526
               SN E HP  HDEIDIEFLGTTP KPYTLQTNVY++G+GDG NIIGRE+RF+LWFDPT
Sbjct  60   F--SNNEDHPGNHDEIDIEFLGTTPDKPYTLQTNVYIRGTGDG-NIIGREMRFHLWFDPT  116

Query  525  QDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYK  346
            QD+H+YAILW PSEI+FFVDDVPIR YPRKSDATFP R M+VYGSIWDASSWATENGKYK
Sbjct  117  QDYHNYAILWTPSEIMFFVDDVPIRRYPRKSDATFPTRPMWVYGSIWDASSWATENGKYK  176

Query  345  ADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYD  166
            ADY YQPFI +Y +FK++GC A+  T+CRP   SP+GS  LS QQ +AM WVQ N+  YD
Sbjct  177  ADYNYQPFIARYTNFKLSGCNADGPTSCRPPSASPSGSDGLSQQQASAMNWVQGNYLVYD  236

Query  165  YCQNTNRDHTQTPEC  121
            YC ++ RDHTQTPEC
Sbjct  237  YCHDSKRDHTQTPEC  251



>gb|KDP29175.1| hypothetical protein JCGZ_16564 [Jatropha curcas]
Length=294

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/276 (68%), Positives = 218/276 (79%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            A  PPSPGY+PS++  S+ F QG+RNLWG  HQ +DQ  L+IWLD T  GSGFKS+K + 
Sbjct  19   ADWPPSPGYWPSSRFKSMSFYQGYRNLWGYSHQRVDQDALTIWLDST-SGSGFKSVKPFR  77

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY++G
Sbjct  78   SGYFGASIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRG  137

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGDG  IIGRE++F+LWFDPTQ+FHHYAILW+P EIIF VDDVPIR YPRKSDATFP R 
Sbjct  138  SGDG-KIIGREMKFHLWFDPTQNFHHYAILWSPKEIIFLVDDVPIRRYPRKSDATFPLRP  196

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            M+VYGSIWDASSWATE+GKYKADYRYQPF+ KY +FK  GC+A +   C P+  SP  S 
Sbjct  197  MWVYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFKAGGCSAYSPAWCHPVSASPFRSG  256

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             L+ QQ  AM WVQ +H  Y+YC +  RDH+ TPEC
Sbjct  257  GLTRQQHRAMRWVQTHHMVYNYCMDPKRDHSLTPEC  292



>ref|XP_006491659.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Citrus sinensis]
Length=293

 Score =   393 bits (1010),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/279 (68%), Positives = 218/279 (78%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S+ A  PPSP Y+PS+K  S+ F +GFRNLWGP+HQ  +Q  L+IWLD +  GSGFKS+K
Sbjct  16   SSFAYWPPSPAYWPSSKFSSMSFYKGFRNLWGPQHQRDEQNALTIWLDSS-SGSGFKSVK  74

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  75   PFRSGYFGASIKLQHGYTAGVITAFYLSNNEAHPGRHDEVDIEFLGTTFGKPYTLQTNVY  134

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW+P E+IF VDDVPIR YPRKS ATFP
Sbjct  135  IRGSGDG-KIIGREMKFHLWFDPTKDFHHYAILWSPKELIFLVDDVPIRRYPRKSAATFP  193

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADYRYQPF+ +Y DFK  GC A     CRP+  SP 
Sbjct  194  LRPMWVYGSIWDASSWATEDGKYKADYRYQPFVARYTDFKACGCTAYAPAWCRPVSVSPF  253

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  LS QQ  AM W+Q +H  YDYC++  RDH  TPEC
Sbjct  254  HSGGLSRQQYWAMRWLQSHHLVYDYCRDQKRDHFLTPEC  292



>ref|XP_002519471.1| Xyloglucan endotransglucosylase/hydrolase protein 14 precursor, 
putative [Ricinus communis]
 gb|EEF42885.1| Xyloglucan endotransglucosylase/hydrolase protein 14 precursor, 
putative [Ricinus communis]
Length=296

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 221/280 (79%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            +S +A+ PPSPGY+PST+   + F QG++NLWG  HQ +DQ  L+IWLD T  GSGFKS+
Sbjct  15   ASTHAEWPPSPGYWPSTRFRPMSFYQGYKNLWGYSHQRVDQNALTIWLDST-SGSGFKSV  73

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNV
Sbjct  74   KPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNV  133

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG NIIGRE++F+LWFDPTQ+FHHYAILW+P EIIF VDDVPIR YPRKS ATF
Sbjct  134  YIRGSGDG-NIIGREMKFHLWFDPTQNFHHYAILWSPKEIIFLVDDVPIRRYPRKSAATF  192

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+VYGSIWDASSWATE+GKYKADYRYQPF+ +Y +FK  GC+A +   C P+  SP
Sbjct  193  PLRPMWVYGSIWDASSWATEDGKYKADYRYQPFVAQYTNFKAGGCSAYSPAWCHPLSASP  252

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              S  L+ QQ  AM WVQ  H  Y+YC ++ RDH+ TPEC
Sbjct  253  FKSGGLTRQQYRAMRWVQTRHMVYNYCMDSKRDHSLTPEC  292



>gb|KHG06305.1| putative xyloglucan endotransglucosylase/hydrolase 31 -like protein 
[Gossypium arboreum]
Length=301

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 201/286 (70%), Positives = 238/286 (83%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            + F   +S NAQ PPSPGY PS+++ S+ FNQGFRNLWGP+HQ + QG+L+IWLDKT  G
Sbjct  18   LAFFMIASGNAQGPPSPGYSPSSRISSVTFNQGFRNLWGPQHQRVYQGSLTIWLDKT-SG  76

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL+ Y SGY GA++KLQ GYTAGVIT LYLSN E HP  HDEIDIEFLGTTP KPY
Sbjct  77   SGFKSLEPYQSGYFGAAMKLQPGYTAGVITSLYLSNNEDHPGNHDEIDIEFLGTTPDKPY  136

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG N+IGRE++F+LWFDPTQD+H+YAILW PSEIIF VDDVPIR Y R
Sbjct  137  TLQTNVYIRGSGDG-NLIGREMKFHLWFDPTQDYHNYAILWTPSEIIFLVDDVPIRRYTR  195

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KSDATFP R M+VYGS+WDASSWATENG+YKADY YQPF+G+Y +FK++GC AN+  +C 
Sbjct  196  KSDATFPTRPMWVYGSVWDASSWATENGRYKADYSYQPFVGRYTNFKISGCTANSPASCH  255

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+GS  LS QQ++AM WVQ+N+  YDYC +  RDHTQTPEC
Sbjct  256  PPSASPSGSGSLSRQQVSAMNWVQRNYLVYDYCHDPKRDHTQTPEC  301



>ref|XP_006291596.1| hypothetical protein CARUB_v10017750mg [Capsella rubella]
 gb|EOA24494.1| hypothetical protein CARUB_v10017750mg [Capsella rubella]
Length=293

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/276 (66%), Positives = 224/276 (81%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
             Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  GSGFKSL+ Y 
Sbjct  20   GQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKS-TGSGFKSLRPYR  78

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GASIKLQ G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV+++G
Sbjct  79   SGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRG  138

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD  N+IGRE++F LWFDPTQDFHHYAILWN ++IIFFVDDVPIR Y RK++ATFP R 
Sbjct  139  SGDR-NVIGREMKFTLWFDPTQDFHHYAILWNSNQIIFFVDDVPIRTYNRKNEATFPTRP  197

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC AN+ ++CRP   +P  + 
Sbjct  198  MWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTANSVSSCRPPSSAPARNQ  257

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             LS QQ+AAMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  258  GLSRQQMAAMAWAQRNFLVYNYCHDPKRDHTQTPEC  293



>ref|XP_011015586.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Populus euphratica]
Length=294

 Score =   392 bits (1008),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 186/283 (66%), Positives = 221/283 (78%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  SS+NAQ PPSPGY+P ++  S+ F QG+RNLWG  HQ +DQ  L+IWLD T  GSGF
Sbjct  12   MVPSSSNAQWPPSPGYWPGSRFRSMSFYQGYRNLWGYSHQRVDQNALTIWLDST-SGSGF  70

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQ
Sbjct  71   KSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQ  130

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNVY++GSGDG  IIGRE++F+LWFDPT+ FH+YAILW+P EIIF VDDVPIR YPRKS 
Sbjct  131  TNVYIRGSGDG-RIIGREMKFHLWFDPTKTFHYYAILWSPKEIIFLVDDVPIRRYPRKSA  189

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
             TFP R M+VYGSIWDASSWATE+GKYK DYRYQPF+  Y +FK +GC+A +   C P+ 
Sbjct  190  TTFPLRPMWVYGSIWDASSWATEDGKYKVDYRYQPFVASYTNFKASGCSAYSPAWCHPVS  249

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP  S  L+ QQ  +M WVQ++H  YDYC++  RDH+ TPEC
Sbjct  250  ASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPEC  292



>ref|XP_004161263.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cucumis sativus]
 emb|CCH26635.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=292

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 220/280 (79%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            S   A  PPSPG++PST+  S+ F +GFRNLWGP+HQSL Q TLSIWLD+T  GSGFKSL
Sbjct  13   SPAAASWPPSPGFWPSTRFRSMEFYKGFRNLWGPQHQSLSQNTLSIWLDRT-TGSGFKSL  71

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + + SGY  ASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNV
Sbjct  72   RPFRSGYFAASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNV  131

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW P+EIIF VDD+PIR YPRKS  TF
Sbjct  132  YVRGSGDG-RIIGREMKFHLWFDPTKDFHHYAILWRPNEIIFLVDDIPIRRYPRKSATTF  190

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M++YGSIWDASSWATE+GKY+ADYRYQPF+ KY +FK  GC+A +   CRP+  SP
Sbjct  191  PLRPMWLYGSIWDASSWATEDGKYRADYRYQPFVAKYTNFKAGGCSAYSPAWCRPVSASP  250

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              S  L+ QQ  AM WVQ +   Y+YC +  RDH+ TPEC
Sbjct  251  FRSGGLTRQQKNAMKWVQSHQLVYNYCWDNKRDHSLTPEC  290



>ref|XP_004137842.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cucumis sativus]
 gb|KGN58992.1| hypothetical protein Csa_3G741330 [Cucumis sativus]
Length=292

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 220/280 (79%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            S   A  PPSPG++PST+  S+ F +GFRNLWGP+HQSL Q TLSIWLD+T  GSGFKSL
Sbjct  13   SPAAASWPPSPGFWPSTRFRSMEFYKGFRNLWGPQHQSLSQNTLSIWLDRT-TGSGFKSL  71

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + + SGY  ASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNV
Sbjct  72   RPFRSGYFAASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNV  131

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG  IIGRE++F+LWFDPT+DFHHYAILW P+EIIF VDD+PIR YPRKS  TF
Sbjct  132  YVRGSGDG-RIIGREMKFHLWFDPTKDFHHYAILWRPNEIIFLVDDIPIRRYPRKSATTF  190

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M++YGSIWDASSWATE+GKY+ADYRYQPF+ KY +FK  GC+A +   CRP+  SP
Sbjct  191  PLRPMWLYGSIWDASSWATEDGKYRADYRYQPFVAKYTNFKAGGCSAYSPAWCRPVSASP  250

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              S  L+ QQ  AM WVQ +   Y+YC +  RDH+ TPEC
Sbjct  251  FRSGGLTRQQKNAMKWVQSHQLVYNYCWDNKRDHSLTPEC  290



>ref|XP_011032301.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Populus euphratica]
Length=294

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 228/276 (83%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            AQ  PSPGYYPS+++ S+GF+QG+ NLWG +HQ ++QGT++IWLD +  GSG+KSL  Y 
Sbjct  21   AQNTPSPGYYPSSRISSIGFDQGYSNLWGAQHQRVEQGTVTIWLDSS-SGSGYKSLHPYR  79

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ GYTAGVIT  YLSN E HP +HDEIDIEFLGTTP KPYTLQTNVY++G
Sbjct  80   SGYFGAAIKLQPGYTAGVITSFYLSNNEAHPGDHDEIDIEFLGTTPDKPYTLQTNVYIRG  139

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD  NIIGRE +F+LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP R 
Sbjct  140  SGDR-NIIGREKKFHLWFDPTQDFHNYAILWTPSEIIFLVDDVPIRRYPRKSDATFPSRP  198

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            M+VYGSIWDASSWATE+GKYKADY YQPFIG+YK+FK+ GC A+   +C P   SP+GS 
Sbjct  199  MWVYGSIWDASSWATEDGKYKADYNYQPFIGRYKNFKIGGCTADGPASCSPPSASPSGSG  258

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             LS QQ + M WVQ+N+  YDYC++  RDHTQTPEC
Sbjct  259  GLSQQQSSVMEWVQRNYLVYDYCRDGKRDHTQTPEC  294



>ref|XP_009150317.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Brassica rapa]
Length=292

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 226/283 (80%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  SS  +Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++ LDK+  GSGF
Sbjct  12   VLCSSGYSQRSPSPGYYPSSRVPTSPFDRDFRTLWGSQHQRTEQDVITLLLDKS-SGSGF  70

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KSL+SY SGY GASIKLQ+GYTAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQ
Sbjct  71   KSLRSYKSGYFGASIKLQSGYTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQ  130

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNV+++GSGD  N+IGRE++FNLWFDPTQDFHHYAILWN ++I+F+VDDVPIR Y RK++
Sbjct  131  TNVFVRGSGDR-NVIGREMKFNLWFDPTQDFHHYAILWNSNQIVFYVDDVPIRTYDRKNE  189

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
            A FP R M++YGSIWDAS WATENG+ KADYRYQPFI KY +FK+ GC A  S++C P  
Sbjct  190  AIFPTRPMWLYGSIWDASDWATENGRIKADYRYQPFIAKYTNFKLAGCTAEGSSSCTPPS  249

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP G+  LS QQ+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  250  ASPMGNRGLSQQQMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  292



>ref|XP_004304471.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Fragaria vesca subsp. vesca]
Length=293

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 221/279 (79%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S+NA  PPSPGY+PS+K  ++ F +GFR LWG +HQSLDQ  L+IWLD+T G SGFKS+K
Sbjct  15   SSNAGWPPSPGYWPSSKFRTMSFYKGFRTLWGAQHQSLDQNALTIWLDRTTG-SGFKSVK  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY G+SIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGSSIKLQPGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIF VDDVPIR Y RKS ATFP
Sbjct  134  IRGSGDG-KIIGREMKFHLWFDPTKNFHHYAILWSPKEIIFLVDDVPIRRYQRKSVATFP  192

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M++YGSIWDASSWATE+GKYKADYRYQPF+ K+ +FK  GC+A +   C P+  SP 
Sbjct  193  LRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAKFTNFKAGGCSAYSPAWCHPVSASPF  252

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ   M WVQ NH  YDYC++  RDH+ TPEC
Sbjct  253  RSGGLTRQQYRVMKWVQANHMVYDYCRDYKRDHSLTPEC  291



>dbj|BAB78506.1| Xyloglucan endo-transglycosylase [Vitis labrusca x Vitis vinifera]
Length=291

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/286 (68%), Positives = 230/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            +I + T+ ++AQ PPSPG+ PS+K   + FNQGFRNLWG +HQ++DQG L+IWLD T  G
Sbjct  8    LILMITTCSDAQGPPSPGFSPSSKFSPISFNQGFRNLWGSQHQTIDQGLLTIWLDST-SG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSLK Y SGY  A+IKLQ GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY
Sbjct  67   SGFKSLKPYRSGYFSAAIKLQPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTLDKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVYMKGSGDG  +IGREV+ +LWFDPT+DFH+YAILW P EIIF VDDVP+R YPR
Sbjct  127  TLQTNVYMKGSGDG-RLIGREVKIHLWFDPTEDFHNYAILWTPDEIIFLVDDVPVRRYPR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            K+DATFP R M+VYGSIWDASSWATE+GKYKADYRYQPF+G+YK+FK+ GC  + + +CR
Sbjct  186  KNDATFPARPMWVYGSIWDASSWATEDGKYKADYRYQPFVGRYKNFKLGGCTTDAAASCR  245

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+ +  LS QQ +AM  VQKN+  YDYCQ+  RDH+Q PEC
Sbjct  246  PPSISPSSAEGLSQQQYSAMESVQKNYVVYDYCQDPKRDHSQIPEC  291



>ref|XP_002275862.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Vitis vinifera]
 emb|CBI17150.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 230/286 (80%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            +I + T+ ++AQ PPSPG+ PS+K   + FNQGFRNLWG +HQ++DQG L+IWLD T  G
Sbjct  8    LILMITTCSDAQGPPSPGFSPSSKFSPISFNQGFRNLWGSQHQTIDQGLLTIWLDST-SG  66

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSLK Y SGY  A+IKLQ GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY
Sbjct  67   SGFKSLKPYRSGYFSAAIKLQPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTLDKPY  126

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVYMKGSGDG  +IGREV+ +LWFDPT+DFH+YAILW P EIIF VDDVP+R YPR
Sbjct  127  TLQTNVYMKGSGDG-RLIGREVKIHLWFDPTEDFHNYAILWTPDEIIFLVDDVPVRRYPR  185

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            K+DATFP R M+VYGSIWDASSWATE+GKYKADYRYQPFIG+YK+FK+ GC  + + +CR
Sbjct  186  KNDATFPARPMWVYGSIWDASSWATEDGKYKADYRYQPFIGRYKNFKLGGCTTDAAASCR  245

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P   SP+ +  LS QQ +AM  VQKN+  YDYCQ+  RDH+Q PEC
Sbjct  246  PPSISPSSAGGLSQQQYSAMESVQKNYVVYDYCQDPKRDHSQIPEC  291



>gb|KHN39069.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Glycine soja]
Length=296

 Score =   391 bits (1004),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 223/289 (77%), Gaps = 4/289 (1%)
 Frame = -2

Query  981  AIIF--LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKT  808
            +I+F  L  SS+NA  PPSP Y PS+K   + F +GF NLWGP+HQS+DQ  L+IWLD +
Sbjct  8    SILFFMLMASSSNAYWPPSPDYRPSSKFRPVNFYRGFNNLWGPQHQSIDQNALTIWLDSS  67

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
              GSGFKS + + SGY GASIKL  GYTAGVIT  YLSN E HP  HDE+DIEFLGTT G
Sbjct  68   -SGSGFKSNRPFRSGYFGASIKLHPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFG  126

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            KPYTLQTNVY++GSGDG  IIGRE++F+LWFDPTQ+FHHYAILW+P EIIF VDD+PIR 
Sbjct  127  KPYTLQTNVYIRGSGDG-TIIGREMKFHLWFDPTQNFHHYAILWSPKEIIFLVDDIPIRR  185

Query  447  YPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTST  268
            YPRKS  TFP R M++YGSIWDASSWATE+GKYKADYRYQPF+ KY +F+  GC+A  S 
Sbjct  186  YPRKSAETFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFRAGGCSAYASR  245

Query  267  ACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             CRP+  SP  S  L+ +Q  AM WVQK H  Y+YCQ+  RDH  TPEC
Sbjct  246  RCRPVSASPYRSGGLTRRQYWAMRWVQKYHMVYNYCQDPKRDHRLTPEC  294



>ref|XP_008465400.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Cucumis melo]
Length=330

 Score =   392 bits (1006),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 223/284 (79%), Gaps = 9/284 (3%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLD-QGTLSIWLDKTHGGSG  793
            + +SS  AQ PP PG+YPS+ V S GF+Q FRNLWGP+HQ LD QG+++IWLD T  GSG
Sbjct  55   MSSSSTTAQGPPFPGFYPSSSVQSNGFSQYFRNLWGPQHQRLDDQGSVTIWLDNT-SGSG  113

Query  792  FKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTL  613
            FKSL SY SGY G ++KLQ GYTAGVIT  YLSN +  P  HDEID+EFLGTTPGKPYTL
Sbjct  114  FKSLHSYRSGYFGVAVKLQPGYTAGVITSFYLSNNQYFPGNHDEIDLEFLGTTPGKPYTL  173

Query  612  QTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS  433
            QTNV++KGSGDG NIIGRE++F+LWFDPTQ+FHHYAI W PS+IIF VDDVPIR Y R++
Sbjct  174  QTNVFIKGSGDG-NIIGREMKFHLWFDPTQNFHHYAIQWTPSDIIFLVDDVPIRRYTRRN  232

Query  432  DATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPI  253
            DATFP R M+VYGSIWDAS WATE+GKYKADY YQPF+ KY++FK++GC A    +CRP 
Sbjct  233  DATFPVRPMWVYGSIWDASQWATEDGKYKADYHYQPFVSKYREFKISGCTAEAGESCRPR  292

Query  252  PGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             G       LS +Q  AM WVQ+N+  YDYC +  RDHTQ PEC
Sbjct  293  SGG------LSEEQYKAMEWVQRNYLVYDYCNDPKRDHTQIPEC  330



>ref|XP_002313534.2| xyloglucan endotransglucosylase/hydrolase protein 31 precursor 
[Populus trichocarpa]
 gb|ABK95370.1| unknown [Populus trichocarpa]
 gb|EEE87489.2| xyloglucan endotransglucosylase/hydrolase protein 31 precursor 
[Populus trichocarpa]
Length=294

 Score =   390 bits (1003),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 228/276 (83%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            AQ  PSPGYYP +++ S+GF+QG+ NLWG +HQ ++QGT++IWLD +  GSG+KSL  Y 
Sbjct  21   AQNTPSPGYYPGSRISSIGFDQGYSNLWGAQHQRVEQGTVTIWLDSS-SGSGYKSLHPYR  79

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ GYTAGVIT  YLSN E HP +HDEIDIEFLGTTP KPYTLQTNVY++G
Sbjct  80   SGYFGAAIKLQPGYTAGVITSFYLSNNEAHPGDHDEIDIEFLGTTPDKPYTLQTNVYIRG  139

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD  NIIGRE++F+LWFDPTQDFH+YAILW PSEIIF VDDVPIR YPRKSDATFP R 
Sbjct  140  SGDR-NIIGREMKFHLWFDPTQDFHNYAILWTPSEIIFLVDDVPIRRYPRKSDATFPLRP  198

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            M+VYGSIWDASSWATE+GKYKADY YQPFIG+YK+FK+ GC A+   AC P   SP+GS 
Sbjct  199  MWVYGSIWDASSWATEDGKYKADYNYQPFIGRYKNFKIGGCTADGPAACSPPSASPSGSG  258

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             LS QQ + M WVQ+N+  YDYC++  RDHTQTPEC
Sbjct  259  GLSQQQSSVMEWVQRNYLVYDYCRDGKRDHTQTPEC  294



>ref|XP_010908974.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Elaeis guineensis]
Length=292

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 225/280 (80%), Gaps = 5/280 (2%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSL  781
            ++A A P PGYYPS++   + F +GF NLWGP+HQS+  DQ +L+IWLD++  GSGFKS 
Sbjct  14   HSAFAQPFPGYYPSSRFRPISFYKGFSNLWGPQHQSVSQDQSSLTIWLDRS-SGSGFKST  72

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + + +GY GASIKLQ GYTAGVIT  YLSN + HP  HDE+DIEFLGT PGKPYTLQTNV
Sbjct  73   RPFRNGYFGASIKLQTGYTAGVITAFYLSNDQAHPGFHDEVDIEFLGTIPGKPYTLQTNV  132

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG  IIGRE+RF+LWFDPT DFHHYAILWNP EI FFVDDVPIR Y RK+ ATF
Sbjct  133  YVRGSGDG-RIIGREMRFHLWFDPTADFHHYAILWNPDEIAFFVDDVPIRRYARKNGATF  191

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M++YGSIWDASSWATE+GKYKADYRYQPF+ ++  F + GC+A   ++CRP+  SP
Sbjct  192  PVRPMWIYGSIWDASSWATEDGKYKADYRYQPFVARFTRFMIGGCSAYAPSSCRPVAASP  251

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +GS  LS+QQ +AM WVQ N+  YDYCQ++ RDH+ TPEC
Sbjct  252  SGSG-LSSQQYSAMRWVQSNYMVYDYCQDSRRDHSLTPEC  290



>ref|XP_009772755.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Nicotiana sylvestris]
Length=296

 Score =   390 bits (1002),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/283 (66%), Positives = 224/283 (79%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  S+N    PPSPGYYPS+K  S+ F QGFRNLWGP HQ++D   ++IWLD+ + GSGF
Sbjct  14   VVPSTNAGYWPPSPGYYPSSKFRSMSFYQGFRNLWGPNHQNVDNNGINIWLDR-NSGSGF  72

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQ
Sbjct  73   KSIKPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGYHDEVDIEFLGTTFGKPYTLQ  132

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNVY++GSGDG  I+GRE++F+LWFDPT++FHHYAILW+P EIIF VDDVPIR Y RKS 
Sbjct  133  TNVYIRGSGDG-KIVGREMKFHLWFDPTKEFHHYAILWSPREIIFLVDDVPIRRYARKSI  191

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
            ATFP R M++YGSIWDASSWATE+GKYKADYRYQPF GK+ +FK +GC A +S  C P+ 
Sbjct  192  ATFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFYGKFTNFKASGCTAYSSRWCHPVS  251

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP+ S  L+ QQ  AM WV  ++  YDYC+++ RDH+ TPEC
Sbjct  252  ASPSRSGGLTRQQRQAMNWVHSHYLAYDYCRDSKRDHSLTPEC  294



>emb|CDX99172.1| BnaA06g18630D [Brassica napus]
Length=292

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 181/283 (64%), Positives = 226/283 (80%), Gaps = 2/283 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  SS  +Q  PSPGYYPS++V +  F++ FR LWG +H+  +Q  +++ LDK+  GSGF
Sbjct  12   VLCSSGYSQRSPSPGYYPSSRVPTSPFDRDFRTLWGSQHRRTEQDVITLLLDKS-SGSGF  70

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KSL+SY SGY GASIKLQ+GYTAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQ
Sbjct  71   KSLRSYKSGYFGASIKLQSGYTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQ  130

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD  430
            TNV+++GSGD  N+IGRE++FNLWFDPTQDFHHYAILWN ++I+F+VDDVPIR Y RK++
Sbjct  131  TNVFVRGSGDR-NVIGREMKFNLWFDPTQDFHHYAILWNSNQIVFYVDDVPIRTYDRKNE  189

Query  429  ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP  250
            A FP R M++YGSIWDAS WATENG+ KADYRYQPFI KY +FK+ GC A  S++C P  
Sbjct  190  AIFPTRPMWLYGSIWDASDWATENGRIKADYRYQPFIAKYTNFKLAGCTAEGSSSCTPPS  249

Query  249  GSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             SP G+  LS QQ+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  250  ASPMGNRGLSQQQMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  292



>ref|XP_006419084.1| hypothetical protein EUTSA_v10002627mg [Eutrema salsugineum]
 dbj|BAJ34323.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37520.1| hypothetical protein EUTSA_v10002627mg [Eutrema salsugineum]
Length=295

 Score =   390 bits (1001),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 181/276 (66%), Positives = 224/276 (81%), Gaps = 2/276 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            +Q  PSPGYYPS++V +  F++ F+ LWG +HQ  +Q  +++WLDK+  GSGFKS+ SY 
Sbjct  22   SQRSPSPGYYPSSRVPTSTFDREFQPLWGSQHQRREQDVITLWLDKS-TGSGFKSIHSYR  80

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GASIKLQ GYTAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV+++G
Sbjct  81   SGYFGASIKLQPGYTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRG  140

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGD  N+IGRE++FNLWFDPTQDFHHYAILWN ++I+F+VDDVPIR Y RK++A FP R 
Sbjct  141  SGDR-NVIGREMKFNLWFDPTQDFHHYAILWNANQIVFYVDDVPIRTYDRKNEAIFPTRP  199

Query  408  MYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST  229
            M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A+ ST+CRP   SP  + 
Sbjct  200  MWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADGSTSCRPPSASPMRNR  259

Query  228  RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             LS QQ+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  260  GLSRQQMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  295



>gb|KHG21816.1| putative xyloglucan endotransglucosylase/hydrolase 32 -like protein 
[Gossypium arboreum]
Length=293

 Score =   390 bits (1001),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/279 (67%), Positives = 218/279 (78%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NA  PPSPGY+PS K   + F++GF+NLWGP HQS++   L+IWLDKT  GSGFKS++
Sbjct  15   SANAGFPPSPGYWPSYKFRPMSFHKGFKNLWGPSHQSVNHNALTIWLDKT-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY  ASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFSASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPTQDFHHYAILW P EIIF VDDVPIR YPRKS ATFP
Sbjct  134  VRGSGDG-KIIGREMKFHLWFDPTQDFHHYAILWTPKEIIFLVDDVPIRRYPRKSAATFP  192

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYGSIWDASSWATE+GKYKADY+YQPF+ KY +FK +GC+A     C P+  SP 
Sbjct  193  LRPMWVYGSIWDASSWATEDGKYKADYKYQPFVAKYTNFKASGCSAYAPAWCHPVSASPF  252

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ  AM WVQ+ H  Y+YC++  R+H  TPEC
Sbjct  253  RSGGLTRQQRRAMRWVQRYHMVYNYCRDPKRNHALTPEC  291



>ref|XP_003535142.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Glycine max]
Length=296

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 223/289 (77%), Gaps = 4/289 (1%)
 Frame = -2

Query  981  AIIF--LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKT  808
            +I+F  L  SS+NA  PPSP Y PS+K   + F +GF NLWGP+HQS+DQ  L+IWLD +
Sbjct  8    SILFFMLMASSSNAYWPPSPDYRPSSKFRPVNFYRGFNNLWGPQHQSIDQNALTIWLDSS  67

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
              GSGFKS + + SGY GASIKL  GYTAGVIT  YLSN E HP  HDE+DIEFLGTT G
Sbjct  68   -SGSGFKSNRPFRSGYFGASIKLHPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFG  126

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            KPYTLQTNVY++GSGDG  IIGRE++F+LWFDPTQ+FHHYAILW+P EIIF VDD+PIR 
Sbjct  127  KPYTLQTNVYIRGSGDG-TIIGREMKFHLWFDPTQNFHHYAILWSPKEIIFLVDDIPIRR  185

Query  447  YPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTST  268
            YPRKS  TFP R +++YGSIWDASSWATE+GKYKADYRYQPF+ KY +F+  GC+A  S 
Sbjct  186  YPRKSAETFPLRPIWLYGSIWDASSWATEDGKYKADYRYQPFVAKYTNFRAGGCSAYASR  245

Query  267  ACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             CRP+  SP  S  L+ +Q  AM WVQK H  Y+YCQ+  RDH  TPEC
Sbjct  246  RCRPVSASPYRSGGLTRRQYWAMRWVQKYHMVYNYCQDPKRDHRLTPEC  294



>gb|ACD03222.1| xyloglucan endotransglucosylase/hydrolase 12 [Actinidia eriantha]
Length=294

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 222/287 (77%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
             +I +   +N    PPSPGYYPS+K  S+ F QGF+NLWGP+HQ +D   L+IWLD ++ 
Sbjct  8    VLILMVQPTNAGSWPPSPGYYPSSKFRSMSFYQGFKNLWGPQHQRMDNNALAIWLD-SNS  66

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  67   GSGFKSVRPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGYHDEVDIEFLGTTFGKP  126

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPTQ FHHYAILW+P EIIF VDDVPIR Y 
Sbjct  127  YTLQTNVYIRGSGDG-RIIGREMKFHLWFDPTQGFHHYAILWSPKEIIFLVDDVPIRRYQ  185

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            R+S ATFP R M++YGSIWDASSWATE+GKYKA+Y+YQPF+G Y +FK TGC+A     C
Sbjct  186  RQSVATFPLRPMWLYGSIWDASSWATEDGKYKANYQYQPFVGMYTNFKATGCSAYAPRWC  245

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             P+  SP  S  LS +Q  AM WVQ +   YDYC+++ RDH+ TPEC
Sbjct  246  HPVSASPFRSGGLSTRQYMAMRWVQSHFLVYDYCRDSKRDHSLTPEC  292



>ref|XP_008805707.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Phoenix dactylifera]
Length=292

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 224/280 (80%), Gaps = 5/280 (2%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSL  781
            ++A A PSPGYYPS+K   + F +GF NLWGP+HQS+  DQ +L+IWLD++  GSGFKS 
Sbjct  14   HSAIAQPSPGYYPSSKFRPISFYKGFNNLWGPQHQSVSQDQSSLTIWLDRS-SGSGFKST  72

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + + +GY GASIKLQ GYTAGVIT  YLSN + HP  HDE+DIEFLGT PGKPYTLQTNV
Sbjct  73   RPFRNGYFGASIKLQTGYTAGVITAFYLSNDQAHPGFHDEVDIEFLGTIPGKPYTLQTNV  132

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG  IIGRE+RFNLWFDPT DFHHYAILWNP EIIFFVDDVPIR Y RK+ AT+
Sbjct  133  YVRGSGDG-RIIGREMRFNLWFDPTADFHHYAILWNPDEIIFFVDDVPIRRYARKNGATY  191

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R +++YGSIWDASSWAT++GKYKADYRYQPF+ ++  F + GC+A   + C PI  SP
Sbjct  192  PMRPLWMYGSIWDASSWATDDGKYKADYRYQPFVARFTRFMIGGCSAYAPSGCLPIAASP  251

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +GS  LS+QQ AAM WVQ  +  YDYCQ++ RDH+ TPEC
Sbjct  252  SGSG-LSSQQNAAMRWVQSKYMVYDYCQDSRRDHSLTPEC  290



>ref|XP_008799509.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Phoenix dactylifera]
Length=292

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 220/274 (80%), Gaps = 5/274 (2%)
 Frame = -2

Query  936  PSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSG  763
            PSPGYYPS+K G + F QGF NLWGP+HQS+  DQ +L+IWLD +  GSGFKS++ + +G
Sbjct  20   PSPGYYPSSKFGPMSFYQGFNNLWGPQHQSVSQDQSSLTIWLDSS-SGSGFKSIRPFRNG  78

Query  762  YIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSG  583
            Y GAS++LQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTTPGKPYTLQTNVY++GSG
Sbjct  79   YFGASVRLQTGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTPGKPYTLQTNVYVRGSG  138

Query  582  DGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMY  403
            DG  IIGRE+RF+LWFDPT DFHHYAILWNP EIIFFVDDVPIR Y RK +AT+P R M+
Sbjct  139  DG-TIIGREMRFHLWFDPTADFHHYAILWNPDEIIFFVDDVPIRRYVRKDEATYPVRPMW  197

Query  402  VYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRL  223
            +YGSIWDASSWATE+GKYKADY YQPF+ ++  F + GC+A   + CRP+  SP+G   L
Sbjct  198  LYGSIWDASSWATEDGKYKADYHYQPFVARFAKFMIGGCSAYAPSDCRPVAASPSG-FGL  256

Query  222  SNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S+QQ AAM W Q N+  Y YCQ++ RDH+ TPEC
Sbjct  257  SSQQNAAMTWAQSNYMVYYYCQDSRRDHSLTPEC  290



>ref|XP_010696289.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Beta vulgaris subsp. vulgaris]
Length=299

 Score =   388 bits (996),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 226/287 (79%), Gaps = 3/287 (1%)
 Frame = -2

Query  978  IIFLFTSSN-NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            + F+ +S N +A  PPSPGYYPS K  S+ F QGF+NLWGP+HQ  DQ  L++WLD+T  
Sbjct  11   LSFMVSSINGSAPWPPSPGYYPSKKFKSMKFYQGFKNLWGPQHQRQDQHALTLWLDRT-S  69

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY G SIKLQ GYTAGVIT  YLSN E HP  HDE+D+EFLGTT GKP
Sbjct  70   GSGFKSVRPFRSGYFGTSIKLQRGYTAGVITSFYLSNNEAHPGVHDEVDMEFLGTTFGKP  129

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y LQTNVY++GSGDG  IIGRE++F+LWFDPT+ FHHYAILW+P EIIF VDD+PIR Y 
Sbjct  130  YVLQTNVYIRGSGDG-KIIGREMKFHLWFDPTKGFHHYAILWSPKEIIFLVDDIPIRRYL  188

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            +KS ATFP R M++YGSIWDASSWATENGKYKADYRYQPF+G+Y +FK +GC+A  S  C
Sbjct  189  KKSAATFPLRPMWLYGSIWDASSWATENGKYKADYRYQPFVGQYTNFKASGCSAYASLRC  248

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP+  SP  S  L+ +Q + M WVQK++  Y+YC++  RDH+ TPEC
Sbjct  249  RPVSVSPYRSGGLTRKQYSVMRWVQKHYMFYNYCKDYKRDHSLTPEC  295



>ref|XP_010098793.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Morus notabilis]
 gb|EXB75881.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Morus notabilis]
Length=282

 Score =   387 bits (994),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 216/279 (77%), Gaps = 2/279 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S+NA  PPSPGY+PSTK  ++ F +G+RNLWG  HQ  DQ  L+IWLD T  GSGFKS +
Sbjct  4    SSNADWPPSPGYWPSTKFRTISFYKGYRNLWGISHQRADQNALTIWLDST-SGSGFKSNR  62

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY G +IKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  63   PFRSGYFGVNIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  122

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE++F+LWFDPTQ FHHYAILW+P EIIF VDDVPIR YPRKS ATFP
Sbjct  123  IRGSGDG-KIIGREMKFHLWFDPTQAFHHYAILWSPKEIIFLVDDVPIRTYPRKSAATFP  181

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M++YGSIWDASSWATE+GKYKADYRYQPF+  Y +FK  GC+A  S  CRP+  SP 
Sbjct  182  LRPMWIYGSIWDASSWATEDGKYKADYRYQPFVAHYTNFKAGGCSAYASPWCRPVSASPF  241

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S  L+ QQ   M WVQ+ H  YDYC++  RDH+ TPEC
Sbjct  242  RSGGLTRQQYRTMRWVQRYHMVYDYCKDYKRDHSLTPEC  280



>ref|XP_011018780.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Populus euphratica]
Length=294

 Score =   387 bits (994),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/286 (66%), Positives = 225/286 (79%), Gaps = 2/286 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            +I +  SS+NAQ PPSPGY+PS++  S+ F++G+RNLWG  HQ +D   L+IWLD T  G
Sbjct  9    LILMAPSSSNAQWPPSPGYWPSSRFRSMSFSEGYRNLWGYSHQRVDPNALTIWLDST-SG  67

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GAS+KLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  68   SGFKSVKPFRSGYFGASVKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPY  127

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPR  439
            TLQTNVY++GSGDG  IIGRE++F+LWFDPT++FHHYAILW+P EIIF VDDVPIR YPR
Sbjct  128  TLQTNVYIRGSGDG-RIIGREMKFHLWFDPTKNFHHYAILWSPKEIIFLVDDVPIRRYPR  186

Query  438  KSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACR  259
            KS ATFP R M+VYGSIWDASSWATE GKYKADYRYQPF+  Y +FK  GC+A +   CR
Sbjct  187  KSAATFPLRPMWVYGSIWDASSWATEEGKYKADYRYQPFVASYTNFKAAGCSAYSPAWCR  246

Query  258  PIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P+  SP  S  L+ QQ   M WVQ+ H  Y+YC+++ RDH+ TPEC
Sbjct  247  PVSASPFRSGGLTRQQHRTMRWVQRYHMVYNYCKDSKRDHSLTPEC  292



>gb|KDP43978.1| hypothetical protein JCGZ_05445 [Jatropha curcas]
Length=293

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/263 (70%), Positives = 217/263 (83%), Gaps = 3/263 (1%)
 Frame = -2

Query  909  KVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAG  730
            ++  +GFNQGFRNLWGP+HQ +DQGTL++WLD +  GSG+KSL+SY SGY GA++KL  G
Sbjct  34   RISPIGFNQGFRNLWGPQHQKIDQGTLTVWLDSS-SGSGYKSLQSYRSGYFGAAMKLHPG  92

Query  729  YTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVR  550
            YTAGVIT  YLSN E  P  HDEIDIEFLGTTPGKPYTLQTNVYMKGSGDG  IIGRE+R
Sbjct  93   YTAGVITSFYLSNNEDFPGNHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDG-KIIGREMR  151

Query  549  FNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSW  370
            F+LWFDPTQDFH+YAILW P+EIIFFVDDVPIR YPRK+DATFP R M+VYGSIWDASSW
Sbjct  152  FHLWFDPTQDFHNYAILWTPNEIIFFVDDVPIRRYPRKNDATFPLRPMWVYGSIWDASSW  211

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWV  190
            ATE+GKYKADY YQPFIG+Y++FK++GC+ +   +C   P +    + LS QQ +AM WV
Sbjct  212  ATEDGKYKADYSYQPFIGRYRNFKISGCSTSGPASCH-SPSASPSGSGLSQQQYSAMQWV  270

Query  189  QKNHKEYDYCQNTNRDHTQTPEC  121
            Q N+  YDYC +  RDHTQTPEC
Sbjct  271  QSNYLAYDYCTDPKRDHTQTPEC  293



>ref|XP_002877376.1| hypothetical protein ARALYDRAFT_484893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53635.1| hypothetical protein ARALYDRAFT_484893 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 233/287 (81%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            A++ L  SS ++Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  
Sbjct  9    ALLVLCPSSGHSQGSPSPGYYPSSRVATSSFDREFRTLWGSQHQRREQDVITLWLDKS-T  67

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL+ Y SGY GASIKLQ G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKP
Sbjct  68   GSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKP  127

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y+LQTNV+ +GSGD  N+IGRE++F LWFDPTQDFHHYAILWNP+EI+FFVDD+PIR Y 
Sbjct  128  YSLQTNVFARGSGDR-NVIGREMKFTLWFDPTQDFHHYAILWNPNEIVFFVDDIPIRTYN  186

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RK++ATFP R M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A++S++C
Sbjct  187  RKNEATFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSC  246

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP   +P  +  LS QQ+AA+AW Q+N   Y+YC +  RDHTQTPEC
Sbjct  247  RPPSPAPVLNQGLSRQQMAALAWAQRNFLVYNYCHDPKRDHTQTPEC  293



>ref|XP_009149823.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Brassica rapa]
Length=292

 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 175/285 (61%), Positives = 226/285 (79%), Gaps = 2/285 (1%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
            + +F+    +Q  PSPGYYPS++V +  +++ FR  WG +HQ  +    ++WLDK   GS
Sbjct  10   LLVFSHCGYSQRSPSPGYYPSSRVPTSPYDRDFRTQWGFQHQRREHDITTLWLDKA-SGS  68

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKS++ Y SGY GASIKLQ+GYTAGV T  +LSN ++HP +HDE+DIEFLGTTPGKPY+
Sbjct  69   GFKSIRPYISGYFGASIKLQSGYTAGVDTSFFLSNHQEHPGDHDEVDIEFLGTTPGKPYS  128

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNV+++GSGD  N+IGRE++FNLWFDPTQDFHHYAILWNP++++F+VDDVPIR Y RK
Sbjct  129  LQTNVFVRGSGDR-NVIGREMKFNLWFDPTQDFHHYAILWNPNQVVFYVDDVPIRTYDRK  187

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            ++A FP R M+VYGSIWDAS WATENG+ KADYRYQPF+ +Y++FK+ GC A+ S +CRP
Sbjct  188  NEAIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAQYRNFKLAGCTADRSNSCRP  247

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               +PTG+  LS QQ+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  248  PSAAPTGNRGLSQQQMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  292



>emb|CDY29731.1| BnaAnng03530D [Brassica napus]
Length=292

 Score =   386 bits (991),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/285 (61%), Positives = 226/285 (79%), Gaps = 2/285 (1%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGS  796
            + +F+    +Q  PSPGYYPS++V +  +++ FR  WG +HQ  +    ++WLDK   GS
Sbjct  10   LLVFSHCGYSQRSPSPGYYPSSRVPTSPYDRDFRTQWGFQHQRREHDITTLWLDKA-SGS  68

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKS++ Y SGY GASIKLQ+GYTAGV T  +LSN ++HP +HDE+DIEFLGTTPGKPY+
Sbjct  69   GFKSIRPYISGYFGASIKLQSGYTAGVDTSFFLSNHQEHPGDHDEVDIEFLGTTPGKPYS  128

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNV+++GSGD  N+IGRE++FNLWFDPTQDFHHYAILWNP++++F+VDDVPIR Y RK
Sbjct  129  LQTNVFVRGSGDR-NVIGREMKFNLWFDPTQDFHHYAILWNPNQVVFYVDDVPIRTYDRK  187

Query  435  SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP  256
            ++A FP R M+VYGSIWDAS WATENG+ KADYRYQPF+ +Y++FK+ GC A+ S +CRP
Sbjct  188  NEAIFPARPMWVYGSIWDASDWATENGRIKADYRYQPFVAQYRNFKLAGCTADRSNSCRP  247

Query  255  IPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               +PTG+  LS QQ+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  248  PSAAPTGNRGLSQQQMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  292



>ref|XP_010045311.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Eucalyptus grandis]
 gb|KCW87473.1| hypothetical protein EUGRSUZ_B03937 [Eucalyptus grandis]
Length=306

 Score =   386 bits (991),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 216/263 (82%), Gaps = 2/263 (1%)
 Frame = -2

Query  909  KVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAG  730
            +  ++ F+QGFRNLWGP+HQ +DQGTL+IWLD +  GSGFKSL+ Y SGY  A++KLQ G
Sbjct  46   RFDAITFDQGFRNLWGPQHQVVDQGTLTIWLDSS-SGSGFKSLQRYKSGYFSAAVKLQPG  104

Query  729  YTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVR  550
            YTAGV TC YLSN E +P  HDE+DIEFLGTTP KPYTLQTNVY+ GSGDG NIIGRE++
Sbjct  105  YTAGVNTCFYLSNNEDYPGNHDEVDIEFLGTTPDKPYTLQTNVYITGSGDG-NIIGREMK  163

Query  549  FNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSW  370
            F+LWFDPT+DFH+YAILW P+EIIF VDDVPIR YPRK DATFP R M+VYGSIWDASSW
Sbjct  164  FHLWFDPTEDFHNYAILWTPNEIIFLVDDVPIRKYPRKGDATFPMRPMWVYGSIWDASSW  223

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWV  190
            ATENGKYKA+Y+YQPF+GKY +FK+ GC A++S +C+P   SP+ S  LS+QQ A M WV
Sbjct  224  ATENGKYKANYQYQPFVGKYTNFKIGGCTADSSASCQPPSASPSRSGGLSHQQKATMEWV  283

Query  189  QKNHKEYDYCQNTNRDHTQTPEC  121
            Q+N+  Y YC + +RD T TPEC
Sbjct  284  QRNYMVYYYCSDPSRDRTLTPEC  306



>ref|XP_004147295.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like, partial [Cucumis sativus]
Length=276

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 187/275 (68%), Positives = 218/275 (79%), Gaps = 4/275 (1%)
 Frame = -2

Query  939  PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            PPSPGY+PST+V S GF+Q FRN WG +HQ +DQGTL+IWLD +  GSGFKSL  Y SGY
Sbjct  4    PPSPGYFPSTQVQSTGFDQVFRNRWGSQHQKVDQGTLTIWLDSS-SGSGFKSLHRYQSGY  62

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             GA+IKL  GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY LQTNV+M+GSGD
Sbjct  63   FGAAIKLHPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTSDKPYVLQTNVFMRGSGD  122

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYV  400
            G NIIGRE+RF+LWF+PTQDFH+YAILW P EIIF VDDVPIR Y RKS+ATFP R M+V
Sbjct  123  G-NIIGREMRFHLWFNPTQDFHNYAILWTPEEIIFLVDDVPIRRYERKSEATFPVRPMWV  181

Query  399  YGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG--SPTGSTR  226
            YGSIWDASSWATE+GKYKADY+YQPFIG+Y +FK++GC  + + +CRP+       G  R
Sbjct  182  YGSIWDASSWATEDGKYKADYKYQPFIGRYNNFKLSGCTTDGAASCRPLNSGPGGGGRGR  241

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +S QQ  AM WVQ N+  Y+YC +  RDHT TPEC
Sbjct  242  MSQQQEKAMEWVQNNYLVYNYCHDPRRDHTLTPEC  276



>gb|AEX07607.1| xyloglucosyl transferase 3, partial [Brassica juncea]
Length=292

 Score =   385 bits (989),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 222/271 (82%), Gaps = 2/271 (1%)
 Frame = -2

Query  933  SPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIG  754
            SPGYYPS++V +  F++ FR LWG +HQ  +Q  +++ LDK+  GSGFKSL+SY SGY G
Sbjct  24   SPGYYPSSQVPTSPFDREFRTLWGSQHQRTEQDVITLLLDKS-SGSGFKSLRSYKSGYFG  82

Query  753  ASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGG  574
            ASIKLQ+GYTAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV+++GSGD  
Sbjct  83   ASIKLQSGYTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRGSGDR-  141

Query  573  NIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYG  394
            N+IGRE++FNLWFDPTQDFHHY+ILWNP++I+F+VDDVPIR Y RK++A FP R M++YG
Sbjct  142  NVIGREMKFNLWFDPTQDFHHYSILWNPNQIVFYVDDVPIRTYDRKNEAIFPTRPMWLYG  201

Query  393  SIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQ  214
            SIWDAS WATENG+ KADYRYQPFI KY +FK+ GC A+ S++C P   SP G+  LS +
Sbjct  202  SIWDASDWATENGRIKADYRYQPFIAKYTNFKLAGCTADGSSSCTPPSASPMGNRGLSQR  261

Query  213  QIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            Q+ AMAW Q+N   Y+YC +  RDHTQTPEC
Sbjct  262  QMGAMAWAQRNFLVYNYCHDPKRDHTQTPEC  292



>ref|XP_008462950.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Cucumis melo]
Length=297

 Score =   385 bits (988),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 216/275 (79%), Gaps = 4/275 (1%)
 Frame = -2

Query  939  PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            PPSPGY+PS +V S+GF Q FRN WG +HQ +DQGTL+IWLD +  GSGFKSL  Y SGY
Sbjct  25   PPSPGYFPSNQVQSIGFYQLFRNRWGSQHQKVDQGTLTIWLDSS-SGSGFKSLHRYRSGY  83

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             G +IKL  GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY LQTNV+M+GSGD
Sbjct  84   FGVAIKLHPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTWDKPYVLQTNVFMRGSGD  143

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYV  400
            G NIIGRE+RF+LWFDPTQDFH YAILW P EIIF VDDVPIR Y RKSD TFP R M+V
Sbjct  144  G-NIIGREMRFHLWFDPTQDFHSYAILWTPEEIIFLVDDVPIRRYERKSDTTFPVRPMWV  202

Query  399  YGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG--SPTGSTR  226
            YGSIWDASSWATE+GKYKADY+YQPFIG+YK+FK++GCAA  + +CRP+       G  R
Sbjct  203  YGSIWDASSWATEDGKYKADYKYQPFIGRYKNFKLSGCAAEGAASCRPLNSGPGGGGRGR  262

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +S QQ  AM WVQ N+  Y+YC +  RDHT TPEC
Sbjct  263  MSQQQEKAMEWVQNNYLVYNYCHDPRRDHTLTPEC  297



>gb|KGN64814.1| hypothetical protein Csa_1G109370 [Cucumis sativus]
Length=299

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/275 (68%), Positives = 218/275 (79%), Gaps = 4/275 (1%)
 Frame = -2

Query  939  PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            PPSPGY+PST+V S GF+Q FRN WG +HQ +DQGTL+IWLD +  GSGFKSL  Y SGY
Sbjct  27   PPSPGYFPSTQVQSTGFDQVFRNRWGSQHQKVDQGTLTIWLDSS-SGSGFKSLHRYQSGY  85

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             GA+IKL  GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY LQTNV+M+GSGD
Sbjct  86   FGAAIKLHPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTSDKPYVLQTNVFMRGSGD  145

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYV  400
            G NIIGRE+RF+LWF+PTQDFH+YAILW P EIIF VDDVPIR Y RKS+ATFP R M+V
Sbjct  146  G-NIIGREMRFHLWFNPTQDFHNYAILWTPEEIIFLVDDVPIRRYERKSEATFPVRPMWV  204

Query  399  YGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG--SPTGSTR  226
            YGSIWDASSWATE+GKYKADY+YQPFIG+Y +FK++GC  + + +CRP+       G  R
Sbjct  205  YGSIWDASSWATEDGKYKADYKYQPFIGRYNNFKLSGCTTDGAASCRPLNSGPGGGGRGR  264

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +S QQ  AM WVQ N+  Y+YC +  RDHT TPEC
Sbjct  265  MSQQQEKAMEWVQNNYLVYNYCHDPRRDHTLTPEC  299



>ref|XP_004163686.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Cucumis sativus]
Length=299

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/275 (68%), Positives = 218/275 (79%), Gaps = 4/275 (1%)
 Frame = -2

Query  939  PPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            PPSPGY+PST+V S GF+Q FRN WG +HQ +DQGTL+IWLD +  GSGFKSL  Y SGY
Sbjct  27   PPSPGYFPSTQVQSTGFDQVFRNRWGSQHQKVDQGTLTIWLDSS-SGSGFKSLHRYQSGY  85

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             GA+IKL  GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY LQTNV+M+GSGD
Sbjct  86   FGAAIKLHPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTSDKPYVLQTNVFMRGSGD  145

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYV  400
            G NIIGRE+RF+LWF+PTQDFH+YAILW P EIIF VDDVPIR Y RKS+ATFP R M+V
Sbjct  146  G-NIIGREMRFHLWFNPTQDFHNYAILWTPEEIIFLVDDVPIRRYERKSEATFPVRPMWV  204

Query  399  YGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG--SPTGSTR  226
            YGSIWDASSWATE+GKYKADY+YQPFIG+Y +FK++GC  + + +CRP+       G  R
Sbjct  205  YGSIWDASSWATEDGKYKADYKYQPFIGRYNNFKLSGCTTDGAASCRPLNSGPGRGGRGR  264

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +S QQ  AM WVQ N+  Y+YC +  RDHT TPEC
Sbjct  265  MSQQQEKAMEWVQNNYLVYNYCHDPRRDHTLTPEC  299



>emb|CBI30149.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   382 bits (981),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/259 (69%), Positives = 210/259 (81%), Gaps = 2/259 (1%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYTAG  718
            + F QGFRNLWGP+HQ +DQ  L+IWLD T  GSGFKS++ + SGY GASIKLQ GYTAG
Sbjct  1    MSFYQGFRNLWGPQHQRVDQNALTIWLDST-SGSGFKSVRPFRSGYFGASIKLQPGYTAG  59

Query  717  VITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLW  538
            VIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY++GSGDG  IIGRE++F+LW
Sbjct  60   VITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDG-RIIGREMKFHLW  118

Query  537  FDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATEN  358
            FDPT+DFHHYAILW+P +IIFFVDDVP+R YPRKS  TFP R M++YGSIWDASSWATE+
Sbjct  119  FDPTKDFHHYAILWSPKDIIFFVDDVPVRRYPRKSATTFPLRPMWLYGSIWDASSWATED  178

Query  357  GKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNH  178
            GKYKADYRYQPF+G+Y +FK +GC+A +  +CRP+  SP  S RL+ QQ  AM WVQ  H
Sbjct  179  GKYKADYRYQPFVGQYSNFKASGCSAYSPASCRPVSASPYRSGRLTGQQYRAMQWVQSRH  238

Query  177  KEYDYCQNTNRDHTQTPEC  121
              Y+YC +  RDH+ TPEC
Sbjct  239  MVYNYCSDNKRDHSLTPEC  257



>ref|XP_010111835.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Morus notabilis]
 gb|EXC31800.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Morus notabilis]
Length=502

 Score =   390 bits (1001),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 220/268 (82%), Gaps = 3/268 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPP-SPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            + FL   S +AQ PP SPGY PS++V S+GF+QGFRNLWG +HQS+DQG L+IWLD +  
Sbjct  9    LFFLMIFSTSAQGPPPSPGYNPSSEVNSIGFDQGFRNLWGSKHQSVDQGQLTIWLDNS-S  67

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS K Y SGY G ++KLQ GYTAGVIT  YLSN E HP  HDEIDIEFLGTTP KP
Sbjct  68   GSGFKSQKPYRSGYFGTAVKLQPGYTAGVITSFYLSNNEDHPGNHDEIDIEFLGTTPDKP  127

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSG   NIIGRE+RF+LWFDPTQDFH+YAI+WNP+EIIFFVDDVP+R Y 
Sbjct  128  YTLQTNVYVRGSG-SVNIIGREMRFHLWFDPTQDFHNYAIIWNPTEIIFFVDDVPVRRYL  186

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKSDATFP R M+VYGSIWDASSWATE+GKYKADY++QPFIG+YK+FK+ GC ++   +C
Sbjct  187  RKSDATFPMRPMWVYGSIWDASSWATEDGKYKADYKFQPFIGRYKNFKLAGCTSDEPASC  246

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNH  178
             P   SP+ ST LS QQ +AM WVQ+N+
Sbjct  247  HPPSASPSQSTGLSPQQESAMDWVQRNY  274



>ref|XP_009386049.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=289

 Score =   382 bits (981),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 220/279 (79%), Gaps = 5/279 (2%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLK  778
            +  A PSPGYYP +    L F QG+ NLWGP+HQS+  DQ +L+IWLD +  GSGFKS +
Sbjct  14   SVAAQPSPGYYPGSLFRPLRFYQGYSNLWGPQHQSVSQDQYSLTIWLDSS-SGSGFKSTR  72

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             Y +GY  ASIKLQ+GYTAGV T  YLSN + HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  73   PYRNGYFAASIKLQSGYTAGVNTAFYLSNNQAHPGNHDEVDIEFLGTTFGKPYTLQTNVY  132

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  +IGRE+RF+LWFDPT DFH YA+LWNP EIIFFVDDVPIR Y +K++ATFP
Sbjct  133  VRGSGDG-RLIGREMRFHLWFDPTADFHRYAMLWNPDEIIFFVDDVPIRRYEKKTEATFP  191

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M++YGSIWDASSWATENGKYK DY+YQPF+ +Y DFK+ GC+A   + CRP+  SP+
Sbjct  192  DRPMWMYGSIWDASSWATENGKYKVDYQYQPFVARYTDFKIGGCSAFAPSGCRPVRASPS  251

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G   LS QQ AAM WVQ+NH  YDYCQ+ +RDH+ TPEC
Sbjct  252  GGG-LSPQQRAAMEWVQRNHLVYDYCQDYSRDHSLTPEC  289



>ref|XP_009394629.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=293

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 228/289 (79%), Gaps = 8/289 (3%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSL-GFNQGFRNLWGPEHQSL--DQGTLSIWLDKT  808
            ++F+    +NAQ  PSPGYYPS +   L GF++GF NLWGPEHQS+  DQ +++IWLD+ 
Sbjct  8    LLFVMLHWSNAQ--PSPGYYPSYRFRPLRGFDRGFNNLWGPEHQSVSGDQSSVTIWLDR-  64

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
            + GSGFKS++ + +GY GASIKLQ GYTAGVIT  YLSN + HP  HDE+DIEFLGTTPG
Sbjct  65   NSGSGFKSIRPFRNGYFGASIKLQPGYTAGVITAFYLSNNQAHPGFHDEVDIEFLGTTPG  124

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            KPYTLQTNVY++GSGDG NIIGRE++F+LWFDPT  FH+Y ILWNP+EIIFFVDDVPIR 
Sbjct  125  KPYTLQTNVYVRGSGDG-NIIGREMKFHLWFDPTAGFHNYGILWNPNEIIFFVDDVPIRQ  183

Query  447  YPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTST  268
            YPRKS  TFPQR M++YGSIWDASSWATE+GKY+ADYRYQPF+ ++  F V GCA +   
Sbjct  184  YPRKSAGTFPQRPMWLYGSIWDASSWATEDGKYRADYRYQPFVARFTRFIVRGCAPSAPP  243

Query  267  ACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             CRP P S  G+  LS +Q AAM W Q++   Y+YC++  RDH+ TPEC
Sbjct  244  RCRPAPSSSYGAG-LSRRQFAAMGWAQRHFMVYNYCRDPKRDHSLTPEC  291



>ref|NP_190085.1| xyloglucan endotransglucosylase/hydrolase [Arabidopsis thaliana]
 sp|P93046.2|XTH31_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 31; Short=At-XTH31; Short=AtXTR8; Short=XTH-31; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB89314.1| xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AAL07012.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AAM97119.1| xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AAP13434.1| At3g44990 [Arabidopsis thaliana]
 gb|AEE77976.1| xyloglucan endotransglucosylase/hydrolase [Arabidopsis thaliana]
Length=293

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/287 (64%), Positives = 232/287 (81%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            A++ L  SS ++Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  
Sbjct  9    ALLVLCPSSGHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKS-T  67

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL+ Y SGY GASIKLQ G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKP
Sbjct  68   GSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKP  127

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y+LQTNV+++GSGD  N+IGRE++F LWFDPTQDFHHYAILWNP++I+FFVDDVPIR Y 
Sbjct  128  YSLQTNVFVRGSGDR-NVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYN  186

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RK++A FP R M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A++S++C
Sbjct  187  RKNEAIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSC  246

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP   +P  +  LS QQ+AA+ W Q+N   Y+YC +  RDHTQTPEC
Sbjct  247  RPPSPAPMRNRGLSRQQMAALTWAQRNFLVYNYCHDPKRDHTQTPEC  293



>emb|CAA63553.1| xyloglucan endo-transglycosylase [Arabidopsis thaliana]
Length=293

 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 232/287 (81%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            A++ L  SS ++Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  
Sbjct  9    ALVVLCPSSGHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKS-T  67

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL+ Y SGY GASIKLQ G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKP
Sbjct  68   GSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKP  127

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            Y+LQTNV+++GSGD  N+IGRE++F LWFDPTQDFHHYAILWNP++I+FFVDDVPIR Y 
Sbjct  128  YSLQTNVFVRGSGDR-NVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYN  186

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RK++A FP R M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A++S++C
Sbjct  187  RKNEAIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSC  246

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP   +P  +  L+ QQ+AA+ W Q+N   Y+YC +  RDHTQTPEC
Sbjct  247  RPPSPAPMRNRGLTRQQMAALTWAQRNFLVYNYCHDPKRDHTQTPEC  293



>ref|XP_009418099.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=294

 Score =   378 bits (970),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 220/281 (78%), Gaps = 7/281 (2%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKS  784
            S NAQ  PSPGYYPS+++  + F QG+  LWGP+HQS+  DQ +++IWLD++  GSGFKS
Sbjct  19   SINAQ--PSPGYYPSSRIWPMRFYQGYSYLWGPQHQSVSQDQSSVTIWLDRS-SGSGFKS  75

Query  783  LKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTN  604
             + Y +GY GASIKLQ GYTAGV T  YLSN + HP  HDE+DIEFLGTTPGKPYTLQTN
Sbjct  76   NRPYRNGYFGASIKLQGGYTAGVNTAFYLSNNQAHPGFHDEVDIEFLGTTPGKPYTLQTN  135

Query  603  VYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDAT  424
            VY++GSGDG  IIGRE+RF LWFDPT DFHHYAILWNP EIIFFVDDVPIR Y RK +AT
Sbjct  136  VYVRGSGDG-RIIGREMRFYLWFDPTADFHHYAILWNPDEIIFFVDDVPIRRYARKMEAT  194

Query  423  FPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGS  244
            FP R M+VYGSIWDASSWATENGKYK DY +QPF+ ++  FK  GC+A    +C P+  S
Sbjct  195  FPDRPMWVYGSIWDASSWATENGKYKVDYGHQPFVARFTGFKTAGCSAYAPWSCNPVSSS  254

Query  243  PTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P G   LS+QQ AAM W Q+NH  Y+YCQ+ +RDH+ TPEC
Sbjct  255  PAGYG-LSSQQDAAMQWAQRNHMIYNYCQDYSRDHSLTPEC  294



>ref|XP_010503152.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Camelina sativa]
Length=293

 Score =   377 bits (967),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/280 (65%), Positives = 228/280 (81%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            SS ++Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  GSGFKS+
Sbjct  16   SSGHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKS-TGSGFKSI  74

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + Y SGY GASIKLQ G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV
Sbjct  75   RPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNV  134

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            + +GSGD  N+IGRE++F LWFDPTQDFHHYAILWNP++I+FFVDDVPIR Y RK++ATF
Sbjct  135  FARGSGDR-NVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNEATF  193

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A++S++CRP   +P
Sbjct  194  PTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSCRPPSPAP  253

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              +  LS QQ+AAM W Q+N   Y+YC +  RDHTQTPEC
Sbjct  254  FRNQGLSRQQMAAMTWAQRNFLVYNYCHDPKRDHTQTPEC  293



>gb|KGN46873.1| hypothetical protein Csa_6G147660 [Cucumis sativus]
Length=289

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 221/277 (80%), Gaps = 9/277 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLD-QGTLSIWLDKTHGGSGFKSLKSY  772
            AQ PP PG+YPS+ + S GF+Q FRNLWGP+HQ LD QG+++IWLD T  GSGFKSL+SY
Sbjct  21   AQGPPFPGFYPSSSIQSSGFSQYFRNLWGPQHQRLDDQGSVTIWLDST-SGSGFKSLQSY  79

Query  771  GSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMK  592
             SGY G ++KLQ+GYTAGVIT  YLSN +  P  HDEID+EFLGTTPGKPYTLQTNV+++
Sbjct  80   LSGYFGVAVKLQSGYTAGVITSFYLSNNQYFPGNHDEIDLEFLGTTPGKPYTLQTNVFIR  139

Query  591  GSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQR  412
            GSGDG NIIGREV+F+LWFDPTQ+FHHYAI W PS+IIF VDDVPIR Y RK+DATFP R
Sbjct  140  GSGDG-NIIGREVKFHLWFDPTQNFHHYAIRWTPSDIIFLVDDVPIRRYTRKNDATFPVR  198

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGS  232
             ++VYGSIWDAS WATE+GKYKADYRYQPF+ KY++FK++GC      +CR       GS
Sbjct  199  PLWVYGSIWDASQWATEDGKYKADYRYQPFVSKYQEFKISGCRGLAGESCR------AGS  252

Query  231  TRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              LS +Q  AM WVQ+N+  YDYC +  RDHTQ PEC
Sbjct  253  GGLSQEQYKAMEWVQRNYLVYDYCNDPKRDHTQIPEC  289



>ref|XP_004145761.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Cucumis sativus]
Length=298

 Score =   376 bits (965),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/278 (67%), Positives = 221/278 (79%), Gaps = 9/278 (3%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLD-QGTLSIWLDKTHGGSGFKSLKS  775
             AQ PP PG+YPS+ + S GF+Q FRNLWGP+HQ LD QG+++IWLD T  GSGFKSL+S
Sbjct  29   TAQGPPFPGFYPSSSIQSSGFSQYFRNLWGPQHQRLDDQGSVTIWLDST-SGSGFKSLQS  87

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY G ++KLQ+GYTAGVIT  YLSN +  P  HDEID+EFLGTTPGKPYTLQTNV++
Sbjct  88   YLSGYFGVAVKLQSGYTAGVITSFYLSNNQYFPGNHDEIDLEFLGTTPGKPYTLQTNVFI  147

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NIIGREV+F+LWFDPTQ+FHHYAI W PS+IIF VDDVPIR Y RK+DATFP 
Sbjct  148  RGSGDG-NIIGREVKFHLWFDPTQNFHHYAIRWTPSDIIFLVDDVPIRRYTRKNDATFPV  206

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R ++VYGSIWDAS WATE+GKYKADYRYQPF+ KY++FK++GC      +CR       G
Sbjct  207  RPLWVYGSIWDASQWATEDGKYKADYRYQPFVSKYQEFKISGCRGLAGESCR------AG  260

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S  LS +Q  AM WVQ+N+  YDYC +  RDHTQ PEC
Sbjct  261  SGGLSQEQYKAMEWVQRNYLVYDYCNDPKRDHTQIPEC  298



>ref|XP_009413141.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=290

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 219/278 (79%), Gaps = 5/278 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            A + PSPG++P + +  + F QG+ NLWGP+HQS+  DQ T +IWLD +  GSGFKS  +
Sbjct  16   AISQPSPGFHPGSSLSPVRFYQGYGNLWGPQHQSVSQDQYTATIWLDSS-SGSGFKSNTA  74

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY GASIKLQ+GYTAGV T  YLSN + +P  HDE+DIEFLG   G+PYTLQTNVY+
Sbjct  75   YRNGYFGASIKLQSGYTAGVNTAFYLSNNQAYPGFHDEVDIEFLGNIAGRPYTLQTNVYV  134

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  IIGRE+RF+LWFDPT DFHHY ILWNP EIIFFVDDVP+R Y RK++ATFP 
Sbjct  135  RGSGDG-RIIGREMRFHLWFDPTADFHHYGILWNPDEIIFFVDDVPVRRYARKTEATFPD  193

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M++YGSIWDASSWAT+NG+Y+ADYRYQPF+ ++  FK+ GC A+   +CRP+P SP+G
Sbjct  194  RPMWMYGSIWDASSWATDNGRYRADYRYQPFVAEFTGFKLGGCTASAPPSCRPVPSSPSG  253

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS +Q AAM WVQ NH  YDYCQ++ RDH+ TPEC
Sbjct  254  GG-LSPEQYAAMQWVQSNHMVYDYCQDSTRDHSLTPEC  290



>ref|XP_010425930.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Camelina sativa]
Length=293

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/280 (64%), Positives = 227/280 (81%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            S  ++Q  PSPGYYPS++V +  F++ F+ LWG +HQ  +Q  +++WLDK+  GSGFKS+
Sbjct  16   SGGHSQRSPSPGYYPSSRVPTSPFDREFQTLWGSQHQRREQDVVTLWLDKS-TGSGFKSI  74

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + Y SGY GASIKLQ G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV
Sbjct  75   RPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNV  134

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            + +GSGD  N+IGRE++F LWFDPTQDFHHYAILWNP++I+FFVDDVPIR Y RK++ATF
Sbjct  135  FARGSGDR-NVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNEATF  193

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A++S++CRP   +P
Sbjct  194  PTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSCRPPSPAP  253

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              +  LS QQ+AAM W Q+N   Y+YC +  RDHTQTPEC
Sbjct  254  FRNQGLSRQQMAAMTWAQRNFLVYNYCHDPKRDHTQTPEC  293



>ref|XP_010514834.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 isoform X1 [Camelina sativa]
Length=293

 Score =   372 bits (955),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 180/280 (64%), Positives = 227/280 (81%), Gaps = 2/280 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            SS ++Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  GSGFKS+
Sbjct  16   SSCHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKS-TGSGFKSI  74

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + Y SGY GASIKL  G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV
Sbjct  75   RPYRSGYFGASIKLHPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNV  134

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            + +GSGD  N+IGRE++F LWFDPT+DFHHYAILWNP++I+FFVDDVPIR Y RK++ATF
Sbjct  135  FARGSGDR-NVIGREMKFTLWFDPTKDFHHYAILWNPNQIVFFVDDVPIRTYNRKNEATF  193

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M+VYGSIWDAS WATENG+ KADYRYQPF+ KYK+FK+ GC A++S++CRP   +P
Sbjct  194  PTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSCRPPSPAP  253

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              +  LS QQ+AAM W Q+N   Y+YC +  RDHTQTPEC
Sbjct  254  FRNQGLSRQQMAAMTWAQRNFLVYNYCHDPKRDHTQTPEC  293



>emb|CCH26634.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=289

 Score =   372 bits (955),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 220/277 (79%), Gaps = 9/277 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLD-QGTLSIWLDKTHGGSGFKSLKSY  772
            AQ PP PG+YPS+ + S GF+Q FRNLWGP+HQ LD QG+++IWLD T  GSGFKSL+SY
Sbjct  21   AQGPPFPGFYPSSSIQSSGFSQYFRNLWGPQHQRLDDQGSVTIWLDST-SGSGFKSLQSY  79

Query  771  GSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMK  592
             SGY G ++KLQ+GYTAGVIT  YLSN +  P  HDEID+EFLGTTPGKPYTLQTNV+++
Sbjct  80   LSGYFGVAVKLQSGYTAGVITSFYLSNNQYFPGNHDEIDLEFLGTTPGKPYTLQTNVFIR  139

Query  591  GSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQR  412
            GSGDG NIIGRE++F+LWFDPTQ+FHHYAI W PS+IIF VDDVPIR Y RK+DATFP R
Sbjct  140  GSGDG-NIIGREMKFHLWFDPTQNFHHYAIRWTPSDIIFLVDDVPIRRYTRKNDATFPVR  198

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGS  232
             ++VYGSIWDAS WATE+GKYKADY YQPF+ KY++FK++GC      +CR       GS
Sbjct  199  PLWVYGSIWDASQWATEDGKYKADYHYQPFVSKYQEFKISGCRGLAGESCR------AGS  252

Query  231  TRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              LS +Q  AM WVQ+N+  YDYC +  RDHTQ PEC
Sbjct  253  GGLSQEQYKAMEWVQRNYLVYDYCNDPKRDHTQIPEC  289



>ref|XP_004160069.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Cucumis sativus]
Length=298

 Score =   372 bits (955),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 184/278 (66%), Positives = 220/278 (79%), Gaps = 9/278 (3%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLD-QGTLSIWLDKTHGGSGFKSLKS  775
             AQ PP PG+YPS+ + S GF+Q FRNLWGP+HQ LD QG+++IWLD T  GSGFKSL+S
Sbjct  29   TAQGPPFPGFYPSSSIQSSGFSQYFRNLWGPQHQRLDDQGSVTIWLDST-SGSGFKSLQS  87

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY G ++KLQ+GYTAGVIT  YLSN +  P  HDEID+EFLGTTPGKPYTLQTNV++
Sbjct  88   YLSGYFGVAVKLQSGYTAGVITSFYLSNNQYFPGNHDEIDLEFLGTTPGKPYTLQTNVFI  147

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NIIGRE++F+LWFDPTQ+FHHYAI W PS+IIF VDDVPIR Y RK+DATFP 
Sbjct  148  RGSGDG-NIIGREMKFHLWFDPTQNFHHYAIRWTPSDIIFLVDDVPIRRYTRKNDATFPV  206

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R ++VYGSIWDAS WATE+GKYKADY YQPF+ KY++FK++GC      +CR       G
Sbjct  207  RPLWVYGSIWDASQWATEDGKYKADYHYQPFVSKYQEFKISGCRGLAGESCR------AG  260

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            S  LS +Q  AM WVQ+N+  YDYC +  RDHTQ PEC
Sbjct  261  SGGLSQEQYKAMEWVQRNYLVYDYCNDPKRDHTQIPEC  298



>ref|XP_006833493.1| hypothetical protein AMTR_s00082p00180450 [Amborella trichopoda]
 gb|ERM98771.1| hypothetical protein AMTR_s00082p00180450 [Amborella trichopoda]
Length=295

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/282 (63%), Positives = 213/282 (76%), Gaps = 3/282 (1%)
 Frame = -2

Query  966  FTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFK  787
            ++SS NAQ PP PG+ P+++  +L F Q F NLWGP+HQ+L    L+IWLD++  GSGFK
Sbjct  12   YSSSCNAQRPPYPGFSPTSRFRALQFGQAFSNLWGPQHQTLSNDQLAIWLDRS-SGSGFK  70

Query  786  SLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQT  607
            S + + SGY GA+IKLQ GYTAGVIT  YLSN E H   HDE+DIEFLGTT GKPYTLQT
Sbjct  71   STRPFRSGYFGAAIKLQPGYTAGVITAFYLSNNEAHQGHHDEVDIEFLGTTLGKPYTLQT  130

Query  606  NVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA  427
            NVY+ GSGDG  IIGRE++F+LWFDPT DFH+YAILW PS+I+FFVDDVPIR YPRK  +
Sbjct  131  NVYINGSGDG-RIIGREMKFHLWFDPTADFHNYAILWTPSQIVFFVDDVPIRRYPRKGPS  189

Query  426  TFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG  247
            +FP R M+VYGSIWDASSWATE+GKYKADY +QPF+ +Y  F V GC++     CR    
Sbjct  190  SFPSRPMWVYGSIWDASSWATEDGKYKADYSFQPFVARYSRFIVEGCSSYAPLTCRAPSA  249

Query  246  SPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            SP G T LS QQI AM W Q+N   YDYC++  RDH   P+C
Sbjct  250  SPIGGT-LSGQQIVAMQWAQRNFMVYDYCKDPKRDHALLPDC  290



>ref|XP_009382126.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=290

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 221/288 (77%), Gaps = 7/288 (2%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTH  805
            ++FL   + +AQ  PSPGY+PS+ V  + F +G+ NLWGP+HQ++  DQ + +IWLD T 
Sbjct  8    LVFLVLRTADAQ--PSPGYHPSSSVSPIRFYEGYSNLWGPQHQTISPDQYSTTIWLD-TS  64

Query  804  GGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGK  625
             GSGFKS  SY +GY GASIKLQ+GYTAGV T  YLSN + +P  HDE+DIEFLG   G+
Sbjct  65   SGSGFKSKNSYRNGYFGASIKLQSGYTAGVNTAFYLSNNQAYPGFHDEVDIEFLGNIEGR  124

Query  624  PYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYY  445
            PY LQTNVY++GSGDG  IIGRE+RF+LWFDPT  FHHYAILW+  EIIF VDDVPIR Y
Sbjct  125  PYILQTNVYVRGSGDG-RIIGREMRFHLWFDPTASFHHYAILWDSDEIIFLVDDVPIRRY  183

Query  444  PRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTA  265
             RK +ATFP R M+VYGSIWDASSWAT+NGKYKADYRYQPF+ KY DFK+ GC  +   +
Sbjct  184  ARKVEATFPDRPMWVYGSIWDASSWATDNGKYKADYRYQPFVAKYTDFKLGGCTGSAPPS  243

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            CRP+P SP+G   LS QQ AAM WVQ N+  Y YC++++RD + TPEC
Sbjct  244  CRPVPSSPSGHG-LSPQQYAAMRWVQNNYMVYYYCEDSSRDRSLTPEC  290



>emb|CDP15274.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   369 bits (947),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/259 (69%), Positives = 204/259 (79%), Gaps = 2/259 (1%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYTAG  718
            + F +G+RNLWG  HQS+D   ++IWLD +  GSGFKS+K + SGY GASIKLQ GYTAG
Sbjct  1    MSFYKGYRNLWGANHQSVDNSGITIWLDSS-SGSGFKSVKPFRSGYFGASIKLQPGYTAG  59

Query  717  VITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLW  538
            VIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY++GSGDG  IIGRE++F+LW
Sbjct  60   VITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDG-RIIGREMKFHLW  118

Query  537  FDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATEN  358
            FDPT+ FHHYAILWNP EIIF VDDVPIR YPRKS ATFP R M+VYGSIWDASSWATE+
Sbjct  119  FDPTRHFHHYAILWNPKEIIFLVDDVPIRRYPRKSAATFPLRPMWVYGSIWDASSWATED  178

Query  357  GKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNH  178
            GKYKADYRYQPFIGK+ +FK +GC A     CRP+  SP  S  LS QQ  AM WVQ + 
Sbjct  179  GKYKADYRYQPFIGKFTNFKASGCTAYAPAWCRPVSASPFRSGGLSGQQYRAMQWVQSHF  238

Query  177  KEYDYCQNTNRDHTQTPEC  121
              YDYC++  RDH+ TPEC
Sbjct  239  LVYDYCRDYKRDHSLTPEC  257



>dbj|BAC45131.1| putative xyloglucan endo-transglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAH01448.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score =   369 bits (948),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 218/287 (76%), Gaps = 5/287 (2%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHG  802
            +    +++ A A PSPGYYPS+   ++ F++ + N WGP+HQ+L  DQ +L+IWLDKT  
Sbjct  18   VAAIMAASPAGAQPSPGYYPSSVHRAMAFSRDYTNKWGPQHQTLSADQSSLTIWLDKT-C  76

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS KSY +GY  A +KL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+P
Sbjct  77   GSGFKSRKSYRNGYFAARVKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEP  136

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  I+GRE+RF+LWFDPT DFHHYAILWNP  I FFVDDVPIR Y 
Sbjct  137  YTLQTNVYVRGSGDG-RIVGREMRFHLWFDPTADFHHYAILWNPDAITFFVDDVPIRRYE  195

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS+ TFP R M+VYGSIWDAS WAT++G+++ADYRYQPF+ ++  F V GCA +   +C
Sbjct  196  RKSELTFPDRPMWVYGSIWDASDWATDDGRHRADYRYQPFVARFDRFTVAGCAPSAPASC  255

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            RP+P SP G+  L+ +Q AAM W Q++H  Y YCQ+  RDH+ TPEC
Sbjct  256  RPVPASPAGAG-LTPRQYAAMRWAQQSHMVYYYCQDYRRDHSLTPEC  301



>ref|XP_007144347.1| hypothetical protein PHAVU_007G148500g [Phaseolus vulgaris]
 gb|ESW16341.1| hypothetical protein PHAVU_007G148500g [Phaseolus vulgaris]
Length=337

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 221/287 (77%), Gaps = 2/287 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+F   S +NA  PPSP Y PS+K   + F +GFRNLWGP+HQS+DQ  L++WLD+T  
Sbjct  51   AILFFMASPSNAYWPPSPSYRPSSKFRPVNFYKGFRNLWGPQHQSIDQNALTLWLDRT-S  109

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIKL  GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  110  GSGFKSVRPFRSGYFGASIKLHPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  169

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  IIGRE++F+LWFDPTQ+FHHYAILW+P EIIF VDD+PIR YP
Sbjct  170  YTLQTNVYIRGSGDG-TIIGREMKFHLWFDPTQNFHHYAILWSPKEIIFLVDDIPIRRYP  228

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            RKS  TFP R M++YGSIWDASSWATE+GKYKADYRYQPF+ +Y +FKV GC+A  S  C
Sbjct  229  RKSAETFPLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVARYTNFKVGGCSAYASRWC  288

Query  261  RPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            R    SP  S  L+ +Q   M  VQK H  Y+YCQ+  RDH  TPEC
Sbjct  289  RLASASPYRSGGLTRRQYWTMRGVQKYHMVYNYCQDPKRDHRLTPEC  335



>gb|EPS62787.1| hypothetical protein M569_12004, partial [Genlisea aurea]
Length=284

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 217/288 (75%), Gaps = 9/288 (3%)
 Frame = -2

Query  981  AIIFLFTSSN-NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTH  805
            AI+ +F  S  + Q PP PG+Y S    S  F+Q + NLWGP HQ ++   ++IWLD+ +
Sbjct  5    AILLIFYRSQVSGQNPPLPGFYLSNHFPSRRFDQLYANLWGPTHQRIENNGITIWLDR-N  63

Query  804  GGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGK  625
             G GFKS K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDEIDIEFLGTT GK
Sbjct  64   SGCGFKSEKPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGYHDEIDIEFLGTTFGK  123

Query  624  PYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYY  445
            PYTLQTNVY++GSGDG  IIGRE++F+LWFDPTQDFHHYAILW P++I+F VDDVP+R Y
Sbjct  124  PYTLQTNVYVRGSGDG-RIIGREMKFHLWFDPTQDFHHYAILWTPNQILFLVDDVPVRRY  182

Query  444  PRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTA  265
             ++SDATFPQR M+VYGSIWDASSWATE+GKYK DY YQPF+GK+ +FK+ GC A ++ +
Sbjct  183  LKRSDATFPQRPMWVYGSIWDASSWATEDGKYKVDYSYQPFVGKFNEFKIWGCTAYSAAS  242

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            CRPI G       L+ QQ  AM WV  +   YDYC++  RDH+ TPEC
Sbjct  243  CRPISGG------LTRQQQVAMQWVTSHSMVYDYCRDNRRDHSLTPEC  284



>ref|XP_008779033.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Phoenix dactylifera]
Length=292

 Score =   367 bits (943),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/278 (65%), Positives = 217/278 (78%), Gaps = 5/278 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQ--SLDQGTLSIWLDKTHGGSGFKSLKS  775
            + A PSPGYYPS  +  L F  GF NLWGPEHQ  S DQ +++IWLD+ + GSGFKS + 
Sbjct  16   SNAQPSPGYYPSHGLSPLRFYHGFNNLWGPEHQYVSGDQSSVTIWLDR-NSGSGFKSNRP  74

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            + SGY  ASIKLQAGYTAGVIT  YLSN E HP  HDE+D+EFLGTTPG+PYTLQTNVY+
Sbjct  75   FRSGYFSASIKLQAGYTAGVITAFYLSNNEAHPGFHDEVDVEFLGTTPGEPYTLQTNVYI  134

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  IIGRE++F+LWFDPT  FH+YAILW+P EIIF+VDDVPIR YPRKS   FP 
Sbjct  135  RGSGDG-RIIGREMKFHLWFDPTAGFHNYAILWSPREIIFYVDDVPIRRYPRKSAHIFPL  193

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            RAM++YGSIWDASSWAT++GKYKADYRYQPF+ ++  F   GC+A  S +CRP+  SP G
Sbjct  194  RAMWLYGSIWDASSWATDDGKYKADYRYQPFVARFTRFVAHGCSAYASPSCRPVRSSPFG  253

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS++Q  AM WVQK++  Y+YC +  RDH+ TPEC
Sbjct  254  -VGLSSRQSMAMRWVQKHYMIYNYCLDPKRDHSLTPEC  290



>ref|XP_004983770.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Setaria italica]
Length=309

 Score =   368 bits (944),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 169/279 (61%), Positives = 216/279 (77%), Gaps = 6/279 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            AQ PPSPGYYPS  + SL F++ +R LWGP+HQ+L  D  +L++W+D++  GSGFKS ++
Sbjct  34   AQQPPSPGYYPSATLRSLAFSEAYRTLWGPQHQTLSPDGRSLTLWMDRS-SGSGFKSARA  92

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY GAS+++Q GYTAGV T  YLSN E++P  HDEID+E LGT PG+PYTLQTNVY+
Sbjct  93   YRSGYFGASVRVQPGYTAGVNTAFYLSNSEEYPGHHDEIDMELLGTVPGEPYTLQTNVYV  152

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  I+GRE+RF+LWFDPT DFHHYAI+WNP +I+F VDDVPIR Y RK++ATFP 
Sbjct  153  RGSGDG-TIVGREMRFHLWFDPTADFHHYAIIWNPDQILFLVDDVPIRRYERKTEATFPD  211

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANT-STACRPIPGSPT  238
            R M+ YGSIWDAS WAT+ G+Y+ DYRYQPF+ ++ D K+ GCAA+     CRP+P SP+
Sbjct  212  REMWAYGSIWDASDWATDGGRYRVDYRYQPFVSRFADLKIGGCAADAPPQGCRPVPASPS  271

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G+  LS QQ AAM W Q+N   Y YC +++RD    PEC
Sbjct  272  GAA-LSPQQEAAMRWAQRNSMVYYYCLDSSRDRVLYPEC  309



>gb|EAZ16868.1| hypothetical protein OsJ_32344 [Oryza sativa Japonica Group]
Length=306

 Score =   367 bits (943),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 169/279 (61%), Positives = 215/279 (77%), Gaps = 5/279 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            ++A PSPGYYPS    S+ F +G+  LWGP+HQ+L  DQ +L++W+D++  GSGFKS +S
Sbjct  30   SEAQPSPGYYPSKMFRSMAFYEGYSTLWGPQHQTLSQDQKSLTLWMDRS-SGSGFKSTRS  88

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY GASI++Q GYTAGV T  YLSN EQ+P  HDEID+E LGT PG+PYTLQTNVY+
Sbjct  89   YRNGYFGASIRVQPGYTAGVNTAFYLSNTEQYPGHHDEIDMELLGTVPGEPYTLQTNVYV  148

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NI+GRE+RF+LWFDPT  FHHYAILWNP +I+F VDDVPIR Y +K + TFP 
Sbjct  149  RGSGDG-NIVGREMRFHLWFDPTAGFHHYAILWNPDQILFLVDDVPIRRYEKKVEGTFPD  207

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+ YGSIWDAS WAT+ G+YK+DYRYQPF+ +Y+D K+ GC A    +C+P+P SP+G
Sbjct  208  RQMWAYGSIWDASDWATDGGRYKSDYRYQPFVSRYRDLKIAGCEAAAPASCQPVPASPSG  267

Query  234  ST-RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +T  LS QQ AAM W Q+    Y YCQ+ +R+H   PEC
Sbjct  268  ATGELSAQQKAAMRWAQQRSMVYYYCQDYSRNHANYPEC  306



>gb|EAY79406.1| hypothetical protein OsI_34534 [Oryza sativa Indica Group]
Length=307

 Score =   367 bits (943),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 214/279 (77%), Gaps = 5/279 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            ++A PSPGYYPS    S+ F +G+  LWGP+HQ+L  DQ +L++W+D++ G SGFKS +S
Sbjct  31   SEAQPSPGYYPSKMFRSMAFYEGYSTLWGPQHQTLSQDQKSLTLWMDRSSG-SGFKSTRS  89

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY GASI++Q GYTAGV T  YLSN EQ+P  HDEID+E LGT PG+PYTLQTNVY+
Sbjct  90   YRNGYFGASIRVQPGYTAGVNTAFYLSNTEQYPGRHDEIDMELLGTVPGEPYTLQTNVYV  149

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NI+GRE+RF+LWFDPT  FHHYAILWNP +I+F VDDVPIR Y +K + TFP+
Sbjct  150  RGSGDG-NIVGREMRFHLWFDPTAGFHHYAILWNPDQILFLVDDVPIRRYEKKVEGTFPE  208

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP-T  238
            R M+ YGSIWDAS WAT+ G+Y+ADYRYQPF+ ++ D KV GCA     AC P+P S   
Sbjct  209  REMWAYGSIWDASDWATDGGRYRADYRYQPFVSRFADLKVGGCATAAPPACSPVPASSGG  268

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            GS  LS QQ AAMAW Q+N   Y YCQ+ +RDHT  PEC
Sbjct  269  GSAALSPQQEAAMAWAQRNAMVYYYCQDYSRDHTFYPEC  307



>ref|NP_001065209.2| Os10g0545500 [Oryza sativa Japonica Group]
 gb|AAK20055.1|AC025783_15 putative cellulase [Oryza sativa Japonica Group]
 gb|AAP54882.1| Glycosyl hydrolases family 16 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27123.2| Os10g0545500 [Oryza sativa Japonica Group]
Length=306

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 214/279 (77%), Gaps = 5/279 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            ++A PSPGYYPS    S+ F +G+  LWGP+HQ+L  DQ +L++W+D++  GSGFKS +S
Sbjct  30   SEAQPSPGYYPSKMFRSMAFYEGYSTLWGPQHQTLSQDQKSLTLWMDRS-SGSGFKSTRS  88

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY GASI++Q GYTAGV T  YLSN EQ+P  HDEID+E LGT PG+PYTLQTNVY+
Sbjct  89   YRNGYFGASIRVQPGYTAGVNTAFYLSNTEQYPGHHDEIDMELLGTVPGEPYTLQTNVYV  148

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NI+GRE+RF+LWFDPT  FHHYAILWNP +I+F VDDVPIR Y +K + TFP+
Sbjct  149  RGSGDG-NIVGREMRFHLWFDPTAGFHHYAILWNPDQILFLVDDVPIRRYEKKVEGTFPE  207

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP-T  238
            R M+ YGSIWDAS WAT+ G+Y+ADYRYQPF+ ++ D KV GCA     AC P+P S   
Sbjct  208  REMWAYGSIWDASDWATDGGRYRADYRYQPFVSRFADLKVGGCATAAPPACSPVPASSGG  267

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            GS  LS QQ AAMAW Q+N   Y YCQ+ +RDHT  PEC
Sbjct  268  GSAALSPQQEAAMAWAQRNAMVYYYCQDYSRDHTFYPEC  306



>ref|NP_001048699.1| Os03g0108300 [Oryza sativa Japonica Group]
 gb|ABF93563.1| Glycosyl hydrolases family 16 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10613.1| Os03g0108300 [Oryza sativa Japonica Group]
 dbj|BAG87745.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74361.1| hypothetical protein OsI_09671 [Oryza sativa Indica Group]
Length=310

 Score =   365 bits (936),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 217/293 (74%), Gaps = 9/293 (3%)
 Frame = -2

Query  978  IIFLFTSSN----NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWL  817
            I+ +   SN     A A PSPGYYPS  + S+ F +G+ NLWG +HQ+L  DQ  L++W+
Sbjct  20   IMVVVACSNYMISGAGAQPSPGYYPSKTIRSMAFGEGYDNLWGGQHQTLSADQTALTVWM  79

Query  816  DKTHGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGT  637
            D++  GSGFKS +SY +GY GASIK+ +GYTAGV T  YLSN E +P +HDEIDIE LGT
Sbjct  80   DRS-SGSGFKSKRSYRNGYFGASIKVPSGYTAGVNTAFYLSNNELYPGQHDEIDIELLGT  138

Query  636  TPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVP  457
             PG+P+TLQTNVY+ G+GDG  IIGRE+RF+LWFDPT DFHHYAILWNP  I+F VDDVP
Sbjct  139  VPGEPWTLQTNVYVHGTGDGA-IIGREMRFHLWFDPTADFHHYAILWNPDHIVFLVDDVP  197

Query  456  IRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN  277
            +R YPR +  TFP R M+ YGSIWDAS WAT+ G+YK+DYRYQPF+ +Y+D K+ GC A 
Sbjct  198  VRRYPRAAGNTFPDRQMWAYGSIWDASDWATDGGRYKSDYRYQPFVSRYRDLKIAGCEAA  257

Query  276  TSTACRPIPGSPTGST-RLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               +C+P+P SP+G+T  LS QQ AAM W Q+    Y YCQ+ +R+H   PEC
Sbjct  258  APASCQPVPASPSGATGELSAQQKAAMRWAQQRSMVYYYCQDYSRNHANYPEC  310



>ref|XP_009418263.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=295

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/280 (64%), Positives = 219/280 (78%), Gaps = 7/280 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSL-GFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLK  778
            + A PSPGYYPS +   L GF +GF NLWGPEHQ++  DQ +++IWLD+ + GSGFKS++
Sbjct  17   SNAQPSPGYYPSYRFRPLRGFYRGFNNLWGPEHQTVSGDQSSVTIWLDR-NSGSGFKSIR  75

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + +GY G SIKLQ GYTAGVIT  YLSN + HP  HDE+DIEFLGTTPGKPYTLQTNVY
Sbjct  76   PFRNGYFGTSIKLQPGYTAGVITAFYLSNNQAHPGFHDEVDIEFLGTTPGKPYTLQTNVY  135

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK-SDATF  421
            ++GSGD G IIGREV+F+LWFDPT  FH+YAILWNP+EIIFFVDD+PIR YPRK + ATF
Sbjct  136  VRGSGD-GRIIGREVKFHLWFDPTAGFHNYAILWNPNEIIFFVDDIPIRQYPRKNAGATF  194

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R M++YGSIWDASSWATE+GKYKADYRYQPF+ ++  F V GC A     C+P+P S 
Sbjct  195  PLRPMWLYGSIWDASSWATEDGKYKADYRYQPFVARFTRFVVRGCTAFAPLLCQPVPSSW  254

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             G   LS +Q AAM W Q+ +  Y+YC++  RDH+ TPEC
Sbjct  255  HGDG-LSRRQYAAMQWAQRYYLVYNYCKDPKRDHSLTPEC  293



>ref|XP_006662567.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Oryza brachyantha]
Length=295

 Score =   362 bits (929),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 168/280 (60%), Positives = 216/280 (77%), Gaps = 7/280 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            ++A PSPGYYPS    S+ F++G+  LWGP+HQ+L  DQ +L++W+D++  GSGFKS +S
Sbjct  19   SEAQPSPGYYPSRVYRSMAFSEGYSTLWGPQHQTLSQDQKSLTLWMDRS-SGSGFKSTRS  77

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY GASI++Q GYTAGV T  YLSN E++P +HDE+D+E LGT PG+PYTLQTNVY+
Sbjct  78   YRNGYFGASIRVQPGYTAGVNTAFYLSNTERYPGQHDEVDMELLGTVPGEPYTLQTNVYV  137

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG NI+GRE+RF+LWFDPT   HHYAILWNP +I+F VDDVPIR Y +K + TFP+
Sbjct  138  RGSGDG-NIVGREMRFHLWFDPTAGLHHYAILWNPDQILFLVDDVPIRRYEKKVEGTFPE  196

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIP--GSP  241
            R M+ Y SIWDAS WAT+ G+Y+ADYRYQPF+ ++ D K+ GCAA T+  C P+P  G  
Sbjct  197  REMWAYASIWDASDWATDGGRYRADYRYQPFVSRFADLKIAGCAAATA-PCSPVPVSGGG  255

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             G+  LS QQ AAMAW Q+N   Y YCQ+ +RDHT  PEC
Sbjct  256  PGAAALSPQQEAAMAWAQRNAMVYYYCQDYSRDHTLYPEC  295



>ref|XP_003563122.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Brachypodium distachyon]
Length=302

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/280 (62%), Positives = 210/280 (75%), Gaps = 5/280 (2%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLK  778
            ++ A PSPGYYPS++   + FN+G++N WGP+HQ+L  DQ  L+IWLDKT  GSGFKS  
Sbjct  25   SSDAQPSPGYYPSSRFRPVAFNRGYKNKWGPQHQTLSGDQSALTIWLDKT-CGSGFKSKH  83

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
            SY +GY    IKL +GYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQTNVY
Sbjct  84   SYRNGYFATRIKLPSGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQTNVY  143

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE+RF+LWFDPT  FHHYAILWNP  I FFVDDVPIR Y RK++ TFP
Sbjct  144  VRGSGDG-RIIGREMRFHLWFDPTAGFHHYAILWNPDAITFFVDDVPIRRYERKTELTFP  202

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGS-P  241
             R M+ YGSIWDAS WAT++G+++ADYRYQPF+ ++  F V GCA     +CRP+P S P
Sbjct  203  DREMWAYGSIWDASDWATDDGRHRADYRYQPFVARFDRFVVAGCATTAPASCRPVPASGP  262

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             GST L+ +Q AAM W Q+ H  Y YCQ+  RD + TPEC
Sbjct  263  RGSTGLTPRQYAAMRWAQQGHMVYYYCQDFRRDRSLTPEC  302



>gb|EAZ03861.1| hypothetical protein OsI_25995 [Oryza sativa Indica Group]
Length=301

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/271 (63%), Positives = 209/271 (77%), Gaps = 5/271 (2%)
 Frame = -2

Query  927  GYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIG  754
            GYYPS+   ++ F++ + N WGP+HQ+L  DQ +L+IWLDKT  GSGFKS KSY +GY  
Sbjct  34   GYYPSSVHRAMAFSRDYTNKWGPQHQTLSADQSSLTIWLDKT-CGSGFKSRKSYRNGYFA  92

Query  753  ASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGG  574
            A +KL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQTNVY++GSGDG 
Sbjct  93   ARVKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQTNVYVRGSGDG-  151

Query  573  NIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYG  394
             I+GRE+RF+LWFDPT DFHHYAILWNP  I FFVDDVPIR Y RKS+ TFP R M+VYG
Sbjct  152  RIVGREMRFHLWFDPTADFHHYAILWNPDAITFFVDDVPIRRYERKSELTFPDRPMWVYG  211

Query  393  SIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQ  214
            SIWDAS WAT++G+++ADYRYQPF+ ++  F V GCA +   +CRP+P SP G+  L+ +
Sbjct  212  SIWDASDWATDDGRHRADYRYQPFVARFDRFTVAGCAPSAPASCRPVPASPAGAV-LTPR  270

Query  213  QIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            Q AAM W Q++H  Y YCQ+  RDH+ TPEC
Sbjct  271  QYAAMRWAQQSHMVYYYCQDYRRDHSLTPEC  301



>emb|CCH26633.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=288

 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 206/268 (77%), Gaps = 4/268 (1%)
 Frame = -2

Query  918  PSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKL  739
            P T +  L   Q FRN WG +HQ +DQGTL+IWLD +  GSGFKSL  Y SGY GA+IKL
Sbjct  23   PKTILPPLAIFQVFRNRWGSQHQKVDQGTLTIWLDSS-SGSGFKSLHRYQSGYFGAAIKL  81

Query  738  QAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGR  559
              GYTAGVIT  YLSN E +P  HDEIDIEFLGTT  KPY LQTNV+M+GSGDG NIIGR
Sbjct  82   HPGYTAGVITSFYLSNNEDYPGNHDEIDIEFLGTTSDKPYVLQTNVFMRGSGDG-NIIGR  140

Query  558  EVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDA  379
            E+RF+LWF+PTQDFH+YAILW P EIIF VDDVPIR Y RKS+ATFP R M+VYGSIWDA
Sbjct  141  EMRFHLWFNPTQDFHNYAILWTPEEIIFLVDDVPIRRYERKSEATFPVRPMWVYGSIWDA  200

Query  378  SSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG--SPTGSTRLSNQQIA  205
            SSWATE+GKYKADY+YQPFIG+Y +FK++GC  + + +CRP+       G  R+S QQ  
Sbjct  201  SSWATEDGKYKADYKYQPFIGRYNNFKLSGCTTDGAASCRPLNSGPGRGGRGRMSQQQEK  260

Query  204  AMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            AM WVQ N+  Y+YC +  RDHT TPEC
Sbjct  261  AMEWVQNNYLVYNYCHDPRRDHTLTPEC  288



>ref|XP_010940514.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Elaeis guineensis]
Length=292

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/278 (65%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQ--SLDQGTLSIWLDKTHGGSGFKSLKS  775
            + A PSPGYYPS +   L F  GF NLWGP+HQ  S DQ +++IWLD+   GSGFKS + 
Sbjct  16   SNAQPSPGYYPSHRFRPLRFYHGFNNLWGPQHQYVSGDQSSVTIWLDRN-SGSGFKSNRP  74

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            + SGY  ASIKLQ GYTAGVIT  YLSN E HP  HDE+D+EFLGTTPG+PYTLQTNVY+
Sbjct  75   FRSGYFSASIKLQRGYTAGVITAFYLSNNEAHPGFHDEVDVEFLGTTPGEPYTLQTNVYI  134

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  IIGRE++F+LWFDPT  FH+YAILWN  EIIF+VDDVPIR YPRKS  TFP 
Sbjct  135  RGSGDG-RIIGREMKFHLWFDPTAGFHNYAILWNAREIIFYVDDVPIRRYPRKSVYTFPL  193

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+VYGSIWDASSWAT++GKYKADYRYQPF+  +  F V GC+A  S  CRP+  SP G
Sbjct  194  RPMWVYGSIWDASSWATDDGKYKADYRYQPFVASFTRFVVHGCSAFASPRCRPVHSSPFG  253

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS++Q  AM WVQK+   Y+YC +  RDH+ TPEC
Sbjct  254  -IGLSSRQSMAMHWVQKHCMIYNYCWDHKRDHSLTPEC  290



>ref|XP_008787464.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Phoenix dactylifera]
Length=294

 Score =   359 bits (922),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/280 (62%), Positives = 213/280 (76%), Gaps = 5/280 (2%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQ--SLDQGTLSIWLDKTHGGSGFKSL  781
            + + A PSPGYYPS +   L F  GF NLWGPEHQ  S DQ + +IWLD+ + GSGFKS 
Sbjct  16   HGSNAQPSPGYYPSHRFKPLRFYHGFSNLWGPEHQYVSRDQSSATIWLDR-NSGSGFKSN  74

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + + +GY   SIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGT PG+PYTLQTNV
Sbjct  75   RPFRNGYFSTSIKLQRGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTMPGEPYTLQTNV  134

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATF  421
            Y++GSGDG  IIGRE++F+LWFDPT  FH+YAILW+P EIIFFVDD+PIR YPR+S  TF
Sbjct  135  YIRGSGDG-RIIGREMKFHLWFDPTAGFHNYAILWSPREIIFFVDDIPIRRYPRRSVYTF  193

Query  420  PQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSP  241
            P R +++YGSIWDASSWAT++G+YKADYRYQPF+ ++  F V GC A  S  CRP+  SP
Sbjct  194  PVRPLWLYGSIWDASSWATDDGRYKADYRYQPFVARFARFIVRGCTAYASHRCRPVRSSP  253

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +G   LS++Q  AM W QK++  Y+YC +  RDH+ TPEC
Sbjct  254  SG-VGLSSRQTMAMRWAQKHYMIYNYCWDPKRDHSLTPEC  292



>ref|XP_010935831.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Elaeis guineensis]
Length=293

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/278 (63%), Positives = 211/278 (76%), Gaps = 5/278 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQ--SLDQGTLSIWLDKTHGGSGFKSLKS  775
              A PSPGYYPS +   L F  GF NLWGP+HQ  S DQ T++IWLD+ + GSGFKS + 
Sbjct  17   GNAQPSPGYYPSHRFRPLRFYHGFNNLWGPQHQYVSRDQSTVTIWLDR-NSGSGFKSNRP  75

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            + +GY   SI+LQ GYTAGVIT  YLSN E HP  HDE+D+EFLGT PGKPYTLQTNVY+
Sbjct  76   FRNGYFSTSIQLQRGYTAGVITAFYLSNNEAHPGFHDEVDMEFLGTMPGKPYTLQTNVYI  135

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  IIGRE++F+LWFDPT  FH+YAILW+  EIIFFVDDVPIR YPRKS+ TFP 
Sbjct  136  RGSGDG-RIIGREMKFHLWFDPTAGFHNYAILWSSREIIFFVDDVPIRRYPRKSEYTFPL  194

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M++YGSIWDASSWAT++GKYKADYRYQPF+ ++  F V GC A  S  CRP+  SP G
Sbjct  195  RPMWLYGSIWDASSWATDDGKYKADYRYQPFVARFTRFIVRGCTAYASPRCRPVRSSPFG  254

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS++Q  AM W QK++  Y+YC +  RDH+ TPEC
Sbjct  255  -VGLSSRQTLAMRWAQKHYMVYNYCWDPKRDHSLTPEC  291



>gb|ACS13755.1| xyloglucan xyloglucosyl transferase [Hordeum vulgare]
 dbj|BAJ97082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 212/289 (73%), Gaps = 10/289 (3%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKT  808
            A+I L       +A PSPGYYPS+KV S  F+Q +  LWGP+HQSL  DQ  L++W+D++
Sbjct  23   AVILL-----QGEAQPSPGYYPSSKVSSTPFSQWYSTLWGPQHQSLSPDQTALTLWMDRS  77

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
              GSGFKS +SY +GY G S+K+Q GYTAGV T  YLSN E +P  HDEID+E LGT PG
Sbjct  78   -SGSGFKSKRSYRNGYFGVSMKVQPGYTAGVNTAFYLSNNEVYPGYHDEIDVELLGTVPG  136

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            +PYTLQTNVY++G+GD   I+GRE+RF+LWFDP   FHHYA+LWNP EI+F VDDVP+R 
Sbjct  137  EPYTLQTNVYVRGTGDAHPIVGREMRFHLWFDPAAAFHHYAVLWNPDEIVFLVDDVPVRR  196

Query  447  YPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTST  268
            Y +K +ATFP+R M+ YGS+WDAS WAT+ G+Y++DYRYQPF+  +KDFKV GC      
Sbjct  197  YQKKVEATFPEREMWAYGSVWDASDWATDGGRYRSDYRYQPFVSGFKDFKVAGCEVGAPA  256

Query  267  ACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +CRP+P  P G   LS QQ AAM+W Q+    Y YCQ+ ++D +  PEC
Sbjct  257  SCRPVPAGPGGG--LSAQQSAAMSWAQQRAMVYYYCQDGSKDRSNYPEC  303



>ref|XP_002467558.1| hypothetical protein SORBIDRAFT_01g030140 [Sorghum bicolor]
 gb|EER94556.1| hypothetical protein SORBIDRAFT_01g030140 [Sorghum bicolor]
Length=309

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/277 (60%), Positives = 210/277 (76%), Gaps = 5/277 (2%)
 Frame = -2

Query  945  QAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSY  772
            Q PPSPGYYPS     LGF++ +R LWG +HQ++  D  +L++W+D +  GSGFKS ++Y
Sbjct  36   QQPPSPGYYPSGMFRPLGFSEAYRTLWGSQHQTVSPDGKSLTLWMDSS-SGSGFKSARAY  94

Query  771  GSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMK  592
              GY GAS+++Q GYTAGV T  YLSN E++P  HDEID+E LGT PG+PYTLQTNVY++
Sbjct  95   RDGYFGASVRVQPGYTAGVNTAFYLSNSEEYPGHHDEIDMELLGTVPGEPYTLQTNVYVR  154

Query  591  GSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQR  412
            GSGDG  I+GRE+RF+LWFDPT DFHHYAI+WNP +I+F VDDVPIR Y RK++ATFP R
Sbjct  155  GSGDG-TIVGREMRFHLWFDPTADFHHYAIIWNPDQILFLVDDVPIRRYERKTEATFPDR  213

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGS  232
             M+ YGSIWDAS WAT+ G+Y+ADYRYQPF+ ++   K+ GCAA+ S  C+P+P S T +
Sbjct  214  EMWAYGSIWDASDWATDGGRYRADYRYQPFVSRFAGLKIGGCAADASADCQPVPASGT-T  272

Query  231  TRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              LS QQ AAM W Q+N   Y YC + +RDH   PEC
Sbjct  273  AALSAQQEAAMRWAQRNSMVYYYCLDASRDHALYPEC  309



>ref|XP_009418633.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Musa acuminata subsp. malaccensis]
Length=296

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 210/275 (76%), Gaps = 6/275 (2%)
 Frame = -2

Query  936  PSPGYYPSTKVGSL-GFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGS  766
            PSPGYYPS +   L GF  G+ NLWGP+HQ++  DQ + +IWLD+ + GSGFKS + Y S
Sbjct  23   PSPGYYPSHRFKPLPGFYHGYSNLWGPQHQTVSGDQSSATIWLDR-NSGSGFKSNRPYRS  81

Query  765  GYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGS  586
            GY  ASIKLQAGYTAGVIT  YLSN + HP  HDE+DIEF+G TPGKPY LQTNVY++GS
Sbjct  82   GYFAASIKLQAGYTAGVITAFYLSNNQVHPGFHDEVDIEFMGNTPGKPYRLQTNVYIRGS  141

Query  585  GDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAM  406
            GD    +GRE++F+LWFDPT DFH+YAILWNP EIIFFVDD+PIR YPRKS+ TFP R M
Sbjct  142  GDS-RYVGREMKFHLWFDPTADFHNYAILWNPDEIIFFVDDIPIRRYPRKSENTFPMRPM  200

Query  405  YVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTR  226
            ++YG+IWDASSWAT+ GKY+ DYRYQPF+ ++  F + GC+A   ++CR  P S +GS  
Sbjct  201  WMYGTIWDASSWATDRGKYRVDYRYQPFVARFTRFIIRGCSAYAPSSCRQAPSSQSGSG-  259

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            LS QQ AAM W Q N+  Y+YC +  RDH  TPEC
Sbjct  260  LSPQQYAAMQWAQSNYMVYNYCMDPKRDHALTPEC  294



>ref|NP_001148432.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Zea mays]
 gb|ACG31450.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Zea mays]
Length=314

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 208/275 (76%), Gaps = 6/275 (2%)
 Frame = -2

Query  933  SPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            SPGYYPS     LGF++ +R LWG +HQ+L  D  +L++W+D +  GSGFKS ++Y +GY
Sbjct  42   SPGYYPSGMFRPLGFSEAYRTLWGAQHQTLSPDGKSLTLWMDSS-SGSGFKSARAYRNGY  100

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             GAS+++Q GYTAGV T  YLSN E++P  HDEID+E LGT PG+PYTLQTNVY++GSGD
Sbjct  101  FGASVRVQPGYTAGVNTAFYLSNSEEYPGHHDEIDMELLGTVPGEPYTLQTNVYVRGSGD  160

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYV  400
            G  I+GRE+RF+LWFDPT DFHHYAI+WNP +I+F VDDVP+R Y RK++ATFP R M+ 
Sbjct  161  G-TIVGREMRFHLWFDPTADFHHYAIIWNPDQILFLVDDVPVRRYERKAEATFPDREMWA  219

Query  399  YGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT--GSTR  226
            YGSIWDAS WAT+ G+Y+ADYRYQPF+ ++   +V GCAA+ S  C+P+P SP   G+  
Sbjct  220  YGSIWDASDWATDGGRYRADYRYQPFVSRFAGLRVGGCAADASADCQPVPASPAAPGTAA  279

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +S QQ AAM W Q+N   Y YC ++ RD    PEC
Sbjct  280  ISAQQEAAMRWAQRNSMVYYYCLDSTRDRALYPEC  314



>tpg|DAA46166.1| TPA: xyloglucan endotransglucosylase/hydrolase protein 32 [Zea 
mays]
Length=341

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 208/275 (76%), Gaps = 6/275 (2%)
 Frame = -2

Query  933  SPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGY  760
            SPGYYPS     LGF++ +R LWG +HQ+L  D  +L++W+D +  GSGFKS ++Y +GY
Sbjct  69   SPGYYPSGMFRPLGFSEAYRTLWGAQHQTLSPDGKSLTLWMDSS-SGSGFKSARAYRNGY  127

Query  759  IGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGD  580
             GAS+++Q GYTAGV T  YLSN E++P  HDEID+E LGT PG+PYTLQTNVY++GSGD
Sbjct  128  FGASVRVQPGYTAGVNTAFYLSNSEEYPGHHDEIDMELLGTVPGEPYTLQTNVYVRGSGD  187

Query  579  GGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYV  400
            G  I+GRE+RF+LWFDPT DFHHYAI+WNP +I+F VDDVP+R Y RK++ATFP R M+ 
Sbjct  188  G-TIVGREMRFHLWFDPTADFHHYAIIWNPDQILFLVDDVPVRRYERKAEATFPDREMWA  246

Query  399  YGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT--GSTR  226
            YGSIWDAS WAT+ G+Y+ADYRYQPF+ ++   +V GCAA+ S  C+P+P SP   G+  
Sbjct  247  YGSIWDASDWATDGGRYRADYRYQPFVSRFAGLRVGGCAADASADCQPVPASPAAPGTAA  306

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +S QQ AAM W Q+N   Y YC ++ RD    PEC
Sbjct  307  ISAQQEAAMRWAQRNSMVYYYCLDSTRDRALYPEC  341



>ref|XP_004957690.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Setaria italica]
Length=312

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 209/284 (74%), Gaps = 5/284 (2%)
 Frame = -2

Query  966  FTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSG  793
             ++++ A A PSPGYYPS++   + FN+G+ N WGP+HQ+L  D   L+IWLD+T  GSG
Sbjct  32   ISATSGADAQPSPGYYPSSRFRPIPFNRGYSNKWGPQHQTLSGDHSALTIWLDRT-CGSG  90

Query  792  FKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTL  613
            FKS  +Y +GY    IKL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTL
Sbjct  91   FKSKHAYRNGYFSTRIKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTL  150

Query  612  QTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS  433
            QTNVY++GSGDG  I+GRE+RF+LWFDPT  +H YAILWNP  I FFVDDVP+R Y R++
Sbjct  151  QTNVYVRGSGDG-RIVGREMRFHLWFDPTAGYHTYAILWNPDAITFFVDDVPVRRYERRA  209

Query  432  DATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPI  253
            + TFP R M+VYGSIWDAS WAT++G+++ADYRYQPF+     F + GC+A    ACRP+
Sbjct  210  ELTFPDRPMWVYGSIWDASDWATDDGRHRADYRYQPFVAHLDRFVIAGCSAAAPPACRPV  269

Query  252  PGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            P SP G+  L+ QQ AAM W Q+ H  Y YC +  RDH+ TPEC
Sbjct  270  PASPRGAG-LTQQQYAAMRWAQQGHMVYYYCNDFRRDHSLTPEC  312



>ref|XP_009396171.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X3 [Musa acuminata subsp. malaccensis]
Length=294

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 217/279 (78%), Gaps = 6/279 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSL-GFNQGFRNLWGPEHQ--SLDQGTLSIWLDKTHGGSGFKSLK  778
            + A PSPGYY S++   L GF  G+  LWGP HQ  S DQ +++IWLD++  GSGFKS +
Sbjct  17   SSAQPSPGYYLSSRFKPLPGFYHGYNTLWGPRHQTVSADQSSVAIWLDRS-SGSGFKSNR  75

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY  ASIKLQ G TAGVIT  YLSN + HP  HDE+DIEFLGTTPG+PY LQTNVY
Sbjct  76   PFRSGYFAASIKLQPGDTAGVITAFYLSNNQVHPGFHDEVDIEFLGTTPGRPYKLQTNVY  135

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            +KGSGDG  +IGRE++F+LWFDP  DFHHYAILWNP+EIIFFVDD+PIR YPRKSD TFP
Sbjct  136  VKGSGDG-RVIGREMKFHLWFDPAADFHHYAILWNPNEIIFFVDDIPIRRYPRKSDDTFP  194

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+VYG+IWDASSWAT+NGK++ DYR+QPF+ ++  F V GC+A   + CRP+P SP+
Sbjct  195  LRPMWVYGTIWDASSWATDNGKHRVDYRHQPFVARFTRFVVRGCSAYAPSGCRPVPSSPS  254

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G   LS QQ+AAMAW Q+N+  YDYC++  RD + TPEC
Sbjct  255  GFG-LSKQQLAAMAWAQRNYMVYDYCRDDRRDRSLTPEC  292



>tpg|DAA62696.1| TPA: xyloglucan endotransglucosylase/hydrolase protein 32 [Zea 
mays]
Length=314

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/282 (60%), Positives = 209/282 (74%), Gaps = 7/282 (2%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFK  787
            SS +AQ  PSPGYYPS++   + FN+ + N WGP+HQ+L  D   L+IWLDKT  GSGFK
Sbjct  38   SSGDAQ--PSPGYYPSSRFRPVPFNRAYTNKWGPQHQTLSGDHSALTIWLDKT-CGSGFK  94

Query  786  SLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQT  607
            S  +Y +GY    IKL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQT
Sbjct  95   SKHAYRNGYFSTRIKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQT  154

Query  606  NVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA  427
            NVY++GSGDG  I+GRE+RF+LWFDPT  +H YAILWNP  I FFVDDVP+R Y R+++ 
Sbjct  155  NVYVRGSGDG-RIVGREMRFHLWFDPTAAYHTYAILWNPDAITFFVDDVPVRRYERRTEL  213

Query  426  TFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG  247
            TFP R M+VYGSIWDAS WAT++G+++ADYRYQPF+ +   F V GC+A+   ACRP+P 
Sbjct  214  TFPDRPMWVYGSIWDASDWATDDGRHRADYRYQPFVARLDRFVVAGCSASAPPACRPVPA  273

Query  246  SPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            SP G+  L+ +Q AAM W Q+ H  Y YC +  RDH+ TPEC
Sbjct  274  SPAGAG-LTPRQYAAMRWAQQGHMVYYYCNDFRRDHSLTPEC  314



>ref|XP_004986046.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like [Setaria italica]
Length=300

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/278 (59%), Positives = 205/278 (74%), Gaps = 7/278 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            AQA PSPGYYPS+ V S+ F++G+ NLWGP+HQ+L  DQ  L++ +D++  GSGFKS +S
Sbjct  28   AQAQPSPGYYPSSMVRSMAFSEGYVNLWGPQHQTLSQDQKALTLLMDRS-SGSGFKSKRS  86

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY GASIK+Q GYTAGV T  YLSN E +P +HDEID+E LGT PG+PYTLQTNVY+
Sbjct  87   YRNGYFGASIKVQPGYTAGVNTAFYLSNNELYPGKHDEIDMELLGTVPGEPYTLQTNVYV  146

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +G+GDG  ++GRE+RF+LWFDP  DFHHYAILWNP EI+F VDDVP+R Y   +   FP 
Sbjct  147  RGTGDGARLVGREMRFHLWFDPAADFHHYAILWNPDEIVFLVDDVPVRRY---AGDAFPD  203

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+ YGSIWDAS WAT+ G+Y+ADY YQPF+ +++ FK  GC     + CRP+P SP G
Sbjct  204  REMWAYGSIWDASDWATDGGRYRADYAYQPFVARFQGFKTAGCEVAAPSTCRPMPASPAG  263

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             T LS+QQ  AM W Q     Y YCQ+  +D    PEC
Sbjct  264  -TGLSSQQQDAMRWAQHRSMVYYYCQDHTKDRALYPEC  300



>ref|XP_002460690.1| hypothetical protein SORBIDRAFT_02g033240 [Sorghum bicolor]
 gb|EER97211.1| hypothetical protein SORBIDRAFT_02g033240 [Sorghum bicolor]
Length=314

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/274 (60%), Positives = 204/274 (74%), Gaps = 5/274 (2%)
 Frame = -2

Query  936  PSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSG  763
            PSPGYYPS++   + FN+ + N WGP+HQ+L  D   L+IWLD+T  GSGFKS  +Y +G
Sbjct  44   PSPGYYPSSRFRPVPFNRAYNNKWGPQHQTLSGDHSALTIWLDRT-CGSGFKSKHAYRNG  102

Query  762  YIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSG  583
            Y    IKL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQTNVY++GSG
Sbjct  103  YFSTRIKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQTNVYVRGSG  162

Query  582  DGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMY  403
            DG  I+GRE+RF+LWFDPT  +H YAILWNP  I FFVDDVP+R Y R+++ TFP R M+
Sbjct  163  DG-RIVGREMRFHLWFDPTAAYHTYAILWNPDAITFFVDDVPVRRYERRTELTFPDRPMW  221

Query  402  VYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRL  223
            VYGSIWDAS WAT++G+++ADYRYQPF+ +   F V GC+ +   ACRP+P SP G+  L
Sbjct  222  VYGSIWDASDWATDDGRHRADYRYQPFVARLDRFVVAGCSVSAPPACRPVPASPAGAG-L  280

Query  222  SNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            + QQ AAM W Q++H  Y YC +  RDH+ TPEC
Sbjct  281  TAQQYAAMRWAQRDHMVYYYCNDFRRDHSLTPEC  314



>dbj|BAJ88307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=296

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 204/278 (73%), Gaps = 5/278 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            + A PSPGYYPS++   + FN+G+ N WGP+HQ++  D   ++IWLD+T  GSGFKS  +
Sbjct  22   SDAQPSPGYYPSSRFRPVAFNRGYSNKWGPQHQTVSGDHSAITIWLDRT-CGSGFKSKHA  80

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY    IKL AGYTAG  T  YLSN E HP  HDE+D+EFLGT PG+PYTLQTNVY+
Sbjct  81   YRNGYFATRIKLPAGYTAGTNTAFYLSNNEAHPGFHDEVDMEFLGTIPGEPYTLQTNVYV  140

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +GSGDG  IIGRE+RF+LWFDPT  FH+YAILWNP  I FFVDDVPIR Y RK++ TFP 
Sbjct  141  RGSGDG-RIIGREMRFHLWFDPTAGFHNYAILWNPDAITFFVDDVPIRRYERKTELTFPD  199

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+ YGSIWDAS WAT++G+++ADYRYQPF+ ++  F V GC      +CRP+  SP G
Sbjct  200  RPMWAYGSIWDASDWATDDGRHRADYRYQPFVTRFDRFVVAGCGPGAPPSCRPVRASPVG  259

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             T L+ QQ AAM W Q+ H  Y YCQ+  RD + TPEC
Sbjct  260  -TGLTRQQYAAMRWAQQRHMVYYYCQDFRRDRSLTPEC  296



>ref|NP_001151883.1| LOC100285520 precursor [Zea mays]
 gb|ACG44750.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Zea mays]
Length=317

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/282 (60%), Positives = 209/282 (74%), Gaps = 7/282 (2%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFK  787
            SS +AQ  PSPGYYPS++   + FN+ + N WGP+HQ+L  D   L+IWLDKT  GSGFK
Sbjct  41   SSGDAQ--PSPGYYPSSRFRPVPFNRAYTNKWGPQHQTLSGDHSALTIWLDKT-CGSGFK  97

Query  786  SLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQT  607
            S  +Y +GY    IKL AGYTAG  T  YLSN E HP  +DEID+EFLGT PG+PYTLQT
Sbjct  98   SKHAYRNGYFSTRIKLPAGYTAGTNTAXYLSNNEAHPGFYDEIDMEFLGTIPGEPYTLQT  157

Query  606  NVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA  427
            NVY++GSGDG  I+GRE+RF+LWFDPT  +H YAILWNP  I FFVDDVP+R Y R+++ 
Sbjct  158  NVYVRGSGDG-RIVGREMRFHLWFDPTAAYHTYAILWNPDAITFFVDDVPVRRYERRTEL  216

Query  426  TFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPG  247
            TFP R M+VYGSIWDAS WAT++G+++ADYRYQPF+ +   F V GC+A+   ACRP+P 
Sbjct  217  TFPDRPMWVYGSIWDASDWATDDGRHRADYRYQPFVARLDRFVVAGCSASAPPACRPVPA  276

Query  246  SPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            SP G+  L+ +Q AAM W Q+ H  Y YC +  RDH+ TPEC
Sbjct  277  SPAGAG-LTPRQYAAMRWAQQGHMVYYYCNDFRRDHSLTPEC  317



>gb|AAN62784.1| Putative cellulase [Oryza sativa Japonica Group]
Length=260

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 200/262 (76%), Gaps = 5/262 (2%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F +G+ NLWG +HQ+L  DQ  L++W+D++  GSGFKS +SY +GY GASIK+ +GYT
Sbjct  1    MAFGEGYDNLWGGQHQTLSADQTALTVWMDRS-SGSGFKSKRSYRNGYFGASIKVPSGYT  59

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV T  YLSN E +P +HDEIDIE LGT PG+P+TLQTNVY+ G+GDG  IIGRE+RF+
Sbjct  60   AGVNTAFYLSNNELYPGQHDEIDIELLGTVPGEPWTLQTNVYVHGTGDGA-IIGREMRFH  118

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWAT  364
            LWFDPT DFHHYAILWNP  I+F VDDVP+R YPR +  TFP R M+ YGSIWDAS WAT
Sbjct  119  LWFDPTADFHHYAILWNPDHIVFLVDDVPVRRYPRAAGNTFPDRQMWAYGSIWDASDWAT  178

Query  363  ENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGST-RLSNQQIAAMAWVQ  187
            + G+YK+DYRYQPF+ +Y+D K+ GC A    +C+P+P SP+G+T  LS QQ AAM W Q
Sbjct  179  DGGRYKSDYRYQPFVSRYRDLKIAGCEAAAPASCQPVPASPSGATGELSAQQKAAMRWAQ  238

Query  186  KNHKEYDYCQNTNRDHTQTPEC  121
            +    Y YCQ+ +R+H   PEC
Sbjct  239  QRSMVYYYCQDYSRNHANYPEC  260



>ref|NP_001132709.1| uncharacterized protein LOC100194192 precursor [Zea mays]
 gb|ACF81668.1| unknown [Zea mays]
 tpg|DAA42854.1| TPA: xyloglucan endotransglucosylase/hydrolase protein 32 [Zea 
mays]
Length=301

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 200/278 (72%), Gaps = 4/278 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            A A PSPGY+PS+ V  + F+ G+ NLWGP+HQ+L  D+  L++ +D+T G SGFKS +S
Sbjct  22   AAAQPSPGYFPSSTVRPMAFSDGYDNLWGPQHQTLSQDRMALTLLMDRTSG-SGFKSKRS  80

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY G SIK+Q GYTAGV T  YLSN E +P  HDEID+E LGT PG+PYTLQTNVY+
Sbjct  81   YRNGYFGVSIKVQPGYTAGVNTAFYLSNNELYPGRHDEIDMELLGTVPGEPYTLQTNVYV  140

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +G+GDG  ++GRE+RF+LWFDP  DFHHYAILWNP +I+F VDDVPIR Y   S   FP 
Sbjct  141  RGTGDGARLVGREMRFHLWFDPAADFHHYAILWNPDQIVFLVDDVPIRRYAAASAPFFPD  200

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+ YGSIWDAS WAT+ G+Y+ADY YQPF+  ++ F+  GC A     CRP+P SP G
Sbjct  201  RQMWAYGSIWDASDWATDGGRYRADYSYQPFLAGFRGFRTAGCEAAAPAQCRPVPASPAG  260

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +  LS QQ  AM W Q+    Y YCQ+  +D +  PEC
Sbjct  261  AG-LSVQQRDAMRWAQQTSMVYYYCQDYTKDRSLYPEC  297



>dbj|BAJ93467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   342 bits (878),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 208/289 (72%), Gaps = 10/289 (3%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKT  808
            A+I L       +A PSPGYYPS+KV S  F+Q +  LWGP+HQSL  DQ  L++W+D++
Sbjct  23   AVILL-----QGEAQPSPGYYPSSKVSSTPFSQWYSTLWGPQHQSLSPDQTALTLWMDRS  77

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
              GSGFKS +SY +GY G S+K+Q GYTAGV T  YLSN E +P  HDEID+E LGT PG
Sbjct  78   -SGSGFKSKRSYRNGYFGVSMKVQPGYTAGVNTAFYLSNNEVYPGYHDEIDVELLGTVPG  136

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            +PYTLQTNVY++G+GD   I+GRE+RF+LWFDP   FHHYA+LWNP EI+F VDDVP+R 
Sbjct  137  EPYTLQTNVYVRGTGDAHPIVGREMRFHLWFDPAAAFHHYAVLWNPDEIVFLVDDVPVRR  196

Query  447  YPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTST  268
            Y +K +ATFP+R M+ YGS+WDAS WAT+ G+Y++DYRYQPF+  +KDFKV GC      
Sbjct  197  YQKKVEATFPEREMWAYGSVWDASDWATDGGRYRSDYRYQPFVSGFKDFKVAGCEVGAPA  256

Query  267  ACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +CRP+         L  QQ AAM+W Q+    Y YCQ+ ++D +  PEC
Sbjct  257  SCRPV--PAGPGGGLGAQQSAAMSWAQQRAMVYYYCQDGSKDRSNYPEC  303



>ref|XP_009396169.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X1 [Musa acuminata subsp. malaccensis]
Length=319

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 218/303 (72%), Gaps = 29/303 (10%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSL-GFNQGFRNLWGPEHQ--SLDQGTLSIWLDKTHG--------  802
            + A PSPGYY S++   L GF  G+  LWGP HQ  S DQ +++IWLD++ G        
Sbjct  17   SSAQPSPGYYLSSRFKPLPGFYHGYNTLWGPRHQTVSADQSSVAIWLDRSSGLLLLLLPH  76

Query  801  ----------------GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKE  670
                            GSGFKS + + SGY  ASIKLQ G TAGVIT  YLSN + HP  
Sbjct  77   GSSQSHVNPASAASITGSGFKSNRPFRSGYFAASIKLQPGDTAGVITAFYLSNNQVHPGF  136

Query  669  HDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNP  490
            HDE+DIEFLGTTPG+PY LQTNVY+KGSGDG  +IGRE++F+LWFDP  DFHHYAILWNP
Sbjct  137  HDEVDIEFLGTTPGRPYKLQTNVYVKGSGDG-RVIGREMKFHLWFDPAADFHHYAILWNP  195

Query  489  SEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKY  310
            +EIIFFVDD+PIR YPRKSD TFP R M+VYG+IWDASSWAT+NGK++ DYR+QPF+ ++
Sbjct  196  NEIIFFVDDIPIRRYPRKSDDTFPLRPMWVYGTIWDASSWATDNGKHRVDYRHQPFVARF  255

Query  309  KDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQT  130
              F V GC+A   + CRP+P SP+G   LS QQ+AAMAW Q+N+  YDYC++  RD + T
Sbjct  256  TRFVVRGCSAYAPSGCRPVPSSPSGFG-LSKQQLAAMAWAQRNYMVYDYCRDDRRDRSLT  314

Query  129  PEC  121
            PEC
Sbjct  315  PEC  317



>ref|NP_001141552.1| uncharacterized protein LOC100273667 precursor [Zea mays]
 gb|ACF86607.1| unknown [Zea mays]
 gb|ACN27263.1| unknown [Zea mays]
 gb|AFW63927.1| hypothetical protein ZEAMMB73_893886 [Zea mays]
Length=326

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 169/284 (60%), Positives = 210/284 (74%), Gaps = 11/284 (4%)
 Frame = -2

Query  945  QAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGT----LSIWLDKTHGGSGFKSLK  778
            Q PP PG+YPS +  +  F++ FR LWG +HQS+  G     ++IWLD T  GSGFKS +
Sbjct  33   QHPPLPGFYPSKRYRARPFSRDFRTLWGAQHQSVSGGGGGGGVTIWLDST-SGSGFKSRR  91

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
            ++ SGY GAS+KLQAGYTAGVIT  YLSN + HP  HDE+D+EFLGTTPG+PYTLQTNVY
Sbjct  92   AFRSGYFGASVKLQAGYTAGVITAFYLSNADAHPGFHDEVDMEFLGTTPGQPYTLQTNVY  151

Query  597  MKGSGDG--GNIIGREVRFNL-WFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA  427
            + GSGDG  G ++GREV+F L WFDPT DFHHYAILW+P+ IIF+VDDVPIR YPR+S+ 
Sbjct  152  VLGSGDGGPGRVVGREVKFRLDWFDPTADFHHYAILWSPTHIIFYVDDVPIRRYPRRSE-  210

Query  426  TFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP--I  253
            TFP+R M+VYGSIWDASSWAT++G+YKADYRY PF+ ++    +  C+      CR    
Sbjct  211  TFPRRPMWVYGSIWDASSWATDDGRYKADYRYSPFVARFSGLLLRACSPRAPPRCRAPSG  270

Query  252  PGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              +  G   LS QQ AAM WVQ+NH  Y+YC +  RDH+ TPEC
Sbjct  271  GPTGGGGDALSPQQEAAMRWVQRNHMVYNYCLDPKRDHSLTPEC  314



>ref|NP_001148998.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Zea mays]
 gb|ACG33758.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor 
[Zea mays]
Length=297

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/278 (57%), Positives = 200/278 (72%), Gaps = 7/278 (3%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            A + PSPGY+PS+ V  + F+ G+ NLWGP+HQ+L  D+  L++ +D+T  GSGFKS +S
Sbjct  21   AASQPSPGYFPSSTVRPMAFSDGYDNLWGPQHQTLSQDRMALTLLMDRT-SGSGFKSKRS  79

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY G SIK+Q GYTAGV T  YLSN E +P  HDEID+E LGT PG+PYTLQTNVY+
Sbjct  80   YRNGYFGVSIKVQPGYTAGVNTAFYLSNNELYPGRHDEIDMELLGTVPGEPYTLQTNVYV  139

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +G+GDG  ++GRE+RF+LWFDP  DFHHYAILWNP +I+F VDDVPIR Y   S   FP 
Sbjct  140  RGTGDGARLVGREMRFHLWFDPAADFHHYAILWNPDQIVFLVDDVPIRRYAAASAPFFPD  199

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+ YGSIWDAS WAT+ G+Y+ADYRYQPF+  ++ F+  GC       CRP+P SP G
Sbjct  200  RQMWAYGSIWDASDWATDGGRYRADYRYQPFLAGFRGFRTAGC---EDAQCRPVPASPAG  256

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +  LS QQ  AM W Q+    Y YCQ+  +D +  PEC
Sbjct  257  AG-LSVQQRDAMRWAQQTSMVYYYCQDYTKDRSLYPEC  293



>gb|EMT14079.1| Putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Aegilops tauschii]
Length=296

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 198/279 (71%), Gaps = 5/279 (2%)
 Frame = -2

Query  951  NAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLK  778
            ++ A PSPGYYPS++   + FN+G+RN WGP+HQ+L  D   ++IWLDKT  GSGFKS  
Sbjct  21   SSDAQPSPGYYPSSRFRPVAFNRGYRNKWGPQHQTLSGDHSAITIWLDKT-CGSGFKSKH  79

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
            +Y +GY    IKL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQTNVY
Sbjct  80   AYRNGYFATRIKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQTNVY  139

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGDG  IIGRE+RF+LWFDP   FH+YAILWNP  I FFVDDVPIR Y RK++ TFP
Sbjct  140  VRGSGDG-RIIGREMRFHLWFDPAAGFHNYAILWNPDAITFFVDDVPIRRYERKTELTFP  198

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT  238
             R M+ YGSIW AS WAT++G+ +  +R  PF+ ++  F V GC      +CRP   SP 
Sbjct  199  DRPMWAYGSIWGASDWATDHGRDRGGHRSPPFVARFDRFVVAGCGPGAPPSCRPARASPV  258

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            G T L+ QQ AAM W Q+ H  Y YCQ+  RD + TPEC
Sbjct  259  G-TGLTRQQYAAMRWAQQRHMVYYYCQDFRRDRSLTPEC  296



>ref|XP_003559007.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 [Brachypodium distachyon]
Length=318

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 206/291 (71%), Gaps = 6/291 (2%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKT  808
            A++        AQ  PSPGYYPS+ V S+ F+QG+ NLWGP+HQSL  DQ +L++++D++
Sbjct  30   ALLVALMQPAAAQQVPSPGYYPSSTVRSMAFSQGYTNLWGPQHQSLSPDQSSLTLFMDRS  89

Query  807  HGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPG  628
              GSGFKS KSY SGY G SIK+Q GYTAGV T  YLSN E +P +HDEID+E LGT PG
Sbjct  90   -SGSGFKSKKSYRSGYFGVSIKVQPGYTAGVNTAFYLSNSELYPGQHDEIDMELLGTIPG  148

Query  627  KPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRY  448
            +PYTLQTNVY+ G+GD   IIGRE+RF+LWFDPT DFHHYAILW+ ++++F VDDVPIR 
Sbjct  149  EPYTLQTNVYVHGTGDSNPIIGREMRFHLWFDPTADFHHYAILWDQNQVVFLVDDVPIRR  208

Query  447  YPRK--SDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANT  274
            Y RK  + A FP R M+ YGS+WDAS WAT+ GKYKADY+Y PF+ ++ +FK+ GC    
Sbjct  209  YQRKPGAAALFPGREMWAYGSVWDASDWATDGGKYKADYKYAPFVARFSEFKLAGCEVGG  268

Query  273  STACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               CRP+  +  G   LS +Q   M W Q+    Y YC + +++    PEC
Sbjct  269  PDGCRPV-ATGPGGGGLSGKQEETMRWAQQRSMVYYYCTDRSKNRANYPEC  318



>ref|XP_002466013.1| hypothetical protein SORBIDRAFT_01g050070 [Sorghum bicolor]
 gb|EER93011.1| hypothetical protein SORBIDRAFT_01g050070 [Sorghum bicolor]
Length=340

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 199/278 (72%), Gaps = 3/278 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            AQA PSPGY+PS  V S+ F++ + NLWGP+HQ+L  D+  L++ +D+T  GSGFKS +S
Sbjct  60   AQAQPSPGYFPSATVRSMAFSEDYDNLWGPQHQTLSQDKMALTLLMDRT-SGSGFKSKRS  118

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY G SIK+Q GYTAGV T  YLSN E +P +HDEIDIE LGT PG+PYTLQTNVY+
Sbjct  119  YRNGYFGVSIKVQPGYTAGVNTAFYLSNNELYPGKHDEIDIELLGTVPGEPYTLQTNVYV  178

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQ  415
            +G+GDG +++GRE+RF+LWFDPT DFHHYAILWNP EI+F VDDVPIR Y   S   FP 
Sbjct  179  RGTGDGAHLVGREMRFHLWFDPTADFHHYAILWNPDEIVFLVDDVPIRRYAAASTTLFPD  238

Query  414  RAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTG  235
            R M+ YGSIWDAS WAT+ G+Y+ADYRYQPF+  ++ F+  GC A    A  P   +   
Sbjct  239  REMWAYGSIWDASDWATDGGRYRADYRYQPFLAGFRTFRTAGCEAAAPAAGCPPVPASPA  298

Query  234  STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               LS QQ  AM W Q+    Y YCQ+  +D +  PEC
Sbjct  299  GAGLSVQQRDAMRWAQQRSMVYYYCQDYTKDRSLYPEC  336



>dbj|BAD22925.1| putative xyloglucan endo-transglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAD22857.1| putative xyloglucan endo-transglycosylase [Oryza sativa Japonica 
Group]
Length=327

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 194/280 (69%), Gaps = 15/280 (5%)
 Frame = -2

Query  936  PSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGT----LSIWLDKTHGGSGFKSLKSYG  769
            PSPG YPS    +  F + FR+LWG EHQ  +       +++WLD+   GSGFKS ++Y 
Sbjct  35   PSPGVYPSRMFRAREFGRDFRSLWGAEHQQQEAAAPETGVTVWLDR-RSGSGFKSRRAYR  93

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA ++LQ GYTAGVIT  YLSN E HP  HDE+D+EFLGTTPGKPYTLQTNV+  G
Sbjct  94   SGYFGAWVRLQRGYTAGVITAFYLSNGEAHPGWHDEVDMEFLGTTPGKPYTLQTNVFSLG  153

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS---DATFP  418
            SGD    +GRE++F+LWFDPT DFHHYAILW    IIF VDDVPIR Y R+S    A FP
Sbjct  154  SGDPPRSLGREIKFHLWFDPTADFHHYAILWTSDHIIFLVDDVPIRRYGRRSAGGAAGFP  213

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC-RPIPGSP  241
             R M+VYGSIWDASSWATE+G+Y+ADY YQPF+ ++  F + GC+ +    C  P+ G  
Sbjct  214  ARPMWVYGSIWDASSWATEDGRYRADYSYQPFVARFSAFLLRGCSPHAPRTCAAPVAGD-  272

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
                 L+  Q+AAM W Q+ H  Y+YC +  RDH+ TPEC
Sbjct  273  -----LTAAQLAAMRWAQRFHMVYNYCYDPKRDHSLTPEC  307



>gb|EAZ25136.1| hypothetical protein OsJ_08934 [Oryza sativa Japonica Group]
Length=307

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 188/273 (69%), Gaps = 15/273 (5%)
 Frame = -2

Query  936  PSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGT----LSIWLDKTHGGSGFKSLKSYG  769
            PSPG YPS    +  F + FR+LWG EHQ  +       +++WLD+   GSGFKS ++Y 
Sbjct  13   PSPGVYPSRMFRAREFGRDFRSLWGAEHQQQEAAAPETGVTVWLDR-RSGSGFKSRRAYR  71

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA ++LQ GYTAGVIT  YLSN E HP  HDE+D+EFLGTTPGKPYTLQTNV+  G
Sbjct  72   SGYFGAWVRLQRGYTAGVITAFYLSNGEAHPGWHDEVDMEFLGTTPGKPYTLQTNVFSLG  131

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS---DATFP  418
            SGD    +GRE++F+LWFDPT DFHHYAILW    IIF VDDVPIR Y R+S    A FP
Sbjct  132  SGDPPRSLGREIKFHLWFDPTADFHHYAILWTSDHIIFLVDDVPIRRYGRRSAGGAAGFP  191

Query  417  QRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC-RPIPGSP  241
             R M+VYGSIWDASSWATE+G+Y+ADY YQPF+ ++  F + GC+ +    C  P+ G  
Sbjct  192  ARPMWVYGSIWDASSWATEDGRYRADYSYQPFVARFSAFLLRGCSPHAPRTCAAPVAGD-  250

Query  240  TGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRD  142
                 L+  Q+AAM W Q+ H  Y+YC +  R+
Sbjct  251  -----LTAAQLAAMRWAQRFHMVYNYCYDPKRE  278



>emb|CAA48325.1| cellulase [Tropaeolum majus]
Length=190

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 160/193 (83%), Gaps = 3/193 (2%)
 Frame = -2

Query  699  LSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQD  520
            LSN + +P +HDEIDIEFLGT PGKPYTLQTNV+++GSGD  NIIGRE+R +LWFDPTQD
Sbjct  1    LSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDY-NIIGRELRIHLWFDPTQD  59

Query  519  FHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKAD  340
            +H+YAI W PSEIIFFVDDVPIR YPRKSDATFP R ++VYGS+WDASSWATENGKYKAD
Sbjct  60   YHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKAD  119

Query  339  YRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYC  160
            YRYQPF+GKY+DFK+  C    +++C P   SP G  +LS QQ+AAM WVQKN+  Y+YC
Sbjct  120  YRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYG--QLSQQQVAAMEWVQKNYMVYNYC  177

Query  159  QNTNRDHTQTPEC  121
             +  RDHT TPEC
Sbjct  178  DDPTRDHTLTPEC  190



>gb|AAT40137.1| putative xyloglucan endotransglycosylase, partial [Bassia scoparia]
Length=210

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  738  QAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGR  559
            Q GYTAGVIT  YLSN + HP  HDE+D+EFLGTT GKPY LQTNVY++GSGDG  IIGR
Sbjct  1    QRGYTAGVITAFYLSNNQVHPGHHDEVDMEFLGTTFGKPYVLQTNVYIRGSGDG-TIIGR  59

Query  558  EVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDA  379
            E++F+LWFDPT+ FHHYAI W+P EIIF VDD+PIR YPRKS AT+P R M+VYGSIWDA
Sbjct  60   EMKFHLWFDPTKGFHHYAIFWSPKEIIFLVDDIPIRRYPRKSAATYPLRPMWVYGSIWDA  119

Query  378  SSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAM  199
            SSWATE+GKYKA+Y YQPF+G+Y +FK +GC+A    +CRP+  SP  S  L+ +Q   M
Sbjct  120  SSWATEDGKYKANYNYQPFVGQYTNFKASGCSAYAPRSCRPVSVSPYRSGGLTQKQTYVM  179

Query  198  AWVQKNHKEYDYCQNTNRDHTQTPEC  121
             WVQ+++  Y+YC++   DH+ TPEC
Sbjct  180  KWVQRHYMIYNYCKDRKXDHSHTPEC  205



>gb|EAZ39802.1| hypothetical protein OsJ_24243 [Oryza sativa Japonica Group]
Length=229

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 167/214 (78%), Gaps = 4/214 (2%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHG  802
            +    +++ A A PSPGYYPS+   ++ F++ + N WGP+HQ+L  DQ +L+IWLDKT  
Sbjct  18   VAAIMAASPAGAQPSPGYYPSSVHRAMAFSRDYTNKWGPQHQTLSADQSSLTIWLDKT-C  76

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS KSY +GY  A +KL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+P
Sbjct  77   GSGFKSRKSYRNGYFAARVKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEP  136

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            YTLQTNVY++GSGDG  I+GRE+RF+LWFDPT DFHHYAILWNP  I FFVDDVPIR Y 
Sbjct  137  YTLQTNVYVRGSGDG-RIVGREMRFHLWFDPTADFHHYAILWNPDAITFFVDDVPIRRYE  195

Query  441  RKSDATFPQRAMYVYGSIWDASSWATENGKYKAD  340
            RKS+ TFP R M+VYGSIWDAS WAT++G+ +AD
Sbjct  196  RKSELTFPDRPMWVYGSIWDASDWATDDGRQRAD  229



>ref|XP_006658556.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like, partial [Oryza brachyantha]
Length=229

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 163/204 (80%), Gaps = 4/204 (2%)
 Frame = -2

Query  942  APPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYG  769
            A PSPGYYPS+   ++ F++ + N WGP+HQ+L  DQ +L+IWLDKT  GSGFKS  SY 
Sbjct  28   AQPSPGYYPSSVHRAMAFSRDYTNKWGPQHQTLSADQSSLTIWLDKT-CGSGFKSKNSYR  86

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            +GY  A +KL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQTNVY++G
Sbjct  87   NGYFAARVKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQTNVYVRG  146

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRA  409
            SGDG  I+GRE+RF+LWFDPT DFHHYAILWNP  I FFVDDVPIR Y RKS+ TFP R 
Sbjct  147  SGDG-RIVGREMRFHLWFDPTADFHHYAILWNPDAITFFVDDVPIRRYERKSELTFPDRP  205

Query  408  MYVYGSIWDASSWATENGKYKADY  337
            M+VYGSIWDAS WAT++G+++ADY
Sbjct  206  MWVYGSIWDASDWATDDGRHRADY  229



>gb|KDO39060.1| hypothetical protein CISIN_1g043947mg, partial [Citrus sinensis]
Length=187

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = -2

Query  681  HPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAI  502
            HP  HDE+ IEFLGTT GKPYTLQTNVY++GSGDG  IIGRE++F+LWFDPT+DFHHYAI
Sbjct  1    HPGRHDEVGIEFLGTTFGKPYTLQTNVYIRGSGDG-EIIGREMKFHLWFDPTKDFHHYAI  59

Query  501  LWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPF  322
            LW+P E+IF VDDVPIR YPRKS ATFP R M+VYGSIWDASSWATE+GKYKADYRYQPF
Sbjct  60   LWSPKELIFLVDDVPIRRYPRKSAATFPLRPMWVYGSIWDASSWATEDGKYKADYRYQPF  119

Query  321  IGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRD  142
            + +Y DFK  GC A     CRP+  SP  S  LS QQ  AM W+Q +H  YDYC++  RD
Sbjct  120  VARYTDFKACGCTAYAPAWCRPVSVSPFHSGGLSRQQYWAMRWLQSHHLVYDYCRDQKRD  179

Query  141  HTQTPEC  121
            H  TPEC
Sbjct  180  HFLTPEC  186



>gb|ABK22838.1| unknown [Picea sitchensis]
Length=277

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 172/225 (76%), Gaps = 8/225 (4%)
 Frame = -2

Query  921  YP-STKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGA  751
            YP ++++ ++ FNQ F  LWGP+H+ +  D+  ++IWLD+ + GSGFKSL++Y SGY  A
Sbjct  55   YPITSQLSAVKFNQAFGVLWGPQHEQVSDDESGITIWLDR-NSGSGFKSLRAYNSGYFSA  113

Query  750  SIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY-MKGSGDGG  574
            +IKLQAGYTAG  T  YLSN E HP  HDEIDIEFLGT PG+PYTLQTN+Y + G+G  G
Sbjct  114  AIKLQAGYTAGTNTAFYLSNNEVHPDYHDEIDIEFLGTIPGRPYTLQTNIYVLAGNGGSG  173

Query  573  NII-GREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVY  397
             I+ GRE + +LWFDPT DFH Y+ILW PS+I+F VDDVPIR YPR +DA FP R M+VY
Sbjct  174  RIVTGREQQIHLWFDPTSDFHRYSILWTPSKIVFSVDDVPIRRYPR-TDA-FPTRPMWVY  231

Query  396  GSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            GSIWDASSWAT++G+YK DY YQPF+ KY DF +T C  + +  C
Sbjct  232  GSIWDASSWATDSGRYKVDYNYQPFVAKYTDFVLTDCTQSMAAEC  276



>gb|ABK21200.1| unknown [Picea sitchensis]
Length=277

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 172/225 (76%), Gaps = 8/225 (4%)
 Frame = -2

Query  921  YP-STKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGA  751
            YP ++++ ++ FNQ F  LWGP+H+ +  D+  ++IWLD+ + GSGFKSL++Y SGY  A
Sbjct  55   YPITSQLSAVKFNQAFGVLWGPQHEQVSDDESGITIWLDR-NSGSGFKSLRAYNSGYFSA  113

Query  750  SIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY-MKGSGDGG  574
            +IKLQAGYTAG  T  YLSN E HP  HDEIDIEFLGT PG+PYTLQTN+Y + G+G  G
Sbjct  114  AIKLQAGYTAGTNTAFYLSNNEVHPDYHDEIDIEFLGTIPGRPYTLQTNIYVLAGNGGSG  173

Query  573  NII-GREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVY  397
             I+ GRE + +LWFDPT DFH Y+ILW PS+I+F VDDVPIR YPR +DA FP R M+VY
Sbjct  174  RIVTGREQQIHLWFDPTSDFHRYSILWTPSKIVFSVDDVPIRRYPR-TDA-FPTRPMWVY  231

Query  396  GSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
            GSIWDASSWAT++G+YK DY YQPF+ KY DF +T C  + +  C
Sbjct  232  GSIWDASSWATDSGRYKVDYNYQPFVAKYTDFVLTDCTQSMAAEC  276



>gb|ABK22090.1| unknown [Picea sitchensis]
Length=265

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = -2

Query  924  YYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGA  751
            Y  +++   + FN+GFR LWGP+HQ++  DQ  ++IWLD+ + GSGFKSL+ Y SGY  A
Sbjct  52   YLRASQFSPVQFNRGFRVLWGPQHQTVSNDQSGITIWLDR-NSGSGFKSLRPYKSGYFSA  110

Query  750  SIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG--SGDG  577
            +IKLQAGYTAGV T  YLSN E H   HDEIDIEFLGT PG+PYTLQTN+Y++   +G G
Sbjct  111  AIKLQAGYTAGVNTAFYLSNNEAHRDYHDEIDIEFLGTIPGRPYTLQTNIYVRAGNAGTG  170

Query  576  GNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVY  397
              I GRE + +LWFDPT+DFH Y+ILW P +I+FFVDD+PIR Y R +  TFP R M++Y
Sbjct  171  RIITGREQQIHLWFDPTKDFHRYSILWTPFKIVFFVDDIPIRKYRRTNPYTFPARPMWLY  230

Query  396  GSIWDASSWATENGKYKADYRYQPFIGKYKDF  301
            GSIWDASSWAT+NGKYK DY+YQPF+  Y+ F
Sbjct  231  GSIWDASSWATDNGKYKVDYKYQPFVAMYRSF  262



>gb|EPS73223.1| hypothetical protein M569_01533, partial [Genlisea aurea]
Length=191

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 152/193 (79%), Gaps = 4/193 (2%)
 Frame = -2

Query  699  LSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQD  520
            LSN E  P  HDEID+EFLGTTP +PY LQTNVYM+GSGDG NIIGRE++F LWFDPT +
Sbjct  3    LSNNEALPGHHDEIDVEFLGTTPFEPYVLQTNVYMRGSGDG-NIIGREMKFYLWFDPTAE  61

Query  519  FHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKAD  340
            FH YAI+WNP+EIIFFVDD+PIR YP+KSD TFP R M+VYGSIWDASSWAT++GKY+AD
Sbjct  62   FHRYAIIWNPAEIIFFVDDIPIRRYPKKSDWTFPMRPMWVYGSIWDASSWATDHGKYRAD  121

Query  339  YRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYC  160
            Y Y+PF+ +Y+DFK++GC A  S   R +  SP G   LS  Q AAM WVQ+++  YDYC
Sbjct  122  YDYEPFVARYRDFKISGCTAACS---RHVTASPYGRPGLSGGQYAAMEWVQRHYMVYDYC  178

Query  159  QNTNRDHTQTPEC  121
            ++  RD +  PEC
Sbjct  179  RDAKRDRSVIPEC  191



>tpg|DAA46168.1| TPA: hypothetical protein ZEAMMB73_368676 [Zea mays]
Length=323

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 158/211 (75%), Gaps = 3/211 (1%)
 Frame = -2

Query  747  IKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNI  568
            I+  + ++A  +  + LSN E++P  HDEID+E LGT PG+PYTLQTNVY++GSGDG  I
Sbjct  114  IRECSRFSAWPLLPMQLSNSEEYPGHHDEIDMELLGTVPGEPYTLQTNVYVRGSGDG-TI  172

Query  567  IGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSI  388
            +GRE+RF+LWFDPT DFHHYAI+WNP +I+F VDDVP+R Y RK++ATFP R M+ YGSI
Sbjct  173  VGREMRFHLWFDPTADFHHYAIIWNPDQILFLVDDVPVRRYERKAEATFPDREMWAYGSI  232

Query  387  WDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPT--GSTRLSNQ  214
            WDAS WAT+ G+Y+ADYRYQPF+ ++   +V GCAA+ S  C+P+P SP   G+  +S Q
Sbjct  233  WDASDWATDGGRYRADYRYQPFVSRFAGLRVGGCAADASADCQPVPASPAAPGTAAISAQ  292

Query  213  QIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            Q AAM W Q+N   Y YC ++ RD    PEC
Sbjct  293  QEAAMRWAQRNSMVYYYCLDSTRDRALYPEC  323



>gb|ABK23544.1| unknown [Picea sitchensis]
Length=309

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 188/291 (65%), Gaps = 9/291 (3%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGS  796
            L ++  N   P  PG        +L F++G+ NLWG +HQ++  D+  +++ LD++  GS
Sbjct  4    LASADKNPAIPSLPGVPVMNYFKTLKFSEGYVNLWGGQHQNISKDESAVTLALDRS-SGS  62

Query  795  GFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYT  616
            GFKS + Y  G+  A++KLQ GYTAG+IT  YLSN + +   HDEIDIEFLGT PG+PY 
Sbjct  63   GFKSNEPYMYGFFNAAVKLQGGYTAGIITSFYLSNSQVYEGWHDEIDIEFLGTIPGEPYK  122

Query  615  LQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRK  436
            LQTNVY  G+GDG N+IGRE +F+LWFDPT+DFH+Y ILW P +I+F VD +PIR +P+ 
Sbjct  123  LQTNVYGNGTGDGPNLIGREQQFHLWFDPTKDFHNYTILWTPHQILFMVDSIPIRRFPKM  182

Query  435  SD--ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTAC  262
                 T+P + M  Y +IWDASSWAT+ GKYKA+Y Y+PF+  Y +F   GC++      
Sbjct  183  KSLGVTYPSKPMSAYATIWDASSWATDGGKYKANYTYEPFLSTYTNFITIGCSSKNEDDM  242

Query  261  RPIPGSPTG---STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQT-PEC  121
            R           S +L+  QI A+  V+KN+  YDYCQ+  R    T PEC
Sbjct  243  RYCSQGFLDCFISPKLNKDQIRALDLVRKNYMTYDYCQDLQRYPKGTMPEC  293



>ref|XP_009396170.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 isoform X2 [Musa acuminata subsp. malaccensis]
Length=304

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 159/195 (82%), Gaps = 2/195 (1%)
 Frame = -2

Query  705  LYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPT  526
            L LSN + HP  HDE+DIEFLGTTPG+PY LQTNVY+KGSGDG  +IGRE++F+LWFDP 
Sbjct  110  LQLSNNQVHPGFHDEVDIEFLGTTPGRPYKLQTNVYVKGSGDG-RVIGREMKFHLWFDPA  168

Query  525  QDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYK  346
             DFHHYAILWNP+EIIFFVDD+PIR YPRKSD TFP R M+VYG+IWDASSWAT+NGK++
Sbjct  169  ADFHHYAILWNPNEIIFFVDDIPIRRYPRKSDDTFPLRPMWVYGTIWDASSWATDNGKHR  228

Query  345  ADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYD  166
             DYR+QPF+ ++  F V GC+A   + CRP+P SP+G   LS QQ+AAMAW Q+N+  YD
Sbjct  229  VDYRHQPFVARFTRFVVRGCSAYAPSGCRPVPSSPSGFG-LSKQQLAAMAWAQRNYMVYD  287

Query  165  YCQNTNRDHTQTPEC  121
            YC++  RD + TPEC
Sbjct  288  YCRDDRRDRSLTPEC  302



>ref|NP_001189692.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 
[Arabidopsis thaliana]
 gb|AEC09309.1| probable xyloglucan endotransglucosylase/hydrolase protein 32 
[Arabidopsis thaliana]
Length=178

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++ L+ SS NA  PPSPGY+PS+KVGSL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  14   LLVLWGSSVNAYWPPSPGYWPSSKVGSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  72

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  73   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  132

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            TLQTNVY++GSGD G IIGRE++F LWFDPT+DFHHYAILW+P EI+
Sbjct  133  TLQTNVYIRGSGD-GKIIGREMKFRLWFDPTKDFHHYAILWSPREIM  178



>ref|XP_006576235.1| PREDICTED: uncharacterized protein LOC100796698 isoform X1 [Glycine 
max]
Length=172

 Score =   244 bits (624),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            AI+ L   S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  
Sbjct  7    AILILMVPSSNAYWPPSPGYWPSSKFRSMSFYKGFRNLWGPQHQSLDQNALTIWLDRT-S  65

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS++ + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKP
Sbjct  66   GSGFKSVRPFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKP  125

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            YTLQTNVY++GSGD G IIGRE++F+LWFDPT+DFHHYAILW+P EI+
Sbjct  126  YTLQTNVYIRGSGD-GRIIGREMKFHLWFDPTKDFHHYAILWSPKEIM  172



>ref|XP_006592278.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like isoform X2 [Glycine max]
Length=183

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++     S++AQ PPSPGYYPS+K+  + F QGF NLWGP HQ LDQG+L+IWLD ++ G
Sbjct  19   VLSCVICSSSAQGPPSPGYYPSSKISPVSFYQGFTNLWGPRHQRLDQGSLTIWLD-SNSG  77

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKSL SY SGY GA+IKLQ GYTAGVIT LYLSN + HP  HDEIDIEFLGTTP KPY
Sbjct  78   SGFKSLHSYRSGYFGAAIKLQPGYTAGVITSLYLSNNQDHPGNHDEIDIEFLGTTPDKPY  137

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
             LQTNVY++GSGD GNIIGRE++F+LWFDPTQDFH+Y ILW PSEI+
Sbjct  138  VLQTNVYIRGSGD-GNIIGREMKFHLWFDPTQDFHNYGILWKPSEIM  183



>ref|XP_006592712.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like isoform X2 [Glycine max]
Length=183

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKSYG  769
            +Q PPSPGYYPS+K   + F++GFRNLWGP+HQ LDQ +L+IWLD ++ GSGFKSL SY 
Sbjct  29   SQGPPSPGYYPSSKTNPVSFDEGFRNLWGPQHQKLDQDSLTIWLD-SYSGSGFKSLHSYR  87

Query  768  SGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKG  589
            SGY GA+IKLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KPY LQTNVY++G
Sbjct  88   SGYFGAAIKLQPGYTAGVITSLYLSNNQDYPGHHDEIDIEFLGTTPDKPYVLQTNVYIRG  147

Query  588  SGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            SGD GNIIGRE+RF+LWFDPTQDFH+YAILW PSEI+
Sbjct  148  SGD-GNIIGREMRFHLWFDPTQDFHNYAILWEPSEIM  183



>ref|XP_010505233.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X2 [Camelina sativa]
 ref|XP_010509426.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X3 [Camelina sativa]
 ref|XP_010516916.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X2 [Camelina sativa]
Length=180

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            ++  + SS NA  PPSPGY+PS+KV SL F +GFRNLWGP+HQ +DQ  L+IWLD+T  G
Sbjct  16   LLVFWGSSVNAYWPPSPGYWPSSKVSSLNFYKGFRNLWGPQHQRMDQNALTIWLDRT-SG  74

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GA+IKLQ GYTAGVIT LYLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  75   SGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPY  134

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            TLQTNVY++GSGD G IIGRE++F+LWFDPT++FHHYAILW+P EI+
Sbjct  135  TLQTNVYIRGSGD-GKIIGREMKFHLWFDPTKEFHHYAILWSPREIM  180



>ref|XP_006593441.1| PREDICTED: uncharacterized protein LOC100796768 isoform X1 [Glycine 
max]
Length=209

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = -2

Query  954  NNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLKS  775
            + +Q PPSPGYYPS+K+  + F +GFRNLWGP+HQ LDQ +L+IWLD ++ GSGFKSL S
Sbjct  53   STSQDPPSPGYYPSSKISPVSFGEGFRNLWGPQHQKLDQDSLTIWLD-SYSGSGFKSLHS  111

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y SGY GA+IKLQ GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KPY LQTNVY+
Sbjct  112  YRSGYFGAAIKLQPGYTAGVITSLYLSNNQDYPGHHDEIDIEFLGTTPDKPYVLQTNVYV  171

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            +GSGD GNIIGRE+R +LWFDPTQDFH+YAILW PSEI+
Sbjct  172  RGSGD-GNIIGREMRIHLWFDPTQDFHNYAILWEPSEIM  209



>ref|XP_006604581.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32-like isoform X2 [Glycine max]
Length=172

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S+NA  PPSPGY+PS+K  S+ F +GFRNLWGP+HQSLDQ  L+IWLD+T  GSGFKS++
Sbjct  15   SSNAYWPPSPGYWPSSKFRSMSFYKGFRNLWGPQHQSLDQNALTIWLDRT-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIK+Q GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKVQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            ++GSGD G IIGRE++F+LWFDPTQDFHHYAILW+P EI+
Sbjct  134  IRGSGD-GRIIGREMKFHLWFDPTQDFHHYAILWSPKEIM  172



>gb|EYU29882.1| hypothetical protein MIMGU_mgv1a0118912mg, partial [Erythranthe 
guttata]
Length=190

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            I+ + T  N  Q PPSPGYYPS++  S+ F QG++NLWGP HQS+D   ++IWLD+ + G
Sbjct  16   ILVIVTLVNAGQWPPSPGYYPSSRFRSMSFYQGYKNLWGPGHQSVDNNGITIWLDR-NSG  74

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ+GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  75   SGFKSVKPFRSGYFGASIKLQSGYTAGVITAFYLSNNEAHPGYHDEVDIEFLGTTIGKPY  134

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            TLQTNVY++GSGD G IIGRE++F+LWFDPTQ+FHHYAILW P EII
Sbjct  135  TLQTNVYVRGSGD-GKIIGREMKFHLWFDPTQNFHHYAILWTPMEII  180



>ref|XP_010243245.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X2 [Nelumbo nucifera]
Length=198

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NAQ PPSPGYYPS +  ++ F  GFRNLWGP+H  +DQ TL+IWLD +  GSGFKS++
Sbjct  15   SINAQWPPSPGYYPSHRFRTMRFYDGFRNLWGPQHMRIDQNTLTIWLDSS-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFP  418
            ++GSGD G IIGRE++F+LWFDPTQDFHHYAILW+P +II  +  V      R+ D+   
Sbjct  134  IRGSGD-GRIIGREMKFHLWFDPTQDFHHYAILWSPKDIIELLQLVATNLRGRR-DSLGS  191

Query  417  QRAM  406
             R M
Sbjct  192  NRTM  195



>ref|XP_010243246.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X3 [Nelumbo nucifera]
Length=187

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NAQ PPSPGYYPS +  ++ F  GFRNLWGP+H  +DQ TL+IWLD +  GSGFKS++
Sbjct  15   SINAQWPPSPGYYPSHRFRTMRFYDGFRNLWGPQHMRIDQNTLTIWLDSS-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            ++GSGD G IIGRE++F+LWFDPTQDFHHYAILW+P +II
Sbjct  134  IRGSGD-GRIIGREMKFHLWFDPTQDFHHYAILWSPKDII  172



>gb|AFK41967.1| unknown [Lotus japonicus]
Length=181

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = -2

Query  981  AIIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHG  802
            +++F F        PPSPGYY S+K+  + F+QGFRNLWGP+HQ LDQG  +IWLD +  
Sbjct  16   SLLFSFVVHCTNAGPPSPGYYLSSKISPVSFDQGFRNLWGPQHQKLDQGLSTIWLDSS-S  74

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKSL SY SGY GA+IKL  GYTAGVIT LYLSN + +P  HDEIDIEFLGTTP KP
Sbjct  75   GSGFKSLHSYRSGYFGAAIKLHPGYTAGVITSLYLSNNQDYPGNHDEIDIEFLGTTPDKP  134

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            Y LQTNVY++GSGD G IIGRE+RF+LWFDPT+DFH+YAILW P+EI+
Sbjct  135  YVLQTNVYIRGSGD-GKIIGREMRFHLWFDPTKDFHNYAILWKPTEIM  181



>ref|XP_010243247.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X4 [Nelumbo nucifera]
Length=180

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            S NAQ PPSPGYYPS +  ++ F  GFRNLWGP+H  +DQ TL+IWLD +  GSGFKS++
Sbjct  15   SINAQWPPSPGYYPSHRFRTMRFYDGFRNLWGPQHMRIDQNTLTIWLDSS-SGSGFKSVR  73

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  74   PFRSGYFGASIKLQPGYTAGVITSFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVY  133

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            ++GSGD G IIGRE++F+LWFDPTQDFHHYAILW+P +I+
Sbjct  134  IRGSGD-GRIIGREMKFHLWFDPTQDFHHYAILWSPKDIM  172



>ref|XP_011006619.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X2 [Populus euphratica]
Length=173

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGG  799
            +I +  SS+NAQ PPSPGY+P ++  S+ F QG+RNLWG  HQ +DQ  L+IWLD T  G
Sbjct  9    LILMAPSSSNAQWPPSPGYWPGSRFRSMSFYQGYRNLWGYSHQRVDQNALTIWLDST-SG  67

Query  798  SGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPY  619
            SGFKS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPY
Sbjct  68   SGFKSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPY  127

Query  618  TLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            TLQTNVY++GSGD G IIGRE++F+LWFDPT+ FH+YAILW+P EI+
Sbjct  128  TLQTNVYIRGSGD-GRIIGREMKFHLWFDPTKTFHYYAILWSPKEIM  173



>ref|XP_011015587.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 isoform X2 [Populus euphratica]
Length=173

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = -2

Query  969  LFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGF  790
            +  SS+NAQ PPSPGY+P ++  S+ F QG+RNLWG  HQ +DQ  L+IWLD T  GSGF
Sbjct  12   MVPSSSNAQWPPSPGYWPGSRFRSMSFYQGYRNLWGYSHQRVDQNALTIWLDST-SGSGF  70

Query  789  KSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQ  610
            KS+K + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQ
Sbjct  71   KSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQ  130

Query  609  TNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            TNVY++GSGD G IIGRE++F+LWFDPT+ FH+YAILW+P EI+
Sbjct  131  TNVYIRGSGD-GRIIGREMKFHLWFDPTKTFHYYAILWSPKEIM  173



>ref|XP_009349873.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Pyrus x bretschneideri]
 ref|XP_009349874.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 32 [Pyrus x bretschneideri]
Length=171

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = -2

Query  957  SNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSLK  778
            + NA  PPSPGY+PS+K  S+ F +GF+ LWGP+HQSL Q  L+IWLD+T G SGFKS++
Sbjct  14   ATNADWPPSPGYWPSSKFRSMSFYKGFKPLWGPQHQSLYQSALTIWLDRTTG-SGFKSVR  72

Query  777  SYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVY  598
             + SGY GASIKLQ GYTAGVIT  YLSN E HP  HDE+DIEFLGTT GKPYTLQTNVY
Sbjct  73   PFRSGYFGASIKLQTGYTAGVITAFYLSNSEAHPGYHDEVDIEFLGTTFGKPYTLQTNVY  132

Query  597  MKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            ++GSGD G I+GRE++F+LWFDPT++FHHYAILW+P EI+
Sbjct  133  IRGSGD-GRIVGREMKFHLWFDPTKNFHHYAILWSPKEIM  171



>gb|EMT25877.1| hypothetical protein F775_52572 [Aegilops tauschii]
Length=253

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -2

Query  978  IIFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTH  805
            ++ L     +A+A PSPGYYPS+KV S+ F+Q + NLWG +HQSL  DQ  L++W+D++ 
Sbjct  24   MLLLLQQGRSAEAQPSPGYYPSSKVSSMPFSQWYSNLWGAQHQSLSPDQTALTLWMDRS-  82

Query  804  GGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGK  625
             GSGFKS  +Y +GY G S+K Q GY AGV T  YLSN E +P  HDEID+E LGT PG+
Sbjct  83   SGSGFKSKGAYRNGYFGVSMKAQPGYPAGVNTAFYLSNNEVYPGYHDEIDVELLGTVPGE  142

Query  624  PYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYY  445
            PYTLQTNVY++G+GD   I+GRE+RF+LWFDP   FHHYA LWNP EI+F VDD P+R Y
Sbjct  143  PYTLQTNVYVRGTGDAHPIVGREMRFHLWFDPAAAFHHYAALWNPDEIVFLVDDAPVRRY  202

Query  444  PRKSD  430
             +K +
Sbjct  203  QKKVE  207



>gb|AAT90325.1| xyloglucan endotransglycosylase [Prunus armeniaca]
Length=144

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -2

Query  828  SIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIE  649
            +IWLD +  GSGFKSL  Y SGY GA++KLQ GYTAGVIT  YLSN E+HP  HDEIDIE
Sbjct  1    TIWLDSS-SGSGFKSLHPYRSGYFGAAVKLQPGYTAGVITSFYLSNNEEHPGNHDEIDIE  59

Query  648  FLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFV  469
            FLGT PGKPYTLQTNVY++GSGD GNIIGRE +F+LWFDPTQDFH+YAI+WNP+EIIF V
Sbjct  60   FLGTIPGKPYTLQTNVYIRGSGD-GNIIGREKKFHLWFDPTQDFHNYAIVWNPTEIIFLV  118

Query  468  DDVPIRYYPRKSDATFPQRAMYVYGS  391
            DDVPIR Y RKSDAT P R M+ YGS
Sbjct  119  DDVPIRRYQRKSDATLPLRPMWAYGS  144



>ref|XP_006650958.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31-like [Oryza brachyantha]
Length=222

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 144/207 (70%), Gaps = 8/207 (4%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHG  802
            + +  S   A A PSPGYYPS    S+ F +G+ NLWG +HQ+L  D   L++W+D++  
Sbjct  1    MVVACSGGGAGAQPSPGYYPSRATRSMEFGEGYSNLWGAQHQTLSPDHRALTVWMDRS-S  59

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            GSGFKS +SY +GY GASIK+ +GYTAGV T  YLSN E +P +HDEID+E LGT PG+P
Sbjct  60   GSGFKSKRSYRNGYFGASIKVPSGYTAGVNTAFYLSNNELYPGQHDEIDVELLGTVPGEP  119

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            +TLQTNVY+ G+GD G IIGRE+RF+LWFDPT DFHHYAILWNP +I+F VDDVP    P
Sbjct  120  WTLQTNVYVHGTGD-GTIIGREMRFHLWFDPTADFHHYAILWNPDQIVFLVDDVP----P  174

Query  441  RKSDATFPQRAMYVYGSIWDASSWATE  361
             +     P  A  +      A SWA +
Sbjct  175  CRPVPASPSGATGLSAQQNAAMSWAQK  201


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  264  CRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            CRP+P SP+G+T LS QQ AAM+W QK    Y YCQ+ +R+H   PEC
Sbjct  175  CRPVPASPSGATGLSAQQNAAMSWAQKRSMVYYYCQDYSRNHANYPEC  222



>gb|ADE76197.1| unknown [Picea sitchensis]
Length=193

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = -2

Query  654  IEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIF  475
            +EFLGTTPGKPYTLQTNVY+ G+GD   + GRE++F+LWFDPT+DFH+Y+ILW P+ IIF
Sbjct  1    MEFLGTTPGKPYTLQTNVYINGTGDAQVLTGRELKFHLWFDPTEDFHNYSILWTPTYIIF  60

Query  474  FVDDVPIRYYPRKSDATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKV  295
            +VDD+ IR YPR+  +T+P R ++VYG+IWDASSWATENGKY+ADYRYQPF+ K+  F +
Sbjct  61   YVDDIAIRKYPRRVSSTYPLRPLWVYGTIWDASSWATENGKYRADYRYQPFVAKFSRFIL  120

Query  294  TGCAANTSTACRPIPGS--PTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            +GC A  ST       S   TG+  L++Q+   M  +Q+N+  Y+YC++  R  T+ PEC
Sbjct  121  SGCPAPDSTCSAAFSDSLISTGTGGLTSQERTRMKSIQRNNLVYNYCKDRERYPTRLPEC  180

Query  120  *K  115
             K
Sbjct  181  GK  182



>ref|XP_010514835.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 31 isoform X2 [Camelina sativa]
Length=174

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQGTLSIWLDKTHGGSGFKSL  781
            SS ++Q  PSPGYYPS++V +  F++ FR LWG +HQ  +Q  +++WLDK+  GSGFKS+
Sbjct  16   SSCHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKS-TGSGFKSI  74

Query  780  KSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNV  601
            + Y SGY GASIKL  G+TAGV T LYLSN ++HP +HDE+DIEFLGTTPGKPY+LQTNV
Sbjct  75   RPYRSGYFGASIKLHPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNV  134

Query  600  YMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEII  478
            + +GSGD  N+IGRE++F LWFDPT+DFHHYAILWNP++I+
Sbjct  135  FARGSGD-RNVIGREMKFTLWFDPTKDFHHYAILWNPNQIV  174



>ref|XP_006848333.1| hypothetical protein AMTR_s00013p00167480 [Amborella trichopoda]
 gb|ERN09914.1| hypothetical protein AMTR_s00013p00167480 [Amborella trichopoda]
Length=221

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 145/225 (64%), Gaps = 10/225 (4%)
 Frame = -2

Query  765  GYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGS  586
            G+  A+IKLQ+GYTAG+IT  YLSN + +   HDE+D+EFLGT  G+P  LQTNVY  G+
Sbjct  3    GFFNAAIKLQSGYTAGIITSFYLSNNQVYEGWHDEVDMEFLGTITGEPIKLQTNVYGNGT  62

Query  585  GDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQR  412
            GDG  + GRE  F+LWFDPT  FH+Y+ILW+P +I+F VDD+PIR +PR       +P +
Sbjct  63   GDGTGMQGREQHFHLWFDPTATFHNYSILWSPHQILFLVDDIPIRRFPRVRALGPKYPSK  122

Query  411  AMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRP--IPGSPT  238
             M VY +IWDAS WAT+ GKYKA+Y Y+PF   Y +FK+ GC     +      IP  P 
Sbjct  123  PMSVYATIWDASDWATDGGKYKANYTYEPFYATYTNFKLRGCQKKRCSHALDSLIPPKPN  182

Query  237  GSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC*KLLRW  103
               R S      + +V++N+  YDYCQ+  R   + PEC  L RW
Sbjct  183  KQFRES------LKFVRENYMVYDYCQDLQRYPNRLPECPSLKRW  221



>gb|AFK39336.1| unknown [Lotus japonicus]
Length=145

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -2

Query  555  VRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDATFPQRAMYVYGSIWDAS  376
            ++F+LWFDPTQDFH+YAILW PSEIIFFVDDVPIR YPRKSDAT+P R MYVYGSIWDAS
Sbjct  1    MKFHLWFDPTQDFHNYAILWKPSEIIFFVDDVPIRRYPRKSDATYPTRPMYVYGSIWDAS  60

Query  375  SWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIAAMA  196
            SW TE+GKYKA+Y YQPFIG+YK+FK+ GC A +   C+P   SP+G   LS++Q +AM 
Sbjct  61   SWTTEDGKYKANYNYQPFIGRYKNFKLQGCTAESPAWCKPPSASPSGYGSLSSRQFSAMQ  120

Query  195  WVQKNHKEYDYCQNTNRDHTQTPEC  121
            W Q N+  Y+YC +  RDHT  PEC
Sbjct  121  WAQNNYMVYNYCHDPRRDHTLIPEC  145



>gb|KEH40692.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=328

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 157/264 (59%), Gaps = 12/264 (5%)
 Frame = -2

Query  891  FNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYTAG  718
            F++G+  L+G  +  +  D   + + LD++  GSGF S   Y  GY  ASIKL + YTAG
Sbjct  33   FDEGYTPLFGDHNLIIHSDSKAVHLLLDES-SGSGFASHDLYLHGYFSASIKLPSDYTAG  91

Query  717  VITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNLW  538
            V+   YLSN + + K HDEID EFLG   GK + +QTNVY    G+G   IGRE R+ LW
Sbjct  92   VVVAFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVY----GNGSTNIGREERYGLW  147

Query  537  FDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD--ATFPQRAMYVYGSIWDASSWAT  364
            FDP+++FHHY+ILW  S+IIF+VDDVPIR   R       FP +AM +Y +IWDAS+WAT
Sbjct  148  FDPSEEFHHYSILWTDSKIIFYVDDVPIREVKRTESMRGDFPSKAMTLYSTIWDASTWAT  207

Query  363  ENGKYKADYRYQPFIGKYKDFKVTGCAANT---STACRPIPGSPTGSTRLSNQQIAAMAW  193
              GKYK +Y+Y P+I ++ DF + GCA +     T C     S T  + ++  +   M  
Sbjct  208  NGGKYKVNYKYAPYIAEFSDFVLHGCAVDPIEHVTKCDSAQSSETVPSDVTQLERIKMEN  267

Query  192  VQKNHKEYDYCQNTNRDHTQTPEC  121
             +  H  Y YC +  R     PEC
Sbjct  268  FRLKHMTYSYCYDKTRYKVPLPEC  291



>gb|EMS47743.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 
[Triticum urartu]
Length=226

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  948  AQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKS  775
            + A PSPGYYPS++   + FN+ + N WGP+HQ+L  D   ++IWLDKT  GSGFKS  +
Sbjct  22   SDAQPSPGYYPSSRFRPVVFNRAYSNKWGPQHQTLSGDHSAITIWLDKT-CGSGFKSKHA  80

Query  774  YGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYM  595
            Y +GY    IKL AGYTAG  T  YLSN E HP  HDEID+EFLGT PG+PYTLQTNVY+
Sbjct  81   YRNGYFATRIKLPAGYTAGTNTAFYLSNNEAHPGFHDEIDMEFLGTIPGEPYTLQTNVYV  140

Query  594  KGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIR  451
            +GSGD G IIGRE+R +LWFDPT  FH YAILWNP  I FFVDDVP+R
Sbjct  141  RGSGD-GRIIGREMRVHLWFDPTAGFHTYAILWNPDAITFFVDDVPVR  187



>ref|XP_009621666.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Nicotiana tomentosiformis]
Length=331

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 161/275 (59%), Gaps = 12/275 (4%)
 Frame = -2

Query  924  YYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGA  751
            Y  S  +  L F++G+ +L+G ++  +  D  +  I LD+   G+GF S   Y  G+  A
Sbjct  19   YGSSRNLPILAFDEGYSHLFGDDNLMILKDGKSAHISLDE-RTGAGFVSQDLYLHGFFSA  77

Query  750  SIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGN  571
            SIKL A YTAGV+   Y+SN++   K HDEID EFLG   GK + +QTN+Y    G+G  
Sbjct  78   SIKLPADYTAGVVVAFYMSNVDMFEKNHDEIDFEFLGNIRGKDWRIQTNIY----GNGST  133

Query  570  IIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVY  397
             +GRE R+ LWFDP++DFHHY+ILW  + IIF+VD+VPIR   R       FP + M +Y
Sbjct  134  SVGREERYGLWFDPSEDFHHYSILWTENFIIFYVDNVPIREIKRTEAMGGDFPSKPMSLY  193

Query  396  GSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTR  226
             +IWD S WAT  GKYK +Y+Y P+I K+ DF + GCA +    S+ C   P + +  T 
Sbjct  194  ATIWDGSGWATNGGKYKVNYKYAPYIAKFSDFVLHGCAVDPIELSSKCDTAPKTASIPTG  253

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            ++  Q   M   +K   +Y YC +  R     PEC
Sbjct  254  ITPDQRRKMEKFRKKQMQYSYCYDKTRYKVPPPEC  288



>ref|XP_007222502.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica]
 gb|EMJ23701.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica]
Length=338

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 157/270 (58%), Gaps = 19/270 (7%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+  L+G ++  +  D  ++ + LD+   GSGF S   Y  G+  ASIKL A YT
Sbjct  32   ISFDEGYNKLFGDDNLMILRDGKSVHLSLDE-RTGSGFVSQDLYHHGFFSASIKLPADYT  90

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN +  PK HDEID EFLG   GK + +QTNVY    G+G    GRE R+N
Sbjct  91   AGVVVAFYMSNGDMFPKNHDEIDFEFLGNIRGKEWRIQTNVY----GNGSTSTGREERYN  146

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD--ATFPQRAMYVYGSIWDASSW  370
            LWFDP+ DFH Y+ILW  S+IIF+VDDVPIR   R       FP + M +Y +IWD S W
Sbjct  147  LWFDPSDDFHQYSILWTDSQIIFYVDDVPIREVKRTESMGGDFPSKPMSLYATIWDGSDW  206

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAAN----TSTAC---RPIPGSPTGSTRLSNQQ  211
            AT  GKY+ +Y+Y P++ ++ D  + GCA +     S  C   R     PTG TRL   Q
Sbjct  207  ATNGGKYRVNYKYAPYLAQFSDLVLHGCAVDPIEQLSKKCDNTRSSESVPTGVTRL---Q  263

Query  210  IAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               M   +K H  Y YC +  R  +  PEC
Sbjct  264  RIKMDSFRKKHMTYSYCYDRIRYKSPPPEC  293



>gb|ACD03223.1| xyloglucan endotransglucosylase/hydrolase 13 [Actinidia deliciosa]
Length=329

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 160/266 (60%), Gaps = 12/266 (5%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+  L+G E+  +  D  ++ + LD+   GSGF S   Y  G+  ASIKL A YT
Sbjct  27   ISFDEGYSQLFGDENLMVLEDGKSVHLSLDE-RTGSGFVSHDLYLHGFFSASIKLPADYT  85

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN + H K HDE+D EFLG   GK + +QTNVY    G+G   +GRE R+ 
Sbjct  86   AGVVVAFYMSNGDMHEKNHDELDFEFLGNIRGKDWRIQTNVY----GNGSTSVGREERYG  141

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSIWDASSW  370
            LWFDP++DFHHY+ILW  ++I F+VD+VPIR   R       FP + M +Y +IWD S+W
Sbjct  142  LWFDPSEDFHHYSILWTENQITFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWDGSNW  201

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTRLSNQQIAAM  199
            AT  G+Y+ +Y+Y P+I ++ D  + GCA +    S+ C   P S +  T ++  Q++ M
Sbjct  202  ATNGGRYRVNYKYAPYITQFSDLVLHGCAVDPIEQSSTCDLPPNSESILTGITPDQLSKM  261

Query  198  AWVQKNHKEYDYCQNTNRDHTQTPEC  121
               +K H +Y YC +  R      EC
Sbjct  262  ENFRKKHMQYSYCYDRTRYKVPPSEC  287



>ref|XP_009621345.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nicotiana tomentosiformis]
Length=330

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/272 (42%), Positives = 161/272 (59%), Gaps = 12/272 (4%)
 Frame = -2

Query  915  STKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIK  742
            S ++ +L F++G+  L+G ++  +  D  ++ + LD+   G+GF S   Y  GY  ASIK
Sbjct  22   SKQLQTLPFDEGYSQLFGHDNLMVLEDGKSVHLSLDE-RTGAGFVSQDLYLHGYFSASIK  80

Query  741  LQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIG  562
            L A YTAGV+   Y+SN +   K HDEID EFLG    K + +QTN+Y    G+G   +G
Sbjct  81   LPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKKWRIQTNIY----GNGSTNVG  136

Query  561  REVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSI  388
            RE R+ LWFDP++DFH Y+ILW  S+IIF+VD++PIR   R       FP + M +Y +I
Sbjct  137  REERYGLWFDPSEDFHQYSILWTESQIIFYVDNIPIREIKRTKAMGGDFPSKPMSLYATI  196

Query  387  WDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTRLSN  217
            WD SSWAT  GKYK +Y+Y P++ K+ DF + GCA +    S  C   P S +  T +S 
Sbjct  197  WDGSSWATNGGKYKVNYKYAPYVAKFSDFILHGCAVDPIELSPKCDTTPNSASIPTSISP  256

Query  216  QQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             Q   M   +K + +Y YC +  R +    EC
Sbjct  257  DQRRKMESFRKKYLQYSYCYDRTRYNVPLSEC  288



>ref|XP_010043929.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Eucalyptus grandis]
 gb|KCW85954.1| hypothetical protein EUGRSUZ_B02660 [Eucalyptus grandis]
Length=332

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 155/266 (58%), Gaps = 12/266 (5%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+  L+G  + +L  D  ++ + LD+   GSGF S   Y  G+  ASIKL A YT
Sbjct  31   ISFDEGYTQLFGDNNLALHGDGQSVHLALDE-RTGSGFASQDLYLHGFFSASIKLPADYT  89

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN + + K HDEID EFLG   GK + +QTN+Y    G+G   +GRE R+ 
Sbjct  90   AGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKNWRIQTNIY----GNGSTSVGREERYG  145

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSIWDASSW  370
            LWFDP+ DFH Y ILW  S+IIF+VD+VPIR + R       FP + M +Y +IWD S W
Sbjct  146  LWFDPSDDFHQYGILWTDSQIIFYVDNVPIREFKRTEAMGGQFPSKPMSLYATIWDGSDW  205

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAANT---STACRPIPGSPTGSTRLSNQQIAAM  199
            AT  GKY+ +Y+Y P++ K+ D  + GCA +      +C  +P        +S +Q   M
Sbjct  206  ATNGGKYRVNYKYAPYVAKFSDLVLHGCAVDPIEHQLSCNDVPSHKAIPQGISPRQRTKM  265

Query  198  AWVQKNHKEYDYCQNTNRDHTQTPEC  121
             + +K H  Y YC +  R     PEC
Sbjct  266  EYFRKKHMTYSYCYDRARYKVPPPEC  291



>dbj|BAK07675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 154/268 (57%), Gaps = 14/268 (5%)
 Frame = -2

Query  912  TKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKL  739
            T   +L F +G+  L+G  +  L  D   + I LD+   GSGF S  +Y  G+  ASIKL
Sbjct  34   TTAAALTFREGYTQLFGDSNLRLHGDGKRVHISLDE-RTGSGFASQGAYFHGFFSASIKL  92

Query  738  QAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGR  559
             + Y AGV+   Y+SN + + K HDE+D EFLG   GK + +QTNVY    GDG   +GR
Sbjct  93   PSDYAAGVVVAFYMSNGDVYEKTHDELDFEFLGNVRGKEWRVQTNVY----GDGSTAVGR  148

Query  558  EVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSIW  385
            E R+ LWFDPT DFH YAILW    I+F+VD  PIR   R     A FP + M +Y +IW
Sbjct  149  EERYGLWFDPTHDFHRYAILWTNRTIVFYVDGTPIREVVRSEAMGAQFPSKPMSLYATIW  208

Query  384  DASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRLSNQQIA  205
            D SSWAT  G+YK +Y+Y P++ ++ D ++ GCA++     +P    P G   +  +Q A
Sbjct  209  DGSSWATSGGRYKVEYKYAPYVAEFTDLELRGCASHDR--AQPASCEPEG---MPARQRA  263

Query  204  AMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            AM  V+  H  Y YC +  R     PEC
Sbjct  264  AMERVRARHMTYGYCYDRARYPAPLPEC  291



>gb|AAK30204.1|AF349963_1 endoxyloglucan transferase [Daucus carota]
Length=330

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 160/269 (59%), Gaps = 18/269 (7%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSLDQGTLSIWLD-KTHGGSGFKSLKSYGSGYIGASIKLQAGYTA  721
            + F +G+  L+G  +  + Q   S  L      GSGF S   Y  G+  ASIKL A YTA
Sbjct  28   VSFEEGYSQLFGDSNLMILQDGKSAHLSLDERTGSGFVSHDLYKHGFFSASIKLPADYTA  87

Query  720  GVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFNL  541
            GV+   Y+SN++   K HDEID EFLG   GK + LQTNVY    G+G    GRE R+ L
Sbjct  88   GVVVAFYMSNVDMFAKNHDEIDFEFLGNIRGKEWRLQTNVY----GNGSTGAGREERYGL  143

Query  540  WFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDAT---FPQRAMYVYGSIWDASSW  370
            WFDP+ DFH Y+ILW+   IIF++D+VPIR   +K++A    FP + M +Y +IWD S+W
Sbjct  144  WFDPSDDFHQYSILWSKDRIIFYIDNVPIREV-KKTEAMGGDFPSKPMSLYATIWDGSNW  202

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGS---PTGSTRLSNQQI  208
            AT  GKYK +Y+Y P+I ++ DF + GCA +    ST+C   P S   PTG+T+ S  + 
Sbjct  203  ATNGGKYKVNYKYSPYIAEFSDFVLHGCAVDPIEMSTSCDTAPKSQSVPTGTTKESRTK-  261

Query  207  AAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              M  ++K + +Y YC +T R      EC
Sbjct  262  --MQNLRKKYMQYSYCYDTTRYQVPPSEC  288



>ref|XP_009777519.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nicotiana sylvestris]
Length=330

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 159/272 (58%), Gaps = 12/272 (4%)
 Frame = -2

Query  915  STKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIK  742
            S K+ +L F++G+  L+G ++  +  D  ++ I LD+   G+GF S   Y  GY  ASIK
Sbjct  22   SKKLQTLPFDEGYSQLFGHDNLMVLEDGKSVHISLDE-RTGAGFVSQDLYLHGYFSASIK  80

Query  741  LQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIG  562
            L A YTAGV+   Y+SN +   K HDEID EFLG    K + +QTN+Y    G+G   +G
Sbjct  81   LPADYTAGVVVAFYMSNGDMFEKSHDEIDFEFLGNIRAKNWRIQTNIY----GNGSTNVG  136

Query  561  REVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSI  388
            RE R+ LWFDP++DFH Y ILW  S+IIF+VD++PIR   R       FP + M +Y +I
Sbjct  137  REERYGLWFDPSEDFHQYTILWTESQIIFYVDNIPIREIKRTKAMGGDFPSKPMSLYATI  196

Query  387  WDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTRLSN  217
            WD SSWAT  GKYK +Y+Y P++ K+ DF + GCA +    S  C   P S    T +S 
Sbjct  197  WDGSSWATNGGKYKVNYKYAPYVAKFSDFVLHGCAVDPIELSPKCDTAPKSAFVPTGISP  256

Query  216  QQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             Q   M   +K + +Y YC +  R +    EC
Sbjct  257  DQRRKMESFRKKYLQYSYCYDRTRYNVPLSEC  288



>ref|XP_010066550.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Eucalyptus grandis]
 gb|KCW64460.1| hypothetical protein EUGRSUZ_G02075 [Eucalyptus grandis]
Length=335

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 158/266 (59%), Gaps = 12/266 (5%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+ +L+G ++  +  D  ++ + LD+   GSGF S   Y  G+  ASIKL A YT
Sbjct  37   VSFDEGYAHLFGDDNLVIHGDGKSVHLTLDE-RTGSGFVSQDLYLHGFFSASIKLPADYT  95

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN +   K HDEID EFLG   GK + +QTNVY    G+G   +GRE R+N
Sbjct  96   AGVVVAFYMSNGDMFEKTHDEIDFEFLGNIRGKEWRVQTNVY----GNGSVGVGREERYN  151

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSIWDASSW  370
            LWFDP+ DFH Y+ILW  S I+F+VD+VPIR   R       FP + M +Y +IWD SSW
Sbjct  152  LWFDPSDDFHQYSILWTDSLIVFYVDNVPIREVKRTKAMGGDFPSKPMTLYATIWDGSSW  211

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTRLSNQQIAAM  199
            AT  GKY+  Y+Y P+I ++ D  + GCA +    S+AC  +  S +  T ++ +Q   M
Sbjct  212  ATNGGKYRVSYKYAPYIVEFSDLVLHGCAVDPIERSSACDAVLPSGSIPTAITREQRVQM  271

Query  198  AWVQKNHKEYDYCQNTNRDHTQTPEC  121
               +K H  Y YC +  R     PEC
Sbjct  272  ESFRKRHMTYSYCYDRARYKIPPPEC  297



>ref|XP_009763784.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Nicotiana sylvestris]
Length=331

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 158/275 (57%), Gaps = 12/275 (4%)
 Frame = -2

Query  924  YYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGA  751
            Y  S  +  L F++G+ +L+G  +  +  D  +  I LD+   G+GF S   Y  G+  A
Sbjct  19   YGSSRNLPILAFDEGYSHLFGDNNLMILKDGKSAHISLDE-RTGAGFVSQDLYLHGFFSA  77

Query  750  SIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGN  571
            SIKL A YTAGV+   Y+SN++   K HDEID EFLG   GK + +QTN+Y    G+G  
Sbjct  78   SIKLPADYTAGVVVAFYMSNVDMFEKNHDEIDFEFLGNIRGKDWRIQTNIY----GNGST  133

Query  570  IIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVY  397
              GRE R+ LWFDP++DFHHY+ILW  + IIF+VD+VPIR   R       FP + M +Y
Sbjct  134  SFGREERYGLWFDPSEDFHHYSILWTENFIIFYVDNVPIREIKRTEAMGGDFPSKPMSLY  193

Query  396  GSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTR  226
             +IWD S WAT  GKYK +Y+Y P+I K+ DF + GCA +    S+ C   P + +  T 
Sbjct  194  ATIWDGSGWATNGGKYKVNYKYAPYIAKFSDFVLHGCAVDPIELSSKCDTAPKTSSIPTG  253

Query  225  LSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            ++  Q   M   +K   +Y YC +  R      EC
Sbjct  254  ITPDQRRKMENFRKKQMQYSYCYDKTRYKVPPTEC  288



>ref|XP_006355045.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27-like [Solanum tuberosum]
Length=330

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 158/272 (58%), Gaps = 12/272 (4%)
 Frame = -2

Query  915  STKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIK  742
            S K+ +L F++G+  L+G ++  +  D+ ++ I LD+   G+GF S   Y  G   ASIK
Sbjct  22   SEKLETLPFHEGYSQLFGHDNLMVLQDEKSVHISLDE-RTGAGFVSQDLYLLGLFSASIK  80

Query  741  LQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIG  562
            L   YTAGV+   Y+SN +   K HDEID EFLG    K + +QTN+Y    G+G   +G
Sbjct  81   LPEDYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKNWRIQTNIY----GNGSTNVG  136

Query  561  REVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--DATFPQRAMYVYGSI  388
            RE R+ LWFDPT+DFH Y ILW  S IIF+VD+VPIR   R       FP + M +Y +I
Sbjct  137  REERYGLWFDPTEDFHTYTILWTDSHIIFYVDNVPIREIKRTQAMGGDFPSKPMSLYATI  196

Query  387  WDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAAN---TSTACRPIPGSPTGSTRLSN  217
            WD SSWAT  GKYK +Y+Y P++ K+ DF + GCA +    S  C  +  S +  T +S 
Sbjct  197  WDGSSWATNGGKYKVNYKYAPYVTKFSDFVLHGCAVDPIELSPKCDIVQDSASIPTEISP  256

Query  216  QQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             Q   M   +K H +Y YC +  R +    EC
Sbjct  257  DQRRKMERFRKKHLQYSYCYDRTRYNVPLSEC  288



>ref|XP_008795338.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Phoenix dactylifera]
Length=337

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 163/292 (56%), Gaps = 20/292 (7%)
 Frame = -2

Query  975  IFLFTSSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSLDQ--GTLSIWLDKTHG  802
            +FLF+SS       S          ++ F +G+   +G  +  L +   T+ I LD+   
Sbjct  18   LFLFSSSATTSVIESSS--------TVSFEEGYTQTFGDSNLMLLRHGKTVHIALDE-RT  68

Query  801  GSGFKSLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKP  622
            G+GF S   Y  G+  ASIKL + Y AGV+   Y+SN +   K HDE+D EFLG   G+ 
Sbjct  69   GAGFASQDLYLHGFFSASIKLPSDYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGRE  128

Query  621  YTLQTNVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYP  442
            + +QTNVY    G+G   IGRE R++LWFDPT DFH Y+ILW+   IIF++D VPIR   
Sbjct  129  WRVQTNVY----GNGSTAIGREERYDLWFDPTDDFHQYSILWSHDRIIFYIDSVPIREIV  184

Query  441  RKSD--ATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANT--  274
            R       FP + M +Y +IWD S+WAT  G+YK +YRY P+I ++ D  + GCA N   
Sbjct  185  RTESMGGQFPSKPMSLYATIWDGSNWATSGGRYKVNYRYAPYIAEFADLILNGCAVNPMD  244

Query  273  -STACRPIPGSPTGSTRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
             S+AC     +   S  +S++Q A M   ++ H  Y YC + NR     PEC
Sbjct  245  HSSACEGRAAARYDSATMSSEQRAQMESFRRKHVTYFYCYDRNRYPNPPPEC  296



>ref|XP_009409244.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 158/267 (59%), Gaps = 12/267 (4%)
 Frame = -2

Query  900  SLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGY  727
            +L F +G+  L+G  +  L  D   + + LD+   G+GF S   Y  G+  ASIKL + Y
Sbjct  33   TLSFEEGYTQLFGDGNLMLLRDGKRVHLSLDE-RTGAGFASQDLYLHGFFSASIKLPSDY  91

Query  726  TAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRF  547
            TAGV+   Y+SN +   K HDE+D EFLG   G+ + +QTNVY    G+G   +GRE R 
Sbjct  92   TAGVVVAFYMSNGDAFEKTHDELDFEFLGNVRGREWRVQTNVY----GNGSTAVGREERC  147

Query  546  NLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDA--TFPQRAMYVYGSIWDASS  373
            +LWFDPT+DFHHY+ILWN   IIF+VDD PIR   R   A   FP + M +Y +IWD S+
Sbjct  148  DLWFDPTEDFHHYSILWNHDRIIFYVDDTPIREIVRAEAAGGVFPAKPMSLYATIWDGSN  207

Query  372  WATENGKYKADYRYQPFIGKYKDFKVTGCAANT---STACRPIPGSPTGSTRLSNQQIAA  202
            WAT  G+YK  Y+Y P++ ++ +  + GCA +    S+ C     +   +  +S+ Q A 
Sbjct  208  WATSGGRYKVKYKYAPYVAEFSELVLHGCAVDPIDHSSPCERPENARYDTLTMSSDQRAR  267

Query  201  MAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            M   ++NH +Y YC + +R  T  PEC
Sbjct  268  MTSFRRNHMQYLYCYDRDRYPTPPPEC  294



>ref|XP_008373536.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Malus domestica]
Length=355

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 160/272 (59%), Gaps = 17/272 (6%)
 Frame = -2

Query  900  SLGFNQGFRNLWGPEH--QSLDQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGY  727
            ++ F+QG+  L+G  +  +S D   + + LD+   GSGF S   Y  G+  A+IKL + Y
Sbjct  43   TIPFDQGYIPLFGDGNLVRSPDGKGVRLLLDR-FTGSGFISSNLYNHGFFSANIKLPSDY  101

Query  726  TAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRF  547
            TAG+    Y SN +   K HDE+DIEFLG T GKP+  QTN+Y    G+G    GRE R+
Sbjct  102  TAGICVAFYTSNADVFEKSHDELDIEFLGNTEGKPWRFQTNIY----GNGSTNRGREERY  157

Query  546  NLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD--ATFPQRAMYVYGSIWDASS  373
             LWFDPT+DFH Y+ILW P +IIF+VD+VPIR   R  +  A +P + M +Y +IWDASS
Sbjct  158  RLWFDPTKDFHRYSILWTPEKIIFYVDEVPIREVVRNEEMGADYPSKPMSLYTTIWDASS  217

Query  372  WATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPIPGSPTGSTRL--------SN  217
            WAT  GKYK +Y+Y PF+ ++KD  + GC A+      P        T L        S 
Sbjct  218  WATSGGKYKVNYKYAPFVAEFKDLALEGCPADPIQQIPPAEACAEHYTHLATQDYSVISP  277

Query  216  QQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            Q+ AAM+  ++ +  Y YC ++ R     PEC
Sbjct  278  QRRAAMSRFRQRYMYYSYCYDSLRYPVPPPEC  309



>ref|XP_008220940.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Prunus mume]
Length=335

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 155/270 (57%), Gaps = 19/270 (7%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+  L+G ++  +  D  ++ + LD+   GSGF S   Y  G+  ASIKL A Y 
Sbjct  32   ISFDEGYNKLFGDDNLMIVRDGKSVHLSLDE-RTGSGFVSQDLYHHGFFSASIKLPADYA  90

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN +  PK HDEID EFLG   GK + +QTNVY    G+G    GRE R+N
Sbjct  91   AGVVVAFYMSNGDMFPKNHDEIDFEFLGNIRGKEWRIQTNVY----GNGSTSTGREERYN  146

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSD--ATFPQRAMYVYGSIWDASSW  370
            LWFDP+ DFH Y+ILW  S+IIF+VDDVPIR   R       FP + M +Y +IWD S W
Sbjct  147  LWFDPSDDFHQYSILWTDSQIIFYVDDVPIREVKRTESMGGDFPSKPMSLYATIWDGSDW  206

Query  369  ATENGKYKADYRYQPFIGKYKDFKVTGCAAN----TSTACRPIPGS---PTGSTRLSNQQ  211
            AT  GKY+ +Y+Y P++ ++ D  + GCA +     S  C     S   PTG TRL   Q
Sbjct  207  ATNGGKYRVNYKYAPYLAQFSDLVLHGCAVDPIEHLSKKCDNTQSSESVPTGVTRL---Q  263

Query  210  IAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
               M   +K H  Y YC +  R  +   EC
Sbjct  264  RIKMDSFRKKHMTYSYCYDRIRYKSPPSEC  293



>ref|XP_004297402.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform 2 [Fragaria vesca subsp. vesca]
Length=330

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 160/271 (59%), Gaps = 21/271 (8%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+  L+G ++  +  D  ++ + LD+   GSGF S   Y  G+  ASIKL   YT
Sbjct  25   MSFDEGYNKLFGDDNLMILKDGKSVHLTLDE-RTGSGFVSQDLYIHGFFSASIKLPTDYT  83

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN +  PK HDEID EFLG   GK + +QTNVY    G+G    GRE R+N
Sbjct  84   AGVVVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVY----GNGSTETGREERYN  139

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDAT---FPQRAMYVYGSIWDASS  373
            LWFDP++D+H Y+ILW  S+IIF+VD++PIR   +KS++    +P + M +Y +IWD S 
Sbjct  140  LWFDPSEDYHQYSILWTDSQIIFYVDNIPIRVV-KKSESMGGDYPSKPMSLYATIWDGSG  198

Query  372  WATENGKYKADYRYQPFIGKYKDFKVTGCAAN----TSTACRPIPGS---PTGSTRLSNQ  214
            WAT+ GKY+ +Y+Y PF  ++ D  + GCA +     S  C    GS   PTG TRL   
Sbjct  199  WATDGGKYRVNYKYAPFRAEFSDLVLHGCAVDPIEQVSKKCDKTQGSEYIPTGVTRL---  255

Query  213  QIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            Q   M   +K    Y YC +  R     PEC
Sbjct  256  QRMRMESFRKRQMTYSYCYDRIRYKVAPPEC  286



>gb|ADE42489.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria chiloensis]
Length=324

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 160/271 (59%), Gaps = 21/271 (8%)
 Frame = -2

Query  897  LGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFKSLKSYGSGYIGASIKLQAGYT  724
            + F++G+  L+G ++  +  D  ++ + LD+   GSGF S   Y  G+  ASIKL   YT
Sbjct  25   MSFDEGYNKLFGDDNLMILKDGKSVHLTLDE-RTGSGFVSQDLYIHGFFSASIKLPTDYT  83

Query  723  AGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQTNVYMKGSGDGGNIIGREVRFN  544
            AGV+   Y+SN +  PK HDEID EFLG   GK + +QTNVY    G+G    GRE R+N
Sbjct  84   AGVVVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVY----GNGSTETGREERYN  139

Query  543  LWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKSDAT---FPQRAMYVYGSIWDASS  373
            LWFDP++D+H Y+ILW  S+IIF+VD++PIR   +KS++    +P + M +Y +IWD S 
Sbjct  140  LWFDPSEDYHQYSILWTDSQIIFYVDNIPIRVV-KKSESMGGDYPSKPMSLYATIWDGSG  198

Query  372  WATENGKYKADYRYQPFIGKYKDFKVTGCAAN----TSTACRPIPGS---PTGSTRLSNQ  214
            WAT+ GKY+ +Y+Y PF  ++ D  + GCA +     S  C    GS   PTG TRL   
Sbjct  199  WATDGGKYRVNYKYAPFRAEFSDLVLHGCAVDPIEQVSKKCDKTQGSEYIPTGVTRL---  255

Query  213  QIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
            Q   M   +K    Y YC +  R     PEC
Sbjct  256  QRMRMESFRKRQMTYSYCYDRIRYKVAPPEC  286



>ref|XP_002462345.1| hypothetical protein SORBIDRAFT_02g024120 [Sorghum bicolor]
 gb|EER98866.1| hypothetical protein SORBIDRAFT_02g024120 [Sorghum bicolor]
Length=343

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 165/290 (57%), Gaps = 18/290 (6%)
 Frame = -2

Query  960  SSNNAQAPPSPGYYPSTKVGSLGFNQGFRNLWGPEHQSL--DQGTLSIWLDKTHGGSGFK  787
            S+  A+A P P   P   V  L F++G+  ++G  + +L  D   + + LD++ G +GF 
Sbjct  24   SARGAEARPPP---PLHGVRPLAFDEGYTQIFGSANLALLRDGRRVRLTLDESTG-AGFA  79

Query  786  SLKSYGSGYIGASIKLQAGYTAGVITCLYLSNIEQHPKEHDEIDIEFLGTTPGKPYTLQT  607
            S   +  G+  A+IKL A Y AGV+   YLSN + + K HDE+D EFLG   G+ + +QT
Sbjct  80   SQDVFLHGFFSAAIKLPADYAAGVVVAFYLSNGDVYEKTHDELDFEFLGNVRGREWRVQT  139

Query  606  NVYMKGSGDGGNIIGREVRFNLWFDPTQDFHHYAILWNPSEIIFFVDDVPIRYYPRKS--  433
            NVY    G+G    GRE R++L FDPT DFHHY+ILW    IIF+VD+ PIR   R S  
Sbjct  140  NVY----GNGSTHAGREERYDLPFDPTDDFHHYSILWTNDRIIFYVDETPIREVVRTSAM  195

Query  432  DATFPQRAMYVYGSIWDASSWATENGKYKADYRYQPFIGKYKDFKVTGCAANTSTACRPI  253
             A FP + M +Y +IWD SSWAT  G+Y+ +Y+Y PF+ ++ D  + GCA + +      
Sbjct  196  GAAFPSKPMSLYATIWDGSSWATLGGRYRVNYKYAPFVAEFADLAIQGCAVDPTDLSSAS  255

Query  252  PGSPTG------STRLSNQQIAAMAWVQKNHKEYDYCQNTNRDHTQTPEC  121
              +  G      +  +S +Q+AAMA  ++ H  Y YC +  R      EC
Sbjct  256  AAASCGAGLGALAVSVSAEQLAAMAAFRRAHTSYSYCHDRRRYPVALSEC  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2989120234566