BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24720_g2_i2 len=1743 path=[3777:0-102 2703:103-362 2963:363-442
426:443-470 454:471-495 11593:496-516 3626:517-547 11643:548-586
215:587-636 3416:637-754 3534:755-763 11856:764-844 11937:845-868
11961:869-1152 12245:1153-1193 12286:1194-1239 12332:1240-1275
12368:1276-1468 12561:1469-1494 12586:1495-1518 3675:1519-1566
12656:1567-1742]

Length=1743
                                                                      Score     E

emb|CDP14397.1|  unnamed protein product                                642   0.0      
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     635   0.0      
emb|CDP13790.1|  unnamed protein product                                635   0.0      
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    626   0.0      
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    624   0.0      
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    624   0.0      
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    615   0.0      
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        613   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     612   0.0      
gb|KHG04965.1|  hypothetical protein F383_30444                         607   0.0      
gb|ADU15553.1|  GLU                                                     606   0.0      
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    603   0.0      
gb|AFU52656.1|  beta-1,3-glucanase 23                                   598   0.0      
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            597   0.0      
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         594   0.0      
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    593   0.0      
gb|KHG05496.1|  hypothetical protein F383_30989                         593   0.0      
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    593   0.0      
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    589   0.0      
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     589   0.0      Vitis vinifera
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    588   0.0      
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                588   0.0      
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     587   0.0      
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    585   0.0      
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    583   0.0      
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             582   0.0      
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    581   0.0      
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             581   0.0      
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    580   0.0      
emb|CDY20780.1|  BnaA02g09200D                                          580   0.0      
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               579   0.0      
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    585   0.0      
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     579   0.0      
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               579   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    582   0.0      
emb|CDY36734.1|  BnaA03g11520D                                          578   0.0      
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    578   0.0      
emb|CDY12009.1|  BnaC03g14350D                                          578   0.0      
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        579   0.0      Populus trichocarpa [western balsam poplar]
gb|AAL77689.1|  AT5g55180/MCO15_13                                      578   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY06601.1|  BnaC02g13250D                                          577   0.0      
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     577   0.0      
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    577   0.0      
emb|CDY19908.1|  BnaC09g31740D                                          576   0.0      
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    575   0.0      
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    575   0.0      
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    575   0.0      
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        574   0.0      
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    574   0.0      
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                574   0.0      
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     574   0.0      
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             572   0.0      
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             573   0.0      
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             573   0.0      
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         573   0.0      
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               572   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    572   0.0      
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             570   0.0      
emb|CDY17308.1|  BnaA10g09420D                                          570   0.0      
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     571   0.0      
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    571   0.0      
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        570   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     569   0.0      
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        569   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    569   0.0      
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    568   0.0      
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    567   0.0      
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    568   0.0      
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    567   0.0      
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    567   0.0      
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             567   0.0      
emb|CDP05678.1|  unnamed protein product                                566   0.0      
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    566   0.0      
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    566   0.0      
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    565   0.0      
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     566   0.0      Vitis vinifera
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    565   0.0      
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    565   0.0      Ricinus communis
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     565   0.0      
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     565   0.0      
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             565   0.0      
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     565   0.0      
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  565   0.0      
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             564   0.0      
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    563   0.0      
emb|CDX92794.1|  BnaC07g40520D                                          563   0.0      
emb|CDY46679.1|  BnaA03g48290D                                          562   0.0      
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    563   0.0      
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    562   0.0      
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    561   0.0      
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    561   0.0      
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    565   0.0      
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            560   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    560   0.0      
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    560   0.0      
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        559   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY18049.1|  BnaC07g04210D                                          558   0.0      
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    558   0.0      
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     557   0.0      
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   560   0.0      
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     556   0.0      
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    555   0.0      
emb|CAB36529.1|  putative beta-1, 3-glucanase                           555   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY56498.1|  BnaAnng14330D                                          553   0.0      
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    555   0.0      
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             555   0.0      
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    554   0.0      Ziziphus jujuba [Chinese jujube]
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     554   0.0      
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                554   0.0      
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   553   0.0      
ref|XP_004304085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    553   0.0      
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             551   0.0      
ref|XP_010046177.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    550   0.0      
ref|XP_010046172.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    550   0.0      
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    550   0.0      
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    548   0.0      
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             548   0.0      
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    547   0.0      
gb|EPS59841.1|  hypothetical protein M569_14964                         546   0.0      
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    546   0.0      
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               546   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     546   0.0      
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    545   0.0      
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          544   0.0      
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    544   0.0      
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    543   0.0      
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      542   0.0      
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    542   0.0      Ricinus communis
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  541   0.0      
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    541   0.0      
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    540   0.0      
gb|EPS68573.1|  hypothetical protein M569_06194                         538   0.0      
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             538   0.0      
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             538   0.0      
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                537   0.0      
gb|KHG21190.1|  hypothetical protein F383_01641                         535   0.0      
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    532   0.0      
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    530   5e-180   
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    527   2e-179   
gb|EPS73917.1|  hypothetical protein M569_00835                         525   7e-179   
gb|AAD26909.1|  putative beta-1,3-glucanase                             526   9e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     525   3e-178   
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  521   5e-177   
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  522   6e-177   
gb|KHG21189.1|  hypothetical protein F383_01641                         517   4e-175   
gb|ACN39797.1|  unknown                                                 508   1e-171   Picea sitchensis
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     495   5e-168   
ref|XP_009417707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    495   1e-166   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    493   1e-165   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    491   5e-165   
ref|XP_008788767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    491   7e-165   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    489   9e-164   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    484   5e-162   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                        482   2e-161   
ref|NP_001048260.1|  Os02g0771700                                       479   3e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    475   1e-158   
dbj|BAC53928.1|  beta-1,3-glucanase-like protein                        469   2e-158   Nicotiana tabacum [American tobacco]
ref|XP_004954063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   5e-157   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    467   2e-155   
ref|XP_004954064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   3e-153   
ref|XP_004954062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   2e-152   
gb|ACF79018.1|  unknown                                                 453   3e-150   Zea mays [maize]
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     453   3e-150   Zea mays [maize]
ref|XP_002454630.1|  hypothetical protein SORBIDRAFT_04g034530          451   5e-149   Sorghum bicolor [broomcorn]
gb|ACF88240.1|  unknown                                                 450   7e-149   Zea mays [maize]
gb|ACR35980.1|  unknown                                                 442   9e-146   Zea mays [maize]
dbj|BAJ87688.1|  predicted protein                                      441   2e-145   
dbj|BAF01977.1|  putative beta-1,3-glucanase                            418   5e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502047.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    405   2e-133   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   403   2e-132   
gb|AFK41861.1|  unknown                                                 400   3e-131   
ref|XP_003601410.1|  Glucan endo-1,3-beta-glucosidase                   402   5e-130   
ref|XP_002462968.1|  hypothetical protein SORBIDRAFT_02g035490          405   5e-130   Sorghum bicolor [broomcorn]
ref|XP_002462967.1|  hypothetical protein SORBIDRAFT_02g035480          399   4e-129   Sorghum bicolor [broomcorn]
ref|NP_001151472.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    402   8e-129   Zea mays [maize]
tpg|DAA62996.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    400   4e-128   
tpg|DAA63006.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    400   2e-127   
ref|XP_008653189.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    400   2e-127   
tpg|DAA63007.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    400   7e-127   
ref|XP_004968973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   8e-127   
ref|XP_008670470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    398   2e-126   
gb|EAZ24771.1|  hypothetical protein OsJ_08544                          389   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059878.1|  Os07g0538000                                       391   5e-125   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82195.1|  hypothetical protein OsI_26335                          391   5e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_004968993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   2e-124   
ref|XP_004957929.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    387   3e-124   
gb|KCW70221.1|  hypothetical protein EUGRSUZ_F03494                     380   1e-123   
ref|XP_006658651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    387   1e-123   
ref|XP_002462970.1|  hypothetical protein SORBIDRAFT_02g035520          389   7e-123   Sorghum bicolor [broomcorn]
ref|XP_004968994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   1e-122   
ref|NP_001059886.2|  Os07g0539400                                       384   2e-122   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061351.1|  Os08g0244500                                       385   3e-122   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC84505.1|  putative beta-1,3-glucanase                            384   7e-122   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175238.1|  Os07g0539300                                       382   3e-121   
ref|XP_003562972.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    381   3e-121   
gb|EEE67336.1|  hypothetical protein OsJ_24592                          382   4e-121   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04201.1|  hypothetical protein OsI_26344                          380   6e-121   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90025.1|  predicted protein                                      393   1e-120   
dbj|BAJ92697.1|  predicted protein                                      379   2e-120   
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    375   1e-119   
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     375   2e-119   
ref|XP_008653187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    376   3e-119   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            369   5e-119   Oryza sativa [red rice]
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     372   1e-118   
ref|XP_008653186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    376   4e-118   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         370   1e-117   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    370   1e-117   
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    370   1e-117   
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     370   3e-117   
dbj|BAJ93567.1|  predicted protein                                      371   3e-117   
ref|XP_004968992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    370   4e-117   
gb|EPS64814.1|  hypothetical protein M569_09966                         363   4e-117   
gb|EMT31770.1|  Glucan endo-1,3-beta-glucosidase 13                     370   1e-116   
ref|XP_006658648.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    370   1e-116   
emb|CDM84006.1|  unnamed protein product                                367   1e-116   
gb|KHG26459.1|  hypothetical protein F383_04538                         367   2e-116   
ref|XP_003562973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    369   2e-116   
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    367   2e-116   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             367   2e-116   
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               367   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|EMS51674.1|  Glucan endo-1,3-beta-glucosidase 13                     369   2e-116   
emb|CDY64970.1|  BnaAnng19910D                                          366   4e-116   
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             366   4e-116   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     366   6e-116   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    365   9e-116   Ricinus communis
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          367   1e-115   
emb|CDY32869.1|  BnaC09g33160D                                          365   1e-115   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               365   1e-115   
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    364   2e-115   
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     364   2e-115   
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    364   2e-115   
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    364   2e-115   
emb|CDP03239.1|  unnamed protein product                                364   3e-115   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    364   3e-115   
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    363   3e-115   
gb|EMS58549.1|  Glucan endo-1,3-beta-glucosidase 13                     367   4e-115   
ref|XP_004968988.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    369   4e-115   
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     363   5e-115   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     363   6e-115   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    363   6e-115   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    363   6e-115   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     363   7e-115   
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     362   1e-114   
ref|NP_001059883.1|  Os07g0539100                                       364   1e-114   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001144992.1|  uncharacterized protein LOC100278152 precursor     361   2e-114   Zea mays [maize]
gb|AIR93910.1|  glucanase                                               360   2e-114   
ref|XP_010545323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     362   2e-114   
gb|EPS73640.1|  hypothetical protein M569_01113                         362   2e-114   
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...    360   3e-114   
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    361   3e-114   
gb|EMT12040.1|  Glucan endo-1,3-beta-glucosidase 13                     362   3e-114   
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          360   7e-114   Sorghum bicolor [broomcorn]
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     360   8e-114   Vitis vinifera
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     358   9e-114   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     360   1e-113   
dbj|BAJ85556.1|  predicted protein                                      360   1e-113   
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     359   2e-113   
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    358   2e-113   
ref|XP_006401304.1|  hypothetical protein EUTSA_v10013309mg             360   2e-113   
gb|KHG04832.1|  hypothetical protein F383_29565                         359   3e-113   
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        358   4e-113   
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    358   5e-113   
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          357   5e-113   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044198.1|  Os01g0739700                                       357   8e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     357   1e-112   
ref|XP_001780045.1|  predicted protein                                  355   2e-112   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            357   2e-112   
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    362   2e-112   
gb|EEC71452.1|  hypothetical protein OsI_03677                          356   2e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_006657798.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    358   3e-112   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    356   4e-112   
ref|XP_001777261.1|  predicted protein                                  353   7e-112   
gb|EMS65653.1|  Glucan endo-1,3-beta-glucosidase 13                     354   8e-112   
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    356   9e-112   
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    354   2e-111   
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                353   2e-111   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    353   3e-111   
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     353   4e-111   
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             353   5e-111   
gb|EEC82204.1|  hypothetical protein OsI_26347                          355   6e-111   
gb|EMS62685.1|  Glucan endo-1,3-beta-glucosidase 13                     353   3e-110   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     352   3e-110   
emb|CDY14214.1|  BnaA08g13450D                                          351   3e-110   
ref|NP_001059888.1|  Os07g0539900                                       353   8e-110   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              347   1e-109   
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             349   1e-109   
gb|EEE67338.1|  hypothetical protein OsJ_24595                          351   1e-109   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              346   1e-109   
gb|KDO55852.1|  hypothetical protein CISIN_1g010782mg                   347   1e-109   
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           349   2e-109   
gb|ABD91577.1|  beta-1,3-glucanase                                      349   2e-109   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     348   2e-109   
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     348   3e-109   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             347   4e-109   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    348   5e-109   
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    347   5e-109   
gb|ABD91576.1|  beta-1,3-glucanase                                      348   6e-109   
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     347   1e-108   
gb|EEE67335.1|  hypothetical protein OsJ_24590                          347   2e-108   
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    346   2e-108   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     347   2e-108   
gb|EMT25818.1|  Glucan endo-1,3-beta-glucosidase 12                     346   5e-108   
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     345   5e-108   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    346   7e-108   
emb|CDY62033.1|  BnaC03g77660D                                          345   9e-108   
gb|KHG29271.1|  hypothetical protein F383_14120                         346   1e-107   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             343   1e-107   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     340   2e-107   
ref|XP_001767901.1|  predicted protein                                  343   2e-107   
gb|ADE76604.1|  unknown                                                 342   2e-107   
gb|EMS66645.1|  Glucan endo-1,3-beta-glucosidase 3                      346   3e-107   
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    344   3e-107   
ref|XP_002974888.1|  hypothetical protein SELMODRAFT_102117             342   4e-107   
ref|XP_002971086.1|  hypothetical protein SELMODRAFT_94863              342   5e-107   
ref|XP_002963799.1|  hypothetical protein SELMODRAFT_79527              342   6e-107   
gb|EMT01043.1|  Glucan endo-1,3-beta-glucosidase 13                     345   7e-107   
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     342   9e-107   
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    342   1e-106   
gb|ABR16205.1|  unknown                                                 341   1e-106   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             342   2e-106   
ref|XP_002975458.1|  hypothetical protein SELMODRAFT_415534             339   5e-106   
ref|XP_009394833.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    339   5e-106   
ref|XP_002962000.1|  hypothetical protein SELMODRAFT_437861             337   9e-106   
ref|XP_007018100.1|  Glucan endo-1,3-beta-glucosidase, putative         337   2e-105   
gb|EEC82201.1|  hypothetical protein OsI_26343                          339   3e-105   
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    336   5e-105   
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    337   5e-105   
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             336   6e-105   
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    337   6e-105   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                356   6e-105   
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      336   9e-105   
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    335   1e-104   
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    337   1e-104   
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             336   2e-104   
gb|EEC82199.1|  hypothetical protein OsI_26341                          334   2e-104   
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    335   3e-104   
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    335   4e-104   
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    336   4e-104   
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      335   4e-104   
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     333   4e-104   
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           335   5e-104   
ref|XP_001784088.1|  predicted protein                                  334   5e-104   
ref|XP_001761806.1|  predicted protein                                  334   5e-104   
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           335   5e-104   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              333   7e-104   
ref|XP_002265396.3|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    334   8e-104   
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              333   9e-104   
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      334   9e-104   
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    334   1e-103   
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      333   1e-103   
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    332   2e-103   
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      333   2e-103   
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             332   3e-103   
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    332   5e-103   
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             332   5e-103   
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    332   6e-103   
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         332   7e-103   
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        332   9e-103   
ref|XP_002510704.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    330   1e-102   
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    331   1e-102   
emb|CDY48807.1|  BnaC02g34070D                                          330   2e-102   
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    330   2e-102   
ref|XP_006599426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   2e-102   
gb|EMT31766.1|  Glucan endo-1,3-beta-glucosidase 13                     331   3e-102   
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          329   3e-102   
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           329   3e-102   
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      330   4e-102   
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      328   5e-102   
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    328   5e-102   
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          329   6e-102   
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    327   7e-102   
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    329   7e-102   
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        328   7e-102   
emb|CDP00829.1|  unnamed protein product                                329   8e-102   
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    329   9e-102   
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   1e-101   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              327   1e-101   
ref|XP_002272900.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     327   1e-101   
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             327   1e-101   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              327   2e-101   
ref|XP_003626949.1|  Beta-1 3-glucanase                                 327   2e-101   
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   2e-101   
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   2e-101   
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   2e-101   
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   2e-101   
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         327   3e-101   
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   3e-101   
ref|XP_003610449.1|  Glucan endo-1,3-beta-glucosidase                   328   3e-101   
gb|AIR93909.1|  glucanase                                               326   3e-101   
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        327   3e-101   
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    327   4e-101   
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            327   4e-101   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    327   4e-101   
emb|CBI40742.3|  unnamed protein product                                327   4e-101   
gb|KDP38099.1|  hypothetical protein JCGZ_04742                         327   5e-101   
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             327   5e-101   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   328   6e-101   
gb|KHG06295.1|  hypothetical protein F383_32557                         326   8e-101   
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    326   9e-101   
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      326   1e-100   
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    326   1e-100   
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    326   1e-100   
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    326   1e-100   
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    325   2e-100   
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                325   2e-100   
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    326   2e-100   
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             326   2e-100   
ref|XP_010278646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    327   2e-100   
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      325   2e-100   
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     320   2e-100   
ref|XP_010278647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    327   2e-100   
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    325   2e-100   
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             325   2e-100   
ref|XP_003632942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      326   2e-100   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       325   3e-100   
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    324   3e-100   
ref|XP_011034841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    324   3e-100   
gb|KFK41053.1|  hypothetical protein AALP_AA2G079300                    325   3e-100   
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             325   3e-100   
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      325   3e-100   
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    324   3e-100   
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    323   3e-100   
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               325   4e-100   
emb|CBI26850.3|  unnamed protein product                                324   5e-100   
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      324   5e-100   
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    324   5e-100   
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             323   6e-100   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             325   7e-100   
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    324   7e-100   
emb|CDP01635.1|  unnamed protein product                                324   7e-100   
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          323   9e-100   
emb|CDY58676.1|  BnaCnng33550D                                          324   1e-99    
ref|XP_008775310.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   1e-99    
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    322   1e-99    
ref|XP_006386885.1|  3-glucanase family protein                         322   1e-99    
ref|XP_002300634.2|  hypothetical protein POPTR_0002s00860g             322   1e-99    
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             324   1e-99    
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             321   1e-99    
gb|AFU52641.1|  beta-1,3-glucanase 6                                    323   1e-99    
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    322   2e-99    
ref|XP_010094541.1|  Glucan endo-1,3-beta-glucosidase 12                322   2e-99    
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    322   2e-99    
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               324   2e-99    
ref|XP_011046950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      324   2e-99    
gb|KDP36766.1|  hypothetical protein JCGZ_08057                         322   2e-99    
ref|XP_004297451.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    323   2e-99    
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               323   2e-99    
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    323   2e-99    
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    322   2e-99    
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      322   3e-99    
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    321   3e-99    
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             322   3e-99    
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   3e-99    
ref|XP_010470500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    323   3e-99    
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   4e-99    
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  321   4e-99    
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   4e-99    
ref|XP_008384081.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    323   4e-99    
ref|XP_009127476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   5e-99    
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      322   5e-99    
ref|XP_010052861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   5e-99    
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                   321   5e-99    
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      322   6e-99    
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    320   7e-99    
emb|CDY16440.1|  BnaA02g12440D                                          322   7e-99    
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    320   7e-99    
ref|XP_009357466.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   7e-99    
gb|KHN35732.1|  Glucan endo-1,3-beta-glucosidase 1                      322   7e-99    
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             321   7e-99    
ref|XP_010415170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   7e-99    
ref|XP_006391369.1|  hypothetical protein EUTSA_v10018427mg             322   8e-99    
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg             321   8e-99    
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    321   8e-99    
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             321   8e-99    
dbj|BAC80125.1|  putative beta-1,3-glucanase precursor                  321   8e-99    
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   9e-99    
ref|XP_010528550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      321   9e-99    
ref|XP_006600304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   1e-98    
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    320   1e-98    
gb|KHG00665.1|  hypothetical protein F383_20417                         320   1e-98    
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    320   1e-98    
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                   320   1e-98    
ref|NP_179219.4|  O-glycosyl hydrolases family 17 protein               321   1e-98    
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             321   1e-98    
ref|XP_003549783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   1e-98    
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    318   1e-98    
ref|XP_009359235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   1e-98    
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   1e-98    
gb|KHG27056.1|  hypothetical protein F383_08405                         321   2e-98    
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    319   2e-98    
gb|KHG27055.1|  hypothetical protein F383_08405                         322   2e-98    
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             322   2e-98    
ref|XP_003529639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   2e-98    
ref|XP_006584084.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   2e-98    
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   3e-98    
ref|XP_010511554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    320   3e-98    
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             318   3e-98    
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    318   4e-98    
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    319   4e-98    



>emb|CDP14397.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/470 (69%), Positives = 375/470 (80%), Gaps = 46/470 (10%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             GSI INYGR+A+DLPSP  VVQLLK+QG+TKVKLYDTDSTVL ALSGSGIS TVALPNE 
Sbjct  41    GSIAINYGRVANDLPSPPHVVQLLKAQGLTKVKLYDTDSTVLSALSGSGISVTVALPNEL  100

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+AAA QS+TD WVQSNI  Y  K++IE +AVGNEVFVDP NTTP+LVPAMKNVY+SL 
Sbjct  101   LSSAAAGQSYTDSWVQSNIFAYYPKTLIEAIAVGNEVFVDPKNTTPFLVPAMKNVYSSLV  160

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY V+ S+K+SSPI  SA+QTSYP SSGSF+PEL+ PVIKPML+FL+QTGS++M+NAYPF
Sbjct  161   KYNVS-SIKISSPIALSALQTSYPSSSGSFQPELVEPVIKPMLNFLKQTGSYVMVNAYPF  219

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AY ANTD ISLDYA+F D++GV DPNNGLVYKSLF+AQ+DAV+AA+N +     +VV+S
Sbjct  220   FAYTANTDTISLDYALFRDDKGVTDPNNGLVYKSLFEAQLDAVFAAMNTLGFNDVKVVVS  279

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPSKG+ N                  E G AS  NAAAYNGNLVRRVLT GGTPLRP
Sbjct  280   ETGWPSKGDEN------------------EVG-ASQQNAAAYNGNLVRRVLTSGGTPLRP  320

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG--------NRGSK  563
             DEPL+VYLF+LFNENQK+GP SERNYGLFYP+EQKVYDVPLTL AL         N    
Sbjct  321   DEPLNVYLFALFNENQKTGPTSERNYGLFYPSEQKVYDVPLTLEALASAPTASPSNTSRV  380

Query  562   AQVPP---------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
                PP               TWCVA+GDVG E+L+ ALDYACG+GAADC PIQPG+TCYN
Sbjct  381   VTKPPSTSSSGDFFPSTAGQTWCVASGDVGEEKLKAALDYACGEGAADCRPIQPGATCYN  440

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTLVAHASYAFNSYYQKNAR  G+CYFGGA YVV+Q P++GSC++PTGY
Sbjct  441   PNTLVAHASYAFNSYYQKNARRSGSCYFGGAAYVVSQLPKYGSCDYPTGY  490



>ref|XP_011097840.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Sesamum indicum]
Length=467

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/461 (69%), Positives = 370/461 (80%), Gaps = 35/461 (8%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             S SG++G+NYGR+ +DLPSP +VVQLLK+QGITKVKLYDTDSTVL ALSGSGIS  VALP
Sbjct  23    SDSGTVGVNYGRLGNDLPSPPQVVQLLKAQGITKVKLYDTDSTVLSALSGSGISVVVALP  82

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             N QLS+AAASQSFTD W+QSNI+PY   +++E +AVGNEVFVDP NTT +LVPAMKNVYA
Sbjct  83    NNQLSSAAASQSFTDSWIQSNILPYHPNTLVEAIAVGNEVFVDPQNTTSFLVPAMKNVYA  142

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNA  1088
             SL KY VA S+KV+SP+  SA+QTSYP SSGSFK +L+ PVI PML+FL+QTGS+LM+NA
Sbjct  143   SLVKYDVASSIKVTSPVALSALQTSYPSSSGSFKSDLVEPVITPMLNFLKQTGSYLMVNA  202

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRV  908
             YPF+AY ANTDKISLDYA+  +N G VDPNNGLVYKSLFDAQ+DAV+AA+NA+     ++
Sbjct  203   YPFFAYSANTDKISLDYALLRNNSGNVDPNNGLVYKSLFDAQIDAVFAAMNALGFNDVKI  262

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTP  728
             V+SE+GWPSKG+ N                  E G AS  NAAAYNGNLVRRVLTGGGTP
Sbjct  263   VVSETGWPSKGDEN------------------EVG-ASEANAAAYNGNLVRRVLTGGGTP  303

Query  727   LRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-----RGSK  563
             LR +EPL+VYLF+LFNEN+K GP SERNYGLFYPNEQKVY++PLT   L        GSK
Sbjct  304   LRRNEPLNVYLFALFNENEKPGPTSERNYGLFYPNEQKVYNIPLTAEGLAGSPSMMNGSK  363

Query  562   AQV---PP-----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAH  407
             +QV   PP     TWCVAN   G E+LQ ALDYACG+G ADCG IQPG+TCY+PNT+ AH
Sbjct  364   SQVVAQPPSSVGQTWCVANAGAGEEKLQQALDYACGEGGADCGAIQPGATCYDPNTVEAH  423

Query  406   ASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             ASYAFNSYYQ+NARG GTC F GA YVVTQ P+FGSCEFPT
Sbjct  424   ASYAFNSYYQRNARGSGTCDFAGAAYVVTQSPKFGSCEFPT  464



>emb|CDP13790.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/470 (68%), Positives = 373/470 (79%), Gaps = 46/470 (10%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             GS+ INYGR+A+DLPSP +VVQLLK+QG+TKVKLYDTDS VL ALSGSGIS TVALPNEQ
Sbjct  115   GSVAINYGRVANDLPSPPQVVQLLKAQGLTKVKLYDTDSNVLSALSGSGISVTVALPNEQ  174

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+AA  QS+TD WVQSN++ Y  K++IE +AVGNEVFVDP NTTP+LVPAMKNVY+SL 
Sbjct  175   LSSAAGGQSYTDSWVQSNVLAYYPKTLIEAIAVGNEVFVDPKNTTPFLVPAMKNVYSSLV  234

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY V+ ++K+SSPI  SA+QTSYP SSGSFK ELI PVIKPML+FL+QTGS++M+NAYPF
Sbjct  235   KYNVS-AIKISSPIALSALQTSYPSSSGSFKSELIEPVIKPMLNFLKQTGSYVMVNAYPF  293

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AY ANTD ISLDYA+FG+++GV DPNNGLVYKSLF+AQ+DAV+AA+NAV     +V +S
Sbjct  294   FAYTANTDTISLDYALFGNSKGVTDPNNGLVYKSLFEAQLDAVFAAMNAVGFKDVKVAVS  353

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPSKG+ N A                    AS  NAA+YNGNLVRRVLTGGGTPLRP
Sbjct  354   ETGWPSKGDENEAG-------------------ASQQNAASYNGNLVRRVLTGGGTPLRP  394

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG--------NRGSK  563
             DEPL+VYLF+LFNENQK+GP SERNYGLFYP+EQKVYDVPLTL AL         N    
Sbjct  395   DEPLNVYLFALFNENQKTGPTSERNYGLFYPSEQKVYDVPLTLEALARAPTASPSNTSRV  454

Query  562   AQVPP---------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             A  PP               TWCVA+GD G E+L+ ALDYACG+GAADC PIQ G+TCY+
Sbjct  455   ATKPPSTSSGGDFSPSTAGQTWCVASGDAGEEKLKDALDYACGEGAADCRPIQRGATCYS  514

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTLVAHASYAFNSYYQKNAR  G+CYFGGA YVV+Q P++G C +PTGY
Sbjct  515   PNTLVAHASYAFNSYYQKNARRSGSCYFGGAAYVVSQSPKYGRCNYPTGY  564



>ref|XP_004251911.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
lycopersicum]
Length=480

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 370/481 (77%), Gaps = 52/481 (11%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ SGSIGINYGRIA++LP+P++VVQLLKSQGI +VKLYDTDS VL ALSGS IS +VAL
Sbjct  19    IANSGSIGINYGRIANNLPTPSEVVQLLKSQGIHRVKLYDTDSAVLTALSGSNISVSVAL  78

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQLS AA+ QSFTD WVQSNIV Y  K+ IE++AVGNEVFVDP NTT +LVPAMKNVY
Sbjct  79    PNEQLSDAASKQSFTDSWVQSNIVRYYPKTNIESIAVGNEVFVDPNNTTKFLVPAMKNVY  138

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+Q SYP S+GSFK ELI PVIKPMLSFL+Q+GSFL +N
Sbjct  139   ASLVKYGVASSIKVSSPVALSALQNSYPSSAGSFKTELIEPVIKPMLSFLKQSGSFLAVN  198

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ A+     +
Sbjct  199   IYPFFAYVANTDTISLDYALFRDNKGVTDPNNGLVYKSLFEAQIDAVYAAMKALNFDDVK  258

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + I+E+GWPSKG+ N                  ETG AS  NAAAYNGNLV+RVLTG GT
Sbjct  259   MEITETGWPSKGDEN------------------ETG-ASTENAAAYNGNLVKRVLTGSGT  299

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG---NRGSKA  560
             PL+PDEPL+VYLF+LFNENQK GP+SERNYGLFYP+++KVYD+ LTL  L    N GSK+
Sbjct  300   PLKPDEPLNVYLFALFNENQKPGPVSERNYGLFYPSKEKVYDITLTLEGLEAGVNNGSKS  359

Query  559   QVPP---------------------------TWCVANGDVGPERLQVALDYACGQGAADC  461
             QV                             TWCVAN   G E+LQ ALDYACG+G ADC
Sbjct  360   QVVKIPVPSPSSSPSPAPVVGGGVEESKVVNTWCVANEKAGAEKLQAALDYACGEGGADC  419

Query  460   GPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
              PIQPG+TC+NP+TL AHASYAFNSYYQK ARG GTC F GA YVVTQ P++GSC+FPTG
Sbjct  420   RPIQPGATCHNPDTLEAHASYAFNSYYQKKARGTGTCDFKGAAYVVTQHPKYGSCKFPTG  479

Query  280   Y  278
             Y
Sbjct  480   Y  480



>ref|XP_006344865.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=480

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 370/481 (77%), Gaps = 52/481 (11%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ SGSIGINYGR+A++LP+P +VVQLLKSQGI +VKLYDTDS VL ALSGS IS TVAL
Sbjct  19    IANSGSIGINYGRVANNLPTPEEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVAL  78

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQLS AA+ QSFTD WVQSNI+ Y  K+ IE++AVGNEVFVDP NTT +LVPAMKNVY
Sbjct  79    PNEQLSDAASKQSFTDSWVQSNIIRYYPKTNIESIAVGNEVFVDPNNTTKFLVPAMKNVY  138

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+Q SYP SSGSFK +LI PVIKPMLSFL+Q+GSFL +N
Sbjct  139   ASLVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVN  198

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ A+     +
Sbjct  199   IYPFFAYVANTDTISLDYALFRDNKGVTDPNNGLVYKSLFEAQIDAVYAAMKALNFDDVK  258

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + I+E+GWPSKG+ N                  ETG ASA NAAAYNGNLV+RVLTG GT
Sbjct  259   MEITETGWPSKGDEN------------------ETG-ASADNAAAYNGNLVKRVLTGSGT  299

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT---LAALGNRGSKA  560
             PL+PDEPL+VYLF+LFNENQK GP+SERNYGLFYP+++KVYD+ LT   L A  N GSK+
Sbjct  300   PLKPDEPLNVYLFALFNENQKPGPVSERNYGLFYPSKEKVYDIMLTREGLEAGPNNGSKS  359

Query  559   QVPP---------------------------TWCVANGDVGPERLQVALDYACGQGAADC  461
             QV                             TWCVAN   G E+LQ ALDYACG+G ADC
Sbjct  360   QVVKIPVPSPSSSPTPAPVVGGGVEESKVVNTWCVANEKAGTEQLQAALDYACGEGGADC  419

Query  460   GPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
              PIQPG+TC+NP+TL AHASYAFNSYYQK ARG GTC F GA YVVTQ P++GSC+FPTG
Sbjct  420   RPIQPGATCHNPDTLAAHASYAFNSYYQKKARGTGTCDFKGAAYVVTQHPKYGSCKFPTG  479

Query  280   Y  278
             Y
Sbjct  480   Y  480



>ref|XP_006344866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=518

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/474 (67%), Positives = 368/474 (78%), Gaps = 46/474 (10%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             + SGSIG+NYGRIA++LP+P +VVQLLKSQGI +VKLYDTDS VL ALSGS IS TVALP
Sbjct  64    ANSGSIGVNYGRIANNLPTPEEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALP  123

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             NEQLS AA+ QSFTD WVQSNI+ Y  K+ IE++AVGNEVFVDP NTT +LVPAMKNVYA
Sbjct  124   NEQLSDAASKQSFTDSWVQSNIIRYYPKTNIESIAVGNEVFVDPKNTTKFLVPAMKNVYA  183

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNA  1088
             SL KYGVA S+KVSSP+  SA+Q SYP SSGSFK +LI PVIKPMLSFL+Q+GSFL +N 
Sbjct  184   SLVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNI  243

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRV  908
             YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ A+     ++
Sbjct  244   YPFFAYVANTDTISLDYALFRDNKGVTDPNNGLVYKSLFEAQIDAVYAAMKALNFDDVKM  303

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTP  728
              I+E+GWPSKG+ N                  ETG ASA NAAAYNGNLV+RVLTG GTP
Sbjct  304   EITETGWPSKGDEN------------------ETG-ASADNAAAYNGNLVKRVLTGSGTP  344

Query  727   LRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT---LAALGNRGSKAQ  557
             L+PDEPL+VYLF+LFNENQK GP+SERNYGLFYP+++KVYD+ L    L A  N GSK+Q
Sbjct  345   LKPDEPLNVYLFALFNENQKPGPVSERNYGLFYPSKEKVYDITLIREGLEADPNNGSKSQ  404

Query  556   VPPT---------------------WCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
             V  T                     WCVAN   G E+LQ ALDYACG+G ADC PIQPG+
Sbjct  405   VVKTPVPSPASVVGGGVEESKVVNTWCVANEKAGTEQLQAALDYACGEGGADCRPIQPGA  464

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             TC+NP+TL AHASYAFNSYYQK ARG GTC F GA YVVTQ P++GSC+FPTGY
Sbjct  465   TCHNPDTLAAHASYAFNSYYQKKARGTGTCDFKGAAYVVTQHPKYGSCKFPTGY  518



>ref|XP_009595038.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/469 (67%), Positives = 365/469 (78%), Gaps = 40/469 (9%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             V+ SGSIGINYGRIA++LPSPA+VVQLLK+QG+ ++KLYDTDS VL ALSGS IS TVAL
Sbjct  18    VAHSGSIGINYGRIANNLPSPAQVVQLLKTQGVNRIKLYDTDSNVLTALSGSNISVTVAL  77

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQLS AA  QSFTD WVQSNI+ Y  K++IE++AVGNEVFVDP NTT +LVPAMKNVY
Sbjct  78    PNEQLSDAAEKQSFTDSWVQSNILTYYPKTLIESIAVGNEVFVDPKNTTKFLVPAMKNVY  137

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+  SYP S+GSFKP+L+ PVIKPMLSFL+QTGS+LM+N
Sbjct  138   ASLVKYGVAESIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVN  197

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ +V  G   
Sbjct  198   IYPFFAYAANTDTISLDYALFKDNKGVTDPNNGLVYKSLFEAQIDAVYAALKSVGFGDVA  257

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + +SE+GWPSKG+ N A                    A A NAAAYNGNLVRRVLTG GT
Sbjct  258   MAVSETGWPSKGDENEAG-------------------AGADNAAAYNGNLVRRVLTGSGT  298

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-----RGS  566
             PL+P+EPL V+LF+LFNENQK GP SERNYGLFYPNEQKVYD+ LT   LGN      GS
Sbjct  299   PLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKDGLGNGPTMNNGS  358

Query  565   KA-------------QVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
             K+             +V  TWCVAN     E+LQ ALDYACG+G ADC PIQ G+TCY+P
Sbjct  359   KSTVVTAPEPALEASKVGNTWCVANEKAAREKLQAALDYACGEGGADCRPIQQGATCYDP  418

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             +TL AHASYAFNSYYQKN RG GTC F GA YVVTQ P++GSC+FPTGY
Sbjct  419   DTLEAHASYAFNSYYQKNTRGIGTCDFSGAAYVVTQHPKYGSCKFPTGY  467



>dbj|BAB17320.1| elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum]
Length=467

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/469 (67%), Positives = 364/469 (78%), Gaps = 40/469 (9%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             V+ SGSIGINYGRIA++LPSPA+VVQLLK+QG+ ++KLYDTDS VL ALSGS IS TVAL
Sbjct  18    VAHSGSIGINYGRIANNLPSPAQVVQLLKTQGVNRIKLYDTDSNVLTALSGSNISVTVAL  77

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQLS AA  QSFTD WVQSNI+ Y  K++IE++AVGNEVFVDP NTT +LVPAMKNVY
Sbjct  78    PNEQLSDAAEKQSFTDSWVQSNILTYYPKTLIESIAVGNEVFVDPKNTTKFLVPAMKNVY  137

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+  SYP S+GSFKP+L+ PVIKPMLSFL+QTGS+LM+N
Sbjct  138   ASLVKYGVAESIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVN  197

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ AV  G   
Sbjct  198   IYPFFAYAANTDTISLDYALFKDNKGVTDPNNGLVYKSLFEAQIDAVYAALKAVGFGDVA  257

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + +SE+GWPSKG+ N A                    A A NAAAYNGNLVRRVLTG GT
Sbjct  258   MAVSETGWPSKGDENEAG-------------------AGADNAAAYNGNLVRRVLTGSGT  298

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG-----NRGS  566
             PL+P+EPL V+LF+LFNENQK GP SERNYGLFYPNEQKVYD+ LT   LG     N GS
Sbjct  299   PLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKDGLGNGPTMNNGS  358

Query  565   K-------------AQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
             K             ++V  TWCVAN     E+LQ ALDYACG+G ADC PIQ G+TCY+P
Sbjct  359   KSTVVTAPEPALEASKVGNTWCVANEKAAREKLQAALDYACGEGGADCRPIQQGATCYDP  418

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             +TL AHASYAFNSYYQKN RG  TC F GA YVVTQ P++GSC+FPTGY
Sbjct  419   DTLEAHASYAFNSYYQKNTRGVSTCDFSGAAYVVTQHPKYGSCKFPTGY  467



>ref|XP_011095448.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Sesamum indicum]
Length=468

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/486 (66%), Positives = 376/486 (77%), Gaps = 35/486 (7%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSV-SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKV  1514
             M    ++ L +F  LF S+   SV S SGSIGINYGR+AD+LPSP +VVQLLK+QGITKV
Sbjct  1     MEILHIHFLSVFLFLFSSICIQSVFSDSGSIGINYGRVADNLPSPPQVVQLLKTQGITKV  60

Query  1513  KLYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQ-SFTDRWVQSNIVPYK--SIIETV  1343
             KLYDTDSTVL+A SGSGIS TVALPNEQLSAAAA+  SFTD WVQSNI+PY   + IE +
Sbjct  61    KLYDTDSTVLNAFSGSGISVTVALPNEQLSAAAAANTSFTDSWVQSNILPYHPNTKIEAI  120

Query  1342  AVGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFK  1163
             AVGNEVFVDP NTTP+LVPAMKNVYASL KYGVA S+K+SSP+  SA+Q+SYP SSGSFK
Sbjct  121   AVGNEVFVDPKNTTPFLVPAMKNVYASLVKYGVASSIKISSPVALSALQSSYPSSSGSFK  180

Query  1162  PELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLV  986
             P+LI PVIKPML+FL++TGS+LM+NAYPF+AY ANTD ISLDYA+F +N G  D NNGL+
Sbjct  181   PDLIEPVIKPMLNFLKETGSYLMVNAYPFFAYSANTDTISLDYALFRNNSGSKDANNGLL  240

Query  985   YKSLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGET  806
             YKSLF+AQ+DAVYAA+ A+     ++V++E+GWPSKG+ N                  E 
Sbjct  241   YKSLFEAQIDAVYAAMAALGFNDVKMVVTETGWPSKGDEN------------------EV  282

Query  805   GPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYP  626
             G +SA NAAAYNGNLVRRVLTGGGTPLRPDEPL+VYLF+LFNENQK GP SERNYGLFYP
Sbjct  283   G-SSAENAAAYNGNLVRRVLTGGGTPLRPDEPLNVYLFALFNENQKPGPTSERNYGLFYP  341

Query  625   NEQKVYDVPLTLAALG------NRGSKAQVPP-----TWCVANGDVGPERLQVALDYACG  479
             N+QKVY++PLT+  L       +       PP     TWCVA+   G E+LQ  ++YACG
Sbjct  342   NQQKVYEIPLTVEGLKGASPTMDETEVMAQPPRKLGQTWCVASEKAGEEKLQKGIEYACG  401

Query  478   QGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGS  299
             +G ADC  IQPG TCYNP+TL  HASYAFNS+YQKN R  G C FGGA YVVT PPR GS
Sbjct  402   EGGADCRAIQPGGTCYNPSTLHFHASYAFNSFYQKNFRQSGACDFGGAAYVVTHPPRLGS  461

Query  298   CEFPTG  281
             CEFPTG
Sbjct  462   CEFPTG  467



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/481 (63%), Positives = 365/481 (76%), Gaps = 39/481 (8%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             +  S+ + L    VSGSGS+GINYGR+A++LPSP KVV+LLKSQGI KVKLYDTD+TVL 
Sbjct  8     LLVSIIVLLSAIVVSGSGSVGINYGRVANNLPSPEKVVELLKSQGINKVKLYDTDATVLT  67

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             AL+ SGI+  VALPNE LS+ AA QSF D WV++NI  +  K+ IE +AVGNEVFVDPAN
Sbjct  68    ALADSGITVVVALPNELLSSTAADQSFADNWVEANITKFYPKTKIEAIAVGNEVFVDPAN  127

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPML  1130
             TT YLVPAMKN++ASL K  +  ++K+SSPI FSA++TSYP S+GSFKPELI PVIKPML
Sbjct  128   TTKYLVPAMKNIHASLVKSKLDSAIKISSPIAFSALKTSYPSSAGSFKPELIEPVIKPML  187

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL+QTGS+LM+NAYPF+AY AN+D+ISLDYA+F DN GVVD  NGL Y SL +AQ+DAV
Sbjct  188   DFLKQTGSYLMVNAYPFFAYSANSDQISLDYALFKDNPGVVDSGNGLKYSSLLEAQIDAV  247

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             +AA++A+K    ++V++E+GWPS G+ +                  E G A+  NAA+YN
Sbjct  248   FAAMSAIKYDDVKMVVTETGWPSMGDED------------------EIG-ANESNAASYN  288

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
             GNLVR+VLTG GTPLRP +PL+VYLF+LFNENQK GP SERNYGLFYPNEQKVY++PLT 
Sbjct  289   GNLVRKVLTGNGTPLRPQDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQKVYNIPLTK  348

Query  589   AA-----------------LGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADC  461
                                +    SKA+V  TWCVANG    ++LQ ALDYACG+G ADC
Sbjct  349   EEAKTGESTPVNSNTSQVPVAGEVSKAKVGQTWCVANGKADEKKLQAALDYACGEGKADC  408

Query  460   GPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
              PIQPG+TCYNPNTL AHASYAFNSYYQKN R  GTC FGGA YVV+Q P +G+CEFPTG
Sbjct  409   SPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGTCEFGGAAYVVSQRPTYGNCEFPTG  468

Query  280   Y  278
             +
Sbjct  469   H  469



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/481 (63%), Positives = 365/481 (76%), Gaps = 39/481 (8%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             +  S+ + L    VSGSGS+GINYGR+A++LPSP KVV+LLKSQGI KVKLYDTD+TVL 
Sbjct  8     LLVSIIVLLSAIVVSGSGSVGINYGRVANNLPSPEKVVELLKSQGINKVKLYDTDATVLT  67

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             AL+ SGI+  VALPNE LS+ AA QSF D WV++NI  +  K+ IE +AVGNEVFVDPAN
Sbjct  68    ALADSGITVVVALPNELLSSTAADQSFADNWVEANITKFYPKTKIEAIAVGNEVFVDPAN  127

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPML  1130
             TT YLVPAMKN++ASL K  +  ++K+SSPI FSA++TSYP S+GSFKPELI PVIKPML
Sbjct  128   TTKYLVPAMKNIHASLVKSKLDSAIKISSPIAFSALKTSYPSSAGSFKPELIEPVIKPML  187

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL+QTGS+LM+NAYPF+AY AN+D+ISLDYA+F DN GVVD  NGL Y SL +AQ+DAV
Sbjct  188   DFLKQTGSYLMVNAYPFFAYSANSDQISLDYALFKDNPGVVDSGNGLKYSSLLEAQIDAV  247

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             +AA++A+K    ++V++E+GWPS G+ +                  E G AS  NAA+YN
Sbjct  248   FAAMSAIKYDDVKMVVTETGWPSMGDED------------------EIG-ASESNAASYN  288

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
             GNLVR+VLTG GTPLRP +PL+VYLF+LFNEN+K GP SERNYGLFYPNEQKVY++PLT 
Sbjct  289   GNLVRKVLTGNGTPLRPQDPLNVYLFALFNENKKPGPTSERNYGLFYPNEQKVYNIPLTK  348

Query  589   AA-----------------LGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADC  461
                                +    SKA+V  TWCVANG    ++LQ ALDYACG+G ADC
Sbjct  349   EEAKTGQSTPVNSNTSQVPVAGEVSKAKVGQTWCVANGKADEKKLQAALDYACGEGKADC  408

Query  460   GPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
              PIQPG+TCYNPNTL AHASYAFNSYYQKN R  GTC FGGA YVV+Q P +GSCEFPTG
Sbjct  409   SPIQPGATCYNPNTLEAHASYAFNSYYQKNTRVTGTCEFGGAAYVVSQRPTYGSCEFPTG  468

Query  280   Y  278
             +
Sbjct  469   H  469



>ref|XP_009794437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
sylvestris]
Length=475

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/477 (66%), Positives = 362/477 (76%), Gaps = 48/477 (10%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             V+ SGSIGINYGRIA++LP PA+VVQLLK+QG+ +VKLYDTDS VL ALSGS IS TVAL
Sbjct  18    VAHSGSIGINYGRIANNLPPPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVAL  77

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQL+ AA  QSFTD WVQSNI+ Y  K+ IE++AVGNEVFVDP NTT +LVPAMKN+Y
Sbjct  78    PNEQLADAAGKQSFTDSWVQSNILTYYPKTQIESIAVGNEVFVDPKNTTKFLVPAMKNMY  137

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+  SYP S+GSFKP+L+ PVIKPMLSFL+QTGS+LM+N
Sbjct  138   ASLVKYGVAQSIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVN  197

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ AV  G   
Sbjct  198   IYPFFAYAANTDTISLDYALFKDNKGVTDPNNGLVYKSLFEAQIDAVYAAMKAVGFGDVA  257

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + +SE+GWPSKG+ N A                    A A NAAAYNGNLVRRVLTG GT
Sbjct  258   MAVSETGWPSKGDENEAG-------------------AGADNAAAYNGNLVRRVLTGSGT  298

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-----RGS  566
             PL+P+EPL V+LF+LFNENQK GP SERNYGLFYPNEQKVYD+ LT   L N      GS
Sbjct  299   PLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKEGLENGPTMNNGS  358

Query  565   K---------------------AQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQ  449
             K                     ++V  TWCVAN     E+LQ ALDYACG+G ADC PIQ
Sbjct  359   KNTVVTAPEPAAAPVSGGDVEASKVGNTWCVANEKAAREKLQAALDYACGEGGADCRPIQ  418

Query  448   PGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              G+TCY+P+TL AHASYAFNSYYQKN RG GTC F GA YVVTQ P++GSC+FPTGY
Sbjct  419   QGATCYDPDTLEAHASYAFNSYYQKNTRGVGTCDFNGAAYVVTQHPKYGSCKFPTGY  475



>gb|AFU52656.1| beta-1,3-glucanase 23 [Solanum tuberosum]
Length=473

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/470 (66%), Positives = 358/470 (76%), Gaps = 52/470 (11%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ SGSIGINYGRIA++LP+P++VVQLLKSQGI +VKLYDTDS VL ALSGS IS TVAL
Sbjct  19    IANSGSIGINYGRIANNLPTPSEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVAL  78

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQLS AA+ QSFTD WVQSNI+ Y  K+ IE++AVGNEVFVDP NTT +LVPAMKNVY
Sbjct  79    PNEQLSDAASKQSFTDSWVQSNILRYYPKTNIESIAVGNEVFVDPKNTTKFLVPAMKNVY  138

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+Q SYP SSGSFK +LI PVIKPMLSFL+Q+GSFL +N
Sbjct  139   ASLVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVN  198

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGL+YKSLF+AQ+DAVYAA+ A+     +
Sbjct  199   IYPFFAYVANTDTISLDYALFRDNKGVTDPNNGLIYKSLFEAQIDAVYAAMKALNFDDVK  258

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + I+E+GWPSKG+                  + ETG ASA NAAAYNGNLV+RVLTG GT
Sbjct  259   MEITETGWPSKGD------------------EKETG-ASADNAAAYNGNLVKRVLTGSGT  299

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT---LAALGNRGSKA  560
             PL+PDEPL+VYLF+LFNENQK GP+SERNYGLFYP ++KVYD+ LT   L A  N GSK+
Sbjct  300   PLKPDEPLNVYLFALFNENQKPGPVSERNYGLFYPTKEKVYDITLTQEGLEAGPNNGSKS  359

Query  559   QVPP---------------------------TWCVANGDVGPERLQVALDYACGQGAADC  461
             QV                             TWCVAN   G E+LQ ALDYACG+G ADC
Sbjct  360   QVVKTPVPSPSSTPTPAPVVGGGVEESKVVNTWCVANEKAGAEQLQAALDYACGEGGADC  419

Query  460   GPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
              PIQ G+TC+NP+TL AHASYAFNSYYQK ARG GTC F GA YVVTQ P
Sbjct  420   RPIQQGATCHNPDTLAAHASYAFNSYYQKKARGTGTCDFKGAAYVVTQHP  469



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/493 (61%), Positives = 371/493 (75%), Gaps = 41/493 (8%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSV--SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITK  1517
             + F ++ S+   A   L LL  ++  S + SIGINYGR+A+DLPSP KVV+LLKS G+ K
Sbjct  2     LCFFQVQSMAYQAFSLLVLLLSAIGFSDASSIGINYGRVANDLPSPDKVVELLKSIGVEK  61

Query  1516  VKLYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETV  1343
             VKLYDTD+TVL AL+ SGIS  VALPNE L++AAA QSF D WVQSNI  +   + IE +
Sbjct  62    VKLYDTDATVLTALANSGISVMVALPNELLASAAADQSFADNWVQSNISKFYPATKIEAI  121

Query  1342  AVGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFK  1163
             AVGNEVFVDP NTT Y+VPAMKNV+ASL K+ +  ++K+SSPI  SA+Q SYP S+GSFK
Sbjct  122   AVGNEVFVDPKNTTSYVVPAMKNVHASLVKFNLDSNIKISSPIALSALQNSYPSSAGSFK  181

Query  1162  PELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLV  986
             P+L+ PVIKPML FL+QT S+LM+NAYPF+AY AN+D+ISLDYA+F +N GVVD  +GL 
Sbjct  182   PDLVEPVIKPMLDFLKQTDSYLMVNAYPFFAYSANSDQISLDYALFKENPGVVDSGSGLK  241

Query  985   YKSLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGET  806
             Y SLF+AQ+DAV+AA++A+K    ++V++E+GWPS G+ N                  E 
Sbjct  242   YNSLFEAQIDAVFAAMSALKYDDVKMVVTETGWPSMGDEN------------------EI  283

Query  805   GPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYP  626
             G AS  NAA+YNGNLVRRVL+G GTPLRP +PL+VYLF+LFNENQKSGP SERNYGLFYP
Sbjct  284   G-ASEANAASYNGNLVRRVLSGNGTPLRPQDPLNVYLFALFNENQKSGPTSERNYGLFYP  342

Query  625   NEQKVYDVPLTLAALGN------RGSKAQVPPT-----------WCVANGDVGPERLQVA  497
             NEQKVY++PLT   L +       G+ +QVP T           WCVAN + G + LQ A
Sbjct  343   NEQKVYNIPLTKEELESGQSTPVNGNTSQVPATGEVSKTSVGQTWCVANKNAGEKTLQAA  402

Query  496   LDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQ  317
             LDYACG+G ADC PIQPG+TCY+PNTL AHASYAFNSYYQK  RG GTC FGGA YVV+Q
Sbjct  403   LDYACGEGGADCKPIQPGATCYSPNTLDAHASYAFNSYYQKKTRGTGTCDFGGAAYVVSQ  462

Query  316   PPRFGSCEFPTGY  278
             PPR+G+CEFPTGY
Sbjct  463   PPRYGNCEFPTGY  475



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/464 (64%), Positives = 356/464 (77%), Gaps = 39/464 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G IG+NYGRIA++LP+P KVV+LLKSQGI + KLYDTDSTVL AL+ SGIS  VALPNE
Sbjct  20    TGKIGVNYGRIANNLPTPEKVVELLKSQGINRAKLYDTDSTVLTALANSGISVVVALPNE  79

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++ AA QSF D+WVQ+NI  Y  ++ IE +AVGNEVFVDP NTT +LVPAMKNVY SL
Sbjct  80    LLASTAADQSFADKWVQANISQYYPQTQIEAIAVGNEVFVDPNNTTKFLVPAMKNVYNSL  139

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K+  + S+K+SSPI  SA+Q+SYP S+GSFKP+L+PV+KPML FL Q+GS+LM+NAYPF
Sbjct  140   VKFNHS-SIKISSPIALSALQSSYPSSAGSFKPDLVPVMKPMLEFLRQSGSYLMINAYPF  198

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AY AN+ +ISLDYA+F +N GVVD  +GL Y SL +AQ+DAV+AA++A++    ++V++
Sbjct  199   FAYSANSKEISLDYALFKENPGVVDSGSGLKYNSLLEAQLDAVFAAMSAIQYSDVKMVVT  258

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPS G+ +                  E G A   NAA+YNGNLV+RVLTG GTPLRP
Sbjct  259   ETGWPSMGDED------------------EIG-AGEENAASYNGNLVKRVLTGNGTPLRP  299

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR------GSKAQ  557
              +PL+VYLF+LFNENQK GP SERNYGLFYPNEQKVYD+PLT   L N       G+K+Q
Sbjct  300   QDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQKVYDIPLTQKELVNSQSTPVSGNKSQ  359

Query  556   VP-----------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
             VP            TWCVANG+ G ERLQ  LDYACG GAADC PIQ G+TCYNPNTL A
Sbjct  360   VPVTGEVSKTSVGQTWCVANGNSGKERLQAGLDYACGDGAADCRPIQEGATCYNPNTLEA  419

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             HASYAFNSYYQK AR  GTC FGGA YVVTQPPR+G+CEFPTGY
Sbjct  420   HASYAFNSYYQKKARAAGTCSFGGAAYVVTQPPRYGNCEFPTGY  463



>ref|XP_010063042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Eucalyptus 
grandis]
 gb|KCW70222.1| hypothetical protein EUGRSUZ_F03495 [Eucalyptus grandis]
Length=456

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/482 (63%), Positives = 360/482 (75%), Gaps = 37/482 (8%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA P    L +  S+F      +++ SGS+G+N+GR+A+DLP PAKVV+LLKSQGIT VK
Sbjct  1     MASPAFSCLLLLVSIF------ALAESGSVGLNWGRVANDLPPPAKVVELLKSQGITLVK  54

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             LYDT    L AL+GSGIS  VALPNEQLS+AA++QSFTD WVQSNI  Y   + I  +AV
Sbjct  55    LYDTYDGALTALAGSGISVVVALPNEQLSSAASAQSFTDSWVQSNISKYYPSTKIVAIAV  114

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVFVDP NTT +LVPAM NV+ASL KY ++  + VSSPI  SA+QTSYP SSGSFK +
Sbjct  115   GNEVFVDPNNTTDFLVPAMNNVHASLVKYNLS-DISVSSPIALSALQTSYPTSSGSFKSD  173

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L+ PVIKPML FL +TGS+LM+N YPF+AY AN+D+ISLDYA+   N GVVD  NGL Y 
Sbjct  174   LVEPVIKPMLEFLRKTGSYLMVNVYPFFAYTANSDQISLDYALLKQNPGVVDSGNGLKYN  233

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SLFDAQVDAVYAA++A++    ++V++E+GWPSKG+ N                  E G 
Sbjct  234   SLFDAQVDAVYAAMSALQYNDLKLVVTETGWPSKGDAN------------------EVG-  274

Query  799   ASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNE  620
             A   NAAAYNGNLVRR LTG GTPLRP+  + VYLF+LFNENQK+GP SERNYGLFYP+E
Sbjct  275   AGTQNAAAYNGNLVRRALTGTGTPLRPNNTVDVYLFALFNENQKTGPTSERNYGLFYPDE  334

Query  619   QKVYDVPLTLAALG---NRGSKAQVPP-----TWCVANGDVGPERLQVALDYACGQGAAD  464
             QKVY +PLTL  L    N  SKAQVP      TWCVANG  G ++LQ ALDYACG+G AD
Sbjct  335   QKVYSIPLTLEQLASDPNNASKAQVPTAPVGQTWCVANGKAGAKKLQAALDYACGKGGAD  394

Query  463   CGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             C PIQ GS CYNPNTL AHASYAFNSYYQKNARG GTC FGGA +VVTQ P +G C+FPT
Sbjct  395   CQPIQQGSACYNPNTLEAHASYAFNSYYQKNARGAGTCNFGGAAFVVTQVPEYGECDFPT  454

Query  283   GY  278
             GY
Sbjct  455   GY  456



>gb|KHG05496.1| hypothetical protein F383_30989 [Gossypium arboreum]
Length=469

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/487 (61%), Positives = 359/487 (74%), Gaps = 47/487 (10%)
 Frame = -3

Query  1672  YSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDS  1493
             +SL + ++LF+      V+  GSIG+NYGRIA++LPS  KVV+LLKS G+ +VK+YDTD 
Sbjct  8     FSLLLISALFI------VADCGSIGVNYGRIANNLPSATKVVELLKSHGLNRVKVYDTDP  61

Query  1492  TVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFV  1319
              VL ALSGSGI  TV LPNEQL AAA S SF + WVQ N+  Y   + IE +AVGNEVFV
Sbjct  62    AVLHALSGSGIKVTVDLPNEQLFAAAKSTSFANSWVQRNVAAYYPHTEIEAIAVGNEVFV  121

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVI  1142
             DP NTT +LVPAMKN++ +L K  +   +K+SSPI  SA+Q SYP S+GSF+PELI PV 
Sbjct  122   DPHNTTKFLVPAMKNIHQALVKSNLHSDIKISSPIALSALQNSYPSSAGSFRPELIEPVF  181

Query  1141  KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQ  962
             KPML+FL QTGSFLM+NAYPF+AYE+NTD ISLDYA+F +N GVVD  NGL Y SLFDAQ
Sbjct  182   KPMLNFLRQTGSFLMVNAYPFFAYESNTDVISLDYALFRENPGVVDAGNGLRYFSLFDAQ  241

Query  961   VDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNA  782
             +DAV+AA++A+K    R+V++E+GWPSKG+ N                  E G AS  NA
Sbjct  242   IDAVFAAMSALKYDDIRLVVTETGWPSKGDEN------------------EIG-ASVENA  282

Query  781   AAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDV  602
             AAYNGNLVRR+LTGGGTPLRP   L+VYLF+LFNEN K GP SERNYGLFYP E+KVYD+
Sbjct  283   AAYNGNLVRRILTGGGTPLRPKADLTVYLFALFNENNKVGPTSERNYGLFYPTEEKVYDI  342

Query  601   PLTLAAL-----------------GNRG--SKAQVPPTWCVANGDVGPERLQVALDYACG  479
             P T+  L                 G +G  SK+    TWCVANG+ G E+LQ ALD+ACG
Sbjct  343   PFTVEGLKNYHDRRSPVAGNQPVNGGKGGVSKSTTGNTWCVANGEAGKEKLQAALDFACG  402

Query  478   QGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGS  299
             +G ADC PIQPG+TCY+PNTL AHAS+AFNSYYQKN R  GTCYFGGA YVVTQPP++G 
Sbjct  403   EGGADCHPIQPGATCYDPNTLEAHASFAFNSYYQKNGRHMGTCYFGGAAYVVTQPPKYGD  462

Query  298   CEFPTGY  278
             CEFPTGY
Sbjct  463   CEFPTGY  469



>ref|XP_004497650.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Cicer arietinum]
 gb|AIR93907.1| glucanase [Cicer arietinum]
Length=468

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/471 (63%), Positives = 359/471 (76%), Gaps = 42/471 (9%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             S S +GS+GINYGR+A++LP+P KVV+LLKSQGI +VKLYDTD+TVL AL+ SGI+ TVA
Sbjct  18    SSSEAGSVGINYGRVANNLPTPTKVVELLKSQGINRVKLYDTDATVLTALANSGINVTVA  77

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNV  1271
             +PNE LSAAAA QSFTD W+Q+NI+ Y   + IE +AVGNEVFVDP NTT YLVPAMKNV
Sbjct  78    MPNELLSAAAADQSFTDTWLQANIIKYYPSTQIEAIAVGNEVFVDPQNTTNYLVPAMKNV  137

Query  1270  YASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLML  1094
             +ASL K  +  ++K+SSPI  SA+Q+SYP SSGSFKPELI PVIKPML FL QTGS+LM+
Sbjct  138   HASLVKQNLDNAIKISSPIALSALQSSYPTSSGSFKPELIEPVIKPMLEFLRQTGSYLMV  197

Query  1093  NAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF  914
             NAYPF+AY AN+D ISLDYA+F +N GV+D  NGL Y +LFDAQ+DAV AA++A++    
Sbjct  198   NAYPFFAYAANSDTISLDYALFKENPGVIDSGNGLKYNNLFDAQIDAVNAAMSALQYDDV  257

Query  913   RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGG  734
             +V +SE+GWPS G+ N     G                    NAA+YNGNLVR VL G G
Sbjct  258   KVTVSETGWPSLGDNNEIGAGGD-------------------NAASYNGNLVRHVLNGSG  298

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS----  566
             TPLRP +PL+V+LF+LFNENQK+GP SERNYGLFYP+E+KVYD+PLT+A + N+ S    
Sbjct  299   TPLRPRDPLNVFLFALFNENQKTGPTSERNYGLFYPSEEKVYDIPLTVAQV-NKSSLSPP  357

Query  565   ----KAQVPPT-----------WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
                 ++QVP T           WCVA+GD   E++Q ALDYACG+G ADC PIQPG+ CY
Sbjct  358   SGTGRSQVPVTGDVSPSNAGVTWCVASGDTSEEKVQHALDYACGEGGADCAPIQPGAMCY  417

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             NPNTL AHASYAFNSYYQK +RG GTC FGGA YVVTQ PR+G CEFPTGY
Sbjct  418   NPNTLEAHASYAFNSYYQKKSRGVGTCDFGGAAYVVTQAPRYGKCEFPTGY  468



>ref|XP_010675772.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/460 (64%), Positives = 354/460 (77%), Gaps = 35/460 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G IGINYGRIA+DLP+P KVVQLLK+QG++++KLYDTDS VL A S SGIS TVALPNE
Sbjct  24    TGKIGINYGRIANDLPTPVKVVQLLKTQGVSRIKLYDTDSDVLKAFSNSGISLTVALPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L+AAAASQSFTD WVQ+NIVP+   S +  +AVGNE  VDP N T Y+ PAM NV+ASL
Sbjct  84    NLTAAAASQSFTDTWVQTNIVPFHPGSNLVAIAVGNEANVDP-NITSYVTPAMSNVHASL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +   +K+SSPI FSA+Q SYP SSGSFK EL+ P IKPML FL++T S++M+NAYP
Sbjct  143   QKYSLDDKIKISSPISFSALQNSYPSSSGSFKQELLEPFIKPMLEFLKKTSSYMMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY +N+D+ISLDYA+F  N GVVD  NGL Y+SLF+AQ+DAVYAA++A+K    ++V+
Sbjct  203   FFAYSSNSDEISLDYALFKPNAGVVDSGNGLKYESLFEAQLDAVYAAMDALKFNDLKIVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS+G+ N                 G +GP    NAAAYNGNL +RVLTGGGTPLR
Sbjct  263   TETGWPSQGDENEV---------------GASGP----NAAAYNGNLAKRVLTGGGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG---------NRG  569
             P++PL VYLF+LFNENQK GP SERNYGLFYPNEQKVY+VPLT A +G         N G
Sbjct  304   PNDPLDVYLFALFNENQKPGPTSERNYGLFYPNEQKVYNVPLTAAQIGDAAVAPASANNG  363

Query  568   SKAQVPPT---WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
             SK  VPPT   WCVAN   G E+LQ  L++ACG+G ADC PIQPG+TCYNP TLVAHASY
Sbjct  364   SKVVVPPTGQTWCVANEQAGEEKLQDGLNWACGEGKADCRPIQPGATCYNPGTLVAHASY  423

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             AFNSYYQ  AR  GTC FGGA +VVTQ P+FGSC+FPTGY
Sbjct  424   AFNSYYQMKARSTGTCDFGGAAHVVTQSPQFGSCKFPTGY  463



>ref|XP_002278044.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
 emb|CBI26687.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/490 (62%), Positives = 365/490 (74%), Gaps = 46/490 (9%)
 Frame = -3

Query  1669  SLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDST  1490
             ++ IFA LFL        G GS+ +NYGRIA+DLP PA+VV+LLK+QGI KVKL+D DST
Sbjct  2     AILIFAFLFLLSFSSPSEGGGSVAVNYGRIANDLPQPAQVVELLKAQGINKVKLFDADST  61

Query  1489  VLDALSGSGISTTVALPNEQLSAAAASQ-SFTDRWVQSNIVPYK--SIIETVAVGNEVFV  1319
             VL AL+ SG+S  VALPNE LS+AAA+  SF+++WVQ+NI  Y   + IE +AVGNEVFV
Sbjct  62    VLTALANSGVSVVVALPNELLSSAAATDGSFSEKWVQTNIAQYHPSTQIEAIAVGNEVFV  121

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VI  1142
             DP NTT +LVPAM NVY SL K+ ++ S+K+SSP+  SA+ +SYPPS+G FKPELI  V+
Sbjct  122   DPNNTTQFLVPAMNNVYKSLVKHNLS-SIKISSPVALSALNSSYPPSAGVFKPELIETVM  180

Query  1141  KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVF-GDNQGVVDPNNGLVYKSLFDA  965
             KPML FL +T S+LM+NAYPF+AY AN+D ISLDYA+F   N  V DP NGL Y SLF+A
Sbjct  181   KPMLEFLRKTSSYLMVNAYPFFAYSANSDVISLDYALFRAVNANVTDPGNGLSYSSLFEA  240

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAVYAA++ ++     VV++E+GWPSKG+ N                  E G AS  N
Sbjct  241   QLDAVYAAMSNIQYNDVPVVVTETGWPSKGDEN------------------EIG-ASTDN  281

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNL++RVLTGGGTPLRP+EPL+VYLF+LFNENQK+GP SERNYGLFYPN++KVY+
Sbjct  282   AAAYNGNLIKRVLTGGGTPLRPNEPLNVYLFALFNENQKTGPTSERNYGLFYPNKEKVYN  341

Query  604   VPLTLAALGN------RGSKAQV--PPT-------------WCVANGDVGPERLQVALDY  488
             +PLT+ AL         GSK QV  PPT             WCVANG+ G E+LQ  LDY
Sbjct  342   IPLTMEALKATGSTPINGSKVQVTSPPTASEEVTTAAVGQTWCVANGEAGAEKLQAGLDY  401

Query  487   ACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPR  308
             ACG+G ADC PIQ GSTCYNPNTL AHASYAFNSYYQKN RG GTC FGGA +VVTQ P+
Sbjct  402   ACGEGGADCRPIQEGSTCYNPNTLEAHASYAFNSYYQKNTRGAGTCNFGGAAHVVTQTPK  461

Query  307   FGSCEFPTGY  278
             FG+CEFPTGY
Sbjct  462   FGNCEFPTGY  471



>ref|XP_010252551.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Nelumbo 
nucifera]
Length=477

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/495 (61%), Positives = 360/495 (73%), Gaps = 43/495 (9%)
 Frame = -3

Query  1690  MAFPRLYSLCIFA-SLFLSLLRH-SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITK  1517
             + F R  S+  F  S FL +L   + + +G+IGINYGR+A++LPS  KVVQLLKSQ +T+
Sbjct  2     LCFSRKQSMERFTISFFLLILSMLATADAGTIGINYGRVANNLPSAMKVVQLLKSQRLTR  61

Query  1516  VKLYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETV  1343
             VKLYDTD  VL A +GSGI   VALPNEQL AAA  +SF D WVQ NI  Y   + I  +
Sbjct  62    VKLYDTDPAVLKAFAGSGIDVVVALPNEQLYAAAKRRSFADTWVQKNIAAYHPDTQIHAI  121

Query  1342  AVGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFK  1163
             AVGNEVFVDP NTT +LVPAM+NV+A+L KY +  ++KVSSPI  SA+Q+SYP S+GSFK
Sbjct  122   AVGNEVFVDPHNTTEFLVPAMRNVHAALVKYNLDSAIKVSSPIALSALQSSYPSSAGSFK  181

Query  1162  PELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLV  986
              EL+ PVIKPML F  QTGS+LM+NAYPF+AY AN+D ISLDYA+F +N GVVD  NGL 
Sbjct  182   TELVEPVIKPMLDFFRQTGSYLMVNAYPFFAYAANSDVISLDYALFRNNPGVVDSGNGLR  241

Query  985   YKSLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGET  806
             Y SLF+AQ+DAV+AA++A+K    ++V++E+GWPSKG+ N                  ET
Sbjct  242   YFSLFEAQIDAVFAAMSALKYDDIKMVVTETGWPSKGDEN------------------ET  283

Query  805   GPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYP  626
             G A+  NAAAYNGNLVRRVL GGGTPLRP E L VYLF+LFNEN+K GP SERNYGLFYP
Sbjct  284   G-ANEENAAAYNGNLVRRVLAGGGTPLRPQEDLDVYLFALFNENKKPGPTSERNYGLFYP  342

Query  625   NEQKVYDVPLTLAALG-----NRGSKAQVPP--------------TWCVANGDVGPERLQ  503
             NEQKVYD+PLT          N G K Q+ P              TWCVANG  G ++LQ
Sbjct  343   NEQKVYDIPLTSEEARQKVPVNGGKKNQMTPVNNGGSVSTSSSGQTWCVANGKAGEQKLQ  402

Query  502   VALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVV  323
              ALDYACG+G ADC  IQPGSTCY+PNTL AHAS+AFNSYYQK  RG GTC F GA YVV
Sbjct  403   AALDYACGEGGADCHQIQPGSTCYDPNTLEAHASFAFNSYYQKMRRGMGTCDFEGAAYVV  462

Query  322   TQPPRFGSCEFPTGY  278
             TQPP+FG+CEFPTGY
Sbjct  463   TQPPKFGNCEFPTGY  477



>gb|EYU27371.1| hypothetical protein MIMGU_mgv1a005776mg [Erythranthe guttata]
Length=471

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/481 (65%), Positives = 365/481 (76%), Gaps = 41/481 (9%)
 Frame = -3

Query  1666  LCIFASLFLSLLRHSV----SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDT  1499
             LC F  L      +S+    S  G+IGINYGRIAD+LPSP +VVQLLK+QGITKVKLYDT
Sbjct  11    LCAF--LIFVCFSNSIVPVFSDGGTIGINYGRIADNLPSPPQVVQLLKAQGITKVKLYDT  68

Query  1498  DSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEV  1325
             +S VL A SGSGI+ TVALPNEQL++AAA  SFTD WVQSNI+ Y   +IIE +AVGNEV
Sbjct  69    NSDVLSAFSGSGIALTVALPNEQLASAAAGTSFTDAWVQSNILAYHPNTIIEAIAVGNEV  128

Query  1324  FVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-P  1148
             FVDPANTT YLV AMKNV+ASL+K   A S+KVSSPI  SA++ SYP SSGSFKPELI P
Sbjct  129   FVDPANTTQYLVAAMKNVHASLSK-NAASSIKVSSPIALSALENSYPSSSGSFKPELIEP  187

Query  1147  VIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFD  968
             VIKPMLSFL++TGS+LM+NAYPF+AY ANTD I LDYAVF +N G  D NNGL+YKSLF+
Sbjct  188   VIKPMLSFLKETGSYLMVNAYPFFAYIANTDTIPLDYAVFRNNSGNPDSNNGLLYKSLFE  247

Query  967   AQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAV  788
             AQ+DAV+AA  AV     ++VISE+GWPSKG+ N                  E G A   
Sbjct  248   AQIDAVFAAAAAVGYKDAKIVISETGWPSKGDEN------------------EIG-AGVD  288

Query  787   NAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVY  608
             NAAAYNGNLVRRVLTGGGTPLRPDEPL+VYLF+LFNENQK+G  SERNYGLF+P+E+KVY
Sbjct  289   NAAAYNGNLVRRVLTGGGTPLRPDEPLNVYLFALFNENQKTGATSERNYGLFFPDEKKVY  348

Query  607   DVPLTLAAL----GNRGSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAAD  464
             D+PLT+  L        SK +V          TWCVAN   G ++L+ ALDYACG+G AD
Sbjct  349   DIPLTVEGLTAAPNMTESKTKVAPAPAAAAGQTWCVANEKAGKKKLKEALDYACGEGGAD  408

Query  463   CGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             C PIQPG+TCYNP++L AHASYAFNSYYQKN R  GTC FGGA YV+T  P+FGSCEFPT
Sbjct  409   CRPIQPGATCYNPSSLEAHASYAFNSYYQKNHRKSGTCDFGGAAYVITHSPKFGSCEFPT  468

Query  283   G  281
             G
Sbjct  469   G  469



>ref|XP_010270042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nelumbo nucifera]
Length=466

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/478 (62%), Positives = 359/478 (75%), Gaps = 42/478 (9%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             LF+S++  S + +G+IGINYGR+A+DLPS  KVVQLLKSQG+ +VKLYDTD+TVL AL+G
Sbjct  10    LFISIV--SFTDAGTIGINYGRVANDLPSSGKVVQLLKSQGLNRVKLYDTDATVLRALAG  67

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             SGIS  V LPNEQLS+AA  QS+TD WVQ NI  Y   + I  +AVGNEVFVDP N T +
Sbjct  68    SGISVVVTLPNEQLSSAAKRQSYTDTWVQKNIAAYYPSTQIHAIAVGNEVFVDPHNITEF  127

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             LV AM+NV+A+L KY +  ++KVSSPI  SA+Q+SYP S+GSFK EL+ PVIKPML FL 
Sbjct  128   LVAAMRNVHAALVKYNLDSAIKVSSPIALSALQSSYPSSAGSFKTELVEPVIKPMLDFLR  187

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             +TGS+LM+NAYPF+AY AN+D ISLDYA+F  N GVVD  NGL Y SLF+AQ+DAV+AA+
Sbjct  188   ETGSYLMVNAYPFFAYAANSDVISLDYALFRTNPGVVDSGNGLRYYSLFEAQIDAVFAAM  247

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +A+K    ++V++E+GWPSKG+ +                  E+G AS VNAAAYNGNLV
Sbjct  248   SALKYDDVKMVVTETGWPSKGDED------------------ESG-ASEVNAAAYNGNLV  288

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RRVL GGGTP RP E L VYLF+LFNEN K GP SERNYGLFYPNE+KVYD+PLT   + 
Sbjct  289   RRVLAGGGTPQRPQEDLDVYLFALFNENMKPGPTSERNYGLFYPNEEKVYDIPLTPEEVR  348

Query  577   NR----GSKAQVPP--------------TWCVANGDVGPERLQVALDYACGQGAADCGPI  452
              +    G K+Q+ P              TWCVANG  G ++LQ ALDYACG+G +DC PI
Sbjct  349   QKVPVNGGKSQMTPVNNGGSVSTSSSGQTWCVANGKAGEQKLQAALDYACGEGGSDCRPI  408

Query  451   QPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             QPG++CY+PNTL AHAS+AFNSYYQK  RG GTC F GA YVVTQPP+FG CEFPTGY
Sbjct  409   QPGASCYDPNTLEAHASFAFNSYYQKMRRGMGTCDFEGAAYVVTQPPKFGKCEFPTGY  466



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/459 (64%), Positives = 354/459 (77%), Gaps = 33/459 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIGINYGRIA+DLP+PAKVV+LLKSQG+ +VKLYDTD+TVL A + SG+   VA+PNE
Sbjct  22    AGSIGINYGRIANDLPTPAKVVELLKSQGLNRVKLYDTDATVLTAFANSGMKVVVAMPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L+ AAA QSFTD WVQ+NI  Y   + IE +AVGNEVFVDP NTT +LVPAMKNV+ASL
Sbjct  82    LLANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVDPNNTTKFLVPAMKNVHASL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  ++K+SSPI  SA+Q S+P SSGSFK EL+ PVIKPML FL QTGS+LM+NAYP
Sbjct  142   VKYSLDKNIKISSPIALSALQNSFPASSGSFKTELLEPVIKPMLDFLRQTGSYLMVNAYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN+DKISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++AVK    ++ +
Sbjct  202   FFAYAANSDKISLDYALFKENPGVVDSGNGLKYTNLFDAQIDAVFAAMSAVKYDDVKIAV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPS G+ N                  E G AS  NAA+YNGNLV+RVL+G GTPL+
Sbjct  262   SETGWPSAGDSN------------------EIG-ASPDNAASYNGNLVKRVLSGSGTPLK  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP---  551
             P+E L V+LF+LFNENQK+GP SERNYGLFYP+++KVYD+ LT  A  +   K+QVP   
Sbjct  303   PNESLDVFLFALFNENQKTGPTSERNYGLFYPSQKKVYDIQLTAEAPPSGVGKSQVPVSG  362

Query  550   --------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYA  395
                      TWCVANG    ++LQ AL+YACG+G ADC PIQPG+TCY+PNTL AHASYA
Sbjct  363   DVTTSSKGQTWCVANGGSSEKKLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYA  422

Query  394   FNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             FNSYYQK AR  GTCYFGG  YVVTQPP++G+CEFPTGY
Sbjct  423   FNSYYQKMARASGTCYFGGTAYVVTQPPKYGNCEFPTGY  461



>ref|XP_004294409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/480 (61%), Positives = 355/480 (74%), Gaps = 34/480 (7%)
 Frame = -3

Query  1672  YSLCIFASLFLSLLRHSVSGS-GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             ++  + ASL LS    + +   G+IGINYGRIA++LP+P KVV LLKSQGIT VKLYDTD
Sbjct  4     FTFSVLASLLLSFFSVAFAAEKGNIGINYGRIANNLPAPTKVVDLLKSQGITNVKLYDTD  63

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
             + VL AL+ S IS  V LPNE LS+AA  QSF D+WVQ+NI  Y  K+ IE +AVGNEV 
Sbjct  64    AAVLTALADSNISVIVCLPNELLSSAAKDQSFADKWVQANISHYYPKTQIEAIAVGNEVL  123

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
              D  N T +LVPAMKN++ASL KY +  S+K+SSPI  +A+Q+SYPPS+GSFKP+L+ PV
Sbjct  124   DDKNNATDFLVPAMKNIHASLKKYNLDSSIKLSSPISLTALQSSYPPSAGSFKPDLVQPV  183

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
             IKP+L FL+QTGS+LM+NAYPF+AY  N+D+ISLDYA+   N G VD  NGL Y SL +A
Sbjct  184   IKPLLDFLQQTGSYLMVNAYPFFAYADNSDEISLDYALLKQNPGNVDSGNGLRYMSLLEA  243

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV +A++A+     ++V++E+GWPS G+ N                  E G A   N
Sbjct  244   QLDAVVSAMSAIGNEDLKMVVTETGWPSNGDEN------------------EVG-AGKEN  284

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNLVRRVLTGGGTPL+P EPL+VYLF+LFNENQK GP SERNYGLFYP+E KVY+
Sbjct  285   AAAYNGNLVRRVLTGGGTPLKPQEPLNVYLFALFNENQKPGPTSERNYGLFYPDEMKVYE  344

Query  604   VPLTLAALGN------RGSKAQVPP-----TWCVANGDVGPERLQVALDYACGQGAADCG  458
             +PLT A L          SK QVP      TWCVAN + G E+LQ ALDYACG+G ADC 
Sbjct  345   IPLTAAELSKDQSTPVNESKTQVPTQPSGNTWCVANANAGEEKLQAALDYACGEGGADCR  404

Query  457   PIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PI  GSTC+NPNTL AHASYAFNSYYQK ARG GTC FGGA YVV+QPPR+G+CEFPTGY
Sbjct  405   PITDGSTCFNPNTLEAHASYAFNSYYQKKARGTGTCNFGGAAYVVSQPPRYGTCEFPTGY  464



>ref|XP_006447645.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
 gb|ESR60885.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
Length=480

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/470 (62%), Positives = 349/470 (74%), Gaps = 44/470 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRIA++LPS +KVVQLLKSQGI +VK++DTD+ VL ALSGSGI  TV LPNE
Sbjct  30    AGSIGVNYGRIANNLPSASKVVQLLKSQGIERVKVFDTDAAVLKALSGSGIKVTVDLPNE  89

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WVQ N+  Y   + IE + VGNEVFVDP NTT +L+PAMKNV+ +L
Sbjct  90    LLFSAAKRPSFAFSWVQKNVAAYHPHTQIEAIGVGNEVFVDPHNTTKFLLPAMKNVHEAL  149

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  S+KVSSPI  SA+Q SYP S+GSF+PELI PV KPML+FL QTGSFLM+NAYP
Sbjct  150   VKYNLHSSIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPMLNFLRQTGSFLMVNAYP  209

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+NTD ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    R+V+
Sbjct  210   FFAYESNTDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYDDIRMVV  269

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  270   TETGWPSKGDEN------------------ENG-ASVENAAAYNGNLVRRILTGGGTPLR  310

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG---------  569
             P   L+VYLF+LFNE+QK GP SERNYGLFYPNE+KVY++P T+  L N           
Sbjct  311   PKADLTVYLFALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRS  370

Query  568   -------------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
                          SK+    TWCVAN +VG E+LQ  LDYACG+G ADC PIQPG+TCY+
Sbjct  371   PTVRAPVNGGGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGADCRPIQPGATCYS  430

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTL AHAS+AFNSYYQK +R  G+CYFGGA YVVTQPPR+G CEFPTGY
Sbjct  431   PNTLEAHASFAFNSYYQKQSRAGGSCYFGGAAYVVTQPPRYGVCEFPTGY  480



>ref|XP_010438690.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/473 (62%), Positives = 351/473 (74%), Gaps = 29/473 (6%)
 Frame = -3

Query  1684  FPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLY  1505
              P    LC+F  +  +        SG IG+NYGRIA++LPSP  VV LLKSQGI+++K+Y
Sbjct  6     LPCFLILCLFPGISFTHAE-----SGMIGVNYGRIANNLPSPKNVVNLLKSQGISRIKIY  60

Query  1504  DTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGN  1331
             DTD  VL AL+ SGI   VALPNE LS+A+++QSF D W+Q+N+  +   + IE +AVGN
Sbjct  61    DTDKNVLTALANSGIKVIVALPNELLSSASSNQSFADNWIQTNVASHSPATEIEAIAVGN  120

Query  1330  EVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI  1151
             EVFVDP NTTPYLVPAMKN++ SL K+ +  ++K+SSP+  SA+  SYPPSSGSFKPELI
Sbjct  121   EVFVDPKNTTPYLVPAMKNIHTSLVKHNLDKAIKISSPVALSALANSYPPSSGSFKPELI  180

Query  1150  -PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSL  974
              PVIKPML  L+ T S+LM+NAYPF+AY AN DKISLDYA+F +N G +D   GL Y SL
Sbjct  181   EPVIKPMLDLLQMTSSYLMVNAYPFFAYSANADKISLDYALFQENAGNIDSGTGLKYNSL  240

Query  973   FDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPAS  794
             FDAQ+DAVYAA++AV     +V+++E+GWPS G+ N                  E G A+
Sbjct  241   FDAQLDAVYAAMSAVGFNDVKVMVTETGWPSVGDEN------------------EIG-AN  281

Query  793   AVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQK  614
               NAAAYNG LV+RVLTG GTPLRP EPL+VYLF+LFNENQK GP SERNYGLFYPNE K
Sbjct  282   EPNAAAYNGGLVKRVLTGNGTPLRPREPLNVYLFALFNENQKPGPTSERNYGLFYPNEGK  341

Query  613   VYDVPLT-LAALGNRGSKAQVP-PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
             VYDVP T  +     G   +VP  TWCV+NG++  +RLQ ALDYACG+G ADC PIQPG+
Sbjct  342   VYDVPFTARSTFPVNGKGDEVPVSTWCVSNGEMARDRLQAALDYACGEGGADCRPIQPGA  401

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             TCY+P TL AHASYAFNSYYQKNARG GTCYFGGA +VVTQPPRFG CEFP G
Sbjct  402   TCYHPETLEAHASYAFNSYYQKNARGVGTCYFGGAAHVVTQPPRFGKCEFPIG  454



>ref|XP_006413135.1| hypothetical protein EUTSA_v10026799mg [Eutrema salsugineum]
 gb|ESQ54588.1| hypothetical protein EUTSA_v10026799mg [Eutrema salsugineum]
Length=462

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/467 (62%), Positives = 352/467 (75%), Gaps = 30/467 (6%)
 Frame = -3

Query  1645  FLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGS  1466
             F S +  + + SG IG+NYGRIA++LPSP  VV LLKSQGI ++K++DTD TVL +L+ S
Sbjct  14    FFSAISLTQADSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIFDTDHTVLASLANS  73

Query  1465  GISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYL  1292
             GI   VALPNE LS+AA+ QSF D WVQ+NI  +   + IE +AVGNEVFVDP+NTTPYL
Sbjct  74    GIKVVVALPNELLSSAASDQSFADNWVQANITKHFPATEIEAIAVGNEVFVDPSNTTPYL  133

Query  1291  VPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQ  1115
             VPAMKN+++SL K+ +  S+K+SSPI  S++  SYPPSSG FKP+L+ PVIKPML  L Q
Sbjct  134   VPAMKNIHSSLVKFNLDESIKISSPIALSSLANSYPPSSGRFKPDLVEPVIKPMLDLLRQ  193

Query  1114  TGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAIN  935
             T S+LM+NAYPF+AY AN DKISLDYA+F +N G VDP  GL Y SLFDAQ+DAV+AA++
Sbjct  194   TSSYLMVNAYPFFAYSANADKISLDYALFRENAGNVDPGTGLRYNSLFDAQIDAVFAAMS  253

Query  934   AVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVR  755
             AV  G  +V+++E+GWPS G+ N                  E G AS  NAAAYNG LV+
Sbjct  254   AVGFGGVKVMVTETGWPSAGDEN------------------EIG-ASESNAAAYNGGLVK  294

Query  754   RVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN  575
             RVLTG GTPLRP +PL+VYLF+LFNENQK GP SERNYGLFYP+E KVYDVP     + +
Sbjct  295   RVLTGNGTPLRPRDPLNVYLFALFNENQKPGPTSERNYGLFYPSEGKVYDVPFVAGEVRS  354

Query  574   ---RGSKAQVP-----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                 G  AQ P      +WCV+NG+ G E+LQ ALDYACG+G ADC PIQPG+TCY+P +
Sbjct  355   TPVNGDGAQFPVAHEGQSWCVSNGNAGKEKLQAALDYACGEGGADCRPIQPGATCYHPES  414

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             L AHAS+AFNSYYQKNAR  GTCYFGGA +VVTQPPR+G CEFPTG+
Sbjct  415   LEAHASFAFNSYYQKNARRVGTCYFGGAAHVVTQPPRYGECEFPTGF  461



>ref|XP_009127020.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Brassica rapa]
Length=460

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/456 (63%), Positives = 347/456 (76%), Gaps = 30/456 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDTDS+VL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTDSSVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LSAAAA QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLSAAAADQSYTDAWVQDNVKKYTPATDIEAIAVGNEVFVDPRNTTAYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             AK+ +  ++K+SSP+  SA+  SYPPS+GSFKP+LI PVIKPML FL +T S LM+NAYP
Sbjct  144   AKFSLDGAIKISSPLALSALANSYPPSAGSFKPDLIEPVIKPMLDFLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISL+YA+F +N G VD  NGL Y++L DAQ+DAV+AA++AV     +VV+
Sbjct  204   FFAYAANADKISLEYALFKENAGNVDSGNGLKYENLLDAQIDAVFAAMSAVGFNDVKVVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP---  551
             P+EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  +     SK +VP   
Sbjct  305   PEEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSAPVNDSKEKVPVKS  364

Query  550   -----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHASYAFNS
Sbjct  365   PSHVGQTWCVANGKTSKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  425   YYQKNARGVGTCDFGGAAYVVSQPPKYGKCEFPTGH  460



>emb|CDY20780.1| BnaA02g09200D [Brassica napus]
Length=449

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/448 (64%), Positives = 345/448 (77%), Gaps = 25/448 (6%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDTDS+VL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTDSSVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LSAAAA QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLSAAAADQSYTDAWVQDNVKKYTPATDIEAIAVGNEVFVDPGNTTAYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             AK+ +  ++K+SSP+  SA+  SYPPS+GSFKP+LI PVIKPML FL +T S LM+NAYP
Sbjct  144   AKFSLDGAIKISSPLALSALANSYPPSAGSFKPDLIEPVIKPMLDFLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISL+YA+F +N G VD  NGL Y++L DAQ+DAV+AA++AV     +VV+
Sbjct  204   FFAYAANADKISLEYALFKENAGNVDSGNGLKYENLLDAQIDAVFAAMSAVGFNDVKVVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTW  542
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  ++    SK +   TW
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSMPVNDSKEK---TW  361

Query  541   CVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARG  362
             CVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHASYAFNSYYQKNARG
Sbjct  362   CVANGKTSKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHASYAFNSYYQKNARG  421

Query  361   PGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  422   VGTCDFGGAAYVVSQPPKYGKCEFPTGH  449



>ref|XP_002864380.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40639.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/456 (64%), Positives = 343/456 (75%), Gaps = 30/456 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLK+QGI +VKLYDT+ TVL AL+ SGI   V+LPNE
Sbjct  25    SGMIGVNYGRIADNLPAPEKVVELLKTQGINRVKLYDTEKTVLTALANSGIKVVVSLPNE  84

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA QS+TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  85    NLASAAADQSYTDTWVQENIKKYIPATDIEAIAVGNEVFVDPRNTTTYLVPAMKNVQSSL  144

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  145   VKFNLDKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  204

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F DN G VD  NGL Y SL DAQ+DAV+AA++AV     +VV+
Sbjct  205   FFAYAANADKISLDYALFKDNAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKVVV  264

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  265   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  305

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L+  +     +K +V P  
Sbjct  306   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSGKSTPVNDNKEKVVPVK  365

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCYNP +L AHASYAFNS
Sbjct  366   PSHVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNS  425

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YYQKNARG GTC FGGA YVV+QPP++G CEFPT +
Sbjct  426   YYQKNARGVGTCDFGGAAYVVSQPPKYGKCEFPTEH  461



>ref|XP_007049173.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93330.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=609

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 354/485 (73%), Gaps = 46/485 (9%)
 Frame = -3

Query  1651  SLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALS  1472
             SL L +   +++  GS+G+NYGRIA++LPS  KVV+LLKS G+ +VK+YDTD  VL ALS
Sbjct  144   SLVLLISVFTLADCGSVGVNYGRIANNLPSATKVVELLKSHGLNRVKVYDTDPAVLHALS  203

Query  1471  GSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTP  1298
             GSGI  TV LPNEQL AAA S SF + WV+ N+  Y   + IE +AVGNEVFVDP NTT 
Sbjct  204   GSGIKVTVDLPNEQLFAAAKSTSFANSWVERNVAAYYPHTEIEAIAVGNEVFVDPHNTTK  263

Query  1297  YLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFL  1121
             +LVPAMKN++ +L K+ +   +KVSSPI  SA+Q SYP S+GSF+PELI PV KPML FL
Sbjct  264   FLVPAMKNIHEALVKFNLHSDIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPMLDFL  323

Query  1120  EQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAA  941
              QTGSFLM+NAYPF+AYE+NTD ISLDYA+F +N GVVDP NGL Y SLFDAQ+DAV+AA
Sbjct  324   RQTGSFLMVNAYPFFAYESNTDVISLDYALFRENPGVVDPGNGLRYFSLFDAQIDAVFAA  383

Query  940   INAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNL  761
             ++A+K    ++V++E+GWPSKG+ N                  E G AS  NAAAYNGNL
Sbjct  384   MSALKYDDIKLVVTETGWPSKGDEN------------------ENG-ASIENAAAYNGNL  424

Query  760   VRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
             VRR+LTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYGLFYPNE+KVYD+P TL  +
Sbjct  425   VRRILTGGGTPLRPKADLTVYLFALFNENKKFGPTSERNYGLFYPNEEKVYDIPFTLEGV  484

Query  580   GNRG------------------------SKAQVPPTWCVANGDVGPERLQVALDYACGQG  473
              N                          SK+    TWCVANG+ G  +LQ ALDYACG+G
Sbjct  485   KNYRDKRSPVAGNQQGAAAPVNGGGGSVSKSTTGNTWCVANGEAGKAKLQAALDYACGEG  544

Query  472   AADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
              ADC  IQPG+TCY+PNT+ AHAS+AFNSYYQK  R  GTCYFGGA YVVTQPP++G+CE
Sbjct  545   GADCHSIQPGATCYDPNTIQAHASFAFNSYYQKKGRQMGTCYFGGAAYVVTQPPKYGNCE  604

Query  292   FPTGY  278
             FPTGY
Sbjct  605   FPTGY  609



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/459 (64%), Positives = 351/459 (76%), Gaps = 36/459 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIGINYGRIA+DLP+PAKVV+LLKSQG+ +VKLYDTD+TVL A + SG+   VA+PNE
Sbjct  22    AGSIGINYGRIANDLPTPAKVVELLKSQGLNRVKLYDTDATVLTAFANSGMKVVVAMPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L+ AAA QSFTD WVQ+NI  Y   + IE +AVGNEVFVDP NTT +LVPAMKNV+ASL
Sbjct  82    LLANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVDPNNTTKFLVPAMKNVHASL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  ++K+SSPI  SA+Q S+P SSGSFK EL+ PVIKPML FL QTGS+LM+NAYP
Sbjct  142   VKYSLDKNIKISSPIALSALQNSFPASSGSFKTELLEPVIKPMLDFLRQTGSYLMVNAYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN+DKISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++AVK    ++ +
Sbjct  202   FFAYAANSDKISLDYALFKENPGVVDSGNGLKYTNLFDAQIDAVFAAMSAVKYDDVKIAV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPS G+ N                  E G AS  NAA+YNGNLV+RVL+G GTPL+
Sbjct  262   SETGWPSAGDSN------------------EIG-ASPDNAASYNGNLVKRVLSGSGTPLK  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP---  551
             P+E L V+LF+LFNENQK+GP SERNYGLFYP E+KVYD   T  A  +   K+QVP   
Sbjct  303   PNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVYD---TAEAPPSGVGKSQVPVSG  359

Query  550   --------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYA  395
                      TWCVANG    ++LQ AL+YACG+G ADC PIQPG+TCY+PNTL AHASYA
Sbjct  360   DVTTSSKGQTWCVANGGSSEKKLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYA  419

Query  394   FNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             FNSYYQK AR  GTCYFGG  YVVTQPP++G+CEFPTGY
Sbjct  420   FNSYYQKMARASGTCYFGGTAYVVTQPPKYGNCEFPTGY  458



>ref|NP_568822.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|ABH04632.1| At5g55180 [Arabidopsis thaliana]
 gb|AED96596.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/456 (63%), Positives = 344/456 (75%), Gaps = 30/456 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLK+QGI ++KLYDT++TVL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIADNLPAPEKVVELLKTQGINRIKLYDTETTVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA QS+TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLASAAADQSYTDTWVQDNIKKYIPATDIEAIAVGNEVFVDPRNTTTYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  144   VKFNLDKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  204   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L   +     +K +V P  
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLNGKSTPVNDNKEKVVPVK  364

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCYNP +L AHASYAFNS
Sbjct  365   PSLVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  425   YYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  460



>ref|XP_006469612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=540

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/470 (62%), Positives = 349/470 (74%), Gaps = 44/470 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRIA++LPS +KVVQLLKSQGI +VK++DTD+ VL ALSGSGI  TV LPNE
Sbjct  90    AGSIGVNYGRIANNLPSASKVVQLLKSQGIERVKVFDTDAAVLKALSGSGIKVTVDLPNE  149

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WVQ N+  Y   + IE + VGNEVFVDP NTT +L+PAMKNV+ +L
Sbjct  150   LLFSAAKRPSFAFSWVQKNVAAYHPHTQIEAIGVGNEVFVDPHNTTKFLLPAMKNVHEAL  209

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  S+KVSSPI  SA+Q SYP S+GSF+PELI PV KPML+FL QTGSFLM+NAYP
Sbjct  210   VKYNLHSSIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPMLNFLRQTGSFLMVNAYP  269

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+NTD ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    R+V+
Sbjct  270   FFAYESNTDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYDDIRMVV  329

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  330   TETGWPSKGDEN------------------ENG-ASVENAAAYNGNLVRRILTGGGTPLR  370

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG---------  569
             P   L+VYLF+LFNE+QK GP SERNYGLFYPNE+KVY++P T+  L N           
Sbjct  371   PKADLTVYLFALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRS  430

Query  568   -------------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
                          SK+    TWCVAN +VG E+LQ  LDYACG+G ADC PIQPG+TCY+
Sbjct  431   PTVRAPVNGGGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGADCRPIQPGATCYS  490

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTL AHAS+AFNSYYQK +R  G+CYFGGA YVVTQPPR+G CEFPTGY
Sbjct  491   PNTLEAHASFAFNSYYQKQSRAGGSCYFGGAAYVVTQPPRYGVCEFPTGY  540



>emb|CDY36734.1| BnaA03g11520D [Brassica napus]
Length=460

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/466 (62%), Positives = 345/466 (74%), Gaps = 30/466 (6%)
 Frame = -3

Query  1642  LSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSG  1463
              S ++ + + SG IG+NYGRIAD+LP+P KVV+LLKSQGI +VKL+DTD TVL AL+ SG
Sbjct  14    FSAIQFTHADSGMIGVNYGRIADNLPAPEKVVELLKSQGINRVKLFDTDKTVLTALANSG  73

Query  1462  ISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLV  1289
             I   V+LPNE L+AAAA QS+TD+WVQ N+  Y   + IE +AVGNEVFVDP NTT YLV
Sbjct  74    IKVVVSLPNENLTAAAADQSYTDKWVQENVKKYTPATDIEAIAVGNEVFVDPKNTTKYLV  133

Query  1288  PAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQT  1112
              AM NV +SL K+ +  SVK+SSPI  SA+  SYPPS+GSFKP+LI PVIKPML  L +T
Sbjct  134   AAMTNVQSSLVKFNLDESVKISSPIALSALANSYPPSAGSFKPDLIEPVIKPMLDLLRKT  193

Query  1111  GSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINA  932
              S LM+NAYPF+AY AN DKI LDYA+F +N G VD  NGL Y SLFDAQ+DAVYAA+ A
Sbjct  194   SSHLMVNAYPFFAYAANADKIPLDYALFRENAGNVDSGNGLKYNSLFDAQIDAVYAAMAA  253

Query  931   VKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRR  752
             V     ++V++E+GWPS G+ N                  E G  SA NAAAYNG LV+R
Sbjct  254   VGFNDVKLVVTETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKR  294

Query  751   VLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR  572
             VLTG GTPL+P+EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +       
Sbjct  295   VLTGNGTPLKPNEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSATVTPVS  354

Query  571   GSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTL  416
              SK +VP         TWCVANG    E+LQ ALDYACG+G ADC  IQ G+TCY+P +L
Sbjct  355   DSKVKVPVNTPSHVGQTWCVANGKTTREKLQEALDYACGEGGADCRSIQKGATCYDPESL  414

Query  415   VAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              AHASYAFNSYYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  415   EAHASYAFNSYYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  460



>ref|XP_009132400.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Brassica rapa]
Length=460

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/466 (62%), Positives = 345/466 (74%), Gaps = 30/466 (6%)
 Frame = -3

Query  1642  LSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSG  1463
              S ++ + + SG IG+NYGRIAD+LP+P KVV+LLKSQGI +VKL+DTD TVL AL+ SG
Sbjct  14    FSAIQFTHADSGMIGVNYGRIADNLPAPEKVVELLKSQGINRVKLFDTDKTVLTALANSG  73

Query  1462  ISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLV  1289
             I   V+LPNE L+AAAA QS+TD+WVQ N+  Y   + IE +AVGNEVFVDP NTT YLV
Sbjct  74    IKVVVSLPNENLTAAAADQSYTDKWVQENVKKYTPATDIEAIAVGNEVFVDPKNTTKYLV  133

Query  1288  PAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQT  1112
              AM NV +SL K+ +  SVK+SSPI  SA+  SYPPS+GSFKP+LI PVIKPML  L +T
Sbjct  134   AAMTNVQSSLVKFNLDKSVKISSPIALSALANSYPPSAGSFKPDLIEPVIKPMLDLLRKT  193

Query  1111  GSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINA  932
              S LM+NAYPF+AY AN DKI LDYA+F +N G VD  NGL Y SLFDAQ+DAVYAA+ A
Sbjct  194   SSHLMVNAYPFFAYAANADKIPLDYALFRENAGNVDSGNGLKYNSLFDAQIDAVYAAMAA  253

Query  931   VKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRR  752
             V     ++V++E+GWPS G+ N                  E G  SA NAAAYNG LV+R
Sbjct  254   VGFNDVKLVVTETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKR  294

Query  751   VLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR  572
             VLTG GTPL+P+EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +       
Sbjct  295   VLTGNGTPLKPNEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSATVTPVS  354

Query  571   GSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTL  416
              SK +VP         TWCVANG    E+LQ ALDYACG+G ADC  IQ G+TCY+P +L
Sbjct  355   DSKVKVPVNTPSHVGQTWCVANGKTTREKLQEALDYACGEGGADCRSIQKGATCYDPESL  414

Query  415   VAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              AHASYAFNSYYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  415   EAHASYAFNSYYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  460



>emb|CDY12009.1| BnaC03g14350D [Brassica napus]
Length=460

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/466 (62%), Positives = 345/466 (74%), Gaps = 30/466 (6%)
 Frame = -3

Query  1642  LSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSG  1463
              S ++ + + SG IG+NYGRIAD+LP+P KVV+LLKSQGI +VKL+DTD TVL AL+ SG
Sbjct  14    FSAIQFTHADSGMIGVNYGRIADNLPAPEKVVELLKSQGINRVKLFDTDKTVLTALANSG  73

Query  1462  ISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLV  1289
             I   V+LPNE L+AAAA QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLV
Sbjct  74    IKVVVSLPNENLTAAAADQSYTDNWVQENVKKYTPATDIEAIAVGNEVFVDPKNTTKYLV  133

Query  1288  PAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQT  1112
              AM NV++SL K+ +  SVK+SSPI  SA+  SYPPS+GSFKP+LI PVIKPML  L +T
Sbjct  134   AAMTNVHSSLVKFNLDESVKISSPIALSALANSYPPSAGSFKPDLIEPVIKPMLDLLRKT  193

Query  1111  GSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINA  932
              S LM+NAYPF+AY AN DKI LDYA+F +N G VD  NGL Y SLFDAQ+DAV+AA+ A
Sbjct  194   SSHLMVNAYPFFAYAANADKIPLDYALFKENAGNVDSGNGLKYNSLFDAQIDAVFAAMAA  253

Query  931   VKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRR  752
             V     ++V++E+GWPS G+ N                  E G  SA NAAAYNG LV+R
Sbjct  254   VGFNDVKLVVTETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKR  294

Query  751   VLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR  572
             VLTG GTPL+ +EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +       
Sbjct  295   VLTGNGTPLKSNEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSATVTPVS  354

Query  571   GSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTL  416
              SK +VP         TWCVANG    E+LQ ALDYACG+G ADC PIQ G+TCY+P +L
Sbjct  355   DSKVKVPVKTPSHVGQTWCVANGKTTKEKLQEALDYACGEGGADCRPIQKGATCYDPESL  414

Query  415   VAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              AHASYAFNSYYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  415   EAHASYAFNSYYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  460



>ref|XP_002316783.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE97395.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=476

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/469 (62%), Positives = 351/469 (75%), Gaps = 44/469 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G+IG+NYGR+A++LP+PA+VV LLKS GI ++KLYDTDS VL AL+GS I+  VALPNE
Sbjct  28    AGTIGVNYGRVANNLPAPAEVVSLLKSHGINRIKLYDTDSDVLTALAGSSINVVVALPNE  87

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+ AA QSF D WV+ NI  +  ++ IE +AVGNEVFVDP NTTP+LVPAMKNV+ SL
Sbjct  88    LLSSVAADQSFADSWVKGNISQHFPQTKIEAIAVGNEVFVDPKNTTPFLVPAMKNVHNSL  147

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ ++ S+K+SSPI  SA+Q+SYP S+GSFK ELI PVIKPML FL QTGS+LM+NAYP
Sbjct  148   VKFNLS-SIKISSPIALSALQSSYPSSAGSFKTELIGPVIKPMLDFLRQTGSYLMINAYP  206

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN D ISLDYA+  +NQGVVD  NGL Y SL +AQ+DAV+AA++A++    ++V+
Sbjct  207   FFAYAANADVISLDYALLKENQGVVDSGNGLKYNSLLEAQLDAVHAAMSAIQYNDVKMVV  266

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ +                  E G   A NAA+YNGNLV+RVLTG GTPLR
Sbjct  267   TETGWPSLGDED------------------EIGAGEA-NAASYNGNLVKRVLTGNGTPLR  307

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS--------  566
             P EPL+VYLF+LFNEN+K GP SERNYGLFYPNE++VYDVP TL  LGN  S        
Sbjct  308   PQEPLNVYLFALFNENEKPGPTSERNYGLFYPNEKRVYDVPFTLEQLGNGQSMPVNKSNS  367

Query  565   -------------KAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
                           + V  TWCVANG+ G E+LQ  LDYACG+G ADC PIQ GSTCYNP
Sbjct  368   PAPSVQSGGDVSTTSSVGQTWCVANGNAGAEKLQAGLDYACGEGGADCRPIQTGSTCYNP  427

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             NT+ AHASYAFNSYYQK ARG GTC FGGA YVVTQ PRFG+C+FPTGY
Sbjct  428   NTVEAHASYAFNSYYQKKARGAGTCDFGGAAYVVTQQPRFGNCKFPTGY  476



>gb|AAL77689.1| AT5g55180/MCO15_13 [Arabidopsis thaliana]
Length=460

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/456 (63%), Positives = 344/456 (75%), Gaps = 30/456 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLK+QGI ++KLYDT++TVL +L+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIADNLPAPEKVVELLKTQGINRIKLYDTETTVLTSLANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA QS+TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLASAAADQSYTDTWVQDNIKKYIPATDIEAIAVGNEVFVDPRNTTTYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  144   VKFNLDKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  204   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L   +     +K +V P  
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLNGKSTPVNDNKEKVVPVK  364

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCYNP +L AHASYAFNS
Sbjct  365   PSLVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  425   YYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  460



>emb|CDY06601.1| BnaC02g13250D [Brassica napus]
Length=449

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/448 (64%), Positives = 345/448 (77%), Gaps = 25/448 (6%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDTD++VL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTDASVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LSAAAA QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLSAAAADQSYTDAWVQDNVKKYTPATDIEAIAVGNEVFVDPRNTTAYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             AK+ +  ++K+SSP+  SA+  SYPPS+GSFKP+LI PVIKPML FL +T S LM+NAYP
Sbjct  144   AKFSLDGAIKISSPLALSALANSYPPSAGSFKPDLIEPVIKPMLDFLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISL+YA+F +N G VD  NGL Y++L DAQ+DAV+AA++AV     +VV+
Sbjct  204   FFAYAANADKISLEYALFKENAGNVDSGNGLKYENLLDAQIDAVFAAMSAVGFNDVKVVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTW  542
             P+EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  +     SK +   TW
Sbjct  305   PEEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSAPVDDSKEK---TW  361

Query  541   CVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARG  362
             CVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHASYAFNSYYQKNARG
Sbjct  362   CVANGKTTKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHASYAFNSYYQKNARG  421

Query  361   PGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  422   VGTCDFGGAAYVVSQPPKYGKCEFPTGH  449



>ref|XP_008364550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
 ref|XP_008364558.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
Length=465

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/461 (64%), Positives = 351/461 (76%), Gaps = 36/461 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++GINYGRIAD+LP P KVV LLKSQGI KVKLYDTD+TVL AL+ SGIS  VALPNE
Sbjct  25    TGTVGINYGRIADNLPPPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNE  84

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA+  SF D+WVQSNI  Y  K+ IE +AVGNEVFVDP NTT +LVPAMKN+ +SL
Sbjct  85    LLSSAASDPSFADKWVQSNISHYHPKTQIEAIAVGNEVFVDPNNTTQFLVPAMKNIQSSL  144

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY ++ S+K+SSPI  SA+ +SYPPS+G+F P+LI PVIKP L FL QT S+LM+NAYP
Sbjct  145   VKYNLS-SIKLSSPIALSALNSSYPPSAGAFNPDLIEPVIKPFLEFLTQTSSYLMINAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+ +DKISLDYA+F  N G  D  NGL Y SL +AQ+DAV AA++AV  G  +VV+
Sbjct  204   FFAYESTSDKISLDYALFRTNPGNPDSGNGLKYYSLLEAQIDAVXAAMSAVGHGDVKVVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G   A NAAAYNGNLV+R+LTGGGTPL+
Sbjct  264   TETGWPSKGDEN------------------EIGSGQA-NAAAYNGNLVKRILTGGGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-GNRGS-----KA  560
             P +PL+VYLF+LFNE+QK GP SERNYGLFYP+E+KVYD+ LT A L G++ S     K 
Sbjct  305   PKDPLNVYLFALFNEDQKPGPTSERNYGLFYPDEKKVYDIALTAAGLSGDQSSPANESKV  364

Query  559   QVP-------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHAS  401
             QVP        TWCVAN   G E+LQ ALDYACG+G ADC PIQ GSTC+ PNTL AHAS
Sbjct  365   QVPTASPSAGSTWCVANAKAGEEKLQAALDYACGEGGADCRPIQEGSTCFTPNTLEAHAS  424

Query  400   YAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YAFNS+YQK ARG GTC FGGA YVV QPP++G+CEFPTGY
Sbjct  425   YAFNSFYQKRARGTGTCNFGGAAYVVAQPPKYGTCEFPTGY  465



>gb|AAM66024.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=460

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/456 (63%), Positives = 344/456 (75%), Gaps = 30/456 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLK+QGI ++KLY+T++TVL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIADNLPAPEKVVELLKTQGINRIKLYNTETTVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA QS+TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLASAAADQSYTDTWVQDNIKKYIPATDIEAIAVGNEVFVDPRNTTTYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPEL+ PVIKPML  L +T S LM+NAYP
Sbjct  144   VKFNLDKSIKISSPIALSALASSYPPSAGSFKPELVEPVIKPMLDLLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  204   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L   +     +K +V P  
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNESKVYDVSLNGKSTPVNDNKEKVVPVK  364

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCYNP +L AHASYAFNS
Sbjct  365   PSLVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  425   YYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  460



>ref|XP_008226995.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Prunus mume]
Length=472

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/461 (63%), Positives = 349/461 (76%), Gaps = 35/461 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G+IGINYGRIA++LP+P KVV LLKSQGI KVKLYDTD+ VL AL+ SGI+  VALPNE
Sbjct  31    TGTIGINYGRIANNLPTPEKVVALLKSQGINKVKLYDTDAAVLTALANSGINVVVALPNE  90

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA   SF D+WVQ+NI  Y  ++ IE +AVGNEVF DP NTT +LVPA+ N+ ++L
Sbjct  91    LLSSAANDPSFADKWVQANISQYHPQTQIEAIAVGNEVFADPNNTTKFLVPAINNLQSAL  150

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ ++ S+K+SSPI  SA+Q SYPPSSGSFKP+LI P IKP+L FL +T S+LM+NAYP
Sbjct  151   VKHNLSSSIKLSSPIALSALQNSYPPSSGSFKPDLIEPAIKPLLDFLSKTSSYLMINAYP  210

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYEAN D+ISLDYA+F  NQG VD  NGL Y SL +AQ+DAV+AA++A+     ++V+
Sbjct  211   FFAYEANADEISLDYALFRTNQGNVDSGNGLRYNSLMEAQLDAVFAAMSALGYDDVKLVV  270

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G   A NAAAYNGNLV+RVLTG GTPL+
Sbjct  271   TETGWPSNGDEN------------------EIGSGKA-NAAAYNGNLVKRVLTGSGTPLK  311

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN------RGSKA  560
             P +PL+VYLF+LFNENQK GP SERNYGLFYP+E KVYD+PLTLA L          SKA
Sbjct  312   PKDPLNVYLFALFNENQKPGPTSERNYGLFYPDEGKVYDIPLTLAGLSGAQSNPVNESKA  371

Query  559   QVPPT-------WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHAS  401
             QVP T       WCVAN + G E+LQ ALDYACG+G ADC  IQ GSTC+NPNTL AHAS
Sbjct  372   QVPTTAPSSGNTWCVANANAGEEKLQAALDYACGEGGADCRSIQEGSTCFNPNTLEAHAS  431

Query  400   YAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YAFNSYYQK ARG GTC FGGA +VV QPPR+G+CE+PTGY
Sbjct  432   YAFNSYYQKKARGTGTCDFGGAAHVVAQPPRYGTCEYPTGY  472



>emb|CDY19908.1| BnaC09g31740D [Brassica napus]
Length=459

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/477 (60%), Positives = 349/477 (73%), Gaps = 32/477 (7%)
 Frame = -3

Query  1669  SLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDST  1490
             +L + + L LS +  + + SG IG+NYGRIAD+LP+P KVV+LLKSQGI +VKLYDTD +
Sbjct  2     ALFVLSLLTLSAISFTHADSGMIGVNYGRIADNLPAPEKVVELLKSQGINRVKLYDTDKS  61

Query  1489  VLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVD  1316
             VL AL+ SGI   V+LPNE L+AA+A QS+TD WVQ N+  Y   + IE +AVGNEVFVD
Sbjct  62    VLTALANSGIKVVVSLPNENLAAASADQSYTDNWVQENVKKYTPATDIEAIAVGNEVFVD  121

Query  1315  PANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIK  1139
             P NTT YLV AMKN+ +SL K+ +  S+KVSSPI  SA+  SYPPSSGSFKP+LI PVIK
Sbjct  122   PRNTTTYLVQAMKNIQSSLVKFNLDESIKVSSPIALSALANSYPPSSGSFKPDLIEPVIK  181

Query  1138  PMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQV  959
             PML  L +T S +M+NAYPF+AY AN DKISLDYA+F +N G VD  NGL Y +L DAQ+
Sbjct  182   PMLDLLRKTSSHIMVNAYPFFAYAANADKISLDYALFKENAGNVDSGNGLKYSNLLDAQI  241

Query  958   DAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAA  779
             DAV+AA+ AV     ++V++E+GWPS G+ N                  E G  SA NAA
Sbjct  242   DAVFAAMAAVGFNDVKLVVTETGWPSAGDEN------------------EIGAGSA-NAA  282

Query  778   AYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVP  599
             AYNG LV+RVLTG GTPL+P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYD+P
Sbjct  283   AYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDLP  342

Query  598   LTLAALGNRGSKAQVP----------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQ  449
              +  +      K +VP           TWCVANG    E+LQ  LDYACG+G ADC PIQ
Sbjct  343   FSAKSTPVNDGKDKVPVKTPSSHVGGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQ  402

Query  448   PGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              G+TCY+P +L AHASYAFNSYYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  403   KGATCYDPESLEAHASYAFNSYYQKNARGVGTCDFGGAAYVVSQPPKYGKCEFPTGH  459



>ref|XP_010448205.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=457

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/475 (61%), Positives = 352/475 (74%), Gaps = 31/475 (7%)
 Frame = -3

Query  1684  FPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLY  1505
              P    LC+F ++  +      + SG IG+NYGRIA++LPSP  VV LLKSQGI ++K+Y
Sbjct  6     LPCFLILCLFPTISFTH-----TESGMIGVNYGRIANNLPSPKNVVSLLKSQGINRIKIY  60

Query  1504  DTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGN  1331
             DTD  VL AL+ +GI   VALPNE LS+A+++QSF D W+Q+N+  +   + IE +AVGN
Sbjct  61    DTDKKVLTALANTGIKVIVALPNELLSSASSNQSFADHWIQTNVASHFPATEIEAIAVGN  120

Query  1330  EVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI  1151
             EVFVDP NTTPYLVPAMKN++ SL K  +  ++K+SSP+  SA+  SYPPSSGSFKPELI
Sbjct  121   EVFVDPKNTTPYLVPAMKNIHTSLVKRNLDKAIKISSPVALSALANSYPPSSGSFKPELI  180

Query  1150  -PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSL  974
              PVIKPML  L++T S+LM+NAYPF+AY AN DKISLDYA+F +N G +D   GL Y SL
Sbjct  181   EPVIKPMLDLLQRTSSYLMVNAYPFFAYSANADKISLDYALFQENVGNIDSGTGLKYNSL  240

Query  973   FDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPAS  794
             F+AQ+DAVYAA++AV     +V+++E+GWPS G+ N                  E G AS
Sbjct  241   FNAQLDAVYAAMSAVGFNDVKVMVTETGWPSVGDEN------------------EIG-AS  281

Query  793   AVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQK  614
               NAAAYN  LV+RVLTG GTPLRP EPL+VYLF+LFNEN+K GP SERNYGLFYPNE K
Sbjct  282   EPNAAAYNVGLVKRVLTGNGTPLRPREPLNVYLFALFNENEKPGPTSERNYGLFYPNEGK  341

Query  613   VYDVPLT-LAALGNRGSKAQVP---PTWCVANGDVGPERLQVALDYACGQGAADCGPIQP  446
             VYDVP T  +A    G   +VP    TWCV+NG++  +RLQ ALDYACG+G ADC PIQP
Sbjct  342   VYDVPFTARSAFPVNGKGDEVPVVSSTWCVSNGEMARDRLQAALDYACGEGGADCRPIQP  401

Query  445   GSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             G+TCY+P TL AHASYAFNSYYQKNAR  GTCYFGGA +VVTQPPRFG CEFPTG
Sbjct  402   GATCYHPETLEAHASYAFNSYYQKNARRVGTCYFGGAAHVVTQPPRFGKCEFPTG  456



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/489 (60%), Positives = 358/489 (73%), Gaps = 46/489 (9%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             +AF   + L  F S        S S +GS+GINYGR+A+DLP+PAKVV+LLK+QG+ +VK
Sbjct  10    LAFSFFFILITFFS--------SSSEAGSVGINYGRVANDLPTPAKVVELLKAQGLNRVK  61

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             LYDTD+TVL A + SGI   VA+PNE L+ AAA QSFTD WVQ+NI  Y   + IE +AV
Sbjct  62    LYDTDATVLTAFANSGIKVVVAMPNELLANAAADQSFTDAWVQANISTYYPATQIEAIAV  121

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVFVDP NTT +LVPAMKNV+ASL KY +  ++K+SSPI  SA+Q S+P SSGSFK E
Sbjct  122   GNEVFVDPNNTTKFLVPAMKNVHASLTKYNLDKNIKISSPIALSALQNSFPASSGSFKTE  181

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L+ PVIKPML  L QTGS+LM+NAYPF+AY AN+DKISLDYA+F +N GVVD  NGL Y 
Sbjct  182   LVEPVIKPMLDLLRQTGSYLMVNAYPFFAYAANSDKISLDYALFKENPGVVDSGNGLKYT  241

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             +LFDAQ+DAV+AA++A+K    ++ +SE+GWPS G+ N                  E G 
Sbjct  242   NLFDAQIDAVFAAMSALKYEDVKIAVSETGWPSAGDSN------------------EIG-  282

Query  799   ASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNE  620
             AS  NAA+YNGNLV+RV++G GTPL+ +E L V+LF+LFNENQK+GP SERNYGLFYP E
Sbjct  283   ASPDNAASYNGNLVKRVMSGSGTPLKQNESLDVFLFALFNENQKTGPTSERNYGLFYPTE  342

Query  619   QKVYDVPLTLAALGNRG----SKAQVP------------PTWCVANGDVGPERLQVALDY  488
             +KVYD+PLT   +         K+QVP             TWCVA+G    ++LQ AL+Y
Sbjct  343   KKVYDIPLTAEEIKEAPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKLQNALNY  402

Query  487   ACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPR  308
             ACG+G ADC PIQPG+TCYNPNTL AHASYAFNSYYQK AR  GTC FGG  YVVTQPP+
Sbjct  403   ACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYVVTQPPK  462

Query  307   FGSCEFPTG  281
             +G+CEFPTG
Sbjct  463   YGNCEFPTG  471



>ref|XP_010482941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=460

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/459 (63%), Positives = 343/459 (75%), Gaps = 33/459 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLKSQGI +VKLYDT++TVL AL+ SGI   V+LPNE
Sbjct  21    SGMIGVNYGRIADNLPAPDKVVELLKSQGINRVKLYDTETTVLTALANSGIKVVVSLPNE  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA Q +TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAM NV +SL
Sbjct  81    DLASAAADQKYTDDWVQQNIKKYIPATDIEAIAVGNEVFVDPRNTTKYLVPAMTNVQSSL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPSSGSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  141   VKFNLDKSIKISSPIALSALASSYPPSSGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F DN G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  201   FFAYAANADKISLDYALFKDNAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  261   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLA-ALGNRGSKAQVPP-  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L+   +     +K +VPP 
Sbjct  302   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSSGKSTPVEDNKEKVPPV  361

Query  547   ---------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYA  395
                      TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCY+P +L AHASYA
Sbjct  362   VKPSSHVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYA  421

Query  394   FNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             FNSYYQKNARG GTC F GA YVV+QPP++G CEFPTG+
Sbjct  422   FNSYYQKNARGVGTCDFKGAAYVVSQPPKYGKCEFPTGH  460



>ref|XP_002867539.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH43798.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=456

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/480 (61%), Positives = 355/480 (74%), Gaps = 33/480 (7%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA   L  L +  SLF ++  HS    G IG+NYGRIA++LPSP KVV LLKSQGI ++K
Sbjct  1     MAVSFLPCLILIVSLFSAIDAHS----GMIGVNYGRIANNLPSPEKVVNLLKSQGINRIK  56

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             ++DTD  VL AL+ S I   VALPNE LS+AA+ QSF D W++++I+ Y   + IE +AV
Sbjct  57    IFDTDKNVLTALANSRIKVIVALPNELLSSAASHQSFADNWIKTHIMSYFPATEIEAIAV  116

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVFVDP NT PYLV AMKN++ SL KY +  ++K+SSPI  SA+  SYPPSSGSFKP+
Sbjct  117   GNEVFVDPKNT-PYLVSAMKNIHTSLVKYNLDKAIKISSPIALSALANSYPPSSGSFKPD  175

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             LI PVIKPML+ L+QT SFLM+NAYPF+AY AN DKISLDYA+F  N G +D   GL Y 
Sbjct  176   LIEPVIKPMLALLQQTSSFLMVNAYPFFAYAANADKISLDYALFKQNAGNIDSGTGLKYN  235

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SLFDAQ+DAVYAA++AV     +V+++E+GWPS G+ N                  E G 
Sbjct  236   SLFDAQIDAVYAALSAVGFKGVKVMVTETGWPSVGDEN------------------EIG-  276

Query  799   ASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNE  620
             AS   AAAYNG LV+RVLTG GTPLRP EPL+VYLF+LFNENQK GP SERNYG+FYPNE
Sbjct  277   ASESTAAAYNGGLVKRVLTGKGTPLRPKEPLNVYLFALFNENQKPGPTSERNYGMFYPNE  336

Query  619   QKVYDVPLT-LAALGNRGSKAQVP-----PTWCVANGDVGPERLQVALDYACGQGAADCG  458
              KVYDVP + + +    G++  VP      TWCV+NG+V  E+LQ ALDYACG+G ADC 
Sbjct  337   GKVYDVPFSRVRSTPVNGNRDHVPVTHEGHTWCVSNGEVAKEKLQEALDYACGEGGADCR  396

Query  457   PIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PIQPG+TCY+P +L AHASYAFNSYYQKN+R  GTCYFGGA +VVTQPPR+G CEFPTG+
Sbjct  397   PIQPGATCYHPESLEAHASYAFNSYYQKNSRRVGTCYFGGAAHVVTQPPRYGKCEFPTGH  456



>ref|XP_010449211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=460

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/459 (63%), Positives = 342/459 (75%), Gaps = 33/459 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+L +P KVVQLLKSQGI +VKLYDT++TVL AL+ SGI   V+LPNE
Sbjct  21    SGMIGVNYGRIADNLSAPEKVVQLLKSQGINRVKLYDTEATVLTALANSGIKVVVSLPNE  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA Q +TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAM NV +SL
Sbjct  81    NLASAAADQKYTDDWVQQNIKKYIPATDIEAIAVGNEVFVDPRNTTKYLVPAMTNVQSSL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPSSGSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  141   VKFNLDKSIKISSPIALSALASSYPPSSGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  201   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  261   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAA----LGNRGSKA--  560
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L+       + +   KA  
Sbjct  302   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSSGGKSTPVEDNKEKATP  361

Query  559   -----QVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYA  395
                  QV  TWCVANG    E+LQ  LDYACG+G ADCGPIQPG+TCY+P +L AHASYA
Sbjct  362   VVPSSQVGQTWCVANGKTTKEKLQEGLDYACGEGRADCGPIQPGATCYDPESLEAHASYA  421

Query  394   FNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             FNSYYQKNARG GTC F GA YVV+QPP++G CEFPTG+
Sbjct  422   FNSYYQKNARGVGTCDFKGAAYVVSQPPKYGKCEFPTGH  460



>gb|EYU33669.1| hypothetical protein MIMGU_mgv1a005896mg [Erythranthe guttata]
Length=466

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/484 (64%), Positives = 366/484 (76%), Gaps = 35/484 (7%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA  +   L  F   F+ +       SG++G+NYGR+AD+LP P +VVQLL+SQGI +VK
Sbjct  1     MASHKQLLLSNFLPAFIFIFVVETVLSGTVGVNYGRLADNLPPPQQVVQLLQSQGIARVK  60

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAV  1337
             ++DTD+ VL AL GSGIS TVA+PNEQLS+AAA QSFTD WVQSNI+PY   +I++ +AV
Sbjct  61    IFDTDAAVLSALGGSGISVTVAMPNEQLSSAAADQSFTDTWVQSNILPYHPNTIVDAIAV  120

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF DPANT  +LVPAMKNVYASL KY VA ++KVSSP+   A+Q+SYPPSSGSF+P+
Sbjct  121   GNEVFADPANTA-FLVPAMKNVYASLVKYDVASTIKVSSPVAMGALQSSYPPSSGSFEPD  179

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L+ PV+KPML FL+QTGSF M N YPF+AY  NTD ISLDYA+  DN G VD NNGLVYK
Sbjct  180   LVEPVMKPMLEFLQQTGSFFMANVYPFFAYIGNTDTISLDYALLRDNGGNVDGNNGLVYK  239

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SLFDAQ+DAVYAAI A+     +VV+ E+GWPS G+                  +GE G 
Sbjct  240   SLFDAQLDAVYAAITALGFPEMKVVVGETGWPSIGD------------------EGEVG-  280

Query  799   ASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNE  620
             AS  NAAAYNGNLVRRVLTGGGTPLRPD P+ VYLF+LFNENQK GP SERNYGLFYPNE
Sbjct  281   ASVENAAAYNGNLVRRVLTGGGTPLRPDVPIDVYLFALFNENQKPGPTSERNYGLFYPNE  340

Query  619   QKVYDVPLTLAALGNRGSKAQVP------------PTWCVANGDVGPERLQVALDYACGQ  476
             +KVYD+PLT AALG   SK +V              TWCVAN   G E+LQ ALDYACG+
Sbjct  341   EKVYDIPLTAAALGVASSKRKVAAAPAHRHRHHSGETWCVANEKAGAEKLQAALDYACGE  400

Query  475   GAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             G ADC PIQPG+TC++P+T+ AHAS+AFNSYYQKNAR  G+CYFGGA YVVTQPP+FG+C
Sbjct  401   GGADCRPIQPGATCHDPDTIGAHASFAFNSYYQKNARRRGSCYFGGAAYVVTQPPKFGTC  460

Query  295   EFPT  284
             +F T
Sbjct  461   DFAT  464



>ref|XP_010545233.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=461

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/482 (60%), Positives = 348/482 (72%), Gaps = 37/482 (8%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             +    I + L  S +  +++ SG +GINYGRIAD+LP+P KVV+LLK QGI +VKLYD+D
Sbjct  1     MAKFLISSLLLFSAIASTIADSGMVGINYGRIADNLPTPDKVVELLKKQGIDRVKLYDSD  60

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
              +VL AL+ SGI   VALPNE LS+AAA QSF+D WV++NI  Y   + IE +AVGNEVF
Sbjct  61    KSVLTALANSGIKVVVALPNELLSSAAADQSFSDNWVEANITEYYPATQIEAIAVGNEVF  120

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
             VDP NTT YLV AMKNV++SL KY +  S+K+SSPI  S++ +SYPPS+GSFKPEL+ PV
Sbjct  121   VDPNNTTEYLVQAMKNVHSSLMKYNLDRSIKISSPIALSSLASSYPPSAGSFKPELVEPV  180

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
             IKPML    QT S+LM+NAYPF+AY AN DKISLDYA+F +N G VD  NGL Y SLF+A
Sbjct  181   IKPMLDLFRQTSSYLMVNAYPFFAYTANADKISLDYALFKENPGTVDSGNGLKYNSLFEA  240

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             QVDAVYAA++A+      + ++E+GWPS G+ N        AA                 
Sbjct  241   QVDAVYAAMSAIGYDDVTLTVTETGWPSAGDENEIGAGAANAAAYNGN------------  288

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
                    L++RVLTG GTPLRP +PL+VYLF+LFNENQK GP SERNYGLFYPNE+KVYD
Sbjct  289   -------LIKRVLTGNGTPLRPKDPLNVYLFALFNENQKPGPTSERNYGLFYPNEEKVYD  341

Query  604   VPLTLAALGNRG-----SKAQVPP--------TWCVANGDVGPERLQVALDYACGQGAAD  464
             VPL +A  G R      SKAQVP         TWCVANG+   E+LQ ALDYACG+G AD
Sbjct  342   VPLGMA--GGRSTPVNESKAQVPTAARGGQARTWCVANGESEEEKLQKALDYACGEGGAD  399

Query  463   CGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             C PIQPG+TCY+PNTL AHASYAFNSYY KNARG GTC FGG  YVVTQPPRFG CEFPT
Sbjct  400   CRPIQPGATCYDPNTLEAHASYAFNSYYHKNARGTGTCDFGGVAYVVTQPPRFGKCEFPT  459

Query  283   GY  278
             G+
Sbjct  460   GH  461



>ref|XP_006283767.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
 gb|EOA16665.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
Length=432

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/449 (63%), Positives = 341/449 (76%), Gaps = 27/449 (6%)
 Frame = -3

Query  1603  IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLS  1424
             IG+NYGRIA++LPSP  VV L+KSQGI+++K+YDTD  VL AL+ SGI   VALPNE L 
Sbjct  2     IGVNYGRIANNLPSPKNVVNLVKSQGISRIKIYDTDKNVLTALANSGIKVIVALPNELLF  61

Query  1423  AAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKY  1250
             +AA++QSF D WVQ+N+  Y   + IE +AVGNEVFVDP NTTPYLVPAMKN++ SL KY
Sbjct  62    SAASNQSFADYWVQTNVTSYFPATEIEAIAVGNEVFVDPKNTTPYLVPAMKNIHTSLVKY  121

Query  1249  GVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFYA  1073
              +  ++K+SSP+  SA+  SYPPSSGSFKP+LI PVI+PML  L+ T S+LM+NAYPF+A
Sbjct  122   NLDKAIKISSPVALSALANSYPPSSGSFKPDLIEPVIRPMLDLLQHTSSYLMVNAYPFFA  181

Query  1072  YEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISES  893
             Y  N DKISLDYA+F +N G +D   GL Y SLFDAQVDAVYAA++AV     +V+++E+
Sbjct  182   YSGNADKISLDYALFQENAGNIDSGTGLKYNSLFDAQVDAVYAALSAVGFNDVKVMVTET  241

Query  892   GWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDE  713
             GWPS G+                  D E G AS  NAAAYNG LV+RVLTG GTPLRP +
Sbjct  242   GWPSVGD------------------DNELG-ASEANAAAYNGGLVKRVLTGNGTPLRPRD  282

Query  712   PLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP-----P  548
             PL+VYLF+LFNENQK GP SERNYGLFYPNE +VYDVP T  +    G+ A VP      
Sbjct  283   PLNVYLFALFNENQKPGPTSERNYGLFYPNEGRVYDVPFTSRSTPVNGNGAGVPVEQEGH  342

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             TWCV+NG++  E+LQ ALDYACG+G ADC PIQPG+TCY+P +L AHASYAFNSYYQKNA
Sbjct  343   TWCVSNGEMAKEKLQAALDYACGEGGADCRPIQPGATCYHPESLEAHASYAFNSYYQKNA  402

Query  367   RGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             R  GTC+FGGA +VVTQPPRFG CEFPTG
Sbjct  403   RRVGTCFFGGAAHVVTQPPRFGKCEFPTG  431



>ref|XP_006401482.1| hypothetical protein EUTSA_v10013478mg [Eutrema salsugineum]
 gb|ESQ42935.1| hypothetical protein EUTSA_v10013478mg [Eutrema salsugineum]
Length=461

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/476 (61%), Positives = 351/476 (74%), Gaps = 33/476 (7%)
 Frame = -3

Query  1669  SLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDST  1490
             SL IF+S   S +  + + SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDT+ +
Sbjct  7     SLLIFSSF--SAIPFTCADSGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTEKS  64

Query  1489  VLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVD  1316
             VL AL+ SGI   V+LPNE L+AAAA QS+TD WVQ N+  Y   + IE +AVGNEVFVD
Sbjct  65    VLTALANSGIKVVVSLPNENLAAAAADQSYTDNWVQENVKKYMPATDIEAIAVGNEVFVD  124

Query  1315  PANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIK  1139
             P NTT YLVPAM NV +SL K+ +  S+K+SSPI  SA+ +SYPPS+GSFKP+LI PVIK
Sbjct  125   PRNTTTYLVPAMTNVQSSLVKFNLDKSIKISSPIALSALASSYPPSAGSFKPDLIEPVIK  184

Query  1138  PMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQV  959
             PML  L +T S LM+NAYPF+AY AN DKISL+YA+F +N G VD  NGL Y +L DAQ+
Sbjct  185   PMLDLLRKTSSHLMVNAYPFFAYAANADKISLEYALFKENAGNVDSGNGLKYSNLLDAQI  244

Query  958   DAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAA  779
             DAV+AA+ AV     ++V++E+GWPS G+ N                  E G A + NAA
Sbjct  245   DAVFAAMAAVGFNDVKLVVTETGWPSAGDEN------------------EIG-AGSTNAA  285

Query  778   AYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVP  599
             AYNG LV+RVLTG GTPL+P EPL VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP
Sbjct  286   AYNGGLVKRVLTGNGTPLKPKEPLDVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVP  345

Query  598   LTLAALGN-RGSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQP  446
              T+ +      SK +VP         TWCVANG    E+LQ  LDYACG+G ADC  IQP
Sbjct  346   FTVRSTTPVNDSKEKVPVKSPSNVGQTWCVANGKTPKEKLQEGLDYACGEGGADCRQIQP  405

Query  445   GSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             G+TCYNP +L AHASYAFNSYYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  406   GATCYNPESLEAHASYAFNSYYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPTGH  461



>ref|XP_006386788.1| hypothetical protein POPTR_0002s21700g [Populus trichocarpa]
 gb|ERP64585.1| hypothetical protein POPTR_0002s21700g [Populus trichocarpa]
Length=453

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/474 (60%), Positives = 350/474 (74%), Gaps = 38/474 (8%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             L  +CIF S          + +GSIG+NYGRIA++LP+ AKVVQL+KSQG+ ++K+YDTD
Sbjct  10    LVLVCIFTS----------ADAGSIGVNYGRIANNLPAAAKVVQLVKSQGLERIKVYDTD  59

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVF  1322
               VL ALSG GI  TV LPNE L +AA +  F   WVQ N+V Y   + IE +AVGNEVF
Sbjct  60    PIVLKALSGCGIKVTVDLPNELLYSAAKNPYFARTWVQKNVVAYHPSTQIEAIAVGNEVF  119

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
             VDP NTT +L+PAM+N++ +L K+ +  S+K+SSP+  SA+Q+SYP S+GSF+PELI PV
Sbjct  120   VDPHNTTKFLIPAMRNIHQALVKFNLHSSIKISSPVALSALQSSYPSSAGSFRPELIEPV  179

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
              KPML FL QTGS+LM+NAYPF+AYE+N+D ISLDYA+  +N GVVD  NGL Y SLFDA
Sbjct  180   FKPMLDFLRQTGSYLMVNAYPFFAYESNSDVISLDYALLRENPGVVDSGNGLRYFSLFDA  239

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV+AA++A+K    ++V++E+GWPSKG+ N                  E G +   N
Sbjct  240   QIDAVFAALSALKYDDIKIVVTETGWPSKGDEN------------------EIG-SGVEN  280

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNLVRR+LTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYG FYP+EQKVYD
Sbjct  281   AAAYNGNLVRRILTGGGTPLRPQADLTVYLFALFNENEKDGPTSERNYGFFYPDEQKVYD  340

Query  604   VPLTLAAL-----GNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
             +P T+  L      NR S      TWCVAN D G ++LQ  LD+ACG+G ADC PIQPG+
Sbjct  341   IPFTVEGLKSYKDSNRSSDTG-RKTWCVANPDAGKQKLQAGLDFACGEGGADCRPIQPGA  399

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             TCY+PNTLVAH+S+AFNSYYQK  RG G CYFGGA YVVTQ P+FG CEFPTGY
Sbjct  400   TCYDPNTLVAHSSFAFNSYYQKQGRGMGDCYFGGAAYVVTQEPKFGQCEFPTGY  453



>gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 348/480 (73%), Gaps = 42/480 (9%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
              FL L    ++ +GSIG+NYGRIA++LPS  KVVQLLKSQG+ +VK++D D  VL ALSG
Sbjct  9     FFLLLCIFCIADAGSIGVNYGRIANNLPSAVKVVQLLKSQGLQRVKVFDADPAVLKALSG  68

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             S I  TV LPNE L +AA  QSF   WVQ NI  Y   + IE +AVGNEVFVDP NTT +
Sbjct  69    SSIKVTVDLPNELLYSAAKRQSFALSWVQRNIAAYYPSTQIEAIAVGNEVFVDPHNTTKF  128

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             L+PAMKN++ +L K  +   +K+SSPI  SA+Q+SYP S+G+F+ ELI PV KP+L FL 
Sbjct  129   LIPAMKNIHQALEKLNLHSDIKISSPIALSALQSSYPSSAGAFRSELIEPVFKPLLDFLR  188

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QTGS+LM+NAYPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA+
Sbjct  189   QTGSYLMVNAYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAAM  248

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +A+K    R+V++E+GWPSKG+ N                  E G AS  NAAAYNGNL+
Sbjct  249   SALKYDDIRMVVTETGWPSKGDEN------------------ELG-ASLQNAAAYNGNLI  289

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RR+LTGGGTPLRP   L+VYLF+LFNENQK+GP SERNYGLFYPNEQKVYD+P T+  L 
Sbjct  290   RRILTGGGTPLRPKADLTVYLFALFNENQKNGPTSERNYGLFYPNEQKVYDIPFTVEGLK  349

Query  577   NRG--------------------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCG  458
             N                      SK+    TWCVAN +VG E+LQ  LD+ACG+G ADC 
Sbjct  350   NYKDNPSPASGGQQVTNPVNGGVSKSTTGNTWCVANSEVGKEKLQAGLDFACGEGGADCR  409

Query  457   PIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PIQPG++CYNPNT+ AHAS+AFNSYYQKN R  GTCYFGG+  VVTQ P++G CEFPTGY
Sbjct  410   PIQPGASCYNPNTIEAHASFAFNSYYQKNGRKAGTCYFGGSALVVTQAPKYGECEFPTGY  469



>ref|NP_194413.2| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEE85258.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=455

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/469 (62%), Positives = 351/469 (75%), Gaps = 35/469 (7%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             L LS L    + SG +G+NYGRIA++LPSP KVV LLKSQGI ++K++DTD  VL AL+ 
Sbjct  10    LILSFLSAIDAHSGMVGVNYGRIANNLPSPEKVVNLLKSQGINRIKIFDTDKNVLTALAN  69

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             S I   VALPNE LS+AA+ QSF D W++++I+PY   + IE +AVGNEVFVDP   TPY
Sbjct  70    SKIKVIVALPNELLSSAASHQSFADNWIKTHIMPYFPATEIEAIAVGNEVFVDPT-ITPY  128

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             LV AMKN++ SL KY +  ++K+SSPI  SA+  SYPPSSGSFKPELI PV+KPML+ L+
Sbjct  129   LVNAMKNIHTSLVKYKLDKAIKISSPIALSALANSYPPSSGSFKPELIEPVVKPMLALLQ  188

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QT S+LM+NAYPF+AY AN DKISLDYA+F +N G +D   GL Y SLFDAQ+DAVYAA+
Sbjct  189   QTSSYLMVNAYPFFAYAANADKISLDYALFKENAGNIDSGTGLKYNSLFDAQIDAVYAAL  248

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +AV     +V+++E+GWPS G+ N                  E G AS  NAAAYN  LV
Sbjct  249   SAVGFKGVKVMVTETGWPSVGDEN------------------EIG-ASESNAAAYNAGLV  289

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-  581
             +RVLTG GTPLRP EPL+VYLF+LFNENQK GP SERNYGLFYPNE KVY+VP T  +  
Sbjct  290   KRVLTGKGTPLRPTEPLNVYLFALFNENQKPGPTSERNYGLFYPNEGKVYNVPFTKKSTT  349

Query  580   ---GNRGSKAQVP-----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
                GNRG   +VP      TWCV+NG+V  E+LQ ALDYACG+G ADC PIQPG+TCY+P
Sbjct  350   PVNGNRG---KVPVTHEGHTWCVSNGEVAKEKLQEALDYACGEGGADCRPIQPGATCYHP  406

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              +L AHASYAFNSYYQKN+R  GTC+FGGA +VVTQPPR+G CEFPTG+
Sbjct  407   ESLEAHASYAFNSYYQKNSRRVGTCFFGGAAHVVTQPPRYGKCEFPTGH  455



>ref|XP_009361042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Pyrus x 
bretschneideri]
Length=465

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/461 (63%), Positives = 351/461 (76%), Gaps = 36/461 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++GINYGRIAD+LP P KVV LLKSQGI KVKLYDTD+TVL AL+ SGIS  VALPN+
Sbjct  25    TGTVGINYGRIADNLPPPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPND  84

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA+  SF D+WVQSNI  Y  K+ IE +AVGNEVFVDP NTT +LVPA+KN+ +SL
Sbjct  85    LLSSAASDPSFADKWVQSNISHYHPKTQIEAIAVGNEVFVDPNNTTQFLVPAIKNIQSSL  144

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY ++ S+K+SSPI  S++ +SYPPS+G+FKP+LI PVIKP+L FL QT S+LM+NAYP
Sbjct  145   VKYNLS-SIKLSSPIALSSLNSSYPPSAGAFKPDLIEPVIKPLLEFLTQTSSYLMINAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+ +DKISLDYA+F  N G  D  NGL Y SL +AQ+DAV+AA++AV  G  +VV+
Sbjct  204   FFAYESTSDKISLDYALFRTNPGNPDSGNGLKYYSLLEAQIDAVFAAMSAVGHGDVKVVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G   A NAAAYNGNLVRRVLTGGGTPL+
Sbjct  264   TETGWPSKGDEN------------------EIGSGQA-NAAAYNGNLVRRVLTGGGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-GNRGS-----KA  560
             P +PL+VYLF+LFNE+QK GP SERNYGLFYP+E KVY + LT A L G++ S     K 
Sbjct  305   PKDPLNVYLFALFNEDQKPGPTSERNYGLFYPDETKVYGITLTAAGLSGDQSSPANESKV  364

Query  559   QVPP-------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHAS  401
              VP        TWCVAN   G E+LQ ALDYACG+G ADC PIQ GSTC+ PNTL AHAS
Sbjct  365   LVPTASPSAGSTWCVANAKAGEEKLQAALDYACGEGGADCRPIQEGSTCFTPNTLEAHAS  424

Query  400   YAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YAFNS+YQK ARG GTC FGGA YVV QPP++G+CEFPTGY
Sbjct  425   YAFNSFYQKRARGTGTCNFGGAAYVVAQPPKYGTCEFPTGY  465



>ref|XP_006280442.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
 gb|EOA13340.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
Length=457

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/455 (63%), Positives = 340/455 (75%), Gaps = 30/455 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIA++LP+P KVVQLLKSQGI +VKLYDTD++VL AL+ SGI   V+LPNE
Sbjct  21    SGMIGVNYGRIANNLPTPEKVVQLLKSQGINRVKLYDTDTSVLTALANSGIKVVVSLPNE  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA Q +TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAM NV +SL
Sbjct  81    YLASAAADQKYTDDWVQQNINKYIPATDIEAIAVGNEVFVDPRNTTKYLVPAMTNVQSSL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S +M+NAYP
Sbjct  141   VKFSLDKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHIMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  201   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  261   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L+  +      K +V P  
Sbjct  302   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSGKSTPVNDEKEKVTPVK  361

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCY+P +L AHASYAFNS
Sbjct  362   PSHVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNS  421

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             YYQKNARG GTC F GA YVV+QPP++G CEFPTG
Sbjct  422   YYQKNARGTGTCDFKGAAYVVSQPPKYGKCEFPTG  456



>emb|CDY17308.1| BnaA10g09420D [Brassica napus]
Length=449

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/455 (62%), Positives = 341/455 (75%), Gaps = 25/455 (5%)
 Frame = -3

Query  1633  LRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGIST  1454
             + ++ + SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDTD +VL AL+ SGI  
Sbjct  17    ISYTHADSGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTDKSVLTALANSGIKV  76

Query  1453  TVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAM  1280
              V+LPNE L+AA+A QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLV AM
Sbjct  77    VVSLPNENLAAASADQSYTDNWVQENVKKYTPATDIEAIAVGNEVFVDPRNTTTYLVQAM  136

Query  1279  KNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSF  1103
             KNV +SL K+ +  S+KVSSPI  SA+  SYPPSSGSFKP+LI PVIKPML  L +T S 
Sbjct  137   KNVQSSLVKFNLDESIKVSSPIALSALANSYPPSSGSFKPDLIEPVIKPMLDLLRKTSSH  196

Query  1102  LMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKP  923
             +M+NAYPF+AY AN DKISLDYA+F +N G VD  NGL Y +L DAQ+DAV+AA+ AV  
Sbjct  197   IMVNAYPFFAYAANADKISLDYALFKENSGNVDSGNGLKYNNLLDAQIDAVFAAMAAVGF  256

Query  922   GHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLT  743
                ++V++E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLT
Sbjct  257   NDVKLVVTETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLT  297

Query  742   GGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSK  563
             G GTPL+P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  +      K
Sbjct  298   GNGTPLKPKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSTPVNDGK  357

Query  562   AQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSY  383
              +   TWCVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHASYAFNSY
Sbjct  358   DK---TWCVANGKTTKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHASYAFNSY  414

Query  382   YQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  415   YQKNARGVGTCDFGGAAYVVSQPPKYGKCEFPTGH  449



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/463 (63%), Positives = 353/463 (76%), Gaps = 33/463 (7%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             S++ SGS+GINYGRIAD+LP+P KVV+LLK+QGI +VKLYDTD TVL AL+ S I   VA
Sbjct  19    SIADSGSVGINYGRIADNLPTPEKVVELLKTQGIHRVKLYDTDKTVLTALANSSIKVVVA  78

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNV  1271
             LPNE LS+AAA QSF D+WV++NI  Y   + IE +AVGNEVFVDP NTT +LV AMKNV
Sbjct  79    LPNELLSSAAADQSFADKWVEANITKYYPSTEIEAIAVGNEVFVDPNNTTEFLVQAMKNV  138

Query  1270  YASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLML  1094
             ++SL KY +  S+KVSSPI  S++ +SYPPS+GSFK +L+ PVIKPML    QT S+LM+
Sbjct  139   HSSLVKYDLDRSIKVSSPIALSSLASSYPPSAGSFKSDLVEPVIKPMLDLFRQTSSYLMV  198

Query  1093  NAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF  914
             NAYPF+AY  N +KISLDYA+F +N G VD  NGL Y SLF+AQ+DAV+AA++A+     
Sbjct  199   NAYPFFAYAGNAEKISLDYALFRENPGSVDSGNGLKYNSLFEAQIDAVFAAMSAIGYDDV  258

Query  913   RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGG  734
             ++ ++E+GWPS G+ N                      A A NAAAYNGNL++RVLTG G
Sbjct  259   KLTVTETGWPSAGDENEVG-------------------AGAANAAAYNGNLIKRVLTGNG  299

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN---RGSK  563
             TPLRP +PL+VYLF+LFNENQK GP SERNYGLFYP+E+KVYDVPL +A  G+     SK
Sbjct  300   TPLRPKDPLNVYLFALFNENQKPGPTSERNYGLFYPSEEKVYDVPLGMAGAGSTPVNESK  359

Query  562   AQVPPT--------WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAH  407
             AQVP T        WCVANG +G E+LQ ALDYACG+G ADC PIQPG+TCY+PNTL AH
Sbjct  360   AQVPTTERGVQSRTWCVANGKLGEEKLQKALDYACGEGGADCRPIQPGATCYDPNTLEAH  419

Query  406   ASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             ASYAFNSYYQKNARG GTC FGG+ YVVTQPPRFG CEFPTG+
Sbjct  420   ASYAFNSYYQKNARGVGTCDFGGSAYVVTQPPRFGKCEFPTGH  462



>ref|XP_004140121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 ref|XP_004156096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 gb|KGN47963.1| hypothetical protein Csa_6G421570 [Cucumis sativus]
Length=476

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/473 (61%), Positives = 347/473 (73%), Gaps = 47/473 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SGSIG+NYGRI +DLPS  KVV+LLKS G+ +VK+YDTD  VL ALSGSGI  TV LPNE
Sbjct  23    SGSIGVNYGRIGNDLPSAVKVVKLLKSHGLQRVKVYDTDPAVLKALSGSGIKVTVDLPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L AAA   +F   WV+ N+  Y   + IE +AVGNEVFVDP NTT +LVPAMKN++ +L
Sbjct  83    LLFAAAKRLTFAYTWVEKNVAAYYPSTEIEAIAVGNEVFVDPHNTTSFLVPAMKNIHQAL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  ++KVSSPI  SA+Q SYP S+GSF+PEL+  V +PML FL QTGS+LM+NAYP
Sbjct  143   VKYNLHSNIKVSSPIALSALQNSYPSSAGSFRPELVETVFRPMLEFLRQTGSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+NTD ISLDYA+F DN GVVD  +G  Y +LFDAQ+DAV+AA++A+K    ++V+
Sbjct  203   FFAYESNTDVISLDYALFRDNPGVVDAGSGYRYFNLFDAQIDAVFAAMSALKYDDIKMVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+L+GGGTPLR
Sbjct  263   TETGWPSKGDEN------------------EIG-ASVENAAAYNGNLVRRILSGGGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-------------  581
             P   L+VYLF+LFNEN+K+GP SERNYGLFYPNE+KVYD+P T   L             
Sbjct  304   PKADLTVYLFALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVS  363

Query  580   -----------GNRG-SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGST  437
                        G+ G SK+Q   TWCVA+G+ G E+LQ  LDYACG+G ADC PIQ G+T
Sbjct  364   GGNAPTAPPASGDGGVSKSQTGNTWCVASGEAGKEKLQSGLDYACGEGGADCRPIQVGAT  423

Query  436   CYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             CYNPNTL AHASYAFNSYYQKN+R  GTCYFGGA YVVTQPP++GSCEFPTGY
Sbjct  424   CYNPNTLEAHASYAFNSYYQKNSRKVGTCYFGGAAYVVTQPPKYGSCEFPTGY  476



>ref|XP_002302861.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE82134.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=470

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/490 (58%), Positives = 352/490 (72%), Gaps = 53/490 (11%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             L  +CIF S          + +GSIG+NYGRIA++LP+ AKVVQL+KSQG+ ++K+YDTD
Sbjct  10    LVLVCIFTS----------ADAGSIGVNYGRIANNLPAAAKVVQLVKSQGLERIKVYDTD  59

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVF  1322
               VL ALSG GI  TV LPNE L +AA +  F   WVQ N+V Y   + IE +AVGNEVF
Sbjct  60    PIVLKALSGCGIKVTVDLPNELLYSAAKNPYFARTWVQKNVVAYHPSTQIEAIAVGNEVF  119

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
             VDP NTT +L+PAM+N++ +L K+ +  S+K+SSP+  SA+Q+SYP S+GSF+PELI PV
Sbjct  120   VDPHNTTKFLIPAMRNIHQALVKFNLHSSIKISSPVALSALQSSYPSSAGSFRPELIEPV  179

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
              KPML FL QTGS+LM+NAYPF+AYE+N+D ISLDYA+  +N GVVD  NGL Y SLFDA
Sbjct  180   FKPMLDFLRQTGSYLMVNAYPFFAYESNSDVISLDYALLRENPGVVDSGNGLRYFSLFDA  239

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV+AA++A+K    ++V++E+GWPSKG+ N                  E G +   N
Sbjct  240   QIDAVFAALSALKYDDIKIVVTETGWPSKGDEN------------------EIG-SGVEN  280

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNLVRR+LTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYG FYP+EQKVYD
Sbjct  281   AAAYNGNLVRRILTGGGTPLRPQADLTVYLFALFNENEKDGPTSERNYGFFYPDEQKVYD  340

Query  604   VPLTLAAL-----GNRGS----------------KAQVPPTWCVANGDVGPERLQVALDY  488
             +P T+  L      NR S                K+    TWCVAN D G ++LQ  LD+
Sbjct  341   IPFTVEGLKSYKDSNRSSDTGSHQVAAPVNGGVSKSTTGKTWCVANPDAGKQKLQAGLDF  400

Query  487   ACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPR  308
             ACG+G ADC PIQPG+TCY+PNTLVAH+S+AFNSYYQK  RG G CYFGGA YVVTQ P+
Sbjct  401   ACGEGGADCRPIQPGATCYDPNTLVAHSSFAFNSYYQKQGRGMGDCYFGGAAYVVTQEPK  460

Query  307   FGSCEFPTGY  278
             FG CEFPTGY
Sbjct  461   FGQCEFPTGY  470



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/472 (61%), Positives = 343/472 (73%), Gaps = 31/472 (7%)
 Frame = -3

Query  1663  CIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVL  1484
             C+  S F S +  + + SG IG+NYGRIA++LPSP  VV LLKSQGI ++K+YDTD  VL
Sbjct  15    CLILSFF-STISITQASSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIYDTDKNVL  73

Query  1483  DALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA  1310
              AL+ S I   V LPNE LS  A+ QSFTD+WV+ N+  +   + +E +AVGNEVFVDP 
Sbjct  74    TALAHSRIKVVVCLPNELLSRTASDQSFTDKWVRHNVRKHFPATEVEAIAVGNEVFVDPK  133

Query  1309  NTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPM  1133
             NTTPYLV AMKN++ASL KY +  S+K+SSPI  SA+  SYPPSSGSFKP+L+ PVIKPM
Sbjct  134   NTTPYLVRAMKNIHASLVKYNLDKSIKISSPIALSALANSYPPSSGSFKPDLVEPVIKPM  193

Query  1132  LSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDA  953
             L  L +T S+LM+NAYPF+AY  N DKISLDYA+F DN G VD  NGL Y SLFDAQ+DA
Sbjct  194   LDLLRKTSSYLMVNAYPFFAYSGNADKISLDYALFRDNAGTVDSGNGLRYNSLFDAQLDA  253

Query  952   VYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAY  773
             VYAA++AV     +V+++E+GWPS G                   DG    AS  NAAAY
Sbjct  254   VYAAMSAVGFNDVKVMVTETGWPSAG-------------------DGNEIGASESNAAAY  294

Query  772   NGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPL-  596
             NG LV+RVL G GTPLRP EPL+V+LF+LFNENQK GP SERNYGLFYPNE+KVY VP  
Sbjct  295   NGGLVKRVLNGNGTPLRPKEPLNVFLFALFNENQKPGPTSERNYGLFYPNERKVYAVPFA  354

Query  595   -TLAALGNRGSKAQVP-----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTC  434
              T +   NR +K Q P      TWCV+NGD   E+LQ ALDYACG+G ADC PIQPG+TC
Sbjct  355   ATTSTPVNR-NKEQAPVAHEGETWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATC  413

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             Y+P +L AHAS+AFNSYYQKNAR  GTCYFGG  +VVTQ PR+G C+FPT Y
Sbjct  414   YHPKSLEAHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYGKCKFPTEY  465



>ref|XP_002320484.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ABK92452.1| unknown [Populus trichocarpa]
 gb|EEE98799.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=470

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/469 (61%), Positives = 349/469 (74%), Gaps = 43/469 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GS+G+NYGRIA++LPS  KVV L+KSQG+ +VK+YDTD  VL ALSGSGI  TV LPN+
Sbjct  21    AGSVGVNYGRIANNLPSAVKVVNLVKSQGLERVKVYDTDPAVLKALSGSGIKVTVDLPNQ  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   +F   WVQ NIV Y   + IE++AVGNEVFVDP NTT +L+PAMKN++ +L
Sbjct  81    LLYSAAKYPNFARSWVQKNIVAYHPSTQIESIAVGNEVFVDPHNTTKFLIPAMKNIHQAL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+KVSSPI  SA+Q+SYP S+GSF+PELI PV KPML FL QTGS+LM+NAYP
Sbjct  141   VKFNLHSSIKVSSPIALSALQSSYPSSAGSFRPELIEPVFKPMLDFLRQTGSYLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+N+D ISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K    ++V+
Sbjct  201   FFAYESNSDVISLDYALFRENPGVVDSGNGLKYFNLFDAQIDAVFAALSALKYDDVKMVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPL+
Sbjct  261   TETGWPSKGDEN------------------EVG-ASVENAAAYNGNLVRRILTGGGTPLK  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-----------  575
             P   L+VYLF+LFNEN+K GP SERNYGLFYP++QKVYD+P T+  L N           
Sbjct  302   PQADLTVYLFALFNENEKDGPTSERNYGLFYPDQQKVYDIPFTVEGLKNYKAPSRSPVSG  361

Query  574   --------RG--SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
                     RG  SK+    TWCVAN D G E+LQ ALD+ACG+G ADC PIQP +TCY+P
Sbjct  362   GQQVSAPVRGGVSKSTTGNTWCVANPDAGKEKLQAALDFACGEGGADCRPIQPDATCYSP  421

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             NTLVAH+S+AFNSYYQK  RG G CYFGGA +VVTQ P+FG CEFPTGY
Sbjct  422   NTLVAHSSFAFNSYYQKKGRGMGDCYFGGAAFVVTQEPKFGVCEFPTGY  470



>ref|XP_011009684.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=470

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/490 (58%), Positives = 352/490 (72%), Gaps = 53/490 (11%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             L  +CIF S          + +GSIG+NYGRIA++LP+  KVVQL+K QG+ ++K+YDTD
Sbjct  10    LLLVCIFTS----------ADAGSIGVNYGRIANNLPAAVKVVQLVKFQGLERIKVYDTD  59

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVF  1322
               VL ALSG GI  TV LPNE L +AA + SF   WVQ N+V Y   + IE +AVGNEVF
Sbjct  60    PVVLKALSGCGIKVTVDLPNELLYSAAKNPSFARTWVQKNVVAYHPSTQIEAIAVGNEVF  119

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
             VDP NTT +L+PAM+N++ +L K+ +  S+KVSSP+  SA+Q+SYP S+GSF+PELI PV
Sbjct  120   VDPHNTTKFLIPAMRNIHQALVKFNLHSSIKVSSPVALSALQSSYPSSAGSFRPELIEPV  179

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
              KPML FL QTGS++M+NAYPF+AYE+N+D ISLDYA+  +N GVVD  NGL Y SLFDA
Sbjct  180   FKPMLDFLRQTGSYVMVNAYPFFAYESNSDVISLDYALLRENPGVVDSGNGLRYFSLFDA  239

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV+AA++A+K    ++V++E+GWPSKG+ N                  E G +   N
Sbjct  240   QIDAVFAAMSALKYDDIKIVVTETGWPSKGDEN------------------EIG-SGVEN  280

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNLVRR+LTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYGLFYP+EQKVYD
Sbjct  281   AAAYNGNLVRRILTGGGTPLRPKADLTVYLFALFNENEKDGPTSERNYGLFYPDEQKVYD  340

Query  604   VPLTLAAL-----GNRGS----------------KAQVPPTWCVANGDVGPERLQVALDY  488
             +P T+  L      NR S                K+    TWCVAN D G ++LQ  LD+
Sbjct  341   IPFTVEGLKSYKDSNRSSDTGSHQVAAPVNGGVSKSTTGKTWCVANPDAGKQKLQAGLDF  400

Query  487   ACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPR  308
             ACG+G ADC PIQPG+TCY+PNTLVAH+S+AFNSYYQK  RG G CYFGGA YVVTQ P+
Sbjct  401   ACGEGGADCRPIQPGATCYDPNTLVAHSSFAFNSYYQKQGRGMGDCYFGGAAYVVTQEPK  460

Query  307   FGSCEFPTGY  278
             FG CEFPTGY
Sbjct  461   FGQCEFPTGY  470



>ref|XP_011044921.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=476

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/468 (61%), Positives = 351/468 (75%), Gaps = 44/468 (9%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G+IG+NYGR+A++LP+PA+VV LLKSQGI ++KLYDTDS VL AL+GS I+  VALPNE 
Sbjct  29    GTIGVNYGRVANNLPAPAEVVSLLKSQGINRIKLYDTDSDVLTALAGSSINVVVALPNEL  88

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+ AA QSF D WV++NI  +  ++ IE +AVGNEVFVDP NTTP+LVPAMKNV+ SL 
Sbjct  89    LSSVAADQSFADSWVKANISQHFPQTKIEAIAVGNEVFVDPKNTTPFLVPAMKNVHNSLV  148

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             K+ ++ S+K+SSPI  SA+Q+SYP S+GSFK ELI PVIKPML FL QTGS+LM+NAYPF
Sbjct  149   KFNLS-SIKISSPIALSALQSSYPSSAGSFKTELIGPVIKPMLDFLRQTGSYLMINAYPF  207

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AY AN+D ISLDYA+  +N+GVVD  NGL Y SL +AQ+DAV++A++A++    ++V++
Sbjct  208   FAYAANSDVISLDYALLKENKGVVDSGNGLKYYSLLEAQLDAVHSAMSAIQYNDVKMVVT  267

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPS G+ N                  E G   A NAA+YNGNLV+RVLTG GTPLRP
Sbjct  268   ETGWPSLGDEN------------------EIGAGEA-NAASYNGNLVKRVLTGNGTPLRP  308

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS----KAQVP  551
              EPL+VYLF+LFNEN+K GP SERNYGLFYP++++VYD+PLTL  L N  S    K+  P
Sbjct  309   QEPLNVYLFALFNENEKPGPTSERNYGLFYPSKKRVYDIPLTLEQLENGQSMPVNKSNSP  368

Query  550   P-----------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPN  422
                               TWCVANG+ G E+LQ  LDYACG+G ADC PIQ GSTCYNPN
Sbjct  369   APSVQSGGDVSTTSSAGQTWCVANGNAGAEKLQAGLDYACGEGGADCRPIQAGSTCYNPN  428

Query  421   TLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             T+ AHASYAFNSYYQK  R  GTC FGGA YVVTQ P FG+C+FPTGY
Sbjct  429   TVEAHASYAFNSYYQKKVRAAGTCDFGGAAYVVTQHPSFGNCKFPTGY  476



>ref|XP_010433433.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/473 (60%), Positives = 350/473 (74%), Gaps = 29/473 (6%)
 Frame = -3

Query  1684  FPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLY  1505
              P    LC+F ++  +      + SG IG+NYGRIA++LPSP  VV LLKSQGI+++K+Y
Sbjct  6     LPCFLILCLFPTISFTH-----AESGMIGVNYGRIANNLPSPKNVVSLLKSQGISRIKIY  60

Query  1504  DTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGN  1331
             DTD  VL AL+ SGI   VALPNE LS+A+++QSF DRW+Q+N+  +   + IE +AVGN
Sbjct  61    DTDKNVLAALANSGIKVIVALPNELLSSASSNQSFADRWIQTNVASHFPATEIEAIAVGN  120

Query  1330  EVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI  1151
             EVFVDP NTTPYL PAMKN++ SL K+ +  ++K+SSP+  SA+  SYPPSSGSFKP+LI
Sbjct  121   EVFVDPKNTTPYLDPAMKNIHTSLVKHNLDKAIKISSPVALSALANSYPPSSGSFKPDLI  180

Query  1150  -PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSL  974
              PVIKPML  L++T S+LM+NAYPF+AY AN DKISLDYA+F +N G +D   GL Y +L
Sbjct  181   EPVIKPMLDLLQRTSSYLMVNAYPFFAYSANADKISLDYALFQENSGNIDSRTGLKYNNL  240

Query  973   FDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPAS  794
             FDAQ+DAVYAA++AV     +V+++E+GWPS G+ N                  E G AS
Sbjct  241   FDAQLDAVYAAMSAVGFNDVKVMVTETGWPSVGDEN------------------EIG-AS  281

Query  793   AVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQK  614
                AAAYN  LV+RVLT  GTPLRP E L+VYLF+L NENQK GP SERNYGLFYPNE K
Sbjct  282   EPYAAAYNVGLVKRVLTDNGTPLRPRESLNVYLFALLNENQKPGPTSERNYGLFYPNEGK  341

Query  613   VYDVPLT-LAALGNRGSKAQVPPT-WCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
             VYDVP T  +     G   +VP + WCV+NG++  +RLQ ALDYACG+G ADC PIQPG+
Sbjct  342   VYDVPFTARSTFPVNGKGDEVPVSKWCVSNGEMARDRLQAALDYACGEGGADCRPIQPGA  401

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             TCY+P TL AHASYAFNSYYQKNARG GTCYFGGA +VVTQPPRFG CEFPTG
Sbjct  402   TCYHPETLEAHASYAFNSYYQKNARGVGTCYFGGAAHVVTQPPRFGKCEFPTG  454



>ref|XP_009334153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/460 (63%), Positives = 345/460 (75%), Gaps = 36/460 (8%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G++GINYGRIAD+LP P KVV L KSQGI KVKLYDTD+ VL AL+ SGI   VA+PNE 
Sbjct  24    GTVGINYGRIADNLPPPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNEL  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+AA+  SF D+WVQSNI  Y  K+ IE +AVGNEVF DP NTT +LVPA+KN+ +SL 
Sbjct  84    LSSAASDPSFADKWVQSNISQYHPKTQIEAIAVGNEVFADPNNTTQFLVPAIKNIQSSLV  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY ++ S+K+SSP   SA+ +SYPPS+G+FKP+LI PVIKP L FL QT S+LM+NAYPF
Sbjct  144   KYNLS-SIKLSSPFALSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINAYPF  202

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AYE+ +DKISLDYA+F  N G  D  NGL Y SL DAQ+DAV+AA++AV  G  ++V++
Sbjct  203   FAYESTSDKISLDYALFRTNPGNPDSGNGLKYYSLLDAQIDAVFAAMSAVGYGDIKLVVT  262

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPS G+ N                  E G A   NAAAYNGNLV+RVLTGGGTPL+P
Sbjct  263   ETGWPSNGDEN------------------EIG-AGKANAAAYNGNLVKRVLTGGGTPLKP  303

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN------RGSKAQ  557
             ++PL+VYLF+LFNE+QK+GP SERNYGLFYP+E KVYD+PLT+A L          SK Q
Sbjct  304   NDPLNVYLFALFNEDQKTGPTSERNYGLFYPDETKVYDIPLTVAGLSGAQSSPANKSKVQ  363

Query  556   VPP-------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
             VP        TWCVANG  G E+LQ ALDYACG+G ADC  IQ GSTC+NPNTL AHASY
Sbjct  364   VPAASPSAGNTWCVANGKAGEEKLQAALDYACGEGGADCRSIQEGSTCFNPNTLEAHASY  423

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             AFNS+YQK ARG GTC FGGA YVV QPP +G+CEFPT Y
Sbjct  424   AFNSFYQKKARGTGTCDFGGAAYVVAQPPSYGTCEFPTRY  463



>ref|XP_009120040.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Brassica 
rapa]
Length=462

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/458 (62%), Positives = 338/458 (74%), Gaps = 32/458 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDTD +VL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTDKSVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L+AA+A QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLV AMKNV +SL
Sbjct  84    NLAAASADQSYTDNWVQENVKKYTPATDIEAIAVGNEVFVDPRNTTTYLVQAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+KVSSPI  SA+  SY PSSGSFKP+LI PVIKPML  L +T S +M+NAYP
Sbjct  144   VKFNLDESIKVSSPIALSALANSYQPSSGSFKPDLIEPVIKPMLDLLRKTSSHIMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y +L DAQ+DAV+AA+ AV     ++V+
Sbjct  204   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNNLLDAQIDAVFAAMAAVGFNDVKLVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP---  551
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  +      K +VP   
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSTPVNDGKDKVPVKT  364

Query  550   -------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAF  392
                     TWCVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHASYAF
Sbjct  365   PSSHVGGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHASYAF  424

Query  391   NSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             NSYYQKNARG GTC FGGA YVV+QPP++G CEFPTG+
Sbjct  425   NSYYQKNARGVGTCDFGGAAYVVSQPPKYGKCEFPTGH  462



>ref|XP_009348307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/460 (63%), Positives = 345/460 (75%), Gaps = 36/460 (8%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G++GINYGRIAD+LP P KVV L KSQGI KVKLYDTD+ VL AL+ SGI   VA+PNE 
Sbjct  24    GTVGINYGRIADNLPPPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNEL  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+AA+  SF D+WVQSNI  Y  K+ IE +AVGNEVF DP NTT +LVPA+KN+ +SL 
Sbjct  84    LSSAASDPSFADKWVQSNISQYHPKTQIEAIAVGNEVFADPNNTTQFLVPAIKNIQSSLV  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY ++ S+K+SSP   SA+ +SYPPS+G+FKP+LI PVIKP L FL QT S+LM+NAYPF
Sbjct  144   KYNLS-SIKLSSPFALSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINAYPF  202

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AYE+ +DKISLDYA+F  N G  D  NGL Y SL DAQ+DAV+AA++AV  G  ++V++
Sbjct  203   FAYESTSDKISLDYALFRTNPGNPDSGNGLKYYSLLDAQIDAVFAAMSAVGYGDIKLVVT  262

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPS G+ N                  E G A   NAAAYNGNLV+RVLTGGGTPL+P
Sbjct  263   ETGWPSNGDEN------------------EIG-AGKANAAAYNGNLVKRVLTGGGTPLKP  303

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN------RGSKAQ  557
             ++PL+VYLF+LFNE+QK+GP SERNYGLFYP+E KVYD+PLT+A L          SK Q
Sbjct  304   NDPLNVYLFALFNEDQKTGPTSERNYGLFYPDETKVYDIPLTVAGLSGAQSSPANESKVQ  363

Query  556   VPP-------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
             VP        TWCVANG  G E+LQ ALDYACG+G ADC  IQ GSTC+NPNTL AHASY
Sbjct  364   VPAASPSAGNTWCVANGKAGEEKLQAALDYACGEGGADCRSIQEGSTCFNPNTLEAHASY  423

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             AFNS+YQK ARG GTC FGGA YVV QPP +G+CEFPT Y
Sbjct  424   AFNSFYQKKARGTGTCDFGGAAYVVAQPPSYGTCEFPTRY  463



>ref|XP_007212383.1| hypothetical protein PRUPE_ppa005210mg [Prunus persica]
 gb|EMJ13582.1| hypothetical protein PRUPE_ppa005210mg [Prunus persica]
Length=472

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/461 (62%), Positives = 346/461 (75%), Gaps = 35/461 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G+IGINYGRIA++LP P KVV LLKSQGI KVKLYDTD+ VL AL+ SGI+  VALPNE
Sbjct  31    TGTIGINYGRIANNLPPPEKVVALLKSQGINKVKLYDTDAAVLTALANSGINVVVALPNE  90

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA   SF D+WVQ+NI  Y  ++ IE +AVGNEVF DP NTT +LVPA+ N+ ++L
Sbjct  91    LLSSAANDPSFADKWVQANISQYHPQTQIEAIAVGNEVFADPNNTTKFLVPAINNLQSAL  150

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ ++ S+K+SSPI  SA+Q SYP SSGSFKP+LI P +KP+L FL +T S+LM+NAYP
Sbjct  151   VKHNLSSSIKLSSPIALSALQNSYPSSSGSFKPDLIEPAVKPLLDFLSKTSSYLMINAYP  210

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYEAN D+ISLDYA+F  N G VD  NGL Y SL +AQ+DAV+AA++A+     ++V+
Sbjct  211   FFAYEANADEISLDYALFRTNPGNVDSGNGLRYNSLMEAQLDAVFAAMSALGYDDVKLVV  270

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G   A NAAAYNGNLV+RVLTGGGTPL+
Sbjct  271   TETGWPSNGDEN------------------EIGSGKA-NAAAYNGNLVKRVLTGGGTPLK  311

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN------RGSKA  560
             P +PL+VYLF+LFNENQK GP SERNYGLFYP+E KVYD+PLTLA L          SKA
Sbjct  312   PKDPLNVYLFALFNENQKPGPTSERNYGLFYPDEGKVYDIPLTLAGLNGAQSNPVNESKA  371

Query  559   QVPPT-------WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHAS  401
             QVP T       WCVAN + G E+LQ  LDYACG+G ADC  IQ GSTC+NPNTL AHAS
Sbjct  372   QVPTTAPSSGNTWCVANVNAGEEKLQAGLDYACGEGGADCRSIQEGSTCFNPNTLEAHAS  431

Query  400   YAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YAFNSYYQK ARG GTC FGGA +VV QPPR+G+CE+PTGY
Sbjct  432   YAFNSYYQKKARGTGTCDFGGAAHVVAQPPRYGTCEYPTGY  472



>emb|CDP05678.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/476 (61%), Positives = 347/476 (73%), Gaps = 43/476 (9%)
 Frame = -3

Query  1639  SLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGI  1460
             S+  HS    GSIG+NYGRIAD+LPS +KV +LLKSQG+ +VK+YDTD  VL AL+GSG+
Sbjct  15    SIFSHS--DGGSIGVNYGRIADNLPSASKVAELLKSQGLDRVKVYDTDPAVLKALAGSGV  72

Query  1459  STTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVP  1286
               TV LPNE L +AA   SF   WVQ N+  Y   + IE +AVGNEVFVDP NTT +LVP
Sbjct  73    KVTVDLPNELLFSAARRPSFAHSWVQRNVAAYHPATQIEAIAVGNEVFVDPHNTTRFLVP  132

Query  1285  AMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTG  1109
             AMKN++++L KY     +KVSSPI  SA+Q SYP S+GSF+P+LI PV KPML FL QTG
Sbjct  133   AMKNIHSALEKYNFHDDIKVSSPIALSALQNSYPSSAGSFRPDLIEPVFKPMLDFLRQTG  192

Query  1108  SFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAV  929
             S+LM+NAYPF+AYE+N+D ISLDYA+F +N GVVD  NG  Y SLFDAQ+DAV+AA++A+
Sbjct  193   SYLMVNAYPFFAYESNSDVISLDYALFRENPGVVDAGNGNHYFSLFDAQIDAVFAAMSAI  252

Query  928   KPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRV  749
             K     +V++E+GWPSKG+ N                  E G AS  NAAAYNGNLV+R+
Sbjct  253   KYDDVSIVVTETGWPSKGDPN------------------EIG-ASVENAAAYNGNLVKRI  293

Query  748   LTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----  581
             LTGGGTPLRP E L+VYLF+LFNE++K GP SERNYGLFYPNE KVYDVP T+  L    
Sbjct  294   LTGGGTPLRPKENLTVYLFALFNEDKKVGPTSERNYGLFYPNEDKVYDVPFTVEGLKHYH  353

Query  580   -------GNR--------GSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQP  446
                    G+R         S +    TWCVANGD   E+LQVALD+ACG+G ADC PIQP
Sbjct  354   DNPTPVTGDRRNSKGTSGNSHSYSGQTWCVANGDEEREKLQVALDFACGEGGADCRPIQP  413

Query  445   GSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             GSTCY+PNTL AHAS+AFNSYYQK  R  GTCYFGGA YVV+ PP++G CEFPTGY
Sbjct  414   GSTCYDPNTLEAHASFAFNSYYQKKGRAIGTCYFGGAAYVVSIPPKYGKCEFPTGY  469



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 344/457 (75%), Gaps = 31/457 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +G+NYGRIADDLPSP  VV+LLK+ GI ++KL+DT+STVL ALS S IS  V+LPNE
Sbjct  21    AGWVGVNYGRIADDLPSPDDVVKLLKTHGIDRIKLFDTESTVLTALSNSNISVVVSLPNE  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA+  SFTD WVQSNI  +   + I+ +AVGNEVFVDP NTT +LVPAMKNVYASL
Sbjct  81    YLSSAASDPSFTDNWVQSNISHFYPSTKIDAIAVGNEVFVDPNNTTNFLVPAMKNVYASL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  ++KVS+P+ FSA+ +SYP SSGSFKP+LI PV+KPML  + Q+ S LM+NAYP
Sbjct  141   QKFNLHTNIKVSTPLAFSALASSYPTSSGSFKPDLIEPVMKPMLDLIRQSQSHLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY  N DKIS+DYA+F +N GV+D  NGL Y +L +AQVDAV+AA++A+K     VV+
Sbjct  201   FFAYIGNADKISIDYALFRENAGVIDSGNGLKYSNLLEAQVDAVFAALSAIKFEDIPVVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLV+RVLTG GTPLR
Sbjct  261   TETGWPSKGDEN------------------EIG-ASIENAAAYNGNLVKRVLTGSGTPLR  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-GNRGSKAQVP--  551
             P EPL+ YLF+LFNEN+K GP SERNYGLFYPNE+KVY++PLT A + G  GS   V   
Sbjct  302   PKEPLNAYLFALFNENKKQGPTSERNYGLFYPNEEKVYEIPLTSADVEGGVGSTPAVNGS  361

Query  550   ------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFN  389
                    TWCVANG V PE+LQ  LDYACG+G ADC  IQPG+TCYNPN+L AHASYAFN
Sbjct  362   KVIKNGQTWCVANGKVAPEKLQAGLDYACGEGGADCSSIQPGATCYNPNSLEAHASYAFN  421

Query  388   SYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             SYYQK  R  GTC FGGA YVVTQPP++G CEFPT Y
Sbjct  422   SYYQKMKRAVGTCDFGGAAYVVTQPPQYGQCEFPTEY  458



>ref|XP_010443128.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Camelina 
sativa]
Length=461

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/459 (62%), Positives = 340/459 (74%), Gaps = 33/459 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+  KVV+LLKSQGI +VKLYDT+++VL AL+ SGI   V+LPNE
Sbjct  22    SGMIGVNYGRIADNLPATEKVVELLKSQGINRVKLYDTEASVLTALANSGIKVVVSLPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA Q +TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAM NV +SL
Sbjct  82    NLASAAADQKYTDDWVQQNIKKYIPATDIEAIAVGNEVFVDPRNTTKYLVPAMTNVQSSL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  142   VKFNLVKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN +KISLDYA+F DN G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  202   FFAYAANANKISLDYALFKDNAGNVDSGNGLKYDSLLDAQIDAVFAAMSAVGFNDVKLVV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  262   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAA---LGNRGSKA---  560
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L+      + +   KA   
Sbjct  303   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLSSGKSTPVEDDKEKATPV  362

Query  559   -----QVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYA  395
                   V  TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCY+P +L AHASYA
Sbjct  363   VKPSSHVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYA  422

Query  394   FNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             FNSYYQKNARG GTC F GA YVV+QPP++G CEFPTG+
Sbjct  423   FNSYYQKNARGVGTCDFKGAAYVVSQPPKYGKCEFPTGH  461



>ref|XP_004161885.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13-like [Cucumis sativus]
Length=458

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 343/457 (75%), Gaps = 31/457 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +G+NYGRIADDLPSP  VV+LLK+ GI ++KL+DT+STVL ALS S IS  V+LPNE
Sbjct  21    AGWVGVNYGRIADDLPSPDDVVKLLKTHGIDRIKLFDTESTVLTALSNSNISVVVSLPNE  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA+  SFTD WVQSNI  +   + I+ +AVGNEVFVDP NTT +LVPAMKNVYASL
Sbjct  81    YLSSAASDPSFTDNWVQSNISHFYPSTKIDAIAVGNEVFVDPNNTTNFLVPAMKNVYASL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  ++KVS P+ FSA+ +SYP SSGSFKP+LI PV+KPML  + Q+ S LM+NAYP
Sbjct  141   QKFNLHTNIKVSXPLAFSALASSYPTSSGSFKPDLIEPVMKPMLDLIRQSQSHLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY  N DKIS+DYA+F +N GV+D  NGL Y +L +AQVDAV+AA++A+K     VV+
Sbjct  201   FFAYIGNADKISIDYALFRENAGVIDSGNGLKYSNLLEAQVDAVFAALSAIKFEDIPVVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLV+RVLTG GTPLR
Sbjct  261   TETGWPSKGDEN------------------EIG-ASIENAAAYNGNLVKRVLTGSGTPLR  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-GNRGSKAQVP--  551
             P EPL+ YLF+LFNEN+K GP SERNYGLFYPNE+KVY++PLT A + G  GS   V   
Sbjct  302   PKEPLNAYLFALFNENKKQGPTSERNYGLFYPNEEKVYEIPLTSADVEGGVGSTPAVNGS  361

Query  550   ------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFN  389
                    TWCVANG V PE+LQ  LDYACG+G ADC  IQPG+TCYNPN+L AHASYAFN
Sbjct  362   KVIKNGQTWCVANGKVAPEKLQAGLDYACGEGGADCSSIQPGATCYNPNSLEAHASYAFN  421

Query  388   SYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             SYYQK  R  GTC FGGA YVVTQPP++G CEFPT Y
Sbjct  422   SYYQKMKRAVGTCDFGGAAYVVTQPPQYGQCEFPTEY  458



>ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
Length=471

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/491 (59%), Positives = 350/491 (71%), Gaps = 50/491 (10%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             L+S  +  S+F      + + +GSIG+NYGRIA++LPS  KVVQLLKSQGI +VK++DTD
Sbjct  6     LHSFLLVISIF------AFADAGSIGVNYGRIANNLPSAVKVVQLLKSQGIERVKVFDTD  59

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
               VL AL  SGI  TV LPNE L +AA  QSF + WVQ N+  Y   + IE +AVGNEVF
Sbjct  60    PAVLKALGESGIKVTVDLPNELLISAAKRQSFANTWVQKNVADYFPATKIEAIAVGNEVF  119

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
             VDP NTT  LVPA+KN++ +L KY +   +KVSSP+  SA+Q+SYP S+GSF+ ELI PV
Sbjct  120   VDPHNTTLSLVPALKNIHKALVKYNLHSHIKVSSPVALSALQSSYPSSAGSFRQELIEPV  179

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
              KPML FL QTGS+LM+NAYPF+AYEAN+D ISLDYA+F +N GVVD  NGL Y +LFDA
Sbjct  180   FKPMLEFLRQTGSYLMVNAYPFFAYEANSDVISLDYALFRENPGVVDAGNGLRYFNLFDA  239

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV+AA++A+K    ++V++E+GWPSKG+ N                  E G AS  N
Sbjct  240   QIDAVFAAMSALKYNDIKMVVTETGWPSKGDEN------------------EIG-ASVAN  280

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNLVRR+LTGGGTPLRP   L V+LF+LFNEN+K GP SERNYGLFYP+E+KVY+
Sbjct  281   AAAYNGNLVRRILTGGGTPLRPKADLVVFLFALFNENKKPGPSSERNYGLFYPSEEKVYN  340

Query  604   VPLTLAALGNR---------GSKAQVP-------------PTWCVANGDVGPERLQVALD  491
             +P T+  L N          G +   P              TWCVANG+ G E+LQ ALD
Sbjct  341   IPFTVEGLKNYRDIQSPVTGGVRVSTPVTRGGSVSPSSSGQTWCVANGETGKEKLQAALD  400

Query  490   YACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             YACG+G ADC PIQPG+TCY+PNTL AHAS+AFNSYYQK  R  GTC F GA YVVTQ P
Sbjct  401   YACGEGQADCHPIQPGATCYDPNTLEAHASFAFNSYYQKKGRVIGTCDFQGAAYVVTQAP  460

Query  310   RFGSCEFPTGY  278
             RFG CEFPTGY
Sbjct  461   RFGKCEFPTGY  471



>ref|XP_004304086.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=475

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/483 (59%), Positives = 348/483 (72%), Gaps = 49/483 (10%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             + LS+L  S S +GS+G+NYGR+AD+LPS  KV  L+KSQG+ +VK++D+D  VL ALSG
Sbjct  11    VLLSVLA-SHSDAGSVGVNYGRVADNLPSAYKVAALIKSQGLERVKVFDSDPAVLRALSG  69

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPY  1295
             SGI  TV LPNE LS+AA +Q F   WVQ N+V Y   + IE +AVGNEVFVD  NTT Y
Sbjct  70    SGIKVTVDLPNELLSSAAKTQMFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTHNTTKY  129

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             L+ AMKN++ +L K+ +A  +KVSSPI  SA+Q SYP S+GSF+PELI PV KPML FL 
Sbjct  130   LIAAMKNIHTALVKFNLASDIKVSSPIALSALQNSYPSSAGSFRPELIQPVFKPMLDFLR  189

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QTGS+LM+NAYP++AYE+N D ISLDYA+F +N GVVD  +GL Y SLFDAQ+DAV+AA+
Sbjct  190   QTGSYLMVNAYPYFAYESNADVISLDYALFRENPGVVDAGSGLRYFSLFDAQIDAVFAAM  249

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +A+K     +V+SE+GWPSKG+ N                  E G AS  NAAAYNGNLV
Sbjct  250   SALKYNDIEMVVSETGWPSKGDEN------------------EIG-ASIENAAAYNGNLV  290

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RR+LTGGGTPLRP   L+VYLF+LFNE++K GP SERNYGLF+PNE+KVYD+P T+  L 
Sbjct  291   RRILTGGGTPLRPKADLTVYLFALFNEDRKFGPTSERNYGLFFPNEKKVYDIPFTVEGLK  350

Query  577   N--------RGSKAQVPP------------------TWCVANGDVGPERLQVALDYACGQ  476
             N         G+  +  P                  TWCVANG+ G E+LQ ALDYACG+
Sbjct  351   NYHDHKSPVSGNHHETAPVTAPVTGSGDVSKTLTGNTWCVANGEAGEEKLQAALDYACGE  410

Query  475   GAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             G ADC  IQPGSTCY+PNTL AHASYAFNSYYQK ARG GTCYFGGA YVV+Q P++G C
Sbjct  411   GGADCHQIQPGSTCYDPNTLEAHASYAFNSYYQKKARGAGTCYFGGAAYVVSQLPKYGKC  470

Query  295   EFP  287
             E P
Sbjct  471   ELP  473



>ref|XP_002529472.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32938.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=472

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/465 (62%), Positives = 351/465 (75%), Gaps = 40/465 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG++GINYGR+A++LPSP KVV+LLKSQGI +VKLYDTDSTVL AL+ SGI+  VALPNE
Sbjct  28    SGTVGINYGRVANNLPSPEKVVELLKSQGINRVKLYDTDSTVLTALANSGITVVVALPNE  87

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++ AA QSF D WVQ+NI  Y  K+ IE +AVGNEVFVDP NTT YLVPAMKNVY SL
Sbjct  88    LLASTAADQSFADNWVQANISQYHPKTQIEAIAVGNEVFVDPQNTTKYLVPAMKNVYNSL  147

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ ++ S+K+SSPI  S++Q+SYP S+GSFKP+LI PV+KPML FL +TGS+LM+NAYP
Sbjct  148   VKFNLS-SIKISSPIALSSLQSSYPSSAGSFKPDLIEPVMKPMLEFLRKTGSYLMVNAYP  206

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN+ +ISLDY +F +N GVVD  NGL Y SL +AQ+DAV+AA+ A++    ++V+
Sbjct  207   FFAYAANSKEISLDYTLFKENPGVVDSGNGLKYFSLLEAQLDAVFAAMKAIQYDDVKMVV  266

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G  +                  E G AS  NAA+YNGNLV+RVLTG GTPLR
Sbjct  267   TETGWPSVGGED------------------EVG-ASEENAASYNGNLVKRVLTGNGTPLR  307

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-------------  581
             P +PL+VYLF+LFNEN K GP SERNYGLFYPNE+KVYD+ LT   L             
Sbjct  308   PQDPLNVYLFALFNENLKPGPTSERNYGLFYPNEEKVYDISLTQKELSTPGNQNKSQAPQ  367

Query  580   ----GNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLV  413
                 G   SK  V  TWCVANG +G E+LQ  +DYACG+G ADC PIQ G+TCYNPNT+ 
Sbjct  368   ASGGGGEVSKTAVGQTWCVANGKIGKEKLQAGIDYACGEGGADCRPIQQGATCYNPNTVE  427

Query  412   AHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             AHASYAFNSYYQK +R  GTCYFGGA YVVTQPPR+G+CEFPTGY
Sbjct  428   AHASYAFNSYYQKKSRAAGTCYFGGAAYVVTQPPRYGNCEFPTGY  472



>ref|XP_008449478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Cucumis melo]
Length=474

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/471 (61%), Positives = 343/471 (73%), Gaps = 45/471 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SGSIG+NYGRIA+DLPS  +VV+LLKS G+ +VK+YDTD  VL ALSGSGI  TV LPNE
Sbjct  23    SGSIGVNYGRIANDLPSAVQVVKLLKSNGLQRVKVYDTDPAVLRALSGSGIKVTVDLPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L AA+   SF   WVQ N+  Y   + IE +AVGNEVFVDP NTT YLVPAMKN++ +L
Sbjct  83    LLFAASQRLSFAYNWVQKNVAAYYPSTEIEAIAVGNEVFVDPHNTTSYLVPAMKNIHQAL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
              K  +   +KVSSPI  SA+Q SYP S+GSF+PEL+  V +PML FL +TGS+LM+NAYP
Sbjct  143   VKNNLDSKIKVSSPIALSALQNSYPASAGSFRPELVETVFRPMLDFLRRTGSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+NTD ISLDYA+F DN GVVD  +G  Y SLFDAQ+DAV+AA++A+K     +V+
Sbjct  203   FFAYESNTDVISLDYALFRDNPGVVDTGSGYRYFSLFDAQIDAVFAAMSALKYDDINMVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPSKG+ N                  E G AS  NAAAYNGNLV R+L+GGGTPLR
Sbjct  263   SETGWPSKGDEN------------------EIG-ASVENAAAYNGNLVHRILSGGGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-------------  581
             P   L+VYLF+LFNEN+K+GP SERNYGLFYPNE+KVYD+P T   L             
Sbjct  304   PKADLTVYLFALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTAEGLKEYKDKPSRKPIS  363

Query  580   ---------GNRG-SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
                      G+ G SK+Q   TWCVA+G+ G E+LQ  LDYACG+G ADC PIQ G+TCY
Sbjct  364   APTGAPVSGGDGGVSKSQTGNTWCVASGEAGREKLQAGLDYACGEGGADCRPIQVGATCY  423

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             NPNTL AHASYAFNSYYQKN R  GTCYFGGA YVVTQPP++GSCEFPTGY
Sbjct  424   NPNTLEAHASYAFNSYYQKNNRKVGTCYFGGAAYVVTQPPKYGSCEFPTGY  474



>ref|XP_011047200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Populus euphratica]
Length=470

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/469 (60%), Positives = 345/469 (74%), Gaps = 43/469 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GS+G+NYGRIA++LPS  KVV L+KSQG+  VK+YDTD  VL ALSGSGI  TV LPN+
Sbjct  21    AGSVGVNYGRIANNLPSAVKVVNLVKSQGLELVKVYDTDPAVLKALSGSGIKVTVDLPNQ  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   +F   WVQ NIV Y   + IE +AVGNEVFVDP NTT +L+PAMKN++ +L
Sbjct  81    LLYSAAKYPNFARSWVQKNIVAYHPSTQIEAIAVGNEVFVDPHNTTKFLIPAMKNIHQAL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
               + +  S+KVSSPI  SA+Q+SYP S+GSF+PELI PV KPML FL QTGS+LM+NAYP
Sbjct  141   VNFNLHSSIKVSSPIALSALQSSYPSSAGSFRPELIQPVFKPMLDFLRQTGSYLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+N+D ISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K    ++V+
Sbjct  201   FFAYESNSDVISLDYALFRENPGVVDSGNGLKYFNLFDAQIDAVFAALSALKYDDVKMVV  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAA YNGNLVRR+LTGGGTPL+
Sbjct  261   TETGWPSKGDEN------------------EVG-ASVENAATYNGNLVRRILTGGGTPLK  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-----------  575
             P   L+VYLF+LFNEN+K GP SERNYGLFYP++QKVYD+P T+  L N           
Sbjct  302   PHADLTVYLFALFNENEKDGPTSERNYGLFYPDQQKVYDIPFTVEGLKNYKAPSRSPVSG  361

Query  574   --------RG--SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
                     RG  SK+    TWCVAN D G E+LQ ALD+ACG+G ADC PIQP +TCYNP
Sbjct  362   GQPVSAPVRGGVSKSTTGNTWCVANPDAGKEKLQAALDFACGEGGADCRPIQPEATCYNP  421

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             NTLVAH+S+AFNSYYQK  RG G CYFGGA +VVTQ P+FG CEFPTGY
Sbjct  422   NTLVAHSSFAFNSYYQKKGRGMGDCYFGGAAFVVTQEPKFGECEFPTGY  470



>ref|XP_007215327.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
 gb|EMJ16526.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
Length=472

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 342/470 (73%), Gaps = 44/470 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             + S+G+NYGRIAD+LPS  +V+QLLKSQG+ +VK++D+D  VL AL+GS I  TV +PNE
Sbjct  22    AASVGVNYGRIADNLPSAYRVMQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+ A SQSF   WVQ N+V Y   + IE +AVGNEVFVD  NTT +L+PAMKN++ +L
Sbjct  82    LLSSVAKSQSFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTHNTTKFLIPAMKNIHTAL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
               + +  ++KVSSPI  SA+Q SYP S+GSF+PEL+  V KPML FL QTGS+LM+NAYP
Sbjct  142   IHFDIHSAIKVSSPIALSALQNSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNAYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             ++AYE+N D ISLDYA+F  N GVVD  NGL Y SLFDAQ+DAV+AA++A+K     +V+
Sbjct  202   YFAYESNADVISLDYALFRQNPGVVDAGNGLRYLSLFDAQIDAVFAAMSALKYDDINMVV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  262   SETGWPSKGDEN------------------EVG-ASLENAAAYNGNLVRRILTGGGTPLR  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------RGS  566
             P   L+VYLF+LFNE++K+GP SERNYGLF+PNE+KVYD+P T   L N         G+
Sbjct  303   PKADLTVYLFALFNEDRKNGPTSERNYGLFFPNERKVYDIPFTFEGLKNYHDHRSPVAGN  362

Query  565   KAQVPP--------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             +    P              TWCVANG+ G E+LQ ALDYACG+G ADC  IQPGS CY+
Sbjct  363   QHMTAPVNGGGDVSKSLTGNTWCVANGEAGKEKLQRALDYACGEGGADCHQIQPGSACYD  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTL AHASYAFNSYYQK ARG GTCYFGGA YVV+QPP++G CE PTGY
Sbjct  423   PNTLEAHASYAFNSYYQKKARGVGTCYFGGAAYVVSQPPKYGKCELPTGY  472



>ref|XP_010557676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=484

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/470 (60%), Positives = 343/470 (73%), Gaps = 42/470 (9%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             S +GSIG+NYGRIADDLPS  KVVQLLKSQGI +VK+YD+D  VL ALSGSGI  TV LP
Sbjct  28    SDAGSIGVNYGRIADDLPSATKVVQLLKSQGIDRVKIYDSDPAVLKALSGSGIRVTVDLP  87

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             NE L +AA   SF   WVQ N+V Y  ++ IE +AVGNEVFVDP NTT +L+PAM+NV+ 
Sbjct  88    NELLFSAAKRPSFAASWVQRNVVAYHPETQIEAIAVGNEVFVDPHNTTKFLIPAMRNVHK  147

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNA  1088
             +L K  +  ++KVSSPI  SA+Q SYP S+GSF+P+L+ PVIKPML FL +TGS LM+N 
Sbjct  148   ALVKNNLHSAIKVSSPIALSALQNSYPSSAGSFRPDLVEPVIKPMLDFLRETGSSLMINV  207

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRV  908
             YPF+AYE N+D I LDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++ +K     +
Sbjct  208   YPFFAYEGNSDVIPLDYALFRENPGVVDAGNGLRYFNLFDAQIDAVFAAMSRLKYDDIEI  267

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTP  728
             V++E+GWPSKG+ N                  E G A+  NA AYNGNLVRR+LTGGGTP
Sbjct  268   VVTETGWPSKGDEN------------------EVG-ATVENAPAYNGNLVRRILTGGGTP  308

Query  727   LRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-----------  581
             LR    L+VYLF+LFNEN+K+GP SERNYGLFYP+E+KVYDVPLT   L           
Sbjct  309   LRRKSDLTVYLFALFNENKKTGPTSERNYGLFYPDERKVYDVPLTAEQLKHYHDNPSPAT  368

Query  580   GNRG---------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             G R          SK+    TWCVAN D G +RLQ  LDYACG+G ADC PIQPG+TCYN
Sbjct  369   GGRQVTSPVAGGVSKSLTGNTWCVANADAGKDRLQAGLDYACGEGGADCRPIQPGATCYN  428

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             P+TL AHAS+AFNSYYQ+ AR  G+CYFGGA Y+VTQPP++G CEFPTGY
Sbjct  429   PDTLEAHASFAFNSYYQRKARAGGSCYFGGAAYIVTQPPKYGRCEFPTGY  478



>gb|KEH41871.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=494

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/479 (59%), Positives = 350/479 (73%), Gaps = 53/479 (11%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIGINYGRIAD+LP+P+KVV+LLK+QG  +VKLYDTD+TVL AL+ SGI  TVA+PNE
Sbjct  35    AGSIGINYGRIADNLPTPSKVVELLKAQGFNRVKLYDTDATVLTALANSGIKVTVAMPNE  94

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AAA QS+TD W+QSNI+ +   + IE +AVGNEVFVDP NTT YLVPAMKNV+ASL
Sbjct  95    LLSSAAADQSYTDTWIQSNILNHYPATEIEAIAVGNEVFVDPKNTTNYLVPAMKNVHASL  154

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K  +   + +SSPI  SA+Q+SYP S+GSFK EL+ PVIKPML FL QTGS+LM+NAYP
Sbjct  155   QKQNLDKQILISSPIALSALQSSYPTSTGSFKTELVEPVIKPMLEFLSQTGSYLMVNAYP  214

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN+D ISLDYA+F  N GV+D  N L Y +L DAQ+DAV AA++A++    ++ +
Sbjct  215   FFAYAANSDTISLDYALFKQNPGVIDSGNHLKYDNLLDAQIDAVNAAMSALQYDDVKITV  274

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPS G+ N                  E G A   NAA+YNGNLV+RVL G GTPLR
Sbjct  275   SETGWPSLGDSN------------------EIG-AGQDNAASYNGNLVKRVLNGSGTPLR  315

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS--------  566
             P +PL+V+LF+LFNENQK+GP SE+NYGLFYP+E+KVYD+PLT++      +        
Sbjct  316   PKDPLNVFLFALFNENQKTGPTSEKNYGLFYPSEKKVYDIPLTMSETNKSLTPIAESPVE  375

Query  565   ----------KAQVP-------------PTWCVANGDVGPERLQVALDYACGQGAADCGP  455
                       +++VP              TWCVANG    E+L+ ALDYACG+G ADC P
Sbjct  376   SAQAPVAGVGRSKVPVSGGDVSVVENKGQTWCVANGGYSEEKLKHALDYACGEGGADCAP  435

Query  454   IQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             IQPG+TCYNPNTL AHAS+AFNSYYQK +RG GTC FGGA YVVTQ PR+G C+FPTGY
Sbjct  436   IQPGATCYNPNTLEAHASFAFNSYYQKKSRGGGTCDFGGAAYVVTQAPRYGKCDFPTGY  494



>ref|XP_007142328.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
 gb|ESW14322.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
Length=466

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/464 (61%), Positives = 342/464 (74%), Gaps = 38/464 (8%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GS+GINYGRIA+DLP+PAKVV+LLKSQG+++VKLYDTD+TVL A + SGI   VA+PNE
Sbjct  22    AGSVGINYGRIANDLPTPAKVVELLKSQGLSRVKLYDTDATVLSAFANSGIKVVVAMPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS AAA QSFTD WV+ NI  +   + IE +AVGNEVFVDP NTT +LV AMKNV+ASL
Sbjct  82    LLSNAAADQSFTDAWVKDNIASHYPATQIEAIAVGNEVFVDPNNTTKFLVAAMKNVHASL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K  +  ++K+SSPI  SA+Q+S+P SSGSFK EL+ PVIKPML  L QTGS+LM+NAYP
Sbjct  142   TKSSLDTNIKISSPIALSALQSSFPASSGSFKTELVEPVIKPMLDLLRQTGSYLMVNAYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISL+YA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A++    ++ +
Sbjct  202   FFAYSANADKISLEYALFKENAGVVDSGNGLKYTNLFDAQIDAVFAAMSALQYTDVKITV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPS G+ N                  E G A   NAA YNGNLVRRVL   GTPLR
Sbjct  262   SETGWPSAGDSN------------------EIG-AGPENAAEYNGNLVRRVLGQSGTPLR  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS----KAQV  554
             P++ L V+LF+LFNENQK+GP SERNYGLFYP+E+KVYD+PL    +    S    K+QV
Sbjct  303   PNDSLDVFLFALFNENQKTGPTSERNYGLFYPSEKKVYDIPLKAEGVTEAPSSGVEKSQV  362

Query  553   PP------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
             P             TWCVANG    E+LQ  L+YACG+G ADC  IQP +TCYNPNTL A
Sbjct  363   PASGEVSTTSRDGQTWCVANGGASEEKLQNGLNYACGEGGADCSAIQPDATCYNPNTLEA  422

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             HASYAFNSYYQK AR  GTC FGG  YVVT PP++GSCEFP+GY
Sbjct  423   HASYAFNSYYQKKARAAGTCDFGGTAYVVTHPPKYGSCEFPSGY  466



>gb|KFK27118.1| hypothetical protein AALP_AA8G337200 [Arabis alpina]
Length=461

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 340/460 (74%), Gaps = 32/460 (7%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             + + SG IG+NYGRIAD+LP+P KVV LLKSQGI +VKLYDT+ +VL AL+ S I   V+
Sbjct  18    TFADSGMIGVNYGRIADNLPAPEKVVSLLKSQGINRVKLYDTEQSVLTALANSSIKVVVS  77

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNV  1271
             LPNE L++AAA Q++TD+WVQ NI  Y   + IE +AVGNEVFVDP NTT YLV AMKNV
Sbjct  78    LPNEYLASAAADQTYTDKWVQDNIKKYIPATEIEAIAVGNEVFVDPRNTTTYLVAAMKNV  137

Query  1270  YASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLML  1094
              +SL K+ +  S+K+SSPI  SA+ +SYPPS+GSFKP+LI PVIKPML  L +T S LM+
Sbjct  138   QSSLVKFNLDKSIKISSPIALSALASSYPPSAGSFKPDLIEPVIKPMLDLLRKTSSHLMV  197

Query  1093  NAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF  914
             NAYPF+AY AN DKISLDYA+F +N G VD  NGL Y++L DAQ+DAV+AA++AV     
Sbjct  198   NAYPFFAYAANADKISLDYALFKENAGNVDSGNGLKYENLLDAQIDAVFAAMSAVGFNDV  257

Query  913   RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGG  734
             ++V++E+GWPS G+ N                  E G A + NAAAYNG LV+RVL G G
Sbjct  258   KLVVTETGWPSAGDEN------------------EIG-AGSDNAAAYNGGLVKRVLNGNG  298

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQV  554
             TPL+P EPL VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  +     SK +V
Sbjct  299   TPLKPKEPLDVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSAPVDDSKEKV  358

Query  553   P----------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHA  404
             P           TWCVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHA
Sbjct  359   PVKAPSSSHVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHA  418

Query  403   SYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             SYAFNSYYQKNARG GTC FGGA YVV+QPP++G CEFPT
Sbjct  419   SYAFNSYYQKNARGVGTCNFGGAAYVVSQPPKYGKCEFPT  458



>emb|CDX92794.1| BnaC07g40520D [Brassica napus]
Length=451

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/465 (60%), Positives = 339/465 (73%), Gaps = 25/465 (5%)
 Frame = -3

Query  1663  CIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVL  1484
             C+  S F S +  + + SG IG+NYGRIA++LP P  VV LLKSQGI ++K+YDTD  VL
Sbjct  9     CLILSFF-SAISITQASSGMIGVNYGRIANNLPPPENVVNLLKSQGINRIKIYDTDKNVL  67

Query  1483  DALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA  1310
              AL+ S I   V LPNE LS  A+ QSF D+WV+ NI  +   + IE +AVGNEVFVDP 
Sbjct  68    TALAHSRIKVVVCLPNELLSRTASDQSFADKWVRRNIRKHFPATEIEAIAVGNEVFVDPK  127

Query  1309  NTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPM  1133
             NTTPYLVPAMKN++ SL KY +  S+K+SSPI  SA+  SYPPSSGSFKP+L+ PVIKPM
Sbjct  128   NTTPYLVPAMKNIHTSLVKYNLDKSIKISSPIALSALANSYPPSSGSFKPDLVEPVIKPM  187

Query  1132  LSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDA  953
             L  L +T S+LM+NAYPF+AY  N DKISLDYA+F DN G +DP NGL Y SLFDAQ+DA
Sbjct  188   LDLLRKTSSYLMVNAYPFFAYSGNADKISLDYALFRDNVGTLDPGNGLRYNSLFDAQLDA  247

Query  952   VYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAY  773
             VYAA++AV     +V+++E+GWPS G+ N                  E G AS  NAAAY
Sbjct  248   VYAAMSAVGFNDVKVMVTETGWPSAGDVN------------------EIG-ASEANAAAY  288

Query  772   NGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT  593
             NG LV+RVL G GTPLR +EPL+V+LFSLFNENQK GP SERNYGLFYPNE++VY VP  
Sbjct  289   NGGLVKRVLNGNGTPLRRNEPLNVFLFSLFNENQKPGPTSERNYGLFYPNERRVYAVPF-  347

Query  592   LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLV  413
               A   +   A    +WCV+NGD   E+LQ ALDYACG+G ADC PIQPG+TCYNP +L 
Sbjct  348   -PATTEQAPVAHEGESWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCYNPKSLE  406

Query  412   AHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             AHAS+AFNSYYQKNAR  GTCYFGG  +VVTQ PR+G C+FPT +
Sbjct  407   AHASFAFNSYYQKNARRVGTCYFGGTAHVVTQHPRYGKCKFPTEH  451



>emb|CDY46679.1| BnaA03g48290D [Brassica napus]
Length=446

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/465 (60%), Positives = 336/465 (72%), Gaps = 30/465 (6%)
 Frame = -3

Query  1663  CIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVL  1484
             C+  S F S +  + + SG IG+NYGRIA++LPSP  VV LLKSQGI ++K+YDTD  VL
Sbjct  9     CLILSFF-STISITQASSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIYDTDKNVL  67

Query  1483  DALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA  1310
              AL+ S I   V LPNE LS  A+ QSF D+WV+ N+  +   + +E +AVGNEVFVDP 
Sbjct  68    TALAHSRIKVVVCLPNELLSRTASDQSFADKWVRHNVRKHFPATEVEAIAVGNEVFVDPK  127

Query  1309  NTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPM  1133
             NTTPYLV AMKN++ASL KY +  S+K+SSPI  SA+  SYPPSSGSFKP+L+ PVIKPM
Sbjct  128   NTTPYLVLAMKNIHASLVKYSLGKSIKISSPIALSALANSYPPSSGSFKPDLVEPVIKPM  187

Query  1132  LSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDA  953
             L  L +T S+LM+NAYPF+AY  N DKISLDYA+F DN G VD  NGL Y SLFDAQ+DA
Sbjct  188   LDLLRKTSSYLMVNAYPFFAYSGNADKISLDYALFRDNAGTVDSGNGLRYNSLFDAQLDA  247

Query  952   VYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAY  773
             VYAA++AV     +V+++E+GWPS G                   DG    AS  NAAAY
Sbjct  248   VYAAMSAVGFNDVKVMVTETGWPSAG-------------------DGNEIGASESNAAAY  288

Query  772   NGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT  593
             NG LV+RVL G GTPLRP EPL+V+LF+LFNENQK GP SERNYGLFYPNE+KVY VP  
Sbjct  289   NGGLVQRVLNGNGTPLRPKEPLNVFLFALFNENQKPGPTSERNYGLFYPNERKVYAVPFA  348

Query  592   LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLV  413
                     + +    TWCV+NGD   E+LQ ALDYACG+G ADC PIQPG+TCY+P +L 
Sbjct  349   -------ATTSTPGETWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCYHPKSLE  401

Query  412   AHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             AHAS+AFNSYYQKNAR  GTCYFGG  +VVTQ PR+G C+FPT Y
Sbjct  402   AHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYGKCKFPTEY  446



>ref|XP_006595830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/489 (58%), Positives = 353/489 (72%), Gaps = 50/489 (10%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             I  ++ LSL   +++  GSIG+NYGRIA++LPS  KVVQLLKSQG+T+VK+YDTD  VL 
Sbjct  5     IILTILLSL---ALADGGSIGVNYGRIANNLPSAVKVVQLLKSQGLTRVKVYDTDPAVLR  61

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             ALSGSGI  TV LPN+QL AAA + SF   WV+ N+  Y   + IE++AVGNEVFVDP N
Sbjct  62    ALSGSGIKVTVDLPNQQLFAAAKAPSFASSWVERNVAAYYPHTQIESIAVGNEVFVDPHN  121

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPML  1130
             TT +LVPAMKN+  +L K+ +   +KVSSPI  SA+  SYP S+GSF+PEL+ PV KPML
Sbjct  122   TTKFLVPAMKNIQKALTKHNLDKDIKVSSPIALSALANSYPSSAGSFRPELVEPVFKPML  181

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL +TGS+LM+N YPF+AYE+N D ISLDYA+F DN GVVDP NGL Y +LFDAQ+DAV
Sbjct  182   DFLRETGSYLMVNVYPFFAYESNADVISLDYALFRDNPGVVDPGNGLRYYNLFDAQIDAV  241

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             ++A++A+K    ++V++E+GWPSKG+ N                  E G AS  NAAAYN
Sbjct  242   FSALSALKYDDVKIVVTETGWPSKGDSN------------------EVG-ASVENAAAYN  282

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
             GNLVR++LT  GTPLRP   L+VYLF+LFNENQK GP SERN+GLFYP+E++VY+VPLT+
Sbjct  283   GNLVRKILTAAGTPLRPKADLTVYLFALFNENQKPGPTSERNFGLFYPDERRVYNVPLTV  342

Query  589   AALGNR-----------GSKAQVPP--------------TWCVANGDVGPERLQVALDYA  485
               L +            G K + P               TWCVAN D    +LQ ALD+A
Sbjct  343   EELKDYHDRPSAPVNGGGQKKETPAPVVSGGVSKSTTGNTWCVANPDADKVKLQAALDFA  402

Query  484   CGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRF  305
             CG+G +DCGPIQ G+TCY+PNTLVAHAS+AFNSYYQK +R  G+CYFGG  YVVTQ PR+
Sbjct  403   CGEGGSDCGPIQRGATCYDPNTLVAHASFAFNSYYQKQSRKGGSCYFGGTSYVVTQEPRY  462

Query  304   GSCEFPTGY  278
             GSCEFPTGY
Sbjct  463   GSCEFPTGY  471



>ref|XP_004491104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Cicer arietinum]
Length=475

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/489 (59%), Positives = 352/489 (72%), Gaps = 48/489 (10%)
 Frame = -3

Query  1657  FASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDA  1478
              +++FL L   +++  GSIG+NYGRIA++LPS  KVV LLKSQGI +VK+YDTD +VL +
Sbjct  6     LSAIFLLLTILTLTDGGSIGVNYGRIANNLPSAVKVVHLLKSQGIDRVKVYDTDPSVLRS  65

Query  1477  LSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANT  1304
             LSGS I  TV LPN+QL AAA S SF  +WVQ NIV Y   + IE +AVGNEVFVDP N+
Sbjct  66    LSGSKIKVTVDLPNQQLFAAAKSSSFALQWVQRNIVAYYPHTQIEAIAVGNEVFVDPNNS  125

Query  1303  TPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLS  1127
             T +LVPAMKN+Y +L KY +   +KVSSPI  SA+  SYP SSGSF+PELI PV KPML 
Sbjct  126   TKFLVPAMKNIYQALLKYNLHSDIKVSSPIALSALGNSYPSSSGSFRPELIKPVFKPMLE  185

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVY  947
             FL +TGS+LM+N YPF+AYE+N D I LDYA+F +N GVVDP NGL Y +LFDAQ+DAV+
Sbjct  186   FLRKTGSYLMVNVYPFFAYESNADVIPLDYALFRENPGVVDPGNGLRYLNLFDAQIDAVF  245

Query  946   AAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNG  767
             +A++A+K     +V++E+GWPSKG+ N                  E G AS  NAAAYNG
Sbjct  246   SALSAMKYDDVNIVVTETGWPSKGDNN------------------EVG-ASVENAAAYNG  286

Query  766   NLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLA  587
             NLVR++LTG GTPLRP   L+VYLF+LFNENQK GP SERN+GLFYP+E+KVYD+PLT+ 
Sbjct  287   NLVRKILTGSGTPLRPKADLTVYLFALFNENQKPGPTSERNFGLFYPSEEKVYDIPLTVE  346

Query  586   ALGNRG--------------------------SKAQVPPTWCVANGDVGPERLQVALDYA  485
             AL N                            SK+    TWCVAN D    +LQ+ALD+A
Sbjct  347   ALKNYHDNPSPVAPVSGNTNQPTPAVSPVGGVSKSTTGDTWCVANPDADKNKLQLALDFA  406

Query  484   CGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRF  305
             CG+G ADC  IQPG+TCYNPNTLVAHAS+AFNSYYQK AR  G+C+FGG  YVVTQ P++
Sbjct  407   CGEGGADCRTIQPGATCYNPNTLVAHASFAFNSYYQKQARAGGSCFFGGTSYVVTQEPKY  466

Query  304   GSCEFPTGY  278
             GSCEFPTGY
Sbjct  467   GSCEFPTGY  475



>ref|XP_009127019.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Brassica rapa]
Length=462

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/452 (63%), Positives = 339/452 (75%), Gaps = 30/452 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIA++LP+P KVV+LLKSQGI +VKLYDTDS+VL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIANNLPAPEKVVELLKSQGINRVKLYDTDSSVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LSAAAA QS+TD WVQ N+  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLSAAAADQSYTDAWVQDNVKKYTPATDIEAIAVGNEVFVDPRNTTAYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             AK+ +  ++K+SSP+  SA+  SYPPS+GSFKP+LI PVIKPML FL +T S LM+NAYP
Sbjct  144   AKFSLDGAIKISSPLALSALANSYPPSAGSFKPDLIEPVIKPMLDFLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISL+YA+F +N G VD  NGL Y++L DAQ+DAV+AA++AV     +VV+
Sbjct  204   FFAYAANADKISLEYALFKENAGNVDSGNGLKYENLLDAQIDAVFAAMSAVGFNDVKVVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP---  551
             P+EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +  +     SK +VP   
Sbjct  305   PEEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSAKSAPVNDSKEKVPVKS  364

Query  550   -----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQ G+TCY+P +L AHASYAFNS
Sbjct  365   PSHVGQTWCVANGKTSKEKLQEGLDYACGEGGADCRPIQKGATCYDPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             YYQKNARG GTC FGGA YVV+QPP   S  F
Sbjct  425   YYQKNARGVGTCDFGGAAYVVSQPPSTYSITF  456



>gb|KFK29190.1| hypothetical protein AALP_AA7G101400 [Arabis alpina]
Length=461

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/474 (60%), Positives = 346/474 (73%), Gaps = 37/474 (8%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             L +SL   + +  G +G+NYGR+A++LPSP +VV LLKSQGI + K++DTD  VL AL+ 
Sbjct  8     LIISLFSVAHAHYGLVGVNYGRVANNLPSPKQVVNLLKSQGINRTKIFDTDKNVLTALAN  67

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             SGI+  V LPNE LS+ A+ QSF+D WV +NI  Y   + IE VAVGNEVFVDP+NTTPY
Sbjct  68    SGINVIVCLPNELLSSVASDQSFSDNWVLTNIKEYFPATNIEAVAVGNEVFVDPSNTTPY  127

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLE  1118
             LV AM+N+++SL KY +  S+KVSSPI  SA+  SYPPSSGSFKP+LI  VIKPML  L 
Sbjct  128   LVSAMRNIHSSLVKYKLDQSIKVSSPIALSALANSYPPSSGSFKPDLIEQVIKPMLDLLR  187

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             +T S+LM+N YPF+AY AN DKISLDYA+F DN G VDP +GL Y SL DAQ+DAVY+A+
Sbjct  188   KTSSYLMVNVYPFFAYAANADKISLDYALFRDNAGNVDPGSGLRYNSLLDAQIDAVYSAM  247

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +AV     +++++E+GWPS G+ N                  E G AS  NAAAYNG LV
Sbjct  248   SAVGFNGVQLMVTETGWPSAGDVN------------------EVG-ASQSNAAAYNGGLV  288

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-  581
             +RVLTG GTPLRP +PL+VYLF+LFNENQK GP SERNYGLFYPNE KVYDVP       
Sbjct  289   KRVLTGKGTPLRPRDPLNVYLFALFNENQKPGPTSERNYGLFYPNEAKVYDVPFVAGKKR  348

Query  580   -----GNRGSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
                  GNRG  A VP          WCV+NG+ G E+LQ ALDYACG+G ADC PIQPG+
Sbjct  349   KSPLKGNRG-HAPVPVPAVADEGEKWCVSNGEAGMEKLQAALDYACGEGGADCSPIQPGA  407

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             TC+NP +L AHASYAFNSYYQKNAR  GTC+FGGA +VVTQPPR+G C+FPT Y
Sbjct  408   TCFNPESLEAHASYAFNSYYQKNARRVGTCFFGGAAHVVTQPPRYGKCDFPTKY  461



>ref|XP_007049174.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93331.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=601

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/474 (60%), Positives = 343/474 (72%), Gaps = 46/474 (10%)
 Frame = -3

Query  1651  SLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALS  1472
             SL L +   +++  GS+G+NYGRIA++LPS  KVV+LLKS G+ +VK+YDTD  VL ALS
Sbjct  144   SLVLLISVFTLADCGSVGVNYGRIANNLPSATKVVELLKSHGLNRVKVYDTDPAVLHALS  203

Query  1471  GSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTP  1298
             GSGI  TV LPNEQL AAA S SF + WV+ N+  Y   + IE +AVGNEVFVDP NTT 
Sbjct  204   GSGIKVTVDLPNEQLFAAAKSTSFANSWVERNVAAYYPHTEIEAIAVGNEVFVDPHNTTK  263

Query  1297  YLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFL  1121
             +LVPAMKN++ +L K+ +   +KVSSPI  SA+Q SYP S+GSF+PELI PV KPML FL
Sbjct  264   FLVPAMKNIHEALVKFNLHSDIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPMLDFL  323

Query  1120  EQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAA  941
              QTGSFLM+NAYPF+AYE+NTD ISLDYA+F +N GVVDP NGL Y SLFDAQ+DAV+AA
Sbjct  324   RQTGSFLMVNAYPFFAYESNTDVISLDYALFRENPGVVDPGNGLRYFSLFDAQIDAVFAA  383

Query  940   INAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNL  761
             ++A+K    ++V++E+GWPSKG+ N                  E G AS  NAAAYNGNL
Sbjct  384   MSALKYDDIKLVVTETGWPSKGDEN------------------ENG-ASIENAAAYNGNL  424

Query  760   VRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
             VRR+LTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYGLFYPNE+KVYD+P TL  +
Sbjct  425   VRRILTGGGTPLRPKADLTVYLFALFNENKKFGPTSERNYGLFYPNEEKVYDIPFTLEGV  484

Query  580   GNRG------------------------SKAQVPPTWCVANGDVGPERLQVALDYACGQG  473
              N                          SK+    TWCVANG+ G  +LQ ALDYACG+G
Sbjct  485   KNYRDKRSPVAGNQQGAAAPVNGGGGSVSKSTTGNTWCVANGEAGKAKLQAALDYACGEG  544

Query  472   AADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
              ADC  IQPG+TCY+PNT+ AHAS+AFNSYYQK  R  GTCYFGGA YVVTQPP
Sbjct  545   GADCHSIQPGATCYDPNTIQAHASFAFNSYYQKKGRQMGTCYFGGAAYVVTQPP  598



>ref|NP_001154780.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED96597.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=465

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 334/445 (75%), Gaps = 30/445 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLK+QGI ++KLYDT++TVL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIADNLPAPEKVVELLKTQGINRIKLYDTETTVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA QS+TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLASAAADQSYTDTWVQDNIKKYIPATDIEAIAVGNEVFVDPRNTTTYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  144   VKFNLDKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  204   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L   +     +K +V P  
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLNGKSTPVNDNKEKVVPVK  364

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCYNP +L AHASYAFNS
Sbjct  365   PSLVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPP  311
             YYQKNARG GTC FGGA YVV+QPP
Sbjct  425   YYQKNARGVGTCNFGGAAYVVSQPP  449



>ref|XP_009132399.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Brassica rapa]
Length=472

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/462 (62%), Positives = 337/462 (73%), Gaps = 30/462 (6%)
 Frame = -3

Query  1642  LSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSG  1463
              S ++ + + SG IG+NYGRIAD+LP+P KVV+LLKSQGI +VKL+DTD TVL AL+ SG
Sbjct  14    FSAIQFTHADSGMIGVNYGRIADNLPAPEKVVELLKSQGINRVKLFDTDKTVLTALANSG  73

Query  1462  ISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLV  1289
             I   V+LPNE L+AAAA QS+TD+WVQ N+  Y   + IE +AVGNEVFVDP NTT YLV
Sbjct  74    IKVVVSLPNENLTAAAADQSYTDKWVQENVKKYTPATDIEAIAVGNEVFVDPKNTTKYLV  133

Query  1288  PAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQT  1112
              AM NV +SL K+ +  SVK+SSPI  SA+  SYPPS+GSFKP+LI PVIKPML  L +T
Sbjct  134   AAMTNVQSSLVKFNLDKSVKISSPIALSALANSYPPSAGSFKPDLIEPVIKPMLDLLRKT  193

Query  1111  GSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINA  932
              S LM+NAYPF+AY AN DKI LDYA+F +N G VD  NGL Y SLFDAQ+DAVYAA+ A
Sbjct  194   SSHLMVNAYPFFAYAANADKIPLDYALFRENAGNVDSGNGLKYNSLFDAQIDAVYAAMAA  253

Query  931   VKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRR  752
             V     ++V++E+GWPS G+ N                  E G  SA NAAAYNG LV+R
Sbjct  254   VGFNDVKLVVTETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKR  294

Query  751   VLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR  572
             VLTG GTPL+P+EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDVP +       
Sbjct  295   VLTGNGTPLKPNEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVPFSATVTPVS  354

Query  571   GSKAQVP--------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTL  416
              SK +VP         TWCVANG    E+LQ ALDYACG+G ADC  IQ G+TCY+P +L
Sbjct  355   DSKVKVPVNTPSHVGQTWCVANGKTTREKLQEALDYACGEGGADCRSIQKGATCYDPESL  414

Query  415   VAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
              AHASYAFNSYYQKNARG GTC FGGA YVV+QPP   S  F
Sbjct  415   EAHASYAFNSYYQKNARGVGTCNFGGAAYVVSQPPSTHSILF  456



>ref|XP_008379673.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Malus domestica]
Length=480

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/468 (59%), Positives = 339/468 (72%), Gaps = 42/468 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             + S+G+NYGRIAD+LPS  KVVQLLKSQG+ +VK++D+D  VL AL+GS I  TV LPNE
Sbjct  30    AASVGVNYGRIADNLPSAYKVVQLLKSQGLERVKVFDSDPAVLRALAGSDIKVTVDLPNE  89

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA SQSF   WVQ N+V Y   + IE + VGNEVFVD  +TT +L+ AMKN++ +L
Sbjct  90    LLSSAAKSQSFATNWVQRNVVAYHPNTQIEAIGVGNEVFVDTHHTTKFLISAMKNIHTAL  149

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
               + +  S+KVSSPI  SA+Q SYP S+GSF+PEL+ PV KPML FL QTGS+LM+N YP
Sbjct  150   VHFKLESSIKVSSPIALSALQNSYPSSAGSFRPELVEPVFKPMLEFLRQTGSYLMVNCYP  209

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             ++AYE+N+D I LDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K     +V+
Sbjct  210   YFAYESNSDVIPLDYALFRENPGVVDAGNGLRYFNLFDAQIDAVFAAMSALKYDDINMVV  269

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPSKG+                    E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  270   SETGWPSKGD------------------SVEVG-ASVENAAAYNGNLVRRILTGGGTPLR  310

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG---------  569
             P   L+VYLF+LFNE++K GP SERNYGLF+PNE+KVYD+P T+  L N           
Sbjct  311   PKADLTVYLFALFNEDKKFGPTSERNYGLFFPNERKVYDIPFTVEGLKNYHDRRSPVSGN  370

Query  568   -----------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPN  422
                        SK+    TWCVANG+ G E+LQ  LDYACG+G ADC  IQPGS CY+PN
Sbjct  371   QQVTAPVNGDVSKSLTGSTWCVANGEAGKEKLQAGLDYACGEGGADCHQIQPGSACYDPN  430

Query  421   TLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             TL AHASYAFNSYYQK ARG GTCYFGGA YVV+QPP+FG CE PTGY
Sbjct  431   TLEAHASYAFNSYYQKKARGVGTCYFGGAAYVVSQPPKFGKCELPTGY  478



>dbj|BAB08587.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=471

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 334/445 (75%), Gaps = 30/445 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SG IG+NYGRIAD+LP+P KVV+LLK+QGI ++KLYDT++TVL AL+ SGI   V+LPNE
Sbjct  24    SGMIGVNYGRIADNLPAPEKVVELLKTQGINRIKLYDTETTVLTALANSGIKVVVSLPNE  83

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L++AAA QS+TD WVQ NI  Y   + IE +AVGNEVFVDP NTT YLVPAMKNV +SL
Sbjct  84    NLASAAADQSYTDTWVQDNIKKYIPATDIEAIAVGNEVFVDPRNTTTYLVPAMKNVQSSL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K+ +  S+K+SSPI  SA+ +SYPPS+GSFKPELI PVIKPML  L +T S LM+NAYP
Sbjct  144   VKFNLDKSIKISSPIALSALASSYPPSAGSFKPELIEPVIKPMLDLLRKTSSHLMVNAYP  203

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F +N G VD  NGL Y SL DAQ+DAV+AA++AV     ++V+
Sbjct  204   FFAYAANADKISLDYALFKENAGNVDSGNGLKYNSLLDAQIDAVFAAMSAVGFNDVKLVV  263

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N                  E G  SA NAAAYNG LV+RVLTG GTPL+
Sbjct  264   TETGWPSAGDEN------------------EIGAGSA-NAAAYNGGLVKRVLTGNGTPLK  304

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP--  548
             P EPL+VYLF+LFNENQK+GP SERNYGLFYPNE KVYDV L   +     +K +V P  
Sbjct  305   PKEPLNVYLFALFNENQKTGPTSERNYGLFYPNENKVYDVSLNGKSTPVNDNKEKVVPVK  364

Query  547   ------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCVANG    E+LQ  LDYACG+G ADC PIQPG+TCYNP +L AHASYAFNS
Sbjct  365   PSLVGQTWCVANGKTTKEKLQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNS  424

Query  385   YYQKNARGPGTCYFGGAGYVVTQPP  311
             YYQKNARG GTC FGGA YVV+QPP
Sbjct  425   YYQKNARGVGTCNFGGAAYVVSQPP  449



>emb|CDY18049.1| BnaC07g04210D [Brassica napus]
Length=442

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/464 (60%), Positives = 342/464 (74%), Gaps = 32/464 (7%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             IF  L LS +  S+S +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D  VL 
Sbjct  8     IFLVLILSAI--SLSEAGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPAVLK  65

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPAN  1307
             ALSGSGI  TV LPNE L +AA   SF   WV+ N+  Y   + IE+VAVGNEVFVDP N
Sbjct  66    ALSGSGIRVTVDLPNEMLFSAAKRPSFAATWVKRNVAAYHPSTQIESVAVGNEVFVDPHN  125

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPML  1130
             TT YL+PAM+N++ +L  Y +  S+K+SSP+  SA+Q SYP SSGSF+PEL+  VIKPML
Sbjct  126   TTKYLIPAMRNIHKALVSYNLHSSIKISSPLALSALQNSYPSSSGSFRPELVDLVIKPML  185

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL +TGS LM+N YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV
Sbjct  186   DFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLKENPGMVDSGNGLRYFNLFDAQIDAV  245

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             +AA++A+K     ++++E+GWPSKG+ N                  E G AS  NAA+YN
Sbjct  246   FAAMSALKYDDIEIIVTETGWPSKGDEN------------------EIG-ASVANAASYN  286

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
             GNL+RR+LTGGGTPLRP   L++YLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T 
Sbjct  287   GNLIRRILTGGGTPLRPKADLTIYLFALFNENKKFGPTSERNYGLFFPDEKKVYDIPFTQ  346

Query  589   AALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
               L   GS      TWCVANGD G +RLQ  LDYACG G ADC PIQ G+ CY+P+TL A
Sbjct  347   EGL--TGS------TWCVANGDAGKDRLQGGLDYACGDGGADCRPIQRGAPCYSPDTLEA  398

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             HAS+AFNSYYQK  R  G+CYFGGA YVVTQPP++G CEFPTGY
Sbjct  399   HASFAFNSYYQKKGRAGGSCYFGGAAYVVTQPPKYGRCEFPTGY  442



>ref|XP_009365111.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 isoform X1 [Pyrus 
x bretschneideri]
Length=482

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 340/470 (72%), Gaps = 44/470 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             + S+G+NYGRIAD+LPS  KVVQLLKSQG+ +VK++D+D  VL AL+GS I  TV LPNE
Sbjct  30    AASVGVNYGRIADNLPSAYKVVQLLKSQGLERVKVFDSDPAVLRALAGSDIKVTVDLPNE  89

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA SQSF   WVQ N+V Y   + IE + VGNEVFVD  NTT +L+ AMKN++ +L
Sbjct  90    LLSSAAKSQSFATNWVQRNVVAYHPNTQIEAIGVGNEVFVDTHNTTKFLISAMKNIHTAL  149

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
               + +  S+KVSSPI  SA+Q SYP S+GSF+PEL+ PV KPML FL QTGS+LM+N YP
Sbjct  150   VHFNLESSIKVSSPIALSALQNSYPSSAGSFRPELVEPVFKPMLEFLRQTGSYLMVNCYP  209

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             ++AYE+N+D I LDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K     +V+
Sbjct  210   YFAYESNSDVIPLDYALFRENPGVVDAGNGLRYFNLFDAQIDAVFAAMSALKYDDINMVV  269

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPSKG+                    E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  270   SETGWPSKGD------------------SVEVG-ASVENAAAYNGNLVRRILTGGGTPLR  310

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------RGS  566
             P   L+VYLF+LFNE++K GP SERNYGLF+PNE+KVYD+P T+  L N         G+
Sbjct  311   PKADLTVYLFALFNEDKKFGPTSERNYGLFFPNERKVYDIPFTVEGLKNYHDRRSPVSGN  370

Query  565   KAQVPP--------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             +    P              TWCVANG+ G E+LQ  LDYACG+G ADC  IQPGS CY+
Sbjct  371   QHVTAPVNGGGDMSKSLNGNTWCVANGETGKEKLQAGLDYACGEGGADCHQIQPGSACYD  430

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTL AHASYAFNSYYQK ARG GTCYFGGA YVV+QPP+FG CE PTGY
Sbjct  431   PNTLEAHASYAFNSYYQKKARGVGTCYFGGAAYVVSQPPKFGKCELPTGY  480



>ref|XP_009628415.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nicotiana tomentosiformis]
Length=471

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/469 (59%), Positives = 341/469 (73%), Gaps = 42/469 (9%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++  GSIG+NYGR+A++LPS  K V LLKSQG+ +VK+YDTD  VL ALSGSGI  TV L
Sbjct  20    IADGGSIGVNYGRVANNLPSAVKAVALLKSQGVERVKVYDTDPAVLKALSGSGIKVTVNL  79

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNE L  AA  QSF   WVQ N+  Y   + IE++AVGNEVFVDP NTT +LVPAMKN++
Sbjct  80    PNELLYNAAKRQSFAYSWVQRNVAAYYPSTQIESIAVGNEVFVDPHNTTRFLVPAMKNIH  139

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
              +L KY     +KVSSP+  SA+Q SYP S+GSF+ ELI PVIKPM+ FL QTGS+LM+N
Sbjct  140   EALLKYNFHDKIKVSSPVALSALQNSYPSSAGSFRSELIEPVIKPMMDFLRQTGSYLMVN  199

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQVDAV+AA++A+K    +
Sbjct  200   CYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQVDAVFAALSALKYDDIK  259

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             +V++E+GWPSKG+                  D E G AS  NAAAYNGNLVRR+LTGGGT
Sbjct  260   MVVTETGWPSKGD------------------DIEVG-ASVDNAAAYNGNLVRRILTGGGT  300

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------  575
             PLRP E ++V+LF+LFNEN+K GP SERN+GLFYPNE+KVYD+PL +  L +        
Sbjct  301   PLRPKEDITVFLFALFNENKKPGPTSERNFGLFYPNERKVYDIPLNMEGLKHYIDRQSPV  360

Query  574   -------RGSKAQVPP-----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
                    +G K  V P     TWCVA+G+ G + LQ ALD+ACG+G ADC  IQPGSTCY
Sbjct  361   AGGERMQKGGKGNVSPSVPGQTWCVASGEAGKDNLQAALDFACGEGGADCRSIQPGSTCY  420

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             NPNTL AHASYAFNSYYQK  R  G+CYFGGA Y+V Q P++G+CE PT
Sbjct  421   NPNTLEAHASYAFNSYYQKKGRAMGSCYFGGAAYIVHQQPKYGNCELPT  469



>gb|KDO36784.1| hypothetical protein CISIN_1g009301mg [Citrus sinensis]
Length=538

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/459 (62%), Positives = 338/459 (74%), Gaps = 44/459 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRIA++LPS +KVVQLLKSQGI +VK++DTD+ VL ALSGSGI  TV LPNE
Sbjct  90    AGSIGVNYGRIANNLPSASKVVQLLKSQGIERVKVFDTDAAVLKALSGSGIKVTVDLPNE  149

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WVQ N+  Y   + IE + VGNEVFVDP NTT +L+PAMKNV+ +L
Sbjct  150   LLFSAAKRPSFAFSWVQKNVAAYHPDTQIEAIGVGNEVFVDPHNTTKFLLPAMKNVHEAL  209

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  S+KVSSPI  SA+Q SYP S+GSF+PELI PV KPML+FL QTGSFLM+NAYP
Sbjct  210   VKYNLHSSIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPMLNFLRQTGSFLMVNAYP  269

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+NTD ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    R+V+
Sbjct  270   FFAYESNTDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYDDIRMVV  329

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  330   TETGWPSKGDEN------------------ENG-ASVENAAAYNGNLVRRILTGGGTPLR  370

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG---------  569
             P   L+VYLF+LFNE+QK GP SERNYGLFYPNE+KVY++P T+  L N           
Sbjct  371   PKADLTVYLFALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRS  430

Query  568   -------------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
                          SK+    TWCVAN +VG E+LQ  LDYACG+G ADC PIQ G+TCYN
Sbjct  431   PTVRAPVNGGGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGADCRPIQRGATCYN  490

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             PNTL AHAS+AFNSYYQK +R  G+CYFGGA YVVTQPP
Sbjct  491   PNTLEAHASFAFNSYYQKQSRAGGSCYFGGAAYVVTQPP  529



>ref|XP_008449141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=454

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/449 (62%), Positives = 340/449 (76%), Gaps = 28/449 (6%)
 Frame = -3

Query  1603  IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLS  1424
             +G+NYGRIAD+LPSP KVVQLLKS GI ++KL+DT+STVL ALS S IS  VALPNE LS
Sbjct  24    VGVNYGRIADNLPSPDKVVQLLKSHGIDRIKLFDTESTVLSALSNSNISVVVALPNEHLS  83

Query  1423  AAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKY  1250
             +AAA  SFTD WVQSNI  +   + I+ +AVGNEVFVDP NTT +LVPAM+NVYASL K+
Sbjct  84    SAAADPSFTDNWVQSNISHFYPSTKIDAIAVGNEVFVDPNNTTKFLVPAMQNVYASLQKF  143

Query  1249  GVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFYA  1073
              +  ++KVSSPI  S++ +SYP SSGSF+P+LI PVIKPML  L Q+ S+LM+N YPF+A
Sbjct  144   NLHNNIKVSSPIALSSLASSYPTSSGSFRPDLIEPVIKPMLDLLRQSQSYLMVNVYPFFA  203

Query  1072  YEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISES  893
             Y  N DKIS+DYA+F +N GVVD  NGL Y +LF+AQVDAV+AA++A+K     +V++E+
Sbjct  204   YVGNADKISIDYALFRENPGVVDSGNGLKYSNLFEAQVDAVFAAMSAIKYDDVPLVVTET  263

Query  892   GWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDE  713
             GWPS+G  N                  E G AS  NAAAYNGNLV+RVLTG GTPLRP +
Sbjct  264   GWPSQGEEN------------------EIG-ASTENAAAYNGNLVKRVLTGSGTPLRPKD  304

Query  712   PLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG-----NRGSKAQVP-  551
             PL+VYLF+LFNENQK GP SERNYGLFYPNE+KVY++ LT   +G     + GSK +V  
Sbjct  305   PLNVYLFALFNENQKPGPTSERNYGLFYPNEEKVYEISLTGDVVGATPPDSNGSKVEVTG  364

Query  550   PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
              TWCVAN +VG E+LQ  LDYACG+G ADC  IQ G  CY+PN+L AHASYAFNSYYQK 
Sbjct  365   QTWCVANENVGAEKLQAGLDYACGEGQADCRSIQQGGACYDPNSLQAHASYAFNSYYQKM  424

Query  370   ARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
              R  GTC FGGA Y+VTQPP++G C+FP+
Sbjct  425   KRAAGTCDFGGAAYIVTQPPQYGKCDFPS  453



>ref|XP_009771279.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like, partial 
[Nicotiana sylvestris]
Length=455

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/465 (61%), Positives = 340/465 (73%), Gaps = 42/465 (9%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             GSIG+NYGR+A++LPS  K V LLK QG+ +VK+YDTD  VL ALSGSGI  TV LPNE 
Sbjct  8     GSIGVNYGRVANNLPSAVKAVALLKFQGVERVKVYDTDPAVLKALSGSGIMVTVNLPNEL  67

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L  AA  QSF   WVQ N+V Y   + IE++AVGNEVFVDP NTT +LVPAMKN++ +L 
Sbjct  68    LYNAAKRQSFAYSWVQRNVVAYYPSTQIESIAVGNEVFVDPHNTTRFLVPAMKNIHEALL  127

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY +   +KVSSP+  SA+Q SYP S+GSF+ EL+ PVIKPML FL QTGSFLM+N YPF
Sbjct  128   KYNIHDKIKVSSPVALSALQNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSFLMVNCYPF  187

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQVDAV+AA++A+K    ++V++
Sbjct  188   FAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQVDAVFAALSALKYDDIKMVVT  247

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPSKG+                  D E G AS  NAAAYNGNLVRR+LTGGGTPLRP
Sbjct  248   ETGWPSKGD------------------DIEVG-ASLDNAAAYNGNLVRRILTGGGTPLRP  288

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL------------GN  575
              E ++V+LF+LFNEN+K GP SERN+GLFYPNE+KVYD+PL +  L            G 
Sbjct  289   KEDITVFLFALFNENKKPGPTSERNFGLFYPNERKVYDIPLNMEGLKHYIDRQSPVAGGE  348

Query  574   RGSK-------AQVP-PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
             R  K       A VP  TWCVA+G+ G + LQ ALD+ACG+G ADC  IQPGSTCYNPNT
Sbjct  349   RMQKGGKGNVSAGVPGQTWCVASGEAGKDNLQAALDFACGEGGADCRSIQPGSTCYNPNT  408

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             L AHASYAFNSYYQK  R  G+CYFGGA Y+V Q P++G+CE PT
Sbjct  409   LEAHASYAFNSYYQKKGRAMGSCYFGGAAYIVHQQPKYGNCELPT  453



>emb|CAB36529.1| putative beta-1, 3-glucanase [Arabidopsis thaliana]
 emb|CAB79538.1| putative beta-1, 3-glucanase [Arabidopsis thaliana]
Length=448

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/459 (61%), Positives = 342/459 (75%), Gaps = 35/459 (8%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             L LS L    + SG +G+NYGRIA++LPSP KVV LLKSQGI ++K++DTD  VL AL+ 
Sbjct  10    LILSFLSAIDAHSGMVGVNYGRIANNLPSPEKVVNLLKSQGINRIKIFDTDKNVLTALAN  69

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             S I   VALPNE LS+AA+ QSF D W++++I+PY   + IE +AVGNEVFVDP   TPY
Sbjct  70    SKIKVIVALPNELLSSAASHQSFADNWIKTHIMPYFPATEIEAIAVGNEVFVDPT-ITPY  128

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             LV AMKN++ SL KY +  ++K+SSPI  SA+  SYPPSSGSFKPELI PV+KPML+ L+
Sbjct  129   LVNAMKNIHTSLVKYKLDKAIKISSPIALSALANSYPPSSGSFKPELIEPVVKPMLALLQ  188

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QT S+LM+NAYPF+AY AN DKISLDYA+F +N G +D   GL Y SLFDAQ+DAVYAA+
Sbjct  189   QTSSYLMVNAYPFFAYAANADKISLDYALFKENAGNIDSGTGLKYNSLFDAQIDAVYAAL  248

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +AV     +V+++E+GWPS G+ N                  E G AS  NAAAYN  LV
Sbjct  249   SAVGFKGVKVMVTETGWPSVGDEN------------------EIG-ASESNAAAYNAGLV  289

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-  581
             +RVLTG GTPLRP EPL+VYLF+LFNENQK GP SERNYGLFYPNE KVY+VP T  +  
Sbjct  290   KRVLTGKGTPLRPTEPLNVYLFALFNENQKPGPTSERNYGLFYPNEGKVYNVPFTKKSTT  349

Query  580   ---GNRGSKAQVP-----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
                GNRG   +VP      TWCV+NG+V  E+LQ ALDYACG+G ADC PIQPG+TCY+P
Sbjct  350   PVNGNRG---KVPVTHEGHTWCVSNGEVAKEKLQEALDYACGEGGADCRPIQPGATCYHP  406

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPR  308
              +L AHASYAFNSYYQKN+R  GTC+FGGA +VVTQPPR
Sbjct  407   ESLEAHASYAFNSYYQKNSRRVGTCFFGGAAHVVTQPPR  445



>emb|CDY56498.1| BnaAnng14330D [Brassica napus]
Length=442

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/466 (59%), Positives = 340/466 (73%), Gaps = 30/466 (6%)
 Frame = -3

Query  1666  LCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
             L  F  L L L   S+S +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D  V
Sbjct  4     LRAFHFLVLILSAISLSEAGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPAV  63

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDP  1313
             L ALSGSGI  TV LPNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP
Sbjct  64    LKALSGSGIRVTVDLPNEMLFSAAKRPSFAATWVKRNVAAYHPTTQIESIAVGNEVFVDP  123

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKP  1136
              NTT YL+PAM+N++ +L  Y +  S+K+SSP+  SA+Q SYP SSGSF+PEL+  VIKP
Sbjct  124   HNTTKYLIPAMRNIHKALVSYNLHSSIKISSPLALSALQNSYPSSSGSFRPELVDLVIKP  183

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             ML FL +TGS LM+N YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+D
Sbjct  184   MLDFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQID  243

Query  955   AVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAA  776
             AV+AA++A+K     ++++E+GWPSKG+ N                  E G AS  NAA+
Sbjct  244   AVFAAMSALKYDDIEIIVTETGWPSKGDEN------------------EVG-ASVANAAS  284

Query  775   YNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPL  596
             YNGNL+RRVLTGGGTPLRP   L+VYLF+LFNEN+K G  SERNYGLF+P+E+KVYD+P 
Sbjct  285   YNGNLIRRVLTGGGTPLRPKADLTVYLFALFNENKKFGATSERNYGLFFPDEKKVYDIPF  344

Query  595   TLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTL  416
             T   L   GS      TWCVANGD G +RLQ  LDYACG G ADC PIQ G+ CY+P+TL
Sbjct  345   TQEGL--TGS------TWCVANGDAGKDRLQGGLDYACGDGGADCRPIQRGAPCYSPDTL  396

Query  415   VAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CEFPTGY
Sbjct  397   EAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  442



>ref|XP_006575581.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=472

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 346/482 (72%), Gaps = 48/482 (10%)
 Frame = -3

Query  1636  LLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGIS  1457
             LL  +++  GSIG+NYGRIA++LPS  KVV LLKSQG+T+VK+YDTD  VL ALSGSGI 
Sbjct  10    LLSLTLADGGSIGVNYGRIANNLPSAVKVVHLLKSQGLTRVKVYDTDPAVLRALSGSGIR  69

Query  1456  TTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPA  1283
              TV LPN+QL AAA + SF   WV+ N+  Y   + IE +AVGNEVFVDP NTT +LVPA
Sbjct  70    VTVDLPNQQLFAAAKAPSFASSWVERNVAAYYPHTQIEAIAVGNEVFVDPHNTTKFLVPA  129

Query  1282  MKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGS  1106
             MKN+  +L K+ +   +KVSSPI  SA+  SYP S+GSF+PEL+ PV KPML FL +TGS
Sbjct  130   MKNIQKALTKHNLDKDIKVSSPIALSALANSYPSSAGSFRPELVEPVFKPMLDFLRETGS  189

Query  1105  FLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVK  926
             +LM+N YPF+AYE+N D ISLDYA+F DN GVVDP NGL Y +LFDAQ+DAV++A++A+K
Sbjct  190   YLMVNVYPFFAYESNADVISLDYALFRDNPGVVDPGNGLRYYNLFDAQIDAVFSALSALK  249

Query  925   PGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVL  746
                 ++V++E+GWPSKG+ N                  E G AS  NAAAYNGNLVR++L
Sbjct  250   YDDVKIVVTETGWPSKGDSN------------------EVG-ASVDNAAAYNGNLVRKIL  290

Query  745   TGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN---  575
             T GGTPLRP   L V+LF+LFNENQK GP SERN+GLFYP+E++VY+VPLT   L +   
Sbjct  291   TAGGTPLRPKADLIVFLFALFNENQKPGPTSERNFGLFYPDERRVYNVPLTTEELKDYHD  350

Query  574   -----------RGSKAQVP------------PTWCVANGDVGPERLQVALDYACGQGAAD  464
                        +G+ A  P             TWCVAN D    +LQ ALD+ACG+G AD
Sbjct  351   RPAPVSGGGQQKGTPAPAPVVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEGGAD  410

Query  463   CGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             C PIQ GSTCY+PNTLVAHAS+AFNSYYQK +R  G+CYFGG  YVVTQ P++GSCEFPT
Sbjct  411   CRPIQRGSTCYDPNTLVAHASFAFNSYYQKQSRKGGSCYFGGTSYVVTQEPKYGSCEFPT  470

Query  283   GY  278
             GY
Sbjct  471   GY  472



>ref|XP_007141644.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
 gb|ESW13638.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
Length=473

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/471 (59%), Positives = 340/471 (72%), Gaps = 46/471 (10%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             GSIG+NYGRIA++LPS  KVVQLLKSQG+ +VK+YDTD  VL ALSGSGI  TV LPN Q
Sbjct  22    GSIGVNYGRIANNLPSAVKVVQLLKSQGLNRVKVYDTDPAVLRALSGSGIKVTVDLPNMQ  81

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L AAA + SF   WV+ N+V Y   + IE +AVGNEVFVD  NTT +LVPAMKN++ +L 
Sbjct  82    LFAAAKAPSFASSWVERNVVAYYPHTQIEAIAVGNEVFVDTHNTTKFLVPAMKNIHKALV  141

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             K+ +   +KVSSPI  SA+  SYP SSGSF+P+L+ PV KPML FL ++GS+LM+N YPF
Sbjct  142   KHNLDSDIKVSSPIALSALANSYPSSSGSFRPDLVEPVFKPMLDFLRESGSYLMVNVYPF  201

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AYE+N D ISLDYA+F DN GV DP NGL Y +LFDAQ+DAV++A++A+K    ++V++
Sbjct  202   FAYESNADVISLDYALFRDNPGVTDPGNGLRYYNLFDAQIDAVFSALSALKYDDVKIVVT  261

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPSKG+ N                  E G AS  NAAA+NGNLVR++LTGGGTPLRP
Sbjct  262   ETGWPSKGDNN------------------EVG-ASVENAAAFNGNLVRKILTGGGTPLRP  302

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----------GNRG  569
                L+VYLF+LFNENQKSGP SERN+GLFYP+E++VY+VP T   L          G+  
Sbjct  303   KADLTVYLFALFNENQKSGPTSERNFGLFYPDEKRVYNVPFTAEELKDYHDSPVKGGSHN  362

Query  568   SKAQVPP--------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
                Q P               TWCVAN D    +LQ ALD+ACG+G ADC PIQ G+TCY
Sbjct  363   QTTQAPAPNVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEGGADCAPIQHGATCY  422

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             +PNT+VAHAS+AFNSYYQK AR  G+CYFGG  YVVTQ PR+G+CEFPTGY
Sbjct  423   DPNTIVAHASFAFNSYYQKQARKGGSCYFGGTSYVVTQEPRYGNCEFPTGY  473



>gb|AAZ40342.1| beta-1,3-glucanase 2 [Ziziphus jujuba]
Length=468

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/471 (61%), Positives = 344/471 (73%), Gaps = 43/471 (9%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             + +GSIGINYGR+A+DLP+P+KVV+LLKSQGI +VKLYDTDS VL AL+ SGI   VALP
Sbjct  17    TDAGSIGINYGRVANDLPTPSKVVELLKSQGIDRVKLYDTDSDVLTALANSGIGVVVALP  76

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             NE LS+ A  QSF D+WVQ+NI  Y  K+ IE +AVGNEVFVDP NTT +LVPAMKN++ 
Sbjct  77    NELLSSTANDQSFADKWVQANISQYYPKTKIEAIAVGNEVFVDPNNTTKFLVPAMKNIHT  136

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNA  1088
             SL+KY +  S+K+SSPI  SA+Q+SYP SSGSFK EL+ PVIKPML  L QT S+LM+NA
Sbjct  137   SLSKYNLNDSIKISSPIALSALQSSYPSSSGSFKTELVGPVIKPMLDLLRQTSSYLMVNA  196

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRV  908
             YPF+AY  N+D I L YA+F  N G VD  NGL   SL +AQ+DAVYAA+NA+     ++
Sbjct  197   YPFFAYIDNSDTIPLAYALFQTNAGTVDSGNGLRCNSLLEAQIDAVYAAMNALGYNDVKL  256

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTP  728
             V++E+GWPSKG+ N                  E G A+  NAA+YNGNLVRRVLTG GTP
Sbjct  257   VVTETGWPSKGDEN------------------EIG-ATQANAASYNGNLVRRVLTGSGTP  297

Query  727   LRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-----------  581
                  PL+V+LF+LFNEN+KSGP SERNYGLFYP+E+KVYD+PLT A +           
Sbjct  298   KHLRTPLNVFLFALFNENEKSGPTSERNYGLFYPSEEKVYDIPLTKAEVNGGVQSTTPAN  357

Query  580   ----------GNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
                           SK  V  TWCVANG+VG E+LQ ALDYACG+G ADC PIQ GSTCY
Sbjct  358   GTNSTTEISPAGEVSKTSVGQTWCVANGNVGEEKLQTALDYACGEGGADCRPIQEGSTCY  417

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             +PN+LVAHASYAFNSYYQK AR  G+C FGGA YV TQPP+FG CEFPTGY
Sbjct  418   DPNSLVAHASYAFNSYYQKKARLIGSCDFGGAAYVATQPPKFGQCEFPTGY  468



>ref|XP_009102359.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
 ref|XP_009102360.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=473

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 344/489 (70%), Gaps = 45/489 (9%)
 Frame = -3

Query  1666  LCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
             L  F  L L L   S+S +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D  V
Sbjct  4     LRAFHFLVLILSAISLSEAGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPAV  63

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDP  1313
             L ALSGSGI  TV LPNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP
Sbjct  64    LKALSGSGIRVTVDLPNEMLFSAAKRPSFAATWVKRNVAAYHPSTQIESIAVGNEVFVDP  123

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKP  1136
              NTT YL+PAM+N++ +L  Y +  S+K+SSP+  SA+Q SYP SSGSF+PEL+  VIKP
Sbjct  124   HNTTKYLIPAMRNIHKALVSYNLHSSIKISSPLALSALQNSYPSSSGSFRPELVDLVIKP  183

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             ML FL +TGS LM+N YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+D
Sbjct  184   MLDFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQID  243

Query  955   AVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAA  776
             AV+AA++A+K     ++++E+GWPSKG+ N                  E G AS  NAA+
Sbjct  244   AVFAAMSALKYDDIEIIVTETGWPSKGDEN------------------EVG-ASVANAAS  284

Query  775   YNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPL  596
             YNGNL+RRVLTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P 
Sbjct  285   YNGNLIRRVLTGGGTPLRPKADLTVYLFALFNENKKFGPTSERNYGLFFPDEKKVYDIPF  344

Query  595   TLAALGN----------RGSKAQVPP-------------TWCVANGDVGPERLQVALDYA  485
             T   L +           G +   PP             TWCVANGD G +RLQ  LDYA
Sbjct  345   TQEGLKHYRDGGHNTPATGDQQVTPPNNGGGVSKSLTGSTWCVANGDAGKDRLQGGLDYA  404

Query  484   CGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRF  305
             CG G ADC PIQ G+ CY+P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVVTQPP++
Sbjct  405   CGDGGADCRPIQRGAPCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVTQPPKY  464

Query  304   GSCEFPTGY  278
             G CEFPTGY
Sbjct  465   GRCEFPTGY  473



>ref|XP_010110627.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
 gb|EXC27249.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
Length=479

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/480 (59%), Positives = 346/480 (72%), Gaps = 57/480 (12%)
 Frame = -3

Query  1636  LLRHSV----------SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
             + RHSV          +  GSIG+NYGRIA++LPS  KVVQLL+SQG+ +VK+YDTD  V
Sbjct  1     MERHSVFFFLISIVAFADGGSIGVNYGRIANNLPSARKVVQLLRSQGLERVKVYDTDPAV  60

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDP  1313
             L +LSGSGI  TV LPNE LS+AA  QSF + WVQ N+V Y   + IE +AVGNEVFVDP
Sbjct  61    LKSLSGSGIKVTVDLPNELLSSAARHQSFANSWVQRNVVAYHPATQIEAIAVGNEVFVDP  120

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKP  1136
              NTT +LVPAMKN++A+L K  +  S+K+SSPI  SA+Q SYP S+GSF+PEL+  V KP
Sbjct  121   HNTTTFLVPAMKNIHAALVKNNLDSSIKISSPIALSALQNSYPASAGSFRPELVELVFKP  180

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             +L FL QTGSFLM+NAYPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y +LFDAQ+D
Sbjct  181   LLDFLRQTGSFLMVNAYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFNLFDAQID  240

Query  955   AVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAA  776
             AV+AA++A+K    ++V++E+GWPSKG+ N                  E G AS  NAAA
Sbjct  241   AVFAAMSALKYDDIKMVVTETGWPSKGDEN------------------EIG-ASVENAAA  281

Query  775   YNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPL  596
             YNGNL+RR+LTGGGTP RP E L+VYLF+LFNENQK+GP SERNYGLFYP+E+KVY++P 
Sbjct  282   YNGNLIRRILTGGGTPRRPKEELTVYLFALFNENQKNGPTSERNYGLFYPDEKKVYNIPF  341

Query  595   TLAAL-----------GNRGSKAQVP--------------PTWCVANGDVGPERLQVALD  491
             T+  L           G R  KA V                TWCVANG++G  +LQ ALD
Sbjct  342   TVEGLKDYHDDRSPVTGGRQVKAPVEGGSPRGSVSKSLTGNTWCVANGEMGKVKLQAALD  401

Query  490   YACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             YACG+G ADC  IQPG+TCY+PNT+ AHAS+AFNSYYQK AR  G+CYFGG  YVVTQPP
Sbjct  402   YACGEGGADCRGIQPGATCYDPNTIEAHASFAFNSYYQKKARQMGSCYFGGTAYVVTQPP  461



>ref|XP_003616906.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99864.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=470

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/472 (60%), Positives = 340/472 (72%), Gaps = 42/472 (9%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             +++ +G+IGINYGRIA++LPS  KVVQLLKSQGIT VK+YDTD +VL ALSGS I  TV 
Sbjct  18    ALTNAGNIGINYGRIANNLPSATKVVQLLKSQGITHVKIYDTDPSVLRALSGSKIKLTVD  77

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNV  1271
             LPN+QL AAA SQSF   WV+ NIV Y+  +IIE +AVGNEVFVDP N+T YLVPAMKN+
Sbjct  78    LPNQQLFAAAKSQSFALSWVERNIVAYQPNTIIEAIAVGNEVFVDPNNSTKYLVPAMKNI  137

Query  1270  YASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLML  1094
             Y SL K+ +   +KVSSPI  SA+  SYP SSGSF+PELI PV KPML FL +TGS+LM+
Sbjct  138   YRSLQKHNLHNDIKVSSPIALSALGNSYPSSSGSFRPELIQPVFKPMLDFLRETGSYLMV  197

Query  1093  NAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF  914
             N YPF+AYE+N D ISLDYA+F +N G VD  NGL Y +LFDAQ+DAV+AA++ +K    
Sbjct  198   NVYPFFAYESNADVISLDYALFRENPGQVDAGNGLRYLNLFDAQIDAVFAALSRLKYDDI  257

Query  913   RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGG  734
              VV+SE+GWPSKG                   DG    AS  NAAAYN NLVR++LT  G
Sbjct  258   NVVVSETGWPSKG-------------------DGNEVGASVENAAAYNANLVRKILTSKG  298

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-------  575
             TPLRP   L+V+LF+LFNENQK GP SERN+GLFYP+E+KVY+VPLT+ AL N       
Sbjct  299   TPLRPKADLTVFLFALFNENQKPGPTSERNFGLFYPDEKKVYNVPLTVEALKNYHDDPSP  358

Query  574   -------------RGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTC  434
                            SK+    TWCVAN      +LQ ALD+ACG+G ADC PIQ  +TC
Sbjct  359   ASPVSGGGGSGGGGVSKSTTGNTWCVANPYADKNKLQDALDFACGEGGADCRPIQNNATC  418

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             ++PNTLVAHAS+AFNSYYQK AR  G+CYFGG  YVVTQ P++G CEFPTGY
Sbjct  419   FDPNTLVAHASFAFNSYYQKQARAGGSCYFGGTSYVVTQEPKYGKCEFPTGY  470



>ref|XP_004304085.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=485

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/475 (59%), Positives = 342/475 (72%), Gaps = 49/475 (10%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             + LS+L  S S +GS+G+NYGR+AD+LPS  KV  L+KSQG+ +VK++D+D  VL ALSG
Sbjct  11    VLLSVLA-SHSDAGSVGVNYGRVADNLPSAYKVAALIKSQGLERVKVFDSDPAVLRALSG  69

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPY  1295
             SGI  TV LPNE LS+AA +Q F   WVQ N+V Y   + IE +AVGNEVFVD  NTT Y
Sbjct  70    SGIKVTVDLPNELLSSAAKTQMFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTHNTTKY  129

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             L+ AMKN++ +L K+ +A  +KVSSPI  SA+Q SYP S+GSF+PELI PV KPML FL 
Sbjct  130   LIAAMKNIHTALVKFNLASDIKVSSPIALSALQNSYPSSAGSFRPELIQPVFKPMLDFLR  189

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QTGS+LM+NAYP++AYE+N D ISLDYA+F +N GVVD  +GL Y SLFDAQ+DAV+AA+
Sbjct  190   QTGSYLMVNAYPYFAYESNADVISLDYALFRENPGVVDAGSGLRYFSLFDAQIDAVFAAM  249

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +A+K     +V+SE+GWPSKG+ N                  E G AS  NAAAYNGNLV
Sbjct  250   SALKYNDIEMVVSETGWPSKGDEN------------------EIG-ASIENAAAYNGNLV  290

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RR+LTGGGTPLRP   L+VYLF+LFNE++K GP SERNYGLF+PNE+KVYD+P T+  L 
Sbjct  291   RRILTGGGTPLRPKADLTVYLFALFNEDRKFGPTSERNYGLFFPNEKKVYDIPFTVEGLK  350

Query  577   N--------RGSKAQVPP------------------TWCVANGDVGPERLQVALDYACGQ  476
             N         G+  +  P                  TWCVANG+ G E+LQ ALDYACG+
Sbjct  351   NYHDHKSPVSGNHHETAPVTAPVTGSGDVSKTLTGNTWCVANGEAGEEKLQAALDYACGE  410

Query  475   GAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             G ADC  IQPGSTCY+PNTL AHASYAFNSYYQK ARG GTCYFGGA YVV+Q P
Sbjct  411   GGADCHQIQPGSTCYDPNTLEAHASYAFNSYYQKKARGAGTCYFGGAAYVVSQLP  465



>ref|XP_006396136.1| hypothetical protein EUTSA_v10002515mg [Eutrema salsugineum]
 gb|ESQ36915.1| hypothetical protein EUTSA_v10002515mg [Eutrema salsugineum]
Length=469

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/467 (58%), Positives = 338/467 (72%), Gaps = 41/467 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D  VL ALSGSGI  TV LPNE
Sbjct  22    AGSIGVNYGRISDELPSAVKVVQLLKSQGIDRVKIFDADPAVLKALSGSGIRVTVDLPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT +L+PAM+N++ +L
Sbjct  82    ILFSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVFVDPHNTTKFLIPAMRNIHKAL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
               + +  S+K+SSP+  SA+Q SYP SSGSF+PEL+  VIKPML FL +TGS LM+N YP
Sbjct  142   ISFNLHSSIKISSPLALSALQNSYPSSSGSFRPELVDLVIKPMLDFLRETGSRLMINVYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA++A+K     +++
Sbjct  202   FFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALKYDDIEIIV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G A+  NAA+YNGNL+RR+LTGGGTPLR
Sbjct  262   TETGWPSKGDEN------------------EVG-ATVANAASYNGNLIRRILTGGGTPLR  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-------------  581
             P   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYDVP T   L             
Sbjct  303   PKADLTVYLFALFNENKKFGPTSERNYGLFFPDEKKVYDVPFTQEGLKHFRNTPVAGDQR  362

Query  580   ------GNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                   G   SK+    +WCVANGD G +RLQ  LDYACG+G ADC PIQPG+TCY+P+T
Sbjct  363   VSPPINGGGVSKSLTGSSWCVANGDAGADRLQRGLDYACGEGGADCRPIQPGATCYSPDT  422

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             L AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CEFPTGY
Sbjct  423   LEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  469



>ref|XP_010046177.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 isoform X2 [Eucalyptus 
grandis]
 gb|KCW88739.1| hypothetical protein EUGRSUZ_A01095 [Eucalyptus grandis]
Length=474

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/472 (59%), Positives = 340/472 (72%), Gaps = 47/472 (10%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             GSIG+NYGR+AD+LP   KVVQLLKSQG+ KVK+YD D  VL A +G+GI  TV LPNE+
Sbjct  22    GSIGVNYGRVADNLPPATKVVQLLKSQGVQKVKIYDADPAVLHAFAGTGIRLTVDLPNEK  81

Query  1429  LSAAAASQSFTDRWVQSNIVPYKSI-IETVAVGNEVFVDPANTTPYLVPAMKNVYASLAK  1253
             L AAA S SF+  WVQ N+  Y +  IE +AVGNEVFVD  NTT +LVPAMKN++ +L K
Sbjct  82    LFAAARSLSFSLDWVQQNVADYPTTQIEAIAVGNEVFVDTHNTTRFLVPAMKNIHTALVK  141

Query  1252  YGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFY  1076
             + +  ++K+SSPI  SA+Q SYP S+GSF+PELI PV KPML FL QTGS+LM+NAYPF+
Sbjct  142   HNLHNAIKISSPIALSALQASYPSSAGSFRPELIEPVFKPMLEFLRQTGSYLMVNAYPFF  201

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AYE+N+D ISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K    ++V++E
Sbjct  202   AYESNSDVISLDYALFRENPGVVDAGNGLRYFNLFDAQIDAVFAAMSALKYDDIKMVVTE  261

Query  895   SGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPD  716
             +GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPLR  
Sbjct  262   TGWPSKGDEN------------------EVG-ASKDNAAAYNGNLVRRILTGGGTPLRRQ  302

Query  715   EPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL--------------G  578
               L+VYLF+LFNEN+K GP SE+NYGLFYPN+ KVYDVPLT+  L              G
Sbjct  303   ADLTVYLFALFNENKKPGPSSEQNYGLFYPNQDKVYDVPLTVEGLKNYHDTGKSAPAGGG  362

Query  577   NRG------------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTC  434
              RG            SK+    TWCVA G+ G E+LQ ALD+ACG+G ADC PIQ GSTC
Sbjct  363   QRGVAAPVKGGRGGVSKSSSANTWCVAKGEAGKEKLQAALDFACGEGGADCRPIQRGSTC  422

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             Y+PNTL AHASYAFNSYYQ   R   TC FGGA  +V+QPP++G C+FPTGY
Sbjct  423   YDPNTLEAHASYAFNSYYQMKGRAFWTCDFGGAASIVSQPPKYGKCDFPTGY  474



>ref|XP_010046172.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 isoform X1 [Eucalyptus 
grandis]
 gb|KCW88740.1| hypothetical protein EUGRSUZ_A01095 [Eucalyptus grandis]
Length=477

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/472 (59%), Positives = 340/472 (72%), Gaps = 47/472 (10%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             GSIG+NYGR+AD+LP   KVVQLLKSQG+ KVK+YD D  VL A +G+GI  TV LPNE+
Sbjct  25    GSIGVNYGRVADNLPPATKVVQLLKSQGVQKVKIYDADPAVLHAFAGTGIRLTVDLPNEK  84

Query  1429  LSAAAASQSFTDRWVQSNIVPYKSI-IETVAVGNEVFVDPANTTPYLVPAMKNVYASLAK  1253
             L AAA S SF+  WVQ N+  Y +  IE +AVGNEVFVD  NTT +LVPAMKN++ +L K
Sbjct  85    LFAAARSLSFSLDWVQQNVADYPTTQIEAIAVGNEVFVDTHNTTRFLVPAMKNIHTALVK  144

Query  1252  YGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFY  1076
             + +  ++K+SSPI  SA+Q SYP S+GSF+PELI PV KPML FL QTGS+LM+NAYPF+
Sbjct  145   HNLHNAIKISSPIALSALQASYPSSAGSFRPELIEPVFKPMLEFLRQTGSYLMVNAYPFF  204

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AYE+N+D ISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K    ++V++E
Sbjct  205   AYESNSDVISLDYALFRENPGVVDAGNGLRYFNLFDAQIDAVFAAMSALKYDDIKMVVTE  264

Query  895   SGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPD  716
             +GWPSKG+ N                  E G AS  NAAAYNGNLVRR+LTGGGTPLR  
Sbjct  265   TGWPSKGDEN------------------EVG-ASKDNAAAYNGNLVRRILTGGGTPLRRQ  305

Query  715   EPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL--------------G  578
               L+VYLF+LFNEN+K GP SE+NYGLFYPN+ KVYDVPLT+  L              G
Sbjct  306   ADLTVYLFALFNENKKPGPSSEQNYGLFYPNQDKVYDVPLTVEGLKNYHDTGKSAPAGGG  365

Query  577   NRG------------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTC  434
              RG            SK+    TWCVA G+ G E+LQ ALD+ACG+G ADC PIQ GSTC
Sbjct  366   QRGVAAPVKGGRGGVSKSSSANTWCVAKGEAGKEKLQAALDFACGEGGADCRPIQRGSTC  425

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             Y+PNTL AHASYAFNSYYQ   R   TC FGGA  +V+QPP++G C+FPTGY
Sbjct  426   YDPNTLEAHASYAFNSYYQMKGRAFWTCDFGGAASIVSQPPKYGKCDFPTGY  477



>ref|XP_004140120.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 1 
[Cucumis sativus]
 ref|XP_004156095.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 1 
[Cucumis sativus]
Length=505

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/469 (60%), Positives = 338/469 (72%), Gaps = 47/469 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             SGSIG+NYGRI +DLPS  KVV+LLKS G+ +VK+YDTD  VL ALSGSGI  TV LPNE
Sbjct  23    SGSIGVNYGRIGNDLPSAVKVVKLLKSHGLQRVKVYDTDPAVLKALSGSGIKVTVDLPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L AAA   +F   WV+ N+  Y   + IE +AVGNEVFVDP NTT +LVPAMKN++ +L
Sbjct  83    LLFAAAKRLTFAYTWVEKNVAAYYPSTEIEAIAVGNEVFVDPHNTTSFLVPAMKNIHQAL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  ++KVSSPI  SA+Q SYP S+GSF+PEL+  V +PML FL QTGS+LM+NAYP
Sbjct  143   VKYNLHSNIKVSSPIALSALQNSYPSSAGSFRPELVETVFRPMLEFLRQTGSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+NTD ISLDYA+F DN GVVD  +G  Y +LFDAQ+DAV+AA++A+K    ++V+
Sbjct  203   FFAYESNTDVISLDYALFRDNPGVVDAGSGYRYFNLFDAQIDAVFAAMSALKYDDIKMVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAAAYNGNLVRR+L+GGGTPLR
Sbjct  263   TETGWPSKGDEN------------------EIG-ASVENAAAYNGNLVRRILSGGGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-------------  581
             P   L+VYLF+LFNEN+K+GP SERNYGLFYPNE+KVYD+P T   L             
Sbjct  304   PKADLTVYLFALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVS  363

Query  580   -----------GNRG-SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGST  437
                        G+ G SK+Q   TWCVA+G+ G E+LQ  LDYACG+G ADC PIQ G+T
Sbjct  364   GGNAPTAPPASGDGGVSKSQTGNTWCVASGEAGKEKLQSGLDYACGEGGADCRPIQVGAT  423

Query  436   CYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             CYNPNTL AHASYAFNSYYQKN+R  GTCYFGGA YVVTQPP   S  F
Sbjct  424   CYNPNTLEAHASYAFNSYYQKNSRKVGTCYFGGAAYVVTQPPSKFSLTF  472



>ref|XP_010467085.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 346/493 (70%), Gaps = 49/493 (10%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             L +  +F  LF  +   S+S +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D
Sbjct  3     LLTPLVFLILFSPI---SLSDAGSIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDAD  59

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVF  1322
              +VL ALSGSGI  TV +PNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVF
Sbjct  60    PSVLKALSGSGIKVTVDVPNEILFSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVF  119

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-V  1145
             VDP NTT YL+PAM+N++ +L  + +   +K+SSP+  SA+Q SYP SSGSF+PEL+  V
Sbjct  120   VDPHNTTNYLIPAMRNIHKALVSFNLHSDIKISSPLALSALQNSYPSSSGSFRPELVDTV  179

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
             IKPML FL +TGS LM+N YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDA
Sbjct  180   IKPMLEFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLRENPGMVDAGNGLRYFNLFDA  239

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV+AA++A+K     ++++E+GWPSKG+ N                  E G A+  N
Sbjct  240   QIDAVFAAMSALKYDDIEIIVTETGWPSKGDEN------------------EVG-ATIAN  280

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AA+YNGNL+RR+LT GGTPLRP   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD
Sbjct  281   AASYNGNLIRRILTRGGTPLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYD  340

Query  604   VPLTLAALGNRGSKAQVPPT------------------------WCVANGDVGPERLQVA  497
             +P TL  L +    +  P T                        WCVANGD G ERLQ  
Sbjct  341   IPFTLEGLKHYRDGSHTPVTGDHQVTTPPMSGGGGVSKSLNGQSWCVANGDAGEERLQGG  400

Query  496   LDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQ  317
             LDYACG+G ADC PIQPG+ CY+P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+Q
Sbjct  401   LDYACGEGGADCRPIQPGANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQ  460

Query  316   PPRFGSCEFPTGY  278
             PP++G CEFPTGY
Sbjct  461   PPKYGRCEFPTGY  473



>ref|XP_006452449.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
 gb|ESR65689.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
Length=473

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/478 (59%), Positives = 337/478 (71%), Gaps = 45/478 (9%)
 Frame = -3

Query  1636  LLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGIS  1457
             L+  + + +G +GINYGR+A++LPSP KVV+LLKSQGI +VK YDTDS VL AL+ S IS
Sbjct  16    LVTFASADTGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDIS  75

Query  1456  TTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPA  1283
               VA PNE+LS AAA QSFTD WVQ+NI  Y   + IE VAVGNEVF DP NTTP+LVPA
Sbjct  76    VVVAFPNEELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPFLVPA  135

Query  1282  MKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGS  1106
             MKNVY SL KY +  +VKVSSPI   A+Q SYPPSSGSFK +LI P +KPML FL +T S
Sbjct  136   MKNVYNSLVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSS  195

Query  1105  FLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVK  926
             +LM+NAYPF+AY AN DKISLDYA+F DN G VD  NGL Y +LFDAQ+DAV+AA++A+ 
Sbjct  196   YLMVNAYPFFAYSANADKISLDYALFRDNPGQVDSGNGLKYSNLFDAQLDAVFAAMSAIS  255

Query  925   PGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVL  746
                 +VV++E+GWPS G+ N A      AA                        LVRRVL
Sbjct  256   YNDVKVVVTETGWPSMGDENEAGAGAANAAAYNGN-------------------LVRRVL  296

Query  745   TGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS  566
             +G GTPLRP +PL+VYLF+LFNENQK GP SERNYGLFYPNEQ VYD P  ++  GN  S
Sbjct  297   SGSGTPLRPKDPLNVYLFALFNENQKQGPTSERNYGLFYPNEQTVYDSPF-VSTSGNSSS  355

Query  565   -------KAQVP---------------PTWCVANGDVGPERLQVALDYACGQGAADCGPI  452
                    K QVP                TWCVAN + G ++LQ A+DYACG+G ADC PI
Sbjct  356   TPAANKSKTQVPVSGGGGGDVSPSAAGQTWCVANANAGEKKLQAAIDYACGEGGADCRPI  415

Query  451   QPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             Q G+TCY+PNTL AHASYAFNSYYQK  R  G+C FGGA YVVTQ P++G C+FPTGY
Sbjct  416   QEGATCYDPNTLEAHASYAFNSYYQKQVRKAGSCDFGGAAYVVTQAPKYGKCQFPTGY  473



>ref|XP_010488778.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/485 (56%), Positives = 342/485 (71%), Gaps = 47/485 (10%)
 Frame = -3

Query  1648  LFLSLLR-HSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALS  1472
             +FL LL   S+S +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D +VL ALS
Sbjct  8     VFLILLSPISLSDAGSIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDADPSVLKALS  67

Query  1471  GSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTP  1298
             GSGI  TV +PNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT 
Sbjct  68    GSGIKVTVDVPNEILFSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVFVDPHNTTN  127

Query  1297  YLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFL  1121
             YL+PAM+N++ +L  + +   +K+SSP+  SA+Q SYP SSGSF+PEL+  VIKPML FL
Sbjct  128   YLIPAMRNIHKALVSFNLHSDIKISSPLALSALQNSYPSSSGSFRPELVDTVIKPMLEFL  187

Query  1120  EQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAA  941
              +TGS LM+N YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA
Sbjct  188   RETGSRLMINVYPFFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAA  247

Query  940   INAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNL  761
             ++A+K     ++++E+GWPSKG+ N                  E G A+  NAA+YNGNL
Sbjct  248   MSALKYDDIEIIVTETGWPSKGDEN------------------EVG-ATIANAASYNGNL  288

Query  760   VRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
             +RR+LT GGTPLRP   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T   L
Sbjct  289   IRRILTRGGTPLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGL  348

Query  580   GNRGSKAQVPPT------------------------WCVANGDVGPERLQVALDYACGQG  473
              +       P T                        WCVANGD G ERLQ  LDYACG+G
Sbjct  349   KHYRDGGHTPVTGDHQVTTPPMSGGGGVSKSLNGQSWCVANGDAGEERLQGGLDYACGEG  408

Query  472   AADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
              ADC PIQPG+ CY+P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CE
Sbjct  409   GADCRPIQPGANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCE  468

Query  292   FPTGY  278
             FPTGY
Sbjct  469   FPTGY  473



>gb|EPS59841.1| hypothetical protein M569_14964, partial [Genlisea aurea]
Length=461

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/482 (61%), Positives = 355/482 (74%), Gaps = 35/482 (7%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             M F ++  L +  S+  S +  +  G+G  GINYGRIAD+LPSP +VVQLL+S G+ +VK
Sbjct  1     MEFGKVSQLLLILSVVGSNILFA-RGAGVAGINYGRIADNLPSPPQVVQLLRSLGVNRVK  59

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             +YD DS VL A SGS IS  VALPNEQL+AAA S +  D WV +N+VPY   + IE + V
Sbjct  60    IYDADSAVLSAFSGSNISLVVALPNEQLAAAAGSSAAADAWVMANVVPYYPSTGIEAITV  119

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVFV P N TP+LVPAM+ VY SL K+GV+ S+KVSSPI  SA+Q+SYPPS+G+FK E
Sbjct  120   GNEVFVSPGNLTPFLVPAMERVYDSLVKHGVS-SIKVSSPIALSALQSSYPPSAGAFKGE  178

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVF-GDNQGVVDPNNGLVY  983
             LI   IKPMLSFL +TGS LM+NAYP++AY ANTDKI LDYA+  G++ G  DPNNGLVY
Sbjct  179   LIQSAIKPMLSFLRRTGSSLMVNAYPYFAYTANTDKIPLDYALLDGNSAGNTDPNNGLVY  238

Query  982   KSLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETG  803
             KSLF+AQ+DAVYAA+ AV      VV+SE+GWPSKG+ N                  E G
Sbjct  239   KSLFEAQIDAVYAAMAAVGYDDVAVVVSETGWPSKGDAN------------------EVG  280

Query  802   PASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPN  623
              AS  NAAAYNGNLVRRVL G GTPLRP  PL+VYLF+LFNENQK+GP SERNYGLFYP+
Sbjct  281   -ASVGNAAAYNGNLVRRVLAGNGTPLRPTVPLNVYLFALFNENQKTGPTSERNYGLFYPD  339

Query  622   EQKVYDVPLTLAAL--GNRGSKAQVPP--------TWCVANGDVGPERLQVALDYACGQG  473
             EQKVY++PLT A L  G   S+ Q PP        TWCVAN D G E+LQ ALDYACG+G
Sbjct  340   EQKVYNIPLTAAGLSAGTGVSRIQTPPPEGAAAGETWCVANQDSGSEKLQRALDYACGEG  399

Query  472   AADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
              A+C PIQPG+TCY+P++L+AHAS+AFNSYYQ + R  G C F GA +VVTQPP +G+C+
Sbjct  400   GANCRPIQPGATCYHPDSLLAHASFAFNSYYQASDRRSGACDFAGAAHVVTQPPNYGNCQ  459

Query  292   FP  287
             FP
Sbjct  460   FP  461



>ref|XP_006475009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=472

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/470 (60%), Positives = 333/470 (71%), Gaps = 45/470 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +GINYGR+A++LPSP KVV+LLKSQGI +VK YDTDS VL AL+ S IS  VA PNE
Sbjct  23    TGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             +LS AAA QSFTD WVQ+NI  Y   + IE VAVGNEVF DP NTTP+LVPAMKNVY SL
Sbjct  83    ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPFLVPAMKNVYNSL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  +VKVSSPI   A+Q SYPPSSGSFK +LI P +KPML FL +T S+LM+NAYP
Sbjct  143   VKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F DN G VD  NGL Y +LFDAQ+DAV+AA++A+     +VV+
Sbjct  203   FFAYSANADKISLDYALFRDNPGQVDSGNGLKYSNLFDAQLDAVFAAMSAISYNDVKVVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N A      AA                        LVRRVL+G GTPLR
Sbjct  263   TETGWPSMGDENEAGAGAANAAAYNGN-------------------LVRRVLSGSGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS-------K  563
             P +PL+VYLF+LFNENQK GP SERNYGLFYPNEQ VYD P  ++  GN  S       K
Sbjct  304   PKDPLNVYLFALFNENQKQGPTSERNYGLFYPNEQTVYDSPF-VSTSGNSSSTPAANKSK  362

Query  562   AQVP---------------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
              QVP                TWCVAN + G ++LQ A+DYACG+G ADC PIQ G+TCY+
Sbjct  363   TQVPVSGGGGGDVSPSAAGQTWCVANANAGEKKLQAAIDYACGEGGADCRPIQEGATCYD  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTL AHASYAFNSYYQK  R  G+C FGGA YVVTQ P++G C+FPTGY
Sbjct  423   PNTLEAHASYAFNSYYQKQVRKAGSCDFGGAAYVVTQAPKYGKCQFPTGY  472



>ref|NP_178637.2| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEC05971.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=472

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 337/470 (72%), Gaps = 44/470 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRI+D+LPS  KVVQLLKSQGIT+VK++D D +VL ALSGSGI  TV LPNE
Sbjct  22    AGSIGVNYGRISDELPSAFKVVQLLKSQGITRVKIFDADPSVLKALSGSGIKVTVDLPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVD  NTT +L+PAM+N++ +L
Sbjct  82    LLFSAAKRTSFAVSWVKRNVAAYHPSTQIESIAVGNEVFVDTHNTTSFLIPAMRNIHKAL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
               + +   +K+SSP+  SA+Q SYP SSGSF+PELI  VIKPML FL +TGS LM+N YP
Sbjct  142   MSFNLHSDIKISSPLALSALQNSYPSSSGSFRPELIDSVIKPMLDFLRETGSRLMINVYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA++A+K     +++
Sbjct  202   FFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALKYDDIEIIV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G A+  NAA+YNGNL+RR+LT GGTPLR
Sbjct  262   TETGWPSKGDEN------------------EVG-ATLANAASYNGNLIRRILTRGGTPLR  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR----------  572
             P   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T   L +           
Sbjct  303   PKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTG  362

Query  571   GSKAQVPP------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             G +   PP            TWCVANGD G ERLQ  LDYACG+G ADC PIQPG+ CY+
Sbjct  363   GDQVTKPPMSGGVSKSLNGYTWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYS  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CEFPTGY
Sbjct  423   PDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  472



>ref|XP_004243515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Solanum lycopersicum]
Length=468

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/465 (58%), Positives = 337/465 (72%), Gaps = 38/465 (8%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ +GSIGINYGR+A++LPS  KV+ LLKSQG+ +VK+YDTD  VL ALSGS I  TV L
Sbjct  21    IADAGSIGINYGRVANNLPSAVKVIALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVNL  80

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNE L  AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT +LV AMKNV+
Sbjct  81    PNELLYNAAKRPSFAYSWVEKNVAAYYPSTQIESIAVGNEVFVDPHNTTRFLVSAMKNVH  140

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
              +L K+     +K+SSP+  SA+Q SYP S+GSF+ EL+ PVIKPML FL QTGS+LM+N
Sbjct  141   QALVKFNFHDKIKISSPVALSALQNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSYLMVN  200

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    +
Sbjct  201   CYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYNDIK  260

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             +V++E+GWPSKG+                  D E G AS  NAA+YNGNLVRR+L GGGT
Sbjct  261   MVVTETGWPSKGD------------------DTEIG-ASVDNAASYNGNLVRRILIGGGT  301

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------  575
             PLRP E L+V+LF+LFNEN+K GP SERN+GLFYPNE+KVY++PLT+  L +        
Sbjct  302   PLRPKEDLTVFLFALFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPS  361

Query  574   -------RGSKAQVP-PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                    +G K  V   TWCVA+G+   + LQ ALDYACG+G ADC  IQPGSTCYNPNT
Sbjct  362   AGEQRTQKGGKVNVSGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNT  421

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             L AHAS+AFNSYYQK  R  G+CYFGGA ++V Q P++G CE PT
Sbjct  422   LEAHASFAFNSYYQKKGRAMGSCYFGGAAFIVHQQPKYGHCELPT  466



>ref|XP_006357966.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Solanum tuberosum]
Length=468

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/465 (58%), Positives = 338/465 (73%), Gaps = 38/465 (8%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ +GSIGINYGR+A++LPS  KV+ LLKSQG+ +VK+YDTD  VL ALSGS I  TV L
Sbjct  21    IADAGSIGINYGRVANNLPSAVKVIALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVDL  80

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNE L  AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT +LV AMKNV+
Sbjct  81    PNELLYNAAKRPSFAYSWVEKNVAAYYPSTQIESIAVGNEVFVDPHNTTRFLVSAMKNVH  140

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
              +L K+     +K+SSP+  SA+Q SYP S+GSF+ EL+ PVIKPML FL QTGS+LM+N
Sbjct  141   QALVKFNFHDKIKISSPVALSALQNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSYLMVN  200

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    +
Sbjct  201   CYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYNDIK  260

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             +V++E+GWPSKG+                  D E G A+  NAA+YNGNLVRR+L GGGT
Sbjct  261   MVVTETGWPSKGD------------------DTEIG-ATVDNAASYNGNLVRRILIGGGT  301

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------  575
             PLRP E L+V+LF+LFNEN+K GP SERN+GLFYPNE+KVY++PLT+  L +        
Sbjct  302   PLRPKEDLTVFLFALFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPV  361

Query  574   -------RGSKAQVP-PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                    +G K  V   TWCVA+G+   + LQ ALDYACG+G ADC  IQPGSTCYNPNT
Sbjct  362   AGDQRTQKGGKVNVSGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNT  421

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             L AHAS+AFNSYYQK +R  G+CYFGGA ++V Q P++G CE PT
Sbjct  422   LEAHASFAFNSYYQKKSRAMGSCYFGGAAFIVHQQPKYGHCELPT  466



>ref|XP_006837267.1| hypothetical protein AMTR_s00112p00108890 [Amborella trichopoda]
 gb|ERN00121.1| hypothetical protein AMTR_s00112p00108890 [Amborella trichopoda]
Length=464

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/482 (57%), Positives = 340/482 (71%), Gaps = 37/482 (8%)
 Frame = -3

Query  1684  FPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLY  1505
             F  L+ LC  +   LS    +V+  GS+GINYGR+A++LPS  KVV LLK QGI KVK+Y
Sbjct  7     FRLLFELCFVSGFMLS----AVAAGGSVGINYGRVANNLPSAVKVVTLLKKQGIDKVKIY  62

Query  1504  DTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGN  1331
             D+D  VL ALSGSGIS  + LPNEQL A A  QS  + WV  N+  Y   + I T+AVGN
Sbjct  63    DSDPAVLQALSGSGISVVIGLPNEQLFATARRQSAAEEWVSKNVAKYLPNTKITTIAVGN  122

Query  1330  EVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI  1151
             EVFVDP NTT YL+ AM+NV+++L  Y +   VKVSSPI  SA+QTSYP S+G FK +L 
Sbjct  123   EVFVDPHNTTRYLITAMQNVHSALVMYKIDDKVKVSSPIALSALQTSYPSSAGVFKQDLA  182

Query  1150  PVI-KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSL  974
              V+ KPML FL QTGS+LM+NAYPF+AY+ N D ISLDYA+F  N GVVD  +GL Y +L
Sbjct  183   EVVMKPMLEFLRQTGSYLMVNAYPFFAYKDNADVISLDYALFKPNAGVVDSGSGLQYTNL  242

Query  973   FDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPAS  794
              DAQ+DAV AA+ A+K G  R V++E+GWPSKG+ N                  ETG AS
Sbjct  243   LDAQLDAVNAAMAALKYGDVRTVVTETGWPSKGDEN------------------ETG-AS  283

Query  793   AVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQK  614
               NAAAYN NLVRRVL+G GTPLRP  PL VYLF+LFNEN+K+GP SERNYGLF+P+E+K
Sbjct  284   LANAAAYNSNLVRRVLSGKGTPLRPQTPLEVYLFALFNENKKNGPTSERNYGLFFPDEEK  343

Query  613   VYDVPLTLAALGNRGSKAQVPP----------TWCVANGDVGPERLQVALDYACGQGAAD  464
             VY+VPL +A  G+   K   PP          +WCVA+ +   ++LQ ALDYACG+G AD
Sbjct  344   VYNVPLLMAKSGDD-HKGSSPPVDVGSAAGGQSWCVASEEASEDQLQAALDYACGEGGAD  402

Query  463   CGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             C  IQPG++CY+P+TL AHAS+AFNSYYQKNAR  GTC F GA YVV+Q P+FG C  PT
Sbjct  403   CKEIQPGASCYDPDTLKAHASFAFNSYYQKNARTTGTCDFHGAAYVVSQLPKFGKCALPT  462

Query  283   GY  278
             G+
Sbjct  463   GF  464



>gb|KFK39880.1| hypothetical protein AALP_AA3G300600 [Arabis alpina]
Length=469

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/486 (56%), Positives = 344/486 (71%), Gaps = 44/486 (9%)
 Frame = -3

Query  1660  IFASLFLSLLRH--SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
              F + F  +L    S+S SGSIG+NYGRI+++LPS  KVV LLKSQGI +VK++D D +V
Sbjct  3     FFKAFFFIILLSPISLSESGSIGVNYGRISNELPSAFKVVTLLKSQGINRVKIFDADPSV  62

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDP  1313
             L ALSGS I  TV LPNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVD 
Sbjct  63    LKALSGSNIRVTVDLPNELLYSAAKRPSFASTWVKRNVAAYHPSTQIESIAVGNEVFVDT  122

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKP  1136
              NTT YL+ AM+N++ +L  + +   +K+SSP+  SA+Q SYP SSGSF+PELI  VIKP
Sbjct  123   HNTTQYLILAMRNIHKALISFNLHDDIKISSPLALSALQNSYPSSSGSFRPELINLVIKP  182

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             ML FL +TGS LM+N YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+D
Sbjct  183   MLDFLRETGSRLMVNVYPFFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQID  242

Query  955   AVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAA  776
             AV+AA++A+K     ++++E+GWPSKG+ N                  E G A+  NA +
Sbjct  243   AVFAAMSALKYDDIEIIVTETGWPSKGDEN------------------EIG-ATLANAES  283

Query  775   YNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPL  596
             YNGNL+RR+LTGGGTPLRP   L+VYLF+LFNEN+K GP SERNYGLFYPNE+KVYDVP 
Sbjct  284   YNGNLIRRILTGGGTPLRPKADLTVYLFALFNENKKFGPTSERNYGLFYPNEKKVYDVPF  343

Query  595   TLAAL---------GNRGSKAQVP-----------PTWCVANGDVGPERLQVALDYACGQ  476
             T+  L         G++  K +VP            +WCVANGD G ERLQ  LDYACG+
Sbjct  344   TIEGLKHYRDTPTNGDQNVKPKVPRGGGVSKSLTGSSWCVANGDAGEERLQGGLDYACGE  403

Query  475   GAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             G ADC  IQPG+TCY+P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G C
Sbjct  404   GGADCSLIQPGATCYSPDTLEAHASFAFNSYYQKKGRLAGSCYFGGAAYVVSQPPKYGRC  463

Query  295   EFPTGY  278
             EFPTGY
Sbjct  464   EFPTGY  469



>ref|XP_010412737.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/485 (56%), Positives = 341/485 (70%), Gaps = 47/485 (10%)
 Frame = -3

Query  1648  LFLSLLR-HSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALS  1472
             +FL LL   S+S +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D +VL ALS
Sbjct  8     VFLILLSPISLSDAGSIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDADPSVLKALS  67

Query  1471  GSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTP  1298
             GSGI  TV +PNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT 
Sbjct  68    GSGIKVTVDVPNEILFSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVFVDPHNTTI  127

Query  1297  YLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFL  1121
             YL+PAM+N++ +L  + +   +K+SSP+  SA+Q SYP SSGSF+PEL+  VIKPML FL
Sbjct  128   YLIPAMRNIHKALISFNLHSDIKISSPLALSALQNSYPSSSGSFRPELVDTVIKPMLDFL  187

Query  1120  EQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAA  941
              +TGS LM+N YPF+AY+ N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA
Sbjct  188   RETGSRLMINVYPFFAYDGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAA  247

Query  940   INAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNL  761
             ++A+K     ++++E+GWPSKG+ N                  E G A+  NAA+YNGNL
Sbjct  248   MSALKYDDIEIIVTETGWPSKGDEN------------------EVG-ATIANAASYNGNL  288

Query  760   VRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
             +RR+LT GGTPLRP   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T   L
Sbjct  289   IRRILTRGGTPLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGL  348

Query  580   GNRGSKAQVPPT------------------------WCVANGDVGPERLQVALDYACGQG  473
              +       P T                        WCVANGD G ERLQ  LDYACG+G
Sbjct  349   KHYRDGGHTPVTGDHQVTTPPMSGGGGVSKSLNGQSWCVANGDAGEERLQKGLDYACGEG  408

Query  472   AADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
              ADC PIQPG+ CY+P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CE
Sbjct  409   GADCRPIQPGANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCE  468

Query  292   FPTGY  278
             FP GY
Sbjct  469   FPIGY  473



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/485 (57%), Positives = 342/485 (71%), Gaps = 37/485 (8%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             M  P + S+ +F    +S+   +V G GS+G+NYGR+A++LPS  KVV LLKSQG+ +VK
Sbjct  1     MVVPNISSMLLFLICVVSI--AAVDG-GSVGVNYGRVANNLPSATKVVDLLKSQGVDRVK  57

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAV  1337
             +YD+D  VL ALSGSGI  TV LPNE LS+ A   SF   WV  N+  Y   +++E +AV
Sbjct  58    VYDSDPAVLKALSGSGIKVTVNLPNELLSSTARRPSFAYTWVMKNVAAYHPSTVVEAIAV  117

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVFVD  NTT YL+PAM NV  +L KY +   +KVSSPI  SA+Q SYP S+GSF+P+
Sbjct  118   GNEVFVDTHNTTRYLIPAMYNVQKALVKYNLEKVIKVSSPIALSALQNSYPSSAGSFRPD  177

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L+ PV KPML FL QTGS LM+N YPF+AYE+N D ISLDYA+F +N GVVD  NGL Y 
Sbjct  178   LVEPVFKPMLEFLRQTGSSLMINVYPFFAYESNADVISLDYALFRENPGVVDAGNGLRYF  237

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SLFDAQ+DAV+AA++A+K     +++SE+GWPSKG+ N                  E G 
Sbjct  238   SLFDAQIDAVFAAMSALKYDDVPIIVSETGWPSKGDSN------------------EVG-  278

Query  799   ASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNE  620
             AS  NAAAYNGNLVRRVL GGGTPLRP   L+VYLF+LFNEN+K GP SERN+GLFYPN+
Sbjct  279   ASVENAAAYNGNLVRRVLAGGGTPLRPHANLTVYLFALFNENKKPGPTSERNFGLFYPNQ  338

Query  619   QKVYDVPLTLAALGN--------RGSKAQVPP----TWCVANGDVGPERLQVALDYACGQ  476
             +KVYD+PLT   L +         G + +V      TWCVA  + G E+    LDYACG+
Sbjct  339   KKVYDIPLTAEGLKSYRDIQSPVTGGEQRVSTANGQTWCVAKEEAGKEKQSSGLDYACGE  398

Query  475   GAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             G ADC PIQPGSTC++PNTL AHAS+AFNSYYQK  R  GTCYFGGA Y+VTQ P++G C
Sbjct  399   GGADCHPIQPGSTCFDPNTLEAHASFAFNSYYQKKGRAIGTCYFGGAAYIVTQQPKYGKC  458

Query  295   EFPTG  281
             +FP G
Sbjct  459   DFPFG  463



>ref|XP_002525335.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF37068.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=495

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 331/457 (72%), Gaps = 42/457 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRIAD+LPS  KVVQLLKSQG+ +VK++D D  VL ALSG+ I  TV LPNE
Sbjct  21    AGSIGVNYGRIADNLPSATKVVQLLKSQGLQRVKVFDADPAVLKALSGTRIKVTVDLPNE  80

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WVQ N+  Y   + IE +AVGNEVFVDP NTT +L+PAM+N++ +L
Sbjct  81    LLYSAAKRPSFAFSWVQRNVAVYYPSTEIEAIAVGNEVFVDPHNTTKFLLPAMRNIHQAL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              K  +  ++KVSSPI  SA+Q SYP S+GSF+PELI PV KP+  FL +TGS+LM+NAYP
Sbjct  141   QKLNLDSAIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPLFDFLRETGSYLMVNAYP  200

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K     +VI
Sbjct  201   FFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAAMSALKYDDISMVI  260

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G AS  NAA+YNGNLVRR+LTGGGTPLR
Sbjct  261   TETGWPSKGDEN------------------ELG-ASVQNAASYNGNLVRRILTGGGTPLR  301

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG---------  569
             P   L+VYLF+LFNE++K+GP SERNYGLFYPNEQKVYD+P T+  L N           
Sbjct  302   PHADLTVYLFALFNEDRKNGPTSERNYGLFYPNEQKVYDIPFTVEGLKNYTDRSPPATAG  361

Query  568   -----------SKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPN  422
                        SK+    TWCVAN DVG E+LQ  LDYACG+G ADC PIQPG TCY+PN
Sbjct  362   QQVATPVSGGVSKSTTGNTWCVANPDVGKEKLQHGLDYACGEGGADCHPIQPGETCYDPN  421

Query  421   TLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             T+ AHAS+AFNSYYQK  R  GTCYFGGA YVVTQPP
Sbjct  422   TVEAHASFAFNSYYQKKGREMGTCYFGGAAYVVTQPP  458



>gb|KDO62115.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=472

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/470 (60%), Positives = 332/470 (71%), Gaps = 45/470 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +GINYGR+A++LPSP KVV+LLKSQ I +VK YDTDS VL AL+ S IS  VA PNE
Sbjct  23    TGKVGINYGRVANNLPSPEKVVELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             +LS AAA QSFTD WVQ+NI  Y   + IE VAVGNEVF DP NTTP+LVPAMKNVY SL
Sbjct  83    ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPFLVPAMKNVYNSL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  +VKVSSPI   A+Q SYPPSSGSFK +LI P +KPML FL +T S+LM+NAYP
Sbjct  143   VKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F DN G VD  NGL Y +LFDAQ+DAV+AA++A+     +VV+
Sbjct  203   FFAYSANADKISLDYALFRDNPGQVDSGNGLKYTNLFDAQLDAVFAAMSAISYNDVKVVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N A      AA                        LVRRVL+G GTPLR
Sbjct  263   TETGWPSVGDENEAGAGAANAAAYNGN-------------------LVRRVLSGSGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS-------K  563
             P +PL+VYLF+LFNENQK GP SERNYGLFYPNEQ VYD P  ++  GN  S       K
Sbjct  304   PKDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQTVYDSPF-VSTSGNSSSTPAANKSK  362

Query  562   AQVP---------------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
              QVP                TWCVAN + G ++LQ A+DYACG+G ADC PIQ G+TCY+
Sbjct  363   TQVPVSGGGGGDVSPSAAGQTWCVANANAGEKKLQAAIDYACGEGGADCRPIQEGATCYD  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             PNTL AHASYAFNSYYQK  R  G+C FGGA YVVTQ P++G C+FPTGY
Sbjct  423   PNTLEAHASYAFNSYYQKQVRKAGSCDFGGAAYVVTQAPKYGKCQFPTGY  472



>ref|XP_004491103.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Cicer arietinum]
Length=477

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/478 (58%), Positives = 341/478 (71%), Gaps = 48/478 (10%)
 Frame = -3

Query  1657  FASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDA  1478
              +++FL L   +++  GSIG+NYGRIA++LPS  KVV LLKSQGI +VK+YDTD +VL +
Sbjct  6     LSAIFLLLTILTLTDGGSIGVNYGRIANNLPSAVKVVHLLKSQGIDRVKVYDTDPSVLRS  65

Query  1477  LSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANT  1304
             LSGS I  TV LPN+QL AAA S SF  +WVQ NIV Y   + IE +AVGNEVFVDP N+
Sbjct  66    LSGSKIKVTVDLPNQQLFAAAKSSSFALQWVQRNIVAYYPHTQIEAIAVGNEVFVDPNNS  125

Query  1303  TPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLS  1127
             T +LVPAMKN+Y +L KY +   +KVSSPI  SA+  SYP SSGSF+PELI PV KPML 
Sbjct  126   TKFLVPAMKNIYQALLKYNLHSDIKVSSPIALSALGNSYPSSSGSFRPELIKPVFKPMLE  185

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVY  947
             FL +TGS+LM+N YPF+AYE+N D I LDYA+F +N GVVDP NGL Y +LFDAQ+DAV+
Sbjct  186   FLRKTGSYLMVNVYPFFAYESNADVIPLDYALFRENPGVVDPGNGLRYLNLFDAQIDAVF  245

Query  946   AAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNG  767
             +A++A+K     +V++E+GWPSKG+ N                  E G AS  NAAAYNG
Sbjct  246   SALSAMKYDDVNIVVTETGWPSKGDNN------------------EVG-ASVENAAAYNG  286

Query  766   NLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLA  587
             NLVR++LTG GTPLRP   L+VYLF+LFNENQK GP SERN+GLFYP+E+KVYD+PLT+ 
Sbjct  287   NLVRKILTGSGTPLRPKADLTVYLFALFNENQKPGPTSERNFGLFYPSEEKVYDIPLTVE  346

Query  586   ALGNRG--------------------------SKAQVPPTWCVANGDVGPERLQVALDYA  485
             AL N                            SK+    TWCVAN D    +LQ+ALD+A
Sbjct  347   ALKNYHDNPSPVAPVSGNTNQPTPAVSPVGGVSKSTTGDTWCVANPDADKNKLQLALDFA  406

Query  484   CGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             CG+G ADC  IQPG+TCYNPNTLVAHAS+AFNSYYQK AR  G+C+FGG  YVVTQ P
Sbjct  407   CGEGGADCRTIQPGATCYNPNTLVAHASFAFNSYYQKQARAGGSCFFGGTSYVVTQEP  464



>ref|XP_009365112.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 isoform X2 [Pyrus 
x bretschneideri]
Length=471

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/459 (59%), Positives = 331/459 (72%), Gaps = 44/459 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             + S+G+NYGRIAD+LPS  KVVQLLKSQG+ +VK++D+D  VL AL+GS I  TV LPNE
Sbjct  30    AASVGVNYGRIADNLPSAYKVVQLLKSQGLERVKVFDSDPAVLRALAGSDIKVTVDLPNE  89

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              LS+AA SQSF   WVQ N+V Y   + IE + VGNEVFVD  NTT +L+ AMKN++ +L
Sbjct  90    LLSSAAKSQSFATNWVQRNVVAYHPNTQIEAIGVGNEVFVDTHNTTKFLISAMKNIHTAL  149

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
               + +  S+KVSSPI  SA+Q SYP S+GSF+PEL+ PV KPML FL QTGS+LM+N YP
Sbjct  150   VHFNLESSIKVSSPIALSALQNSYPSSAGSFRPELVEPVFKPMLEFLRQTGSYLMVNCYP  209

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             ++AYE+N+D I LDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K     +V+
Sbjct  210   YFAYESNSDVIPLDYALFRENPGVVDAGNGLRYFNLFDAQIDAVFAAMSALKYDDINMVV  269

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             SE+GWPSKG+                    E G AS  NAAAYNGNLVRR+LTGGGTPLR
Sbjct  270   SETGWPSKGD------------------SVEVG-ASVENAAAYNGNLVRRILTGGGTPLR  310

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------RGS  566
             P   L+VYLF+LFNE++K GP SERNYGLF+PNE+KVYD+P T+  L N         G+
Sbjct  311   PKADLTVYLFALFNEDKKFGPTSERNYGLFFPNERKVYDIPFTVEGLKNYHDRRSPVSGN  370

Query  565   KAQVPP--------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             +    P              TWCVANG+ G E+LQ  LDYACG+G ADC  IQPGS CY+
Sbjct  371   QHVTAPVNGGGDMSKSLNGNTWCVANGETGKEKLQAGLDYACGEGGADCHQIQPGSACYD  430

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             PNTL AHASYAFNSYYQK ARG GTCYFGGA YVV+QPP
Sbjct  431   PNTLEAHASYAFNSYYQKKARGVGTCYFGGAAYVVSQPP  469



>gb|EPS68573.1| hypothetical protein M569_06194, partial [Genlisea aurea]
Length=436

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/449 (62%), Positives = 325/449 (72%), Gaps = 33/449 (7%)
 Frame = -3

Query  1600  GINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLSA  1421
             GINYGR+ADDLPSPA+VV LLKS G+ +VK++DTDS VL A +GS IS TVALPNE L+A
Sbjct  9     GINYGRVADDLPSPAQVVLLLKSLGVDRVKIFDTDSGVLSAFAGSNISLTVALPNELLAA  68

Query  1420  AAASQSFTDRWVQSNIVPYKSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKYGVA  1241
             AA   S TD WVQSN++PY  I E +AVGNEVF    N T +LVPAM+NVY SLAKYGVA
Sbjct  69    AAGGSSLTDSWVQSNVLPYGGI-EAIAVGNEVFAASGNLTAFLVPAMENVYNSLAKYGVA  127

Query  1240  PSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEA  1064
              SVKVSSPI   A+Q+SYPPS+G F  ELI P +KPML+FL QTGS+LM N YP++AY A
Sbjct  128   -SVKVSSPIALGALQSSYPPSAGRFDEELIQPAMKPMLNFLRQTGSYLMANVYPYFAYTA  186

Query  1063  NTDKISLDYAVFGDNQ-GVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISESGW  887
             N D I LDYA+   N  G  DP NGLVY+SLF+AQVDAVYAA+ A+      +V+SE+GW
Sbjct  187   NADSIPLDYALLSSNSSGNTDPENGLVYQSLFEAQVDAVYAAMAAIGFDDVDIVVSETGW  246

Query  886   PSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPL  707
             PS+G+ + A                    AS  NAAAYNGNLVRRVL G GTPLRP  PL
Sbjct  247   PSQGDPDEAG-------------------ASVENAAAYNGNLVRRVLAGNGTPLRPSVPL  287

Query  706   SVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL--GNRGSKAQVPP-----  548
              VYLF+LFNE+QK GP SERNYGLFYP+EQKVYDVPLT A L      SK Q PP     
Sbjct  288   QVYLFALFNEDQKPGPTSERNYGLFYPDEQKVYDVPLTAAGLDEATEVSKIQSPPGSFAG  347

Query  547   ---TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQ  377
                TWCVAN D G ++LQ ALDYACG    +C PIQPG+TCY+PNTL+AHAS+AFNSYYQ
Sbjct  348   GSQTWCVANEDAGTDKLQQALDYACGNSLVNCRPIQPGATCYDPNTLLAHASFAFNSYYQ  407

Query  376   KNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
                R  G+C FGG  +VV+QPP FG+C F
Sbjct  408   MMDRASGSCDFGGGAHVVSQPPNFGNCRF  436



>ref|XP_002883709.1| hypothetical protein ARALYDRAFT_480193 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59968.1| hypothetical protein ARALYDRAFT_480193 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/471 (56%), Positives = 332/471 (70%), Gaps = 45/471 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D +VL ALSGSGI  TV LPNE
Sbjct  22    AGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPSVLKALSGSGIKVTVDLPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVD  NTT +L+PAM+N++ +L
Sbjct  82    LLFSAAKRTSFAVSWVKRNVAAYHPSTQIESIAVGNEVFVDTHNTTSFLIPAMRNIHKAL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNAYP  1082
               + +   +K+SSP+  SA+Q SYP SSGSF+PEL+  VIKPML FL +TGS LM+N YP
Sbjct  142   MSFNIHSDIKISSPLALSALQNSYPSSSGSFRPELVDSVIKPMLDFLRETGSRLMINVYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA++A+K     +++
Sbjct  202   FFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALKYDDIEIIV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G A+  NAA+YNGNL+RR+LT GGTPLR
Sbjct  262   TETGWPSKGDEN------------------EVG-ATLANAASYNGNLIRRILTRGGTPLR  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPT-  545
             P   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T   L +       P T 
Sbjct  303   PKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTG  362

Query  544   ----------------------WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
                                   WCVANGD G E+LQ  LDYACG+G ADC  IQPG+ CY
Sbjct  363   GDQTTTKPPMSGGVSKSLNGHSWCVANGDAGEEKLQGGLDYACGEGGADCSSIQPGANCY  422

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             +P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CEFPTGY
Sbjct  423   SPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  473



>ref|XP_006297583.1| hypothetical protein CARUB_v10013604mg [Capsella rubella]
 gb|EOA30481.1| hypothetical protein CARUB_v10013604mg [Capsella rubella]
Length=475

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/475 (56%), Positives = 335/475 (71%), Gaps = 46/475 (10%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             +S +G+IG+NYGRI+D+LPS  KVVQLLKSQGI +VK++D D +VL ALSGS I  TV L
Sbjct  20    LSDAGTIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDADPSVLKALSGSNIKVTVDL  79

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNE L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT YL+PAM+N++
Sbjct  80    PNEILFSAAKRPSFAASWVKRNVAAYHPSTQIESIAVGNEVFVDPHNTTNYLIPAMRNIH  139

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLN  1091
              +L  + +   +K+SSP+  SA+Q SYP SSGSF+PELI  VIKPML FL +TGS LM+N
Sbjct  140   KALISFNLHSDIKISSPLALSALQNSYPSSSGSFRPELIETVIKPMLDFLRETGSRLMIN  199

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA++A+K     
Sbjct  200   VYPFFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALKYDDIE  259

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             ++++E+GWPSKG+ N                  E G A+  NAA+YNGNL+RR+LT GGT
Sbjct  260   IIVTETGWPSKGDEN------------------EVG-ATIANAASYNGNLIRRILTRGGT  300

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR-------  572
             PLRP   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T   L          
Sbjct  301   PLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKQYHDGGGHN  360

Query  571   -----GSKAQVPP------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
                    +   PP            +WCVANGD G ERLQ  LDYACG+G ADC  IQPG
Sbjct  361   TPVTGDHQVTTPPMSGGVSKSLNGQSWCVANGDAGKERLQGGLDYACGEGGADCSQIQPG  420

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             + CY+P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP++G CEFPTGY
Sbjct  421   ANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  475



>gb|EYU43154.1| hypothetical protein MIMGU_mgv1a005917mg [Erythranthe guttata]
Length=465

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/460 (59%), Positives = 332/460 (72%), Gaps = 38/460 (8%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G+IG+NYGRIA++LPS  KVVQLLKSQG+ +VK+YD+D  VL ALSGSGI  TV LPNE 
Sbjct  26    GAIGVNYGRIANNLPSATKVVQLLKSQGLDRVKVYDSDPAVLHALSGSGIKVTVNLPNEL  85

Query  1429  LSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+AA   SF   WV  N+  Y   + IE +AVGNEVFVD  NTT +L+PAM N++ +L 
Sbjct  86    LSSAARRPSFAYSWVFKNVAAYHPATAIEAIAVGNEVFVDGHNTTGFLIPAMYNIHQALV  145

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY +  +VKVSSP+  SA+Q SYP S+GSF+P LI PV KPML FL +TGS LM+N YPF
Sbjct  146   KYNLHTAVKVSSPVALSALQNSYPSSAGSFRPNLIEPVFKPMLEFLRKTGSSLMVNVYPF  205

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AYE+N D I LDYA+F  N GVVD  NGL Y SLFDAQ+DAV+AA++A+K     V++S
Sbjct  206   FAYESNADVIPLDYALFRQNPGVVDAGNGLRYFSLFDAQIDAVFAAMSALKYDDVPVIVS  265

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPSKG++N                  E G A+  NAAAYNGNLVRRVL GGGTPLRP
Sbjct  266   ETGWPSKGDKN------------------EVG-ATVENAAAYNGNLVRRVLGGGGTPLRP  306

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP---  548
                L+VYLF+LFNEN+K GP SERN+GLFYP+++KVYD+PLT  A G RG   +  P   
Sbjct  307   KADLTVYLFALFNENKKVGPTSERNFGLFYPDQKKVYDIPLT--AEGLRGLGEKTTPVSG  364

Query  547   -----------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHAS  401
                        TWCVA  + G ++LQ  LDYACG+G ADC PIQPGSTC++PNTL AHAS
Sbjct  365   GEQRMATASGETWCVAKEEAGKDKLQEGLDYACGEGGADCHPIQPGSTCFDPNTLEAHAS  424

Query  400   YAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             +AFNSY+QK  R  GTC+FGGA Y+VTQ P++G CEFP G
Sbjct  425   FAFNSYFQKKGRAIGTCFFGGAAYIVTQKPKYGKCEFPFG  464



>gb|KHG21190.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=470

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 346/489 (71%), Gaps = 42/489 (9%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             + SL  F+ L L L   +VS +GS+GINYGR+AD+LP P KVVQLLKSQG+ KVK++D+D
Sbjct  1     MASLSFFSFLILFLSAIAVSDAGSVGINYGRVADNLPPPDKVVQLLKSQGVAKVKIFDSD  60

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
             S VL AL+ SGIS  V LPNEQL++AA  QSF+D WVQ+NI  Y   + IE +A+GNEV 
Sbjct  61    SAVLTALANSGISVVVCLPNEQLASAANDQSFSDGWVQANIAKYYPATKIEAIAIGNEVI  120

Query  1321  VDP-ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-P  1148
              +   +TT ++VPAMK + ASL K  +  ++KVS+P+  S +  SYP S+GSFKP+ +  
Sbjct  121   AENITDTTKFVVPAMKTIQASLVKLKLDSNIKVSTPVAISCLGNSYPASAGSFKPDQVQS  180

Query  1147  VIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFD  968
              I PML FL +TGS+LM+N YPF+AY+ N+  ISLDY++F DN GVVD  NGL YKSLF+
Sbjct  181   TIIPMLDFLRKTGSYLMVNVYPFFAYKDNSKTISLDYSLFKDNPGVVDSGNGLRYKSLFE  240

Query  967   AQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAV  788
             AQVDAVYAA++A+     ++V++E+GWPS G+                   GE G AS  
Sbjct  241   AQVDAVYAAMSALTYDDLKLVVTETGWPSAGDA------------------GEVG-ASQD  281

Query  787   NAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVY  608
             NAAAYNGNLVRRVLTG GTPLRP++PL+VY+F+LFNENQK GP SERNYGLFYPNEQ+VY
Sbjct  282   NAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYGLFYPNEQRVY  341

Query  607   DVPLTLAAL-GNRG------------------SKAQVPPTWCVANGDVGPERLQVALDYA  485
             ++PL+   L GN+                   SKA    TWC+A+ +   E LQ  LDYA
Sbjct  342   NIPLSQKGLNGNQSPPASNVNQTAPVNNGGGVSKATSGQTWCMASPNAEAEELQEGLDYA  401

Query  484   CGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRF  305
             CG+G ADCGPIQP   CYNPN+LVAHASYA+NSYYQK AR  G+C+F G  YV TQ P F
Sbjct  402   CGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSGTAYVSTQRPSF  461

Query  304   GSCEFPTGY  278
             G+C+FPTGY
Sbjct  462   GNCQFPTGY  470



>ref|NP_001275111.1| glucan endo-1,3-beta-glucosidase 12-like precursor [Solanum tuberosum]
 gb|AFU52640.1| beta-1,3-glucanase 5 [Solanum tuberosum]
Length=477

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/456 (58%), Positives = 330/456 (72%), Gaps = 38/456 (8%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ +GSIGINYGR+A++LPS  KV+ LLKSQG+ +VK+YDTD  VL ALSGS I  TV L
Sbjct  21    IADAGSIGINYGRVANNLPSAVKVIALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVNL  80

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNE L  AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT +LV AMKNV+
Sbjct  81    PNELLYNAAKRPSFAYSWVEKNVAAYYPSTQIESIAVGNEVFVDPHNTTRFLVSAMKNVH  140

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
              +L KY     +K+SSP+  SA+Q SYP S+GSF+ EL+ PVIKPML FL QTGS+LM+N
Sbjct  141   QALVKYNFHDKIKISSPVALSALQNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSYLMVN  200

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    +
Sbjct  201   CYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYNDIK  260

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             +V++E+GWPSKG+                  D E G A+  NAA+YNGNLVRR+L GGGT
Sbjct  261   MVVTETGWPSKGD------------------DTEIG-ATVDNAASYNGNLVRRILIGGGT  301

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------  575
             PLRP E L+V+LF+LFNEN+K GP SERN+GLFYPNE+KVY++PLT+  L +        
Sbjct  302   PLRPKEDLTVFLFALFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRLPV  361

Query  574   -------RGSKAQVP-PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                    +G K  V   TWCVA+G+   + LQ ALDYACG+G ADC  IQPGSTCYNPNT
Sbjct  362   AGDQRTEKGGKVNVSGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNT  421

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             L AHAS+AFNSYYQK  R  G+CYFGGA ++V Q P
Sbjct  422   LEAHASFAFNSYYQKKGRAMGSCYFGGAAFIVHQQP  457



>ref|XP_006357965.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Solanum tuberosum]
Length=497

 Score =   530 bits (1365),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 264/456 (58%), Positives = 331/456 (73%), Gaps = 38/456 (8%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             ++ +GSIGINYGR+A++LPS  KV+ LLKSQG+ +VK+YDTD  VL ALSGS I  TV L
Sbjct  21    IADAGSIGINYGRVANNLPSAVKVIALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVDL  80

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNE L  AA   SF   WV+ N+  Y   + IE++AVGNEVFVDP NTT +LV AMKNV+
Sbjct  81    PNELLYNAAKRPSFAYSWVEKNVAAYYPSTQIESIAVGNEVFVDPHNTTRFLVSAMKNVH  140

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
              +L K+     +K+SSP+  SA+Q SYP S+GSF+ EL+ PVIKPML FL QTGS+LM+N
Sbjct  141   QALVKFNFHDKIKISSPVALSALQNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSYLMVN  200

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AYE+N+D ISLDYA+F +N GVVD  NGL Y SLFDAQ+DAV+AA++A+K    +
Sbjct  201   CYPFFAYESNSDVISLDYALFRENPGVVDAGNGLRYFSLFDAQIDAVFAALSALKYNDIK  260

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             +V++E+GWPSKG+                  D E G A+  NAA+YNGNLVRR+L GGGT
Sbjct  261   MVVTETGWPSKGD------------------DTEIG-ATVDNAASYNGNLVRRILIGGGT  301

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN--------  575
             PLRP E L+V+LF+LFNEN+K GP SERN+GLFYPNE+KVY++PLT+  L +        
Sbjct  302   PLRPKEDLTVFLFALFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPV  361

Query  574   -------RGSKAQVP-PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                    +G K  V   TWCVA+G+   + LQ ALDYACG+G ADC  IQPGSTCYNPNT
Sbjct  362   AGDQRTQKGGKVNVSGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNT  421

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             L AHAS+AFNSYYQK +R  G+CYFGGA ++V Q P
Sbjct  422   LEAHASFAFNSYYQKKSRAMGSCYFGGAAFIVHQQP  457



>ref|XP_008385844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=454

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 272/449 (61%), Positives = 327/449 (73%), Gaps = 36/449 (8%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G++GINYGRIAD+LP P         QGI KVKLYDTD+ VL AL+ SGI   VALPNE 
Sbjct  24    GTVGINYGRIADNLPPPEXXXXXXXIQGINKVKLYDTDAAVLTALANSGIGVVVALPNEL  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             LS+AA+  SF D+WVQSNI  Y  K+ IE +AVGNEVF DP NTT +LVPA+KN+ +SL 
Sbjct  84    LSSAASDPSFADKWVQSNISQYHPKTQIEAIAVGNEVFADPNNTTQFLVPAIKNIQSSLV  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY ++ S+K+SSP   SA+ +SYPPS+G FKP+LI PVIKP+L  L QT S+LM+NAYPF
Sbjct  144   KYNLS-SIKLSSPFALSALNSSYPPSAGVFKPDLIEPVIKPLLEXLTQTSSYLMINAYPF  202

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AYE+ +DKISLDYA+F  N G  D  NGL Y SL +AQ+DAV+AA++AV  G  ++V++
Sbjct  203   FAYESTSDKISLDYALFRTNPGNPDSGNGLKYYSLLEAQIDAVFAAMSAVGYGDVKLVVT  262

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPS G+ N                  E G A   NAAAYNGNLV+RVLTGGGTPL+P
Sbjct  263   ETGWPSNGDEN------------------EIG-AGKANAAAYNGNLVKRVLTGGGTPLKP  303

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS------KAQ  557
             ++PL+VYLF+LFNE+QK+GP SERNYGLFYP+E KVYD+PLT+A      S      K Q
Sbjct  304   NDPLNVYLFALFNEDQKTGPTSERNYGLFYPDETKVYDIPLTVAGXSGAQSSPANENKVQ  363

Query  556   VPP-------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
             VP        TWCVANG  G E+LQ ALDYACG+G ADC  IQ GSTC+NPNTL AHASY
Sbjct  364   VPAASPSAGNTWCVANGQAGEEKLQAALDYACGEGGADCRSIQEGSTCFNPNTLEAHASY  423

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             AFNS+YQK AR  GTC FGGA YVV QPP
Sbjct  424   AFNSFYQKKARRTGTCDFGGAAYVVAQPP  452



>gb|EPS73917.1| hypothetical protein M569_00835, partial [Genlisea aurea]
Length=445

 Score =   525 bits (1352),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 263/463 (57%), Positives = 330/463 (71%), Gaps = 37/463 (8%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             S  GSIG+NYGR+A+DLPS  KVV+LLKSQG+ +VK+YD D  VL AL+GSGI  TV LP
Sbjct  2     SDGGSIGVNYGRVANDLPSATKVVRLLKSQGLKRVKVYDADPAVLKALAGSGIRVTVNLP  61

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             NE LS+AA  +SF D WV++N+  Y   + IE VAVGNEVFVD  +TT +L+PAM NVY 
Sbjct  62    NELLSSAARRRSFADDWVRNNVAAYHPATAIEAVAVGNEVFVDAHDTTRFLLPAMYNVYE  121

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTGSFLMLNA  1088
             +L K  +   ++VSSPI  SA+++SYPPS+G+F+ EL+  V +PML FL +TGS LM+N 
Sbjct  122   ALVKRNLQDEIRVSSPIALSALRSSYPPSAGAFRAELVESVFRPMLEFLRKTGSALMVNV  181

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRV  908
             YPF+AYE+N   I LDYA+F +N GVVDP NGL Y SLFDAQ+DAV+AA++A+K     +
Sbjct  182   YPFFAYESNAAVIPLDYALFRENPGVVDPGNGLRYFSLFDAQLDAVFAAMSALKYDDLPI  241

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTP  728
             V+SE+GWPSKG+                    E G A+  NAAAYNGNL+RRVL GGGTP
Sbjct  242   VVSETGWPSKGDSK------------------EVG-AAVENAAAYNGNLIRRVLRGGGTP  282

Query  727   LRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP  548
              RP   L+V+LF+LFNEN+K GP SERN+GLFYP+E +VYDVP T   L N  +    PP
Sbjct  283   RRPSADLTVFLFALFNENKKPGPTSERNFGLFYPDETRVYDVPFTAEGLKNVNNNNNNPP  342

Query  547   ---------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLV  413
                            +WCVAN   G ++LQ  LDYACG+G ADC  IQPGSTC++PNT+ 
Sbjct  343   AMDHGEQRISTGSGPSWCVANAAAGRKKLQAGLDYACGEGGADCRSIQPGSTCFDPNTVE  402

Query  412   AHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             AHAS+AFNSY+QKN R  GTCYFGGA YVVTQ P++G+CE P+
Sbjct  403   AHASFAFNSYFQKNGRRIGTCYFGGAAYVVTQQPKYGACELPS  445



>gb|AAD26909.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM15281.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=473

 Score =   526 bits (1355),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 327/459 (71%), Gaps = 44/459 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGRI+D+LPS  KVVQLLKSQGIT+VK++D D +VL ALSGSGI  TV LPNE
Sbjct  22    AGSIGVNYGRISDELPSAFKVVQLLKSQGITRVKIFDADPSVLKALSGSGIKVTVDLPNE  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L +AA   SF   WV+ N+  Y   + IE++AVGNEVFVD  NTT +L+PAM+N++ +L
Sbjct  82    LLFSAAKRTSFAVSWVKRNVAAYHPSTQIESIAVGNEVFVDTHNTTSFLIPAMRNIHKAL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
               + +   +K+SSP+  SA+Q SYP SSGSF+PELI  VIKPML FL +TGS LM+N YP
Sbjct  142   MSFNLHSDIKISSPLALSALQNSYPSSSGSFRPELIDSVIKPMLDFLRETGSRLMINVYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYE N+D I LDYA+  +N G+VD  NGL Y +LFDAQ+DAV+AA++A+K     +++
Sbjct  202   FFAYEGNSDVIPLDYALLRENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALKYDDIEIIV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+ N                  E G A+  NAA+YNGNL+RR+LT GGTPLR
Sbjct  262   TETGWPSKGDEN------------------EVG-ATLANAASYNGNLIRRILTRGGTPLR  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR----------  572
             P   L+VYLF+LFNEN+K GP SERNYGLF+P+E+KVYD+P T   L +           
Sbjct  303   PKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTG  362

Query  571   GSKAQVPP------------TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
             G +   PP            TWCVANGD G ERLQ  LDYACG+G ADC PIQPG+ CY+
Sbjct  363   GDQVTKPPMSGGVSKSLNGYTWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYS  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             P+TL AHAS+AFNSYYQK  R  G+CYFGGA YVV+QPP
Sbjct  423   PDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPP  461



>ref|XP_010689521.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Beta vulgaris 
subsp. vulgaris]
Length=480

 Score =   525 bits (1352),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 269/477 (56%), Positives = 335/477 (70%), Gaps = 48/477 (10%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             VS +GSIG+NYGRIA++LPS  KVV+LLKSQ I +VK+YD+D+ VL ALS S I  T+ L
Sbjct  23    VSDAGSIGVNYGRIANNLPSATKVVKLLKSQRIDRVKVYDSDTAVLRALSNSNIKVTINL  82

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQL +AA    +   WV  N+V Y   ++IE +AVGNEVFVDP NTT +LVPAM NV+
Sbjct  83    PNEQLRSAATRPFYASVWVLKNVVAYYPHTLIEAIAVGNEVFVDPHNTTNFLVPAMVNVH  142

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ++L KYG+   +KVSSPI  SA+  SYP S+GSF+ ELI PV KPML FL +TGS LM+N
Sbjct  143   SALIKYGLDSKIKVSSPIALSALGNSYPCSAGSFRSELIEPVFKPMLEFLSKTGSSLMVN  202

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
             AYP +AY+AN+D ISLDYA+F +N GVVD  NG  Y +LFDAQ+DAV+AA++A+      
Sbjct  203   AYPIFAYQANSDVISLDYALFRENPGVVDSGNGYRYLNLFDAQIDAVFAAMSALNFPDIP  262

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             ++++E+GWPSKG+                    E G AS  NAAAYNGNLVRR+LTGGGT
Sbjct  263   IIVTETGWPSKGDTM------------------EVG-ASIANAAAYNGNLVRRILTGGGT  303

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS-----  566
             PLRP   L+V+LF+LFNEN+K GP SERNYGLFYP++QKVY++P TL  + N        
Sbjct  304   PLRPKADLTVFLFALFNENKKPGPTSERNYGLFYPSQQKVYNIPFTLEEVKNWKEDREGG  363

Query  565   ---------------------KAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQ  449
                                  K  +  TWCVANG+VG  +LQ ALDYACG+G ADC PIQ
Sbjct  364   PRPVVGPSPTVGPNPKEGPSPKVAMKETWCVANGEVGEGKLQGALDYACGEGGADCHPIQ  423

Query  448   PGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
              G+TCY+PNTL AHASYAFNS+YQKN R  G+C F GA YV ++PP++G CEFPT Y
Sbjct  424   EGATCYDPNTLEAHASYAFNSFYQKNKRAMGSCDFEGAAYVTSRPPKYGKCEFPTQY  480



>gb|KDO62116.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=475

 Score =   521 bits (1343),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 275/459 (60%), Positives = 322/459 (70%), Gaps = 45/459 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +GINYGR+A++LPSP KVV+LLKSQ I +VK YDTDS VL AL+ S IS  VA PNE
Sbjct  23    TGKVGINYGRVANNLPSPEKVVELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             +LS AAA QSFTD WVQ+NI  Y   + IE VAVGNEVF DP NTTP+LVPAMKNVY SL
Sbjct  83    ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPFLVPAMKNVYNSL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  +VKVSSPI   A+Q SYPPSSGSFK +LI P +KPML FL +T S+LM+NAYP
Sbjct  143   VKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F DN G VD  NGL Y +LFDAQ+DAV+AA++A+     +VV+
Sbjct  203   FFAYSANADKISLDYALFRDNPGQVDSGNGLKYTNLFDAQLDAVFAAMSAISYNDVKVVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N A      AA                        LVRRVL+G GTPLR
Sbjct  263   TETGWPSVGDENEAGAGAANAAAYNGN-------------------LVRRVLSGSGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG-------SK  563
             P +PL+VYLF+LFNENQK GP SERNYGLFYPNEQ VYD P  ++  GN         SK
Sbjct  304   PKDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQTVYDSPF-VSTSGNSSSTPAANKSK  362

Query  562   AQVP---------------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
              QVP                TWCVAN + G ++LQ A+DYACG+G ADC PIQ G+TCY+
Sbjct  363   TQVPVSGGGGGDVSPSAAGQTWCVANANAGEKKLQAAIDYACGEGGADCRPIQEGATCYD  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             PNTL AHASYAFNSYYQK  R  G+C FGGA YVVTQ P
Sbjct  423   PNTLEAHASYAFNSYYQKQVRKAGSCDFGGAAYVVTQAP  461



>gb|KDO62114.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=483

 Score =   522 bits (1344),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 275/459 (60%), Positives = 322/459 (70%), Gaps = 45/459 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +GINYGR+A++LPSP KVV+LLKSQ I +VK YDTDS VL AL+ S IS  VA PNE
Sbjct  23    TGKVGINYGRVANNLPSPEKVVELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             +LS AAA QSFTD WVQ+NI  Y   + IE VAVGNEVF DP NTTP+LVPAMKNVY SL
Sbjct  83    ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPFLVPAMKNVYNSL  142

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
              KY +  +VKVSSPI   A+Q SYPPSSGSFK +LI P +KPML FL +T S+LM+NAYP
Sbjct  143   VKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAYP  202

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY AN DKISLDYA+F DN G VD  NGL Y +LFDAQ+DAV+AA++A+     +VV+
Sbjct  203   FFAYSANADKISLDYALFRDNPGQVDSGNGLKYTNLFDAQLDAVFAAMSAISYNDVKVVV  262

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPS G+ N A      AA                        LVRRVL+G GTPLR
Sbjct  263   TETGWPSVGDENEAGAGAANAAAYNGN-------------------LVRRVLSGSGTPLR  303

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG-------SK  563
             P +PL+VYLF+LFNENQK GP SERNYGLFYPNEQ VYD P  ++  GN         SK
Sbjct  304   PKDPLNVYLFALFNENQKPGPTSERNYGLFYPNEQTVYDSPF-VSTSGNSSSTPAANKSK  362

Query  562   AQVP---------------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
              QVP                TWCVAN + G ++LQ A+DYACG+G ADC PIQ G+TCY+
Sbjct  363   TQVPVSGGGGGDVSPSAAGQTWCVANANAGEKKLQAAIDYACGEGGADCRPIQEGATCYD  422

Query  427   PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             PNTL AHASYAFNSYYQK  R  G+C FGGA YVVTQ P
Sbjct  423   PNTLEAHASYAFNSYYQKQVRKAGSCDFGGAAYVVTQAP  461



>gb|KHG21189.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=489

 Score =   517 bits (1332),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 271/494 (55%), Positives = 341/494 (69%), Gaps = 50/494 (10%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             + SL  F+ L L L   +VS +GS+GINYGR+AD+LP P KVVQLLKSQG+ KVK++D+D
Sbjct  1     MASLSFFSFLILFLSAIAVSDAGSVGINYGRVADNLPPPDKVVQLLKSQGVAKVKIFDSD  60

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
             S VL AL+ SGIS  V LPNEQL++AA  QSF+D WVQ+NI  Y   + IE +A+GNEV 
Sbjct  61    SAVLTALANSGISVVVCLPNEQLASAANDQSFSDGWVQANIAKYYPATKIEAIAIGNEVI  120

Query  1321  VDP-ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-P  1148
              +   +TT ++VPAMK + ASL K  +  ++KVS+P+  S +  SYP S+GSFKP+ +  
Sbjct  121   AENITDTTKFVVPAMKTIQASLVKLKLDSNIKVSTPVAISCLGNSYPASAGSFKPDQVQS  180

Query  1147  VIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFD  968
              I PML FL +TGS+LM+N YPF+AY+ N+  ISLDY++F DN GVVD  NGL YKSLF+
Sbjct  181   TIIPMLDFLRKTGSYLMVNVYPFFAYKDNSKTISLDYSLFKDNPGVVDSGNGLRYKSLFE  240

Query  967   AQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAV  788
             AQVDAVYAA++A+     ++V++E+GWPS G+                   GE G AS  
Sbjct  241   AQVDAVYAAMSALTYDDLKLVVTETGWPSAGDA------------------GEVG-ASQD  281

Query  787   NAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVY  608
             NAAAYNGNLVRRVLTG GTPLRP++PL+VY+F+LFNENQK GP SERNYGLFYPNEQ+VY
Sbjct  282   NAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPGPTSERNYGLFYPNEQRVY  341

Query  607   DVPLTLAAL-GNRG------------------SKAQVPPTWCVANGDVGPERLQVALDYA  485
             ++PL+   L GN+                   SKA    TWC+A+ +   E LQ  LDYA
Sbjct  342   NIPLSQKGLNGNQSPPASNVNQTAPVNNGGGVSKATSGQTWCMASPNAEAEELQEGLDYA  401

Query  484   CGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRF  305
             CG+G ADCGPIQP   CYNPN+LVAHASYA+NSYYQK AR  G+C+F G  YV TQ P F
Sbjct  402   CGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARVSGSCFFSGTAYVSTQRPFF  461

Query  304   --------GSCEFP  287
                     G+  FP
Sbjct  462   HVLVLQHLGTVNFP  475



>gb|ACN39797.1| unknown [Picea sitchensis]
Length=474

 Score =   508 bits (1308),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 262/486 (54%), Positives = 332/486 (68%), Gaps = 44/486 (9%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             +   + ++L   + +G+G++GINYGR+AD+LPS  KVVQL+KSQGI K+KLYD D + L 
Sbjct  8     VLIGIVVALAIVASAGAGTVGINYGRVADNLPSAFKVVQLIKSQGIDKLKLYDADPSALR  67

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             A SG+G+  T+ALPNEQL   A   S    WV+ N+V Y   + I  +AVGNEVFV+P N
Sbjct  68    AFSGTGVKITIALPNEQLFYVARRLSRAYAWVKQNVVAYVPGTQITAIAVGNEVFVNPNN  127

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPML  1130
              T YLVPAM N++ +L KY +   VK+SSP+  SA+Q+SYP SSG+FK EL+   IKPML
Sbjct  128   ITSYLVPAMTNLHRALVKYNLDGIVKISSPVALSALQSSYPASSGAFKNELVESTIKPML  187

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL QTGS+LM+NAYPF+AY+ N D ISLDYA+F  N GV D N GL+Y +LFDAQ+DAV
Sbjct  188   DFLRQTGSYLMVNAYPFFAYKDNADVISLDYALFRPNAGVPDGNTGLLYTNLFDAQLDAV  247

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             ++A++A+      +V+SE+GWPSKG+ +                  ETG     NAAAYN
Sbjct  248   FSAMSALGYKDLDIVVSETGWPSKGDED------------------ETG-VGLDNAAAYN  288

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
             GNLV+ V++  GTPLRP   L  +LF+LFNEN+K GP SERNYGLFYP+EQ+VYD+ LT 
Sbjct  289   GNLVKHVMSNSGTPLRPKASLDTFLFALFNENKKPGPTSERNYGLFYPSEQRVYDIALTP  348

Query  589   AALGN----RGSKAQVPP------------------TWCVANGDVGPERLQVALDYACGQ  476
             +A+ N     G+ +   P                  TWCVAN      +LQ ALDYACG+
Sbjct  349   SAVNNPAPASGNSSSSTPAVSAHHHSSGTTPAGGSETWCVANSKSDTSKLQAALDYACGE  408

Query  475   GAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             G ADC  IQPG+ CYNPNTL AHASYAFNSYYQKN+R  GTC F GA YVVTQ P++G C
Sbjct  409   GDADCQQIQPGAPCYNPNTLEAHASYAFNSYYQKNSRKIGTCDFAGAAYVVTQSPKYGDC  468

Query  295   EFPTGY  278
             +FPTGY
Sbjct  469   KFPTGY  474



>gb|KHN38251.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=381

 Score =   495 bits (1274),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 302/404 (75%), Gaps = 38/404 (9%)
 Frame = -3

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNV  1271
             +PNE L+ AAA QSFTD WVQ+NI  Y   + IE +AVGNEVFVDP NTT +LVPAMKNV
Sbjct  1     MPNELLANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVDPNNTTKFLVPAMKNV  60

Query  1270  YASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLML  1094
             +ASL KY +  ++K+SSPI  SA+Q S+P SSGSFK EL+ PVIKPML  L QTGS+LM+
Sbjct  61    HASLTKYNLDKNIKISSPIALSALQNSFPASSGSFKTELVEPVIKPMLDLLRQTGSYLMV  120

Query  1093  NAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF  914
             NAYPF+AY AN+DKISLDYA+F +N GVVD  NGL Y +LFDAQ+DAV+AA++A+K    
Sbjct  121   NAYPFFAYAANSDKISLDYALFKENPGVVDSGNGLKYTNLFDAQIDAVFAAMSALKYDDV  180

Query  913   RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGG  734
             ++ +SE+GWPS G+ N                  E G AS  NAA+YNGNLV+RVL+G G
Sbjct  181   KIAVSETGWPSAGDSN------------------EIG-ASPDNAASYNGNLVKRVLSGSG  221

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQV  554
             TPL+ +E L V+LF+LFNENQK+GP SERNYGLFYP E+KVYD+PL  + +G    K+QV
Sbjct  222   TPLKQNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVYDIPLPPSGVG----KSQV  277

Query  553   P------------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
             P             TWCVA+G    ++LQ AL+YACG+G ADC PIQPG+TCYNPNTL A
Sbjct  278   PVSGEVSTTTSKGQTWCVASGGSSEKKLQNALNYACGEGGADCTPIQPGATCYNPNTLEA  337

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             HASYAFNSYYQK AR  GTC FGG  YVVTQPP++G+CEFPTGY
Sbjct  338   HASYAFNSYYQKKARASGTCDFGGTAYVVTQPPKYGNCEFPTGY  381



>ref|XP_009417707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Musa acuminata 
subsp. malaccensis]
Length=479

 Score =   495 bits (1275),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 330/491 (67%), Gaps = 47/491 (10%)
 Frame = -3

Query  1669  SLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDST  1490
             S+ IFA   L LL  + + +G +G+NYGR+A++LPS  +VV+LLKS GI+ VKLYD D +
Sbjct  7     SMGIFACCSLLLLFSTAAEAGIVGVNYGRVANNLPSATEVVELLKSNGISHVKLYDADPS  66

Query  1489  VLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVD  1316
              L AL+G+G+   V +PNE L++ AA   F   WVQ N+V Y   + I+ +AVGNEVFV 
Sbjct  67    FLRALAGTGVKVVVTVPNEILASTAARPGFALAWVQRNVVAYYPSTQIQAIAVGNEVFVY  126

Query  1315  PANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIK  1139
             P N T +LVPAM+NV+A+L+   +   +K+SSPI  +A+Q SYP S+GSF+PEL+  V++
Sbjct  127   PRNLTTFLVPAMQNVHAALSSLRLDGVIKISSPIALTALQNSYPSSAGSFRPELVVSVLQ  186

Query  1138  PMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQV  959
             PML FL QTGS+LM+NAYPF+AYEAN D ISLDYA+F  N GVVD  NGL Y SL DAQ+
Sbjct  187   PMLEFLRQTGSYLMVNAYPFFAYEANADVISLDYALFRPNPGVVDSGNGLRYYSLLDAQI  246

Query  958   DAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAA  779
             DAV+AA++A+K    ++ ISE+GWPSKG+ +                  ETG   A NAA
Sbjct  247   DAVFAAMSAIKYEDIKIAISETGWPSKGDAD------------------ETGAGQA-NAA  287

Query  778   AYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDV  602
             AYNGNL+RRVL+G  GTPLRP   + VYLF+LFNENQK GP SERNYGLFYP+E KVYDV
Sbjct  288   AYNGNLIRRVLSGNAGTPLRPQADIDVYLFALFNENQKPGPTSERNYGLFYPDEGKVYDV  347

Query  601   PLTLAALGNRGSKAQ------------------------VPPTWCVANGDVGPERLQVAL  494
               TL      G K +                           +WCVAN  VG  +LQ A+
Sbjct  348   EFTLGGRNGGGLKWEDVRGKGPSTTLPPSSSSGTVRTSSTGESWCVANAMVGKSQLQAAM  407

Query  493   DYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             DYACG+G ADC PIQ G+ CY P+T+ AHASYAFNSYYQ   R  GTC F GA YVV+QP
Sbjct  408   DYACGEGGADCRPIQRGAACYEPDTVEAHASYAFNSYYQSKGRAMGTCDFEGAAYVVSQP  467

Query  313   PRFGSCEFPTG  281
             PR G+C  P+G
Sbjct  468   PRIGNCALPSG  478



>ref|XP_008805608.1| PREDICTED: glucan endo-1,3-beta-glucosidase 10-like [Phoenix 
dactylifera]
Length=488

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 336/497 (68%), Gaps = 55/497 (11%)
 Frame = -3

Query  1669  SLCIFASLFLSLL-RHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDS  1493
             S+C    LF S+      S +G++G+NYGR+A++LP  AKVVQLLK +GI +VKLYD DS
Sbjct  12    SVCSLLLLFFSVTPFFPSSEAGAVGVNYGRVANNLPPAAKVVQLLKDKGIEQVKLYDADS  71

Query  1492  TVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFV  1319
             TVL AL+G+GI   V+LPNE L+A A+   F   WVQ N+  Y   + I+ +AVGNEVFV
Sbjct  72    TVLRALAGTGIRAVVSLPNELLAAVASRPGFALAWVQRNVAAYHPATRIQAIAVGNEVFV  131

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVI  1142
             DP+N T  LVPAM+NV+A+LA+  +   VKVSSPI  +A+Q SYP S+GSF+P+L  PV+
Sbjct  132   DPSNLTAALVPAMQNVHAALARLRLDGDVKVSSPIALNALQNSYPSSAGSFRPDLAEPVM  191

Query  1141  KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQ  962
             KPML  L QTGS+LM+NAYPF+AYE N D ISLDYA+F  N GV+D  NGL Y SL DAQ
Sbjct  192   KPMLELLRQTGSYLMVNAYPFFAYEPNADVISLDYALFRPNPGVLDSGNGLKYYSLLDAQ  251

Query  961   VDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNA  782
             +DAV+AA++A+K    +VV+SE+GWPSKG+ N                  ETG A A NA
Sbjct  252   IDAVFAAMSALKYDDVKVVVSETGWPSKGDAN------------------ETG-AGAANA  292

Query  781   AAYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAYNGNLVRRVL+G  GTP RP   L VYLF+LFNENQK GP SERNYGLFYP+E KVYD
Sbjct  293   AAYNGNLVRRVLSGNAGTPRRPQADLDVYLFALFNENQKPGPTSERNYGLFYPDEGKVYD  352

Query  604   VPLTLAALGNRGSKAQ--------------------------VPPT---WCVANGDVGPE  512
             +  TL   G  G K Q                            PT   WCVANG VG E
Sbjct  353   IAFTLR--GGSGLKWQEDGGRAKGGSNGSSSSSSSSGTGRLSASPTGEKWCVANGVVGKE  410

Query  511   RLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAG  332
             RLQ ALDYACG+G ADC PIQP + CY PNTL AHASYAFNSY+QK  R  GTC F GA 
Sbjct  411   RLQAALDYACGEGGADCRPIQPEADCYEPNTLEAHASYAFNSYFQKKGRVVGTCDFEGAA  470

Query  331   YVVTQPPRFGSCEFPTG  281
             YVV++PP+FG C  P G
Sbjct  471   YVVSRPPKFGKCNLPAG  487



>ref|XP_010928243.1| PREDICTED: glucan endo-1,3-beta-glucosidase 10-like [Elaeis guineensis]
Length=496

 Score =   491 bits (1265),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 279/486 (57%), Positives = 327/486 (67%), Gaps = 61/486 (13%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGR+A++LP  A VVQLLKSQGI +VKLYDTD  VL AL+G+GI   VALPNE
Sbjct  29    TGSIGVNYGRVANNLPPAANVVQLLKSQGIDQVKLYDTDPNVLRALAGTGIRVVVALPNE  88

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             QL+AAA    F   WVQ N+  Y   + I+ +AVGNEVFVDP N T  LVPAM+NV+A+L
Sbjct  89    QLAAAARRPGFALAWVQRNVAAYHPATQIQAIAVGNEVFVDPHNLTSALVPAMQNVHAAL  148

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+  +   VKVSSPI  +A+Q SYP S+GSF+ +L  PV+KPML  L QTGS+LM+NAYP
Sbjct  149   ARLRLDADVKVSSPIALTALQNSYPSSAGSFRADLAEPVMKPMLELLRQTGSYLMVNAYP  208

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYEAN D ISLDYA+F  N GV+D  NGL Y SL DAQ+DAV+AA++A+K    +VVI
Sbjct  209   FFAYEANADVISLDYALFRPNPGVLDSGNGLKYYSLLDAQIDAVFAAMSALKYDDVKVVI  268

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGTPL  725
             SE+GWPSKG+ N                  ETG A A NAAAYNGNLVRRVL+G  GTP 
Sbjct  269   SETGWPSKGDAN------------------ETG-AGAANAAAYNGNLVRRVLSGNAGTPR  309

Query  724   RPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL----------AAL--  581
             RP   L VYLF+LFNE+QK GP SERNYGLFYP+E+KVYD+  TL          AAL  
Sbjct  310   RPQADLDVYLFALFNEDQKPGPTSERNYGLFYPDEEKVYDIEFTLSGGGGSSNGGAALRW  369

Query  580   -GNRG-------------------------SKAQVPPTWCVANGDVGPERLQVALDYACG  479
               NRG                         S +     WCVANG VG  RLQ ALDYACG
Sbjct  370   RENRGRADGGDGSSSSSSSPSSSSTGSGRVSASSTGEKWCVANGMVGRGRLQAALDYACG  429

Query  478   QGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGS  299
             +G ADC  IQPG+ CY PNTL AHASYAFNSY+QK  RG GTC F GA YVV+Q P  G 
Sbjct  430   EGGADCRSIQPGADCYEPNTLEAHASYAFNSYFQKKGRGVGTCDFEGAAYVVSQAPSIGK  489

Query  298   CEFPTG  281
             C  P G
Sbjct  490   CTLPAG  495



>ref|XP_008788767.1| PREDICTED: glucan endo-1,3-beta-glucosidase 10-like [Phoenix 
dactylifera]
Length=501

 Score =   491 bits (1265),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 273/487 (56%), Positives = 320/487 (66%), Gaps = 62/487 (13%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +GSIG+NYGR+A++LP PA VVQLLKSQGI +VKLYD D TVL AL+G+GI   VALPNE
Sbjct  33    AGSIGVNYGRVANNLPPPANVVQLLKSQGIDQVKLYDADPTVLRALAGTGIRVVVALPNE  92

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             QL+AAA  Q F   WVQ N+  Y   + I+ +AVGNEVFVDP N T  LVPAM+NV+ +L
Sbjct  93    QLAAAATRQGFALAWVQRNVAAYHPATQIQAIAVGNEVFVDPRNLTASLVPAMQNVHTAL  152

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+  +   VKVSSPI  +A+Q SYP S+GSF+  L  PV+KPML  L QTGS+LM+NAYP
Sbjct  153   ARLRLDADVKVSSPIALTALQNSYPSSAGSFRSNLAEPVMKPMLELLRQTGSYLMVNAYP  212

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AYEANTD ISLDYA+F  N GV+D  +GL Y SL DAQ+DAV+AA++A+K    +VVI
Sbjct  213   FFAYEANTDVISLDYALFRPNPGVLDSGSGLKYYSLLDAQIDAVFAAMSALKYDDVKVVI  272

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGTPL  725
             SE+GWPSKG                   D +   A A NAAAYNGNLVRRVL+G  GTP 
Sbjct  273   SETGWPSKG-------------------DTKETGAGAANAAAYNGNLVRRVLSGNAGTPR  313

Query  724   RPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL---------------  590
             RP   L VYLF+LFNENQK GP SERNYGLFYP+E KVYD+  TL               
Sbjct  314   RPQADLVVYLFALFNENQKPGPTSERNYGLFYPDEGKVYDIEFTLSGGGGSSNGGAGLRW  373

Query  589   ------------------------AALGNRGSKAQVPPTWCVANGDVGPERLQVALDYAC  482
                                     +    R S +     WCVAN  V  ERLQ ALDYAC
Sbjct  374   REYRGRASGGDSSPSPSSSSSSSSSTGSGRVSASSTGEKWCVANAMVARERLQAALDYAC  433

Query  481   GQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFG  302
             G+G ADC  IQPG+ CY PNTL AHASYAFNSY+QK  RG GTC F GA YVV+QPP  G
Sbjct  434   GEGGADCRSIQPGAGCYEPNTLEAHASYAFNSYFQKKGRGVGTCDFEGAAYVVSQPPNVG  493

Query  301   SCEFPTG  281
              C  P G
Sbjct  494   KCTLPAG  500



>ref|XP_010913393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 10-like [Elaeis guineensis]
Length=504

 Score =   489 bits (1258),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 263/489 (54%), Positives = 321/489 (66%), Gaps = 54/489 (11%)
 Frame = -3

Query  1669  SLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDST  1490
             S+C     F        S +G+IG+NYGR+A++LP  AKVVQLLK+QGI +VKLYD D T
Sbjct  12    SVCFLLLFFSVTPFFPSSEAGAIGVNYGRVANNLPPAAKVVQLLKAQGIEQVKLYDVDPT  71

Query  1489  VLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVD  1316
             VL AL+G+GI   V+LPNEQL+  A+ Q F   WVQ N+  Y   + I  +AVGNEVFVD
Sbjct  72    VLRALAGTGIRVVVSLPNEQLATTASRQGFALAWVQRNVAAYHPATRIRAIAVGNEVFVD  131

Query  1315  PANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIK  1139
             P N T  LVPAM+NV+A+LA+ G+   VKVSSP+  +A+Q SYP S+GSF+ +L  PV+K
Sbjct  132   PRNLTAALVPAMQNVHAALARLGLDGDVKVSSPLALTALQNSYPSSAGSFRSDLAEPVMK  191

Query  1138  PMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQV  959
             PML  L QTGS+LM+NAYPF+AYEANTD ISLDYA+F  N GV+D  +GL Y SL DAQ+
Sbjct  192   PMLELLRQTGSYLMVNAYPFFAYEANTDVISLDYALFRPNPGVLDSGSGLKYYSLLDAQI  251

Query  958   DAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAA  779
             DAV+AA++A+K    +VVISE+GWPSKG+ N        AA                   
Sbjct  252   DAVFAAMSALKYDDVKVVISETGWPSKGDANETGAGAANAAAYNGN--------------  297

Query  778   AYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDV  602
                  LVRRVL+G  GTP RP   L VYLF+LFNE+QK GP SE+NYGLFYPNE+KVYD+
Sbjct  298   -----LVRRVLSGNAGTPQRPQADLDVYLFALFNEDQKPGPTSEKNYGLFYPNEEKVYDI  352

Query  601   PLTLAALG--------NRG-----------------------SKAQVPPTWCVANGDVGP  515
               TL+  G        +RG                       S +     WCVANG VG 
Sbjct  353   EFTLSGGGGGGLRWQEDRGRAKGGGDGSSSPSPSTSTGSGRVSASSTGEKWCVANGMVGR  412

Query  514   ERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGA  335
             +RLQ ALDYACG+G ADC PIQ G+ CY PNTL AHASYAFNSY+QK  RG GTC F GA
Sbjct  413   QRLQAALDYACGEGGADCRPIQRGADCYEPNTLEAHASYAFNSYFQKKGRGVGTCVFEGA  472

Query  334   GYVVTQPPR  308
              YVV+QPP+
Sbjct  473   AYVVSQPPQ  481



>ref|XP_006647977.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Oryza brachyantha]
Length=487

 Score =   484 bits (1245),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 270/507 (53%), Positives = 331/507 (65%), Gaps = 60/507 (12%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA PR     I A + L +L  S + +G++GINYGR+A+DLP+PA VVQL+K QGI +VK
Sbjct  1     MALPRGLRALILA-VALPVLFLSAAEAGTVGINYGRVANDLPNPAAVVQLMKQQGIAQVK  59

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             LYDT+ TVL AL+ +GI   VALPNEQL+AAA+  S+   WV+ N+  Y   + I+ +AV
Sbjct  60    LYDTEPTVLRALANTGIKVVVALPNEQLAAAASRPSYALAWVRRNVAAYYPATQIQGIAV  119

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF    N T  LVPAM NV+A+L +  +  +VKVSSPI  +A+  SYPPS+G F+ +
Sbjct  120   GNEVFASAKNLTAQLVPAMTNVHAALTRLNLDKAVKVSSPIALTALAGSYPPSAGVFRED  179

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L   V+KPML FL QTGSFLM+NAYPF+AY AN D ISLDYA+F  N GV+D  +GL Y 
Sbjct  180   LAQAVMKPMLDFLAQTGSFLMVNAYPFFAYSANADVISLDYALFRPNAGVLDSGSGLKYF  239

Query  979   SLFDAQVDAVYAAINAVKPGHF---RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
             SL DAQ+DAV+ A++  K G++   RVV+SE+GWPSKG+                    E
Sbjct  240   SLLDAQLDAVFTAVS--KLGNYNAVRVVVSETGWPSKGDAK------------------E  279

Query  808   TGPASAVNAAAYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLF  632
             TG A+A NAAAYNGNLVRRVL+G  GTP R D  + VYLF+LFNENQK GP SERNYG+F
Sbjct  280   TG-AAAANAAAYNGNLVRRVLSGNAGTPRRADADIDVYLFALFNENQKPGPTSERNYGVF  338

Query  631   YPNEQKVYDVPLTLAAL------------------GNRGSKAQVP-------------PT  545
             YPN+QKVYDV   L                     G  GS +  P               
Sbjct  339   YPNQQKVYDVEFVLGGNSAGSSSSKGNGGLGWQDNGGVGSGSNAPTGAGGGVKATSTGEA  398

Query  544   WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNAR  365
             WCVAN  VG ERLQ ALDYACG G ADC  IQPG+ C+ PNT+V+HASYAFN YYQ+  R
Sbjct  399   WCVANAMVGEERLQKALDYACGPGGADCKAIQPGAACFEPNTMVSHASYAFNDYYQRKGR  458

Query  364   GPGTCYFGGAGYVVTQPPRFGSCEFPT  284
               GTC F GA YVV Q P+ G CE P+
Sbjct  459   TIGTCDFAGAAYVVNQAPKMGKCELPS  485



>gb|AFS50099.1| glucan endo-1,3-beta-glucosidase [Elaeis guineensis]
Length=496

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 276/486 (57%), Positives = 325/486 (67%), Gaps = 59/486 (12%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             S +G+IG+NYG  A++LP  AKVVQLLK+QGI +VKLYDTD  VL AL+G+GI   VALP
Sbjct  29    SEAGAIGVNYGCAANNLPPAAKVVQLLKAQGIDQVKLYDTDPNVLRALAGTGIRVVVALP  88

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             NEQL+AAA    F   WVQ N+  Y   + I+ +AVGNEVFVDP N T  LVPAM+NV+A
Sbjct  89    NEQLAAAARRPGFALAWVQRNVAAYHPATQIQAIAVGNEVFVDPHNLTSALVPAMQNVHA  148

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNA  1088
             +LA+  +   VKVSSPI  +A+Q SYP S+GSF+ +L  PV+KPML  L QTGS+LM+NA
Sbjct  149   ALARLRLDADVKVSSPIALTALQNSYPSSAGSFRADLAEPVMKPMLELLRQTGSYLMVNA  208

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRV  908
             YPF+AYEAN D ISLDYA+F  N GV+D  NGL Y SL DAQ+DAV+AA++A+K    +V
Sbjct  209   YPFFAYEANADVISLDYALFRPNPGVLDSGNGLKYYSLLDAQIDAVFAAMSALKYDDVKV  268

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGT  731
             VISE+GW SKG+ N                  ETG A A NAAAYNGNLVRRVL+G  GT
Sbjct  269   VISETGWTSKGDAN------------------ETG-AGAANAAAYNGNLVRRVLSGNAGT  309

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL----------AAL  581
             P RP   L VYLF+LFNE+QK G  SERNYGLFYP+E+KVYD+  TL          AAL
Sbjct  310   PRRPQADLDVYLFALFNEDQKPGSTSERNYGLFYPDEEKVYDIEFTLSGGGGSSNGGAAL  369

Query  580   ---GNRG-----------------------SKAQVPPTWCVANGDVGPERLQVALDYACG  479
                 NRG                       S +     WCVANG VG  RLQ ALDYACG
Sbjct  370   RWRENRGRADGGDGSSSSSSSSSSTGSGRVSASSTGEKWCVANGMVGRGRLQAALDYACG  429

Query  478   QGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGS  299
             +G ADC  IQPG+ CY PNTL AHASYAFNSY+QK  RG GTC F GA YVV+Q P  G 
Sbjct  430   EGGADCRSIQPGADCYEPNTLEAHASYAFNSYFQKKGRGVGTCDFEGAAYVVSQAPSIGK  489

Query  298   CEFPTG  281
             C  P G
Sbjct  490   CTLPAG  495



>ref|NP_001048260.1| Os02g0771700 [Oryza sativa Japonica Group]
 dbj|BAD16854.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD16859.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10174.1| Os02g0771700 [Oryza sativa Japonica Group]
 dbj|BAG86736.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74084.1| hypothetical protein OsI_09107 [Oryza sativa Indica Group]
 gb|EEE57879.1| hypothetical protein OsJ_08543 [Oryza sativa Japonica Group]
Length=488

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 272/509 (53%), Positives = 331/509 (65%), Gaps = 63/509 (12%)
 Frame = -3

Query  1690  MAFP-RLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKV  1514
             MA P RL +L +  ++ L LL  S S +G++GINYGR+A+DLP+PA VVQL+K QGI +V
Sbjct  1     MALPGRLRALIL--AVALPLLFLSASEAGTVGINYGRVANDLPNPAAVVQLMKQQGIAQV  58

Query  1513  KLYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVA  1340
             KLYDT+ TVL AL+ +GI   VALPNEQL AAA+  S+   WV+ N+  Y   + I+ +A
Sbjct  59    KLYDTEPTVLRALANTGIKVVVALPNEQLLAAASRPSYALAWVRRNVAAYYPATQIQGIA  118

Query  1339  VGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKP  1160
             VGNEVF    N T  LVPAM NV+A+LA+  +   VKVSSPI  +A+  SYPPS+G F+ 
Sbjct  119   VGNEVFASAKNLTAQLVPAMTNVHAALARLSLDKPVKVSSPIALTALAGSYPPSAGVFRE  178

Query  1159  ELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVY  983
             +L   V+KPML FL QTGS+LM+NAYPF+AY  N D ISLDYA+F  N GV+D  +GL Y
Sbjct  179   DLAQAVMKPMLDFLAQTGSYLMVNAYPFFAYSGNADVISLDYALFRPNAGVLDSGSGLKY  238

Query  982   KSLFDAQVDAVYAAINAVKPGHF---RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDG  812
              SL DAQ+DAV+ A++  K G++   RVV+SE+GWPSKG+                    
Sbjct  239   YSLLDAQLDAVFTAVS--KLGNYNAVRVVVSETGWPSKGDAK------------------  278

Query  811   ETGPASAVNAAAYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGL  635
             ETG A+A NAAAYNGNLVRRVL+G  GTP RPD  + VYLF+LFNENQK GP SERNYG+
Sbjct  279   ETG-AAAANAAAYNGNLVRRVLSGNAGTPRRPDADMDVYLFALFNENQKPGPTSERNYGV  337

Query  634   FYPNEQKVYDVPLTL---------------AALG---NRG--------------SKAQVP  551
             FYPN+QKVYDV   L                 LG   N G                    
Sbjct  338   FYPNQQKVYDVEFVLGGNSAGGGGSSGKDNGGLGWQDNGGVNAGNAPAGAGGGVKATSTG  397

Query  550   PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
               WCVAN   G ERLQ ALDYACG G ADC  IQPG+ C+ PNT+VAHASYAFN YYQ+ 
Sbjct  398   EAWCVANAMAGEERLQKALDYACGPGGADCKAIQPGAACFEPNTMVAHASYAFNDYYQRK  457

Query  370   ARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
              R  GTC F GA YVV Q P+ G CE P+
Sbjct  458   GRTIGTCDFAGAAYVVNQAPKMGKCELPS  486



>ref|XP_009414127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 10-like [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 255/504 (51%), Positives = 322/504 (64%), Gaps = 58/504 (12%)
 Frame = -3

Query  1678  RLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDT  1499
             R   L +F S  L L   S S +G++G+NYGR+A++LP   KVV+LLKS  I  VKLYD 
Sbjct  6     RSMGLLLFCSFLLPLF-LSYSEAGTVGVNYGRVANNLPPATKVVELLKSNDIGHVKLYDA  64

Query  1498  DSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEV  1325
             D TVL AL+G+GI   V +PNE L+A A+   F   WVQ N+  Y   + IE +AVGNEV
Sbjct  65    DPTVLRALAGTGIKVVVTIPNEILAATASRSGFAFAWVQRNVAAYYPSTQIEAIAVGNEV  124

Query  1324  FVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-P  1148
             FVD  N T +L+PAM+NV+A+L++  +  +VKV SPI  +A+Q SYPPS+GSF+ +L  P
Sbjct  125   FVDTRNFTAFLIPAMQNVHAALSRLRLDSAVKVCSPIALTALQASYPPSAGSFRSDLAEP  184

Query  1147  VIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFD  968
             V++PML  L  TGS+LM+NAYPF+AYEAN D ISLDYA+F  N+GVVD  NGL Y SL D
Sbjct  185   VMRPMLELLRTTGSYLMVNAYPFFAYEANADVISLDYALFRPNEGVVDSGNGLRYYSLLD  244

Query  967   AQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAV  788
             AQ+DAV+AA++A+K    ++VISE+GWPSKG+ N        AA                
Sbjct  245   AQIDAVFAAMSALKYDDIKIVISETGWPSKGDSNETGAGAANAAAYNGN-----------  293

Query  787   NAAAYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKV  611
                     LVRRVL+G  GTPLRP   L+VY+F+LFNENQK GP SERNYGLFYP+E KV
Sbjct  294   --------LVRRVLSGNAGTPLRPQADLNVYVFALFNENQKPGPTSERNYGLFYPDEGKV  345

Query  610   YDVPLTLAALGNRGSKAQ----------------VPPT------------------WCVA  533
             YD+  TL    + G   +                 PPT                  WCVA
Sbjct  346   YDIEFTLGGTNSGGGGLRWEEDRGRSKGGSKGSGSPPTLPQPSSSGTVRASSTGESWCVA  405

Query  532   NGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGT  353
             N  VG  RLQ ALD+ACG+G ADC  IQPG+ C+ P+T+ AHA+YAFNSYYQ+  R  GT
Sbjct  406   NAMVGKARLQAALDFACGEGGADCRSIQPGAACFEPDTVEAHAAYAFNSYYQRKGRAIGT  465

Query  352   CYFGGAGYVVTQPPRFGSCEFPTG  281
             C F GA Y+V+QPP+ G C FP+G
Sbjct  466   CDFEGAAYLVSQPPKIGRCAFPSG  489



>dbj|BAC53928.1| beta-1,3-glucanase-like protein [Nicotiana tabacum]
Length=358

 Score =   469 bits (1208),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/352 (69%), Positives = 282/352 (80%), Gaps = 22/352 (6%)
 Frame = -3

Query  1621  VSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVAL  1442
             V+ SGSIGINYGRIA++LP PA+VVQLLK+QG+ +VKLYDTDS VL ALSGS IS TVAL
Sbjct  18    VAHSGSIGINYGRIANNLPPPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVAL  77

Query  1441  PNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVY  1268
             PNEQL+ AA  QSFTD WVQSNI+ Y  K+ IE++AVGNEVFVDP NTT +LVPAMKN+Y
Sbjct  78    PNEQLADAAGKQSFTDSWVQSNILTYYPKTQIESIAVGNEVFVDPKNTTKFLVPAMKNMY  137

Query  1267  ASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLN  1091
             ASL KYGVA S+KVSSP+  SA+  SYP S+GSFKP+L+ PVIKPMLSFL+QTGS+LM+N
Sbjct  138   ASLVKYGVAQSIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVN  197

Query  1090  AYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR  911
              YPF+AY ANTD ISLDYA+F DN+GV DPNNGLVYKSLF+AQ+DAVYAA+ AV  G   
Sbjct  198   IYPFFAYAANTDTISLDYALFKDNKGVTDPNNGLVYKSLFEAQIDAVYAAMKAVGFGDVA  257

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGT  731
             + +SE+GWPSKG+ N A                    A A NAAAYNGNLVRRVLTG GT
Sbjct  258   MAVSETGWPSKGDENEAG-------------------AGADNAAAYNGNLVRRVLTGSGT  298

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN  575
             PL+P+EPL V+LF+LFNENQK GP SERNYGLFYPNEQKVYD+ LT   L N
Sbjct  299   PLKPNEPLDVFLFALFNENQKPGPTSERNYGLFYPNEQKVYDITLTKEGLEN  350



>ref|XP_004954063.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Setaria italica]
Length=489

 Score =   471 bits (1212),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 320/481 (67%), Gaps = 59/481 (12%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+P+ VVQLLK QGIT+VKLYDTD TVL AL+ +G+   VALPNE
Sbjct  28    AGTVGVNYGRVANNLPNPSAVVQLLKQQGITQVKLYDTDPTVLRALANTGVKVVVALPNE  87

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  88    QVAAAASRASYALLWVRRNVAAYYPATQIQGIAVGNEVFATAKNVTAQLVPAMVNVHAAL  147

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSP+  +A+  SYP S+G F+ +L  PV+KPML FL QTGS+LM+NAYP
Sbjct  148   ARLGLDKAVKVSSPVALTALANSYPSSAGVFREDLAQPVMKPMLDFLAQTGSYLMVNAYP  207

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF---R  911
             F+AY AN   ISLDYA+F  N GV D  NGL Y SL DAQ+DAV+AA+N  + G++   R
Sbjct  208   FFAYSANAGDISLDYALFRPNAGVQDAGNGLKYYSLLDAQLDAVFAAVN--RLGNYNGVR  265

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GG  734
             VV+SE+GWPSKG+ +                  E G AS  NAAAYNGNL RRVL+G  G
Sbjct  266   VVVSETGWPSKGDAS------------------EVG-ASPANAAAYNGNLARRVLSGNAG  306

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-------  575
             TPLRP+  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L A G        
Sbjct  307   TPLRPNADMDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGAGGAAGGGSQG  366

Query  574   ------------------------RGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAA  467
                                      G K      WCVAN  VG +RL  AL+YACG+G A
Sbjct  367   NGGLGWQENGGPSSGSGSTSGNPPSGVKVTTGEAWCVANAAVGEQRLLAALNYACGEGGA  426

Query  466   DCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             +C  IQPG+ C+ PNT+VAHASYAFN Y+Q+  R  GTC F GA YVV Q P+ G C+ P
Sbjct  427   NCKDIQPGAACFEPNTMVAHASYAFNDYFQRKGRTIGTCDFAGAAYVVNQAPKMGKCDLP  486

Query  286   T  284
             +
Sbjct  487   S  487



>ref|XP_010236896.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Brachypodium 
distachyon]
Length=495

 Score =   467 bits (1201),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 249/488 (51%), Positives = 310/488 (64%), Gaps = 62/488 (13%)
 Frame = -3

Query  1618  SGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALP  1439
             S +G++G+N+GR+A+DLPSPA VV LLK  GIT+VKLYDT+  VL AL+ +G+   VALP
Sbjct  25    SEAGTVGVNWGRVANDLPSPASVVSLLKQHGITQVKLYDTEPAVLRALANTGVKVIVALP  84

Query  1438  NEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYA  1265
             NEQ++AAA   S+   WV+ N+  Y   + I+ VAVGNEVF    N T  LVPAM N++A
Sbjct  85    NEQVAAAARRPSYALAWVRRNVAAYYPATQIQGVAVGNEVFATAGNVTAQLVPAMANIHA  144

Query  1264  SLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNA  1088
             +L +  +  +VKVSSPI  +A+ +SYPPS+G F+ EL   V+KPML FL QTGS+LM+NA
Sbjct  145   ALQRLNLDKAVKVSSPIALTALASSYPPSAGVFREELAQAVMKPMLDFLSQTGSYLMVNA  204

Query  1087  YPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF--  914
             YPF+AY  N   ISLDYA+F  N G +D  +GL Y SL DAQ+DAV+AA+  +    +  
Sbjct  205   YPFFAYAENAGVISLDYALFRPNAGELDAGSGLKYYSLLDAQLDAVFAAVGKLGGNAYNG  264

Query  913   -RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-  740
              R+V+SE+GWPSKG+                    ETG A+A NA AYNGNLVRRVL+G 
Sbjct  265   VRLVVSETGWPSKGDAK------------------ETG-AAASNAEAYNGNLVRRVLSGN  305

Query  739   GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL-------  581
              GTP R D  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L          
Sbjct  306   AGTPRRGDADIDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGGVGAGG  365

Query  580   --------------------GNRGSKAQVP---------PTWCVANGDVGPERLQVALDY  488
                                 GN  + + VP           WCVAN   G  RL  ALDY
Sbjct  366   KGSKGNGGGGGLGWQDDGRNGNGAAPSGVPAGVKVGAPGEAWCVANAMAGEARLHAALDY  425

Query  487   ACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPR  308
             ACG G ADC  IQPG+ C+ PNT+V+HASYAFN YYQ+  R  GTC F GA YVV Q P+
Sbjct  426   ACGPGGADCKAIQPGAACFEPNTMVSHASYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPK  485

Query  307   FGSCEFPT  284
              G CE P+
Sbjct  486   MGKCELPS  493



>ref|XP_004954064.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X3 
[Setaria italica]
Length=485

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 252/475 (53%), Positives = 315/475 (66%), Gaps = 59/475 (12%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+P+ VVQLLK QGIT+VKLYDTD TVL AL+ +G+   VALPNE
Sbjct  28    AGTVGVNYGRVANNLPNPSAVVQLLKQQGITQVKLYDTDPTVLRALANTGVKVVVALPNE  87

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  88    QVAAAASRASYALLWVRRNVAAYYPATQIQGIAVGNEVFATAKNVTAQLVPAMVNVHAAL  147

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSP+  +A+  SYP S+G F+ +L  PV+KPML FL QTGS+LM+NAYP
Sbjct  148   ARLGLDKAVKVSSPVALTALANSYPSSAGVFREDLAQPVMKPMLDFLAQTGSYLMVNAYP  207

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF---R  911
             F+AY AN   ISLDYA+F  N GV D  NGL Y SL DAQ+DAV+AA+N  + G++   R
Sbjct  208   FFAYSANAGDISLDYALFRPNAGVQDAGNGLKYYSLLDAQLDAVFAAVN--RLGNYNGVR  265

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GG  734
             VV+SE+GWPSKG+ +                  E G AS  NAAAYNGNL RRVL+G  G
Sbjct  266   VVVSETGWPSKGDAS------------------EVG-ASPANAAAYNGNLARRVLSGNAG  306

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-------  575
             TPLRP+  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L A G        
Sbjct  307   TPLRPNADMDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGAGGAAGGGSQG  366

Query  574   ------------------------RGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAA  467
                                      G K      WCVAN  VG +RL  AL+YACG+G A
Sbjct  367   NGGLGWQENGGPSSGSGSTSGNPPSGVKVTTGEAWCVANAAVGEQRLLAALNYACGEGGA  426

Query  466   DCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFG  302
             +C  IQPG+ C+ PNT+VAHASYAFN Y+Q+  R  GTC F GA YVV Q P  G
Sbjct  427   NCKDIQPGAACFEPNTMVAHASYAFNDYFQRKGRTIGTCDFAGAAYVVNQAPSSG  481



>ref|XP_004954062.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Setaria italica]
Length=507

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 251/472 (53%), Positives = 314/472 (67%), Gaps = 59/472 (13%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+P+ VVQLLK QGIT+VKLYDTD TVL AL+ +G+   VALPNE
Sbjct  28    AGTVGVNYGRVANNLPNPSAVVQLLKQQGITQVKLYDTDPTVLRALANTGVKVVVALPNE  87

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  88    QVAAAASRASYALLWVRRNVAAYYPATQIQGIAVGNEVFATAKNVTAQLVPAMVNVHAAL  147

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSP+  +A+  SYP S+G F+ +L  PV+KPML FL QTGS+LM+NAYP
Sbjct  148   ARLGLDKAVKVSSPVALTALANSYPSSAGVFREDLAQPVMKPMLDFLAQTGSYLMVNAYP  207

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF---R  911
             F+AY AN   ISLDYA+F  N GV D  NGL Y SL DAQ+DAV+AA+N  + G++   R
Sbjct  208   FFAYSANAGDISLDYALFRPNAGVQDAGNGLKYYSLLDAQLDAVFAAVN--RLGNYNGVR  265

Query  910   VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GG  734
             VV+SE+GWPSKG+ +                  E G AS  NAAAYNGNL RRVL+G  G
Sbjct  266   VVVSETGWPSKGDAS------------------EVG-ASPANAAAYNGNLARRVLSGNAG  306

Query  733   TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGN-------  575
             TPLRP+  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L A G        
Sbjct  307   TPLRPNADMDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGAGGAAGGGSQG  366

Query  574   ------------------------RGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAA  467
                                      G K      WCVAN  VG +RL  AL+YACG+G A
Sbjct  367   NGGLGWQENGGPSSGSGSTSGNPPSGVKVTTGEAWCVANAAVGEQRLLAALNYACGEGGA  426

Query  466   DCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             +C  IQPG+ C+ PNT+VAHASYAFN Y+Q+  R  GTC F GA YVV Q P
Sbjct  427   NCKDIQPGAACFEPNTMVAHASYAFNDYFQRKGRTIGTCDFAGAAYVVNQAP  478



>gb|ACF79018.1| unknown [Zea mays]
 gb|ACF86741.1| unknown [Zea mays]
 gb|ACN33486.1| unknown [Zea mays]
 gb|AFW73667.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=481

 Score =   453 bits (1166),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 315/473 (67%), Gaps = 49/473 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+PA VVQLLK QG+ +VKLYD D TVL AL+ +GI   VALPNE
Sbjct  26    AGTVGVNYGRVANNLPNPAAVVQLLKQQGVAQVKLYDADPTVLRALANTGIKVVVALPNE  85

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  86    QVAAAASRASYALLWVRRNVAAYHPATQIQGIAVGNEVFASAKNVTAQLVPAMANVHAAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSPI  +A+ +SYP S+G+F+ +L   V+KPML FL QTGS+LM+NAYP
Sbjct  146   ARLGLDGAVKVSSPIALTALASSYPSSAGAFREDLAQAVMKPMLDFLAQTGSYLMVNAYP  205

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH--FRV  908
             F+AY  N   ISLDYA+F  N GV+D  NGL Y SL DAQ+DAV+AA++ +  G+   RV
Sbjct  206   FFAYSGNAGDISLDYALFRPNAGVLDAGNGLKYYSLLDAQLDAVFAAVSRLGEGYNGVRV  265

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGT  731
             V+SE+GWPSKG                   D     ASA NAAAYNGNL RRVL+G  GT
Sbjct  266   VVSETGWPSKG-------------------DANEAGASAANAAAYNGNLARRVLSGNAGT  306

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----------  581
             P RPD  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L             
Sbjct  307   PRRPDADIDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLG  366

Query  580   -----GNRGSKAQVPPT---------WCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
                  G   S +  PP+         WCVAN   G  RLQ ALDYACG G ADC  IQPG
Sbjct  367   WQENGGGASSTSTNPPSGVKVTTGEAWCVANAMAGEHRLQAALDYACGPGGADCKAIQPG  426

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             + C+ PNT+VAHASYAFN YYQ+  R  GTC F GA YVV Q P+ G C+ P+
Sbjct  427   AACFEPNTMVAHASYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPKMGKCDLPS  479



>ref|NP_001136613.1| uncharacterized protein LOC100216736 precursor [Zea mays]
 gb|ACF82271.1| unknown [Zea mays]
 gb|ACN31778.1| unknown [Zea mays]
 gb|ACR35803.1| unknown [Zea mays]
 gb|ACR36343.1| unknown [Zea mays]
Length=481

 Score =   453 bits (1166),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 315/473 (67%), Gaps = 49/473 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+PA VVQLLK QG+ +VKLYD D TVL AL+ +GI   VALPNE
Sbjct  26    AGTVGVNYGRVANNLPNPAAVVQLLKQQGVAQVKLYDADPTVLRALANTGIKVVVALPNE  85

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  86    QVAAAASRASYALLWVRRNVAAYHPATQIQGIAVGNEVFASAKNVTAQLVPAMANVHAAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSPI  +A+ +SYP S+G+F+ +L   V+KPML FL QTGS+LM+NAYP
Sbjct  146   ARLGLDGAVKVSSPIALTALASSYPSSAGAFREDLAQAVMKPMLDFLAQTGSYLMVNAYP  205

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH--FRV  908
             F+AY  N   ISLDYA+F  N GV+D  NGL Y SL DAQ+DAV+AA++ +  G+   RV
Sbjct  206   FFAYSGNAGDISLDYALFRPNAGVLDAGNGLKYYSLLDAQLDAVFAAVSRLGEGYNGVRV  265

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGT  731
             V+SE+GWPSKG                   D     ASA NAAAYNGNL RRVL+G  GT
Sbjct  266   VVSETGWPSKG-------------------DANEAGASAANAAAYNGNLARRVLSGNAGT  306

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----------  581
             P RPD  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L             
Sbjct  307   PRRPDADIDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLG  366

Query  580   -----GNRGSKAQVPPT---------WCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
                  G   S +  PP+         WCVAN   G  RLQ ALDYACG G ADC  IQPG
Sbjct  367   WQENGGGASSTSTNPPSGVKVTTGEAWCVANAMAGEHRLQAALDYACGPGGADCKAIQPG  426

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             + C+ PNT+VAHASYAFN YYQ+  R  GTC F GA YVV Q P+ G C+ P+
Sbjct  427   AACFEPNTMVAHASYAFNDYYQRKGRSIGTCDFAGAAYVVNQAPKMGKCDLPS  479



>ref|XP_002454630.1| hypothetical protein SORBIDRAFT_04g034530 [Sorghum bicolor]
 gb|EES07606.1| hypothetical protein SORBIDRAFT_04g034530 [Sorghum bicolor]
Length=491

 Score =   451 bits (1159),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 262/510 (51%), Positives = 326/510 (64%), Gaps = 62/510 (12%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA  R   + +  ++ + LL    + +G++G+NYGR+A++LP+PA VVQLLK QG+ +VK
Sbjct  1     MASLRRLPVAVLLAVAVPLLFLCPAEAGTVGVNYGRVANNLPNPAAVVQLLKQQGVGQVK  60

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             LYD D TVL AL+ +GI   VALPNEQL+AAA+  S+   WV+ N+  Y   + I  +AV
Sbjct  61    LYDADPTVLRALANTGIKVVVALPNEQLAAAASRASYALLWVRRNVAAYYPATQIHGIAV  120

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF    N T  LVPAM NV+A+LA+ G+  +VKVSSPI  +A+ +SYP S+G+F+ +
Sbjct  121   GNEVFASAKNVTAQLVPAMTNVHAALARLGLDNAVKVSSPIALTALASSYPSSAGAFRED  180

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L   V+KPML FL QTGS+LM+NAYPF+AY  N   ISLDYA+F  N GV+D  NGL Y 
Sbjct  181   LAQAVMKPMLDFLAQTGSYLMVNAYPFFAYSGNAGDISLDYALFRPNAGVLDAGNGLKYY  240

Query  979   SLFDAQVDAVYAAINAVKPGHF---RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
             SL DAQ+DAV+AA++  K G++   RVV+SE+GWPSKG                   D  
Sbjct  241   SLLDAQLDAVFAAVS--KLGNYNAVRVVVSETGWPSKG-------------------DAN  279

Query  808   TGPASAVNAAAYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLF  632
                ASA NAAAYNGNL RRVL+G  GTP RPD  + VYLF+LFNENQK GP SERNYG+F
Sbjct  280   EAGASAANAAAYNGNLARRVLSGNAGTPRRPDADIDVYLFALFNENQKPGPTSERNYGVF  339

Query  631   YPNEQKVYDVPLTLAALGN----------------------------------RGSKAQV  554
             YPN+QKVYDV   L   GN                                   G K   
Sbjct  340   YPNQQKVYDVDFVLGGGGNPSGGGSQGNNGLGWQENGGPSSGSGSTSTSGNPPSGVKVTT  399

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
                WCVAN  VG +RLQ ALDYACG G ADC  IQPG+ C+ PNT+VAHASYAFN YYQ+
Sbjct  400   GEAWCVANAIVGEQRLQAALDYACGPGGADCKAIQPGAACFEPNTMVAHASYAFNDYYQR  459

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
               R  GTC F GA YVV Q P+ G C+ P+
Sbjct  460   KGRSIGTCDFAGAAYVVNQAPKMGKCDLPS  489



>gb|ACF88240.1| unknown [Zea mays]
Length=481

 Score =   450 bits (1157),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 314/473 (66%), Gaps = 49/473 (10%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+PA VVQLLK QG+ +VKLYD D TVL AL+ +GI   VALPNE
Sbjct  26    AGTVGVNYGRVANNLPNPAAVVQLLKQQGVAQVKLYDADPTVLRALANTGIKVVVALPNE  85

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  86    QVAAAASRASYALLWVRRNVAAYHPATQIQGIAVGNEVFASAKNVTAQLVPAMANVHAAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSPI  +A+ +SYP S+G+F+ +L   V+KPML FL QTGS+LM+NAYP
Sbjct  146   ARLGLDGAVKVSSPIALTALASSYPSSAGAFREDLAQAVMKPMLDFLAQTGSYLMVNAYP  205

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH--FRV  908
             F+AY  N   ISLDYA+F  N GV+D  NGL Y SL DAQ+DAV+AA++ +  G+   RV
Sbjct  206   FFAYSGNAGDISLDYALFRPNAGVLDAGNGLKYYSLLDAQLDAVFAAVSRLGEGYNGVRV  265

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGT  731
             V+SE+GWPSKG                   D     ASA NAAAYNGNL RRVL+G  GT
Sbjct  266   VVSETGWPSKG-------------------DANEAGASAANAAAYNGNLARRVLSGNAGT  306

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----------  581
             P RPD  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L             
Sbjct  307   PRRPDADIDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLG  366

Query  580   -----GNRGSKAQVPPT---------WCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
                  G   S +  PP+         WCVAN   G  RLQ ALDYACG G ADC  IQPG
Sbjct  367   WQENGGGASSTSTNPPSGVKVTTGEAWCVANAMAGEHRLQAALDYACGPGGADCKAIQPG  426

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             + C+ PNT+VAHASYAFN YYQ+  R  GTC F GA  VV Q P+ G C+ P+
Sbjct  427   AACFEPNTMVAHASYAFNDYYQRKGRSIGTCDFAGAACVVNQAPKMGKCDLPS  479



>gb|ACR35980.1| unknown [Zea mays]
Length=488

 Score =   442 bits (1137),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 251/464 (54%), Positives = 309/464 (67%), Gaps = 49/464 (11%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G++G+NYGR+A++LP+PA VVQLLK QG+ +VKLYD D TVL AL+ +GI   VALPNE
Sbjct  26    AGTVGVNYGRVANNLPNPAAVVQLLKQQGVAQVKLYDADPTVLRALANTGIKVVVALPNE  85

Query  1432  QLSAAAASQSFTDRWVQSNIVPYK--SIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             Q++AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  LVPAM NV+A+L
Sbjct  86    QVAAAASRASYALLWVRRNVAAYHPATQIQGIAVGNEVFASAKNVTAQLVPAMANVHAAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+  +VKVSSPI  +A+ +SYP S+G+F+ +L   V+KPML FL QTGS+LM+NAYP
Sbjct  146   ARLGLDGAVKVSSPIALTALASSYPSSAGAFREDLAQAVMKPMLDFLAQTGSYLMVNAYP  205

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH--FRV  908
             F+AY  N   ISLDYA+F  N GV+D  NGL Y SL DAQ+DAV+AA++ +  G+   RV
Sbjct  206   FFAYSGNAGDISLDYALFRPNAGVLDAGNGLKYYSLLDAQLDAVFAAVSRLGEGYNGVRV  265

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG-GGT  731
             V+SE+GWPSKG                   D     ASA NAAAYNGNL RRVL+G  GT
Sbjct  266   VVSETGWPSKG-------------------DANEAGASAANAAAYNGNLARRVLSGNAGT  306

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----------  581
             P RPD  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L             
Sbjct  307   PRRPDADIDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVLGGGGASQGNGGLG  366

Query  580   -----GNRGSKAQVPPT---------WCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
                  G   S +  PP+         WCVAN   G  RLQ ALDYACG G ADC  IQPG
Sbjct  367   WQENGGGASSTSTNPPSGVKVTTGEAWCVANAMAGEHRLQAALDYACGPGGADCKAIQPG  426

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             + C+ PNT+VAHASYAFN YYQ+  R  GTC F GA YVV Q P
Sbjct  427   AACFEPNTMVAHASYAFNDYYQRKGRSIGTCDFAGAAYVVNQAP  470



>dbj|BAJ87688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 303/472 (64%), Gaps = 51/472 (11%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G++G+N+GR+A+DLPSPA VVQLLK  GI +VKLYDT+  VL AL+ SGI   VALPNEQ
Sbjct  24    GTVGVNWGRVANDLPSPAAVVQLLKQHGIAQVKLYDTEPAVLRALANSGIKVVVALPNEQ  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             ++AAA   S+   WV+ N+  Y   + I+ +AVGNEVF   AN T  LVPAM NV+A+LA
Sbjct  84    VAAAARRPSYALAWVRRNVAAYYPATQIQGIAVGNEVFATAANVTAQLVPAMINVHAALA  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPEL-IPVIKPMLSFLEQTGSFLMLNAYPF  1079
             +  +  +VKVSSP+  +A+  SYPPS+G F+ EL   V+KPML FL QTGS+LM+N YPF
Sbjct  144   RLSMDKAVKVSSPVALTALANSYPPSAGVFREELSQSVMKPMLDFLSQTGSYLMVNCYPF  203

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHF---RV  908
             +AY  N   ISLDYA+F  N G +D  +GL Y SL DAQ+DAV+ A+   K G +    V
Sbjct  204   FAYADNAGVISLDYALFRPNAGELDSGSGLKYYSLLDAQLDAVFTAVG--KLGSYNGVHV  261

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLT-GGGT  731
             V+SE+GWPSKG                   D +   A A NAAAYNGNLVRRVL+   GT
Sbjct  262   VVSETGWPSKG-------------------DAKEVGAGAGNAAAYNGNLVRRVLSKNAGT  302

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP  551
             P RPD  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L   G       + 
Sbjct  303   PRRPDADMDVYLFALFNENQKPGPTSERNYGVFYPNKQKVYDVEFVLGGGGGSVGGGGLG  362

Query  550   -----------------------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
                                      WCVAN   G  RLQ ALDYACG G ADC  IQPG+
Sbjct  363   WQDNGGGGNAGAGGAVRAAVTPGEAWCVANAMAGEARLQAALDYACGPGGADCKGIQPGA  422

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
              C+ PNT+V+HA++AFN YYQ+  R  GTC F GA YVV QPP+ G CE P+
Sbjct  423   ACFEPNTMVSHATFAFNDYYQRKGRSIGTCDFAGAAYVVNQPPKMGKCELPS  474



>dbj|BAF01977.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=314

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 211/336 (63%), Positives = 252/336 (75%), Gaps = 32/336 (10%)
 Frame = -3

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             KY +  ++K+SSPI  SA+  SYPPSSGSFKPELI PV+KPML+ L+QT S+LM+NAYPF
Sbjct  1     KYKLDKAIKISSPIALSALANSYPPSSGSFKPELIEPVVKPMLALLQQTSSYLMVNAYPF  60

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             +AY AN DKISLDYA+F +N G +D   GL Y SLFDAQ+DAVYAA++AV     +V+++
Sbjct  61    FAYAANADKISLDYALFKENAGNIDSGTGLKYNSLFDAQIDAVYAALSAVGFKGVKVMVT  120

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWPS G+ N                  E G AS  NAAAYN  LV+RVLTG GTPLRP
Sbjct  121   ETGWPSVGDEN------------------EIG-ASESNAAAYNAGLVKRVLTGKGTPLRP  161

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL----GNRGSKAQVP  551
              EPL+VYLF+LFNENQK GP SERNYGLFYPNE KVY+VP T  +     GNRG   +VP
Sbjct  162   TEPLNVYLFALFNENQKPGPTSERNYGLFYPNEGKVYNVPFTKKSTTPVNGNRG---KVP  218

Query  550   -----PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   TWCV+NG+V  E+LQ ALDYACG+G ADC PIQPG+TCY+P +L AHASYAFNS
Sbjct  219   VTHEGHTWCVSNGEVAKEKLQEALDYACGEGGADCRPIQPGATCYHPESLEAHASYAFNS  278

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             YYQKN+R  GTC+FGGA +VVTQPPR+G CEFPTG+
Sbjct  279   YYQKNSRRVGTCFFGGAAHVVTQPPRYGKCEFPTGH  314



>ref|XP_004502047.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Cicer arietinum]
Length=354

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 215/368 (58%), Positives = 269/368 (73%), Gaps = 23/368 (6%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             L +L I  S +LSL    V+    IG+NYGRIA++LPS  KVV LLKSQGI +VKLYDTD
Sbjct  4     LLTLSILFS-YLSLPLLIVADGSYIGVNYGRIANNLPSAVKVVNLLKSQGIDRVKLYDTD  62

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
               VL ALSGSGI  TV LPNE+L  AA   SF   W+  N+V Y   ++IET+AVGNEVF
Sbjct  63    PAVLWALSGSGIKVTVNLPNEKLFFAAKKLSFALSWLHKNVVVYYPHTLIETIAVGNEVF  122

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PV  1145
             VDP NTT YLVPAMKN++ +L K  +   +KVSSPI  +A+ +SYP S+GSF+PELI PV
Sbjct  123   VDPHNTTNYLVPAMKNIHKALVKNNLHNFIKVSSPIALTALGSSYPSSTGSFRPELIEPV  182

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
             IKPMLSFL +T SFLM+N YPF+AY +N D ISLDYA+F +N G VDP NGL Y ++FDA
Sbjct  183   IKPMLSFLRETASFLMVNVYPFFAYVSNADVISLDYALFRENPGSVDPGNGLKYFNIFDA  242

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DAV+AA++A+K    R+V+SE+GWPS+G+                    E G AS  N
Sbjct  243   QIDAVFAALSALKYDDVRIVVSETGWPSEGD------------------SYEVG-ASPQN  283

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAYNGNLV+++L+ GGTPLRP+  L+VYLF+LFNEN K GP SER++GLFYP+ +KVYD
Sbjct  284   AAAYNGNLVKKILSNGGTPLRPNANLTVYLFALFNENGKVGPTSERHFGLFYPDMKKVYD  343

Query  604   VPLTLAAL  581
             VP T+AA+
Sbjct  344   VPFTVAAM  351



>gb|AES71661.2| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=362

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 258/345 (75%), Gaps = 22/345 (6%)
 Frame = -3

Query  1606  SIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQL  1427
             SIG+NYGRIA++LPS  KVV+LLKSQGI +VKLYDTD  VL +LSGSGI  TV LPNEQL
Sbjct  25    SIGVNYGRIANNLPSAFKVVKLLKSQGIDRVKLYDTDPAVLKSLSGSGIKVTVNLPNEQL  84

Query  1426  SAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAK  1253
                A   S+   W+Q N+V Y  K+ IE +AVGNEVFVD  NTT YL+PAMKN++ +L K
Sbjct  85    FHTARKLSYALTWLQKNVVVYHPKTQIEAIAVGNEVFVDTHNTTKYLIPAMKNIHKALVK  144

Query  1252  YGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFY  1076
             + +  S+K+SSPI  SA+ +SYP S+GSFKPELI PVIKPML+FL +T S+LM+N YPF+
Sbjct  145   FNLHNSIKISSPIALSALGSSYPSSTGSFKPELIEPVIKPMLNFLRETSSYLMVNVYPFF  204

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AYE+N D ISL+YA+F +N G VDP NGL Y ++FDAQ+DAV+AA+N ++    RVV+SE
Sbjct  205   AYESNADVISLNYALFRENPGNVDPGNGLKYYNIFDAQIDAVFAALNVLQYDDVRVVVSE  264

Query  895   SGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPD  716
             +GWPSKG+ N                  E G AS  NAAAYNGNLV+++L  GGTPLRP+
Sbjct  265   TGWPSKGDSN------------------EVG-ASPQNAAAYNGNLVKKILNNGGTPLRPN  305

Query  715   EPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
               L+VYLF+LFNEN K G  SERN+G+FYP+ +KVYDVP T+A L
Sbjct  306   ANLTVYLFALFNENGKVGLTSERNFGMFYPDMKKVYDVPFTVAGL  350



>gb|AFK41861.1| unknown [Medicago truncatula]
Length=362

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 205/345 (59%), Positives = 257/345 (74%), Gaps = 22/345 (6%)
 Frame = -3

Query  1606  SIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQL  1427
             SIG+NYGRIA++LPS  KVV+LLKSQGI +VKLYDTD  VL +LSGSGI  TV LPNEQL
Sbjct  25    SIGVNYGRIANNLPSAFKVVKLLKSQGIDRVKLYDTDPAVLKSLSGSGIKVTVNLPNEQL  84

Query  1426  SAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAK  1253
                A   S+   W+Q N+V Y  K+ IE +AVGNEVFVD  NTT YL+PAMKN++ +L K
Sbjct  85    FHTARKLSYALTWLQKNVVVYHPKTQIEAIAVGNEVFVDTHNTTKYLIPAMKNIHKALVK  144

Query  1252  YGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFY  1076
             + +  S+K+SSPI  SA+ +SYP S+GSFKPELI PVIKPML+ L +T S+LM+N YPF+
Sbjct  145   FNLHNSIKISSPIALSALGSSYPSSTGSFKPELIEPVIKPMLNSLRETSSYLMVNVYPFF  204

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AYE+N D ISL+YA+F +N G VDP NGL Y ++FDAQ+DAV+AA+N ++    RVV+SE
Sbjct  205   AYESNADVISLNYALFRENPGNVDPGNGLKYYNIFDAQIDAVFAALNVLQYNDVRVVVSE  264

Query  895   SGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPD  716
             +GWPSKG+ N                  E G AS  NAAAYNGNLV+++L  GGTPLRP+
Sbjct  265   TGWPSKGDSN------------------EVG-ASPQNAAAYNGNLVKKILNNGGTPLRPN  305

Query  715   EPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
               L+VYLF+LFNEN K G  SERN+G+FYP+ +KVYDVP T+A L
Sbjct  306   ANLTVYLFALFNENGKVGLTSERNFGMFYPDMKKVYDVPFTVAGL  350



>ref|XP_003601410.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=497

 Score =   402 bits (1033),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 258/345 (75%), Gaps = 22/345 (6%)
 Frame = -3

Query  1606  SIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQL  1427
             SIG+NYGRIA++LPS  KVV+LLKSQGI +VKLYDTD  VL +LSGSGI  TV LPNEQL
Sbjct  25    SIGVNYGRIANNLPSAFKVVKLLKSQGIDRVKLYDTDPAVLKSLSGSGIKVTVNLPNEQL  84

Query  1426  SAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAK  1253
                A   S+   W+Q N+V Y  K+ IE +AVGNEVFVD  NTT YL+PAMKN++ +L K
Sbjct  85    FHTARKLSYALTWLQKNVVVYHPKTQIEAIAVGNEVFVDTHNTTKYLIPAMKNIHKALVK  144

Query  1252  YGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFY  1076
             + +  S+K+SSPI  SA+ +SYP S+GSFKPELI PVIKPML+FL +T S+LM+N YPF+
Sbjct  145   FNLHNSIKISSPIALSALGSSYPSSTGSFKPELIEPVIKPMLNFLRETSSYLMVNVYPFF  204

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AYE+N D ISL+YA+F +N G VDP NGL Y ++FDAQ+DAV+AA+N ++    RVV+SE
Sbjct  205   AYESNADVISLNYALFRENPGNVDPGNGLKYYNIFDAQIDAVFAALNVLQYDDVRVVVSE  264

Query  895   SGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPD  716
             +GWPSKG+ N                  E G AS  NAAAYNGNLV+++L  GGTPLRP+
Sbjct  265   TGWPSKGDSN------------------EVG-ASPQNAAAYNGNLVKKILNNGGTPLRPN  305

Query  715   EPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAAL  581
               L+VYLF+LFNEN K G  SERN+G+FYP+ +KVYDVP T+A L
Sbjct  306   ANLTVYLFALFNENGKVGLTSERNFGMFYPDMKKVYDVPFTVAGL  350



>ref|XP_002462968.1| hypothetical protein SORBIDRAFT_02g035490 [Sorghum bicolor]
 gb|EER99489.1| hypothetical protein SORBIDRAFT_02g035490 [Sorghum bicolor]
Length=581

 Score =   405 bits (1040),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 223/458 (49%), Positives = 296/458 (65%), Gaps = 31/458 (7%)
 Frame = -3

Query  1606  SIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQL  1427
              +G+NYGR+A+DLP PA VVQLL+  GIT V++YDTD  VL + + +GI   V LPNE L
Sbjct  28    EVGVNYGRVANDLPDPAAVVQLLRDNGITMVRIYDTDDAVLRSFANTGIKLMVMLPNENL  87

Query  1426  SAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAK  1253
             + AA S S+   W +  +  Y   + I  V+VGNEVF    + TP LVPAM NV+A+LA+
Sbjct  88    ADAARSPSYAADWARRRVAAYLPATRIHAVSVGNEVFDSRPDLTPLLVPAMTNVHAALAQ  147

Query  1252  YGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFY  1076
              G+A ++KVS+P+ F+A+  S+PPS+G F+ ++  PV++PML FL++TGS+L +N YP++
Sbjct  148   LGLADAIKVSTPLSFAAVAVSWPPSAGRFRDDIAQPVMRPMLEFLQRTGSYLTINLYPYF  207

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AY A  DKIS DY +   N GV DP+ GL+Y S+ DAQ DA ++A++ +     + +  E
Sbjct  208   AYAAQPDKISRDYFLGNPNPGVRDPDTGLMYYSVLDAQRDATFSAMDKLGFTSLQAIPGE  267

Query  895   SGWPSKGNRNAAAYNGK---KAAVNAAAYDGETG------PASAVNAAAYNGNLVRRVLT  743
             +G  S G       + K   + +   A  D   G       AS  NA AYN N++ RVL 
Sbjct  268   TGSASAGRPKPGPRHNKPLHQPSWELAVGDDGDGVRVDPPAASKANAQAYNNNVINRVLA  327

Query  742   G-GGTPLRPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLFYPNEQKVYDVPLTLAALGNR  572
             G  GTPLRPD  + VY+F+LFNENQK SGP   E N+GLFYPN +KVY+          R
Sbjct  328   GRTGTPLRPDADMDVYIFALFNENQKGSGPDDIEANFGLFYPNMEKVYEFDF-------R  380

Query  571   GSKAQVPP-----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAH  407
             G    VPP     +WCVAN  VG   LQ AL+YACG G ADC  IQPG+TC+ P+T+VAH
Sbjct  381   GGG--VPPAPGAESWCVANASVGESWLQAALEYACGHG-ADCSAIQPGATCFEPDTVVAH  437

Query  406   ASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             ASYAFNSYYQ+N R  GTC F GAGY+V Q P  G+C+
Sbjct  438   ASYAFNSYYQRNGRSNGTCDFNGAGYIVYQEPA-GTCD  474


 Score =   113 bits (282),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RL   L+YAC  GA DC  IQPG+ C+ PNT+VAHAS+AFNSYYQ+N 
Sbjct  478  SWCVANAAVGDARLLDGLNYACANGA-DCSTIQPGAPCFEPNTMVAHASHAFNSYYQRNR  536

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GA  VV + P++G+C  P+
Sbjct  537  RASGTCDFAGAASVVYRAPKYGNCVLPS  564



>ref|XP_002462967.1| hypothetical protein SORBIDRAFT_02g035480 [Sorghum bicolor]
 gb|EER99488.1| hypothetical protein SORBIDRAFT_02g035480 [Sorghum bicolor]
Length=500

 Score =   399 bits (1026),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 231/476 (49%), Positives = 295/476 (62%), Gaps = 36/476 (8%)
 Frame = -3

Query  1636  LLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGIS  1457
             LL  S + +G +G++YGR+ + LP  A  V+LL+  GIT V+LYD +S VL AL+ +GI+
Sbjct  17    LLPFSPADAGVVGVSYGRLGNHLPDTASTVKLLQKSGITSVRLYDANSKVLKALANTGIT  76

Query  1456  TTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP-ANTTPYLVP  1286
               V LPN+ L+AAAA  S   RWV+ N+  Y   + I  VAVGNEVF +   N T  LVP
Sbjct  77    VMVMLPNDNLAAAAADPSSARRWVRRNVAAYYPATRIHGVAVGNEVFEEANKNLTAQLVP  136

Query  1285  AMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIP-VIKPMLSFLEQTG  1109
             AM NV+ +L K G+  +VKVS+PI F+A+Q S+PPS+G F+ ++   V+KPML FLE+TG
Sbjct  137   AMANVHDALVKLGLDEAVKVSTPIAFTALQASWPPSAGRFRDDVAASVMKPMLDFLERTG  196

Query  1108  SFLMLNAYPFYAYEANTDKISLDYAVFGDNQ-GVVDPNNGLVYKSLFDAQVDAVYAAI--  938
             S+L +NAYPF+AY    DKISLDYA+   N  GV DP  GLVY SL DAQ+DA Y A+  
Sbjct  197   SYLTVNAYPFFAYVEEPDKISLDYALGNSNAAGVRDPVTGLVYHSLLDAQLDATYFAMEK  256

Query  937   ------NAVKPGHF-----RVVISESGWPSKGNRNAAAYNGKKAAVNAAA----YDGETG  803
                   +A +P        R  +SESGWPS G          +   +        +    
Sbjct  257   LGTSSSSAQEPNFMARKGPRAYVSESGWPSAGRPKPGGRPRPRGGGSGRRCLEEEEAGDE  316

Query  802   PASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQKSGPIS--ERNYGLF  632
              AS  NA AYN  L+ RVL+G  GTP RP   + VY+F+LFNENQK       E+++GLF
Sbjct  317   AASVANARAYNNYLINRVLSGDTGTPYRPGADMDVYVFALFNENQKGDGADDIEQHFGLF  376

Query  631   YPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPI  452
             YPN+ KVY+      AL          P+WCVAN  VG  RLQ AL+YACG GA DCG I
Sbjct  377   YPNQTKVYEFDFRGGAL----------PSWCVANASVGDARLQAALEYACGHGA-DCGAI  425

Query  451   QPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             QPG  C+ P+T+VAHASYAFNSYYQ+N RG GTC F GA  VV   P+ G C  P+
Sbjct  426   QPGGACFEPDTVVAHASYAFNSYYQRNGRGSGTCDFAGAASVVHHAPKVGHCVLPS  481



>ref|NP_001151472.1| hydrolase, hydrolyzing O-glycosyl compounds precursor [Zea mays]
 gb|ACG42985.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
Length=584

 Score =   402 bits (1032),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 230/479 (48%), Positives = 296/479 (62%), Gaps = 37/479 (8%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             +  S  L++L  S + +G +G++YGR+ +DLP  A VV+LLK  GIT V+LYD +S VL 
Sbjct  9     VLLSTALAVLPFSPADAGVVGVSYGRLGNDLPGTASVVKLLKKSGITSVRLYDANSKVLK  68

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             AL+ +GI+  V LPN++L+AAAA  S   RWV+ N+  Y   + I  VAVGNEVF +  N
Sbjct  69    ALANTGITVMVMLPNDKLAAAAADPSSARRWVRRNVAAYYPATHIHAVAVGNEVFEEAKN  128

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPML  1130
              T  LVPAM NV+ +L K G+  +VKVS+PI F+A+Q S+PPS+G F+ ++   V+KPM+
Sbjct  129   LTGQLVPAMSNVHDALVKLGLDGAVKVSTPIAFTALQESWPPSAGRFRDDIARSVMKPMI  188

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDN-QGVVDPNNGLVYKSLFDAQVDA  953
              FLE+TGS+L +NAYPF+AY    DKISLDYA+   N  GV DP  GLVY SL DAQ+DA
Sbjct  189   DFLERTGSYLTVNAYPFFAYAEEPDKISLDYALGNSNATGVRDPVTGLVYHSLLDAQLDA  248

Query  952   VYAAI-------------NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDG  812
              Y A+             N+V P      +SESGWPS G          +        + 
Sbjct  249   TYFAMEKLGTSRSSARGPNSVAPAAH---VSESGWPSGGKPKRGGRPRPRPRGGGRRLEL  305

Query  811   ETG---PASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQKSGPIS--E  650
             E      AS  NA AYN  L++RVL+G  GTP  PD  + VY+FSLFNENQK       E
Sbjct  306   EQAGGEAASVANAQAYNNYLIKRVLSGDTGTPYHPDADMDVYIFSLFNENQKGDGADDVE  365

Query  649   RNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGA  470
             +++GLFYPN  KVY+      AL           +WCVAN   G  RLQ AL+YACG G 
Sbjct  366   QHFGLFYPNRTKVYEFDFRGGAL---------VASWCVANASAGDARLQAALEYACGHG-  415

Query  469   ADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             ADCG IQPG+ C+ P+T +AHASYAFNSYYQ+N R    C F GA YVV   P  G+C+
Sbjct  416   ADCGAIQPGAPCFEPDTRLAHASYAFNSYYQRNGRAKAACDFDGAAYVVYHEPA-GTCD  473


 Score =   115 bits (288),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN   G  RL  AL+YAC  GA DCG IQPG  C+ PNT+VAHASYAFNSYYQ+  
Sbjct  477  SWCVANAAAGDARLLAALNYACANGA-DCGAIQPGGACFEPNTVVAHASYAFNSYYQRKG  535

Query  367  RGPGTCYFGGAGYVVTQPPR-FGSCEFPT  284
            RG GTC F GAG VV   P+  G C  P+
Sbjct  536  RGSGTCDFAGAGSVVYHAPKIIGKCVLPS  564



>tpg|DAA62996.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=584

 Score =   400 bits (1027),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 230/478 (48%), Positives = 295/478 (62%), Gaps = 35/478 (7%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             +  S  L++L  S + +G +G++YGR+ +DLP  A VV+LLK  GIT V+LYD +S VL 
Sbjct  9     VLLSTALAVLPFSPADAGVVGVSYGRLGNDLPGTASVVKLLKKSGITSVRLYDANSKVLK  68

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             AL+ +GI+  V LPN++L+AAAA  S   RWV+ N+  Y   + I  VAVGNEVF +  N
Sbjct  69    ALANTGITVMVMLPNDKLAAAAADPSSARRWVRRNVAAYYPATQIHAVAVGNEVFEEAKN  128

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPML  1130
              T  LVPAM NV+ +L K G+  +VKVS+PI F+A+Q S+PPS+G F+ ++   V+KPM+
Sbjct  129   LTGQLVPAMSNVHDALVKLGLDGAVKVSTPIAFTALQESWPPSAGRFRDDIARSVMKPMI  188

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDN-QGVVDPNNGLVYKSLFDAQVDA  953
              FLE+TGS+L +NAYPF+AY    DKISLDYA+   N  GV DP  GLVY SL DAQ+DA
Sbjct  189   DFLERTGSYLTVNAYPFFAYAEEPDKISLDYALGNSNATGVRDPVTGLVYHSLLDAQLDA  248

Query  952   VYAAINAVKPGHFR------------VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
              Y A+   K G  R              +SESGWPS G          +        + E
Sbjct  249   TYFAME--KLGTSRSSARGPKSVAPAAHVSESGWPSGGKPKRGGRPRPRPRGGGRRLELE  306

Query  808   TG---PASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQKSGPIS--ER  647
                   AS  NA AYN  L++RVL+G  GTP  PD  + VY+FSLFNENQK       E+
Sbjct  307   QAGGEAASVANAQAYNNYLIKRVLSGDTGTPYHPDADMDVYIFSLFNENQKGDGADDVEQ  366

Query  646   NYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAA  467
             ++GLFYPN  KVY+      AL           +WCVAN   G  RLQ AL+YACG G A
Sbjct  367   HFGLFYPNRTKVYEFDFRGGAL---------VASWCVANASAGDARLQAALEYACGHG-A  416

Query  466   DCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             DCG IQPG+ C+ P+T +AHASYAFNSYYQ+N R    C F GA YVV   P  G+C+
Sbjct  417   DCGAIQPGAPCFEPDTRLAHASYAFNSYYQRNGRAKAACDFDGAAYVVYHEPA-GTCD  473


 Score =   115 bits (288),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN   G  RL  AL+YAC  GA DCG IQPG  C+ PNT+VAHASYAFNSYYQ+  
Sbjct  477  SWCVANAAAGDARLLAALNYACANGA-DCGAIQPGGACFEPNTVVAHASYAFNSYYQRKG  535

Query  367  RGPGTCYFGGAGYVVTQPPR-FGSCEFPT  284
            RG GTC F GAG VV   P+  G C  P+
Sbjct  536  RGSGTCDFAGAGSVVYHAPKIIGKCVLPS  564



>tpg|DAA63006.1| TPA: putative O-glycosyl hydrolase family 17 protein, partial 
[Zea mays]
Length=649

 Score =   400 bits (1029),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 222/467 (48%), Positives = 292/467 (63%), Gaps = 20/467 (4%)
 Frame = -3

Query  1657  FASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDA  1478
             F    L LL    + +G +G+NYGR+A+DLP PA VVQLLK  GIT V+LYD +  VL +
Sbjct  12    FLGAALPLLLCGAAEAGEVGVNYGRVANDLPDPASVVQLLKQSGITMVRLYDANPKVLTS  71

Query  1477  LSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANT  1304
             L+ +GI   V LPNE+L+AAA+  S+  +W ++N+  +   + I  VAVGNEVF    + 
Sbjct  72    LANTGIKVMVMLPNEELAAAASDPSYALQWARANVAAFYPATHIHCVAVGNEVFDSRPDL  131

Query  1303  TPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLS  1127
                LVPAM NV+ +LA+ G+A +VKVS+P+ FSA+Q SYPPS+G F+ ++   V+KPML 
Sbjct  132   NSNLVPAMANVHDALAQLGLADAVKVSTPVAFSAVQDSYPPSAGRFRDDIAQSVMKPMLG  191

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGV-----------VDPNNGLVYK  980
             FL++TGS+L +N YP+ AY  + D+ISLDYA+   N GV           +D +NG+ Y 
Sbjct  192   FLDRTGSYLTINIYPYLAYAEHPDQISLDYALGNPNPGVRVDDDDTGSIALDDDNGVTYH  251

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SL DAQ+DA Y A++A+     +  + E+G PS G         +    +  A D +  P
Sbjct  252   SLLDAQLDATYYAMDAMGFTSLKAHVGETGHPSGGRPRPGRRPPRGGRRHLVAGDDDGYP  311

Query  799   -ASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLF  632
              AS  NA AY  N++ RVL+G  GTP RPD  + VY+F+LFNENQK  GP   E+N+GLF
Sbjct  312   VASIANAHAYVNNVINRVLSGNTGTPHRPDADMDVYIFALFNENQKGDGPDDIEQNFGLF  371

Query  631   YPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPI  452
             YP+EQKVY+           G       +WCVAN   G  RLQ ALDYACG G ADC  I
Sbjct  372   YPSEQKVYEFDFHHGGG-GGGGSGGAKASWCVANAAAGDSRLQAALDYACGHG-ADCSAI  429

Query  451   QPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             QPG+ CY PNT +AHASYA N YYQ+  R  GTC F GA  VV Q P
Sbjct  430   QPGAACYEPNTKLAHASYALNDYYQRKGRASGTCDFAGAANVVYQAP  476


 Score =   119 bits (298),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DCG IQPG+TC+ PNT  AHASYAFN YYQ+N 
Sbjct  486  SWCVANAAVGDSRLQAALDYACGHGA-DCGAIQPGATCFKPNTKAAHASYAFNDYYQRNG  544

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
            R  GTC F GA  VV Q P  G+C+  + +
Sbjct  545  RASGTCDFAGAASVVYQEPA-GACDAKSSW  573


 Score =   116 bits (290),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DC  IQPG+TC+ PNT VAHAS+AFNSYYQ+N 
Sbjct  572  SWCVANAAVGDARLQAALDYACGHGA-DCSTIQPGATCFEPNTKVAHASHAFNSYYQRNG  630

Query  367  RGPGTCYFGGAGYVVTQPP  311
            R  GTC F GA  VV Q P
Sbjct  631  RASGTCDFAGAASVVYQAP  649



>ref|XP_008653189.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Zea mays]
Length=660

 Score =   400 bits (1029),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 222/467 (48%), Positives = 292/467 (63%), Gaps = 20/467 (4%)
 Frame = -3

Query  1657  FASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDA  1478
             F    L LL    + +G +G+NYGR+A+DLP PA VVQLLK  GIT V+LYD +  VL +
Sbjct  12    FLGAALPLLLCGAAEAGEVGVNYGRVANDLPDPASVVQLLKQSGITMVRLYDANPKVLTS  71

Query  1477  LSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANT  1304
             L+ +GI   V LPNE+L+AAA+  S+  +W ++N+  +   + I  VAVGNEVF    + 
Sbjct  72    LANTGIKVMVMLPNEELAAAASDPSYALQWARANVAAFYPATHIHCVAVGNEVFDSRPDL  131

Query  1303  TPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLS  1127
                LVPAM NV+ +LA+ G+A +VKVS+P+ FSA+Q SYPPS+G F+ ++   V+KPML 
Sbjct  132   NSNLVPAMANVHDALAQLGLADAVKVSTPVAFSAVQDSYPPSAGRFRDDIAQSVMKPMLG  191

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGV-----------VDPNNGLVYK  980
             FL++TGS+L +N YP+ AY  + D+ISLDYA+   N GV           +D +NG+ Y 
Sbjct  192   FLDRTGSYLTINIYPYLAYAEHPDQISLDYALGNPNPGVRVDDDDTGSIALDDDNGVTYH  251

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SL DAQ+DA Y A++A+     +  + E+G PS G         +    +  A D +  P
Sbjct  252   SLLDAQLDATYYAMDAMGFTSLKAHVGETGHPSGGRPRPGRRPPRGGRRHLVAGDDDGYP  311

Query  799   -ASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLF  632
              AS  NA AY  N++ RVL+G  GTP RPD  + VY+F+LFNENQK  GP   E+N+GLF
Sbjct  312   VASIANAHAYVNNVINRVLSGNTGTPHRPDADMDVYIFALFNENQKGDGPDDIEQNFGLF  371

Query  631   YPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPI  452
             YP+EQKVY+           G       +WCVAN   G  RLQ ALDYACG G ADC  I
Sbjct  372   YPSEQKVYEFDFHHGGG-GGGGSGGAKASWCVANAAAGDSRLQAALDYACGHG-ADCSAI  429

Query  451   QPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             QPG+ CY PNT +AHASYA N YYQ+  R  GTC F GA  VV Q P
Sbjct  430   QPGAACYEPNTKLAHASYALNDYYQRKGRASGTCDFAGAANVVYQAP  476


 Score =   124 bits (312),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DC  IQPG+TC+ PNT VAHAS+AFNSYYQ+N 
Sbjct  572  SWCVANAAVGDARLQAALDYACGHGA-DCSTIQPGATCFEPNTKVAHASHAFNSYYQRNG  630

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GA  VV Q P  G+C  P+
Sbjct  631  RASGTCDFAGAASVVYQAPEVGNCVLPS  658


 Score =   119 bits (298),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DCG IQPG+TC+ PNT  AHASYAFN YYQ+N 
Sbjct  486  SWCVANAAVGDSRLQAALDYACGHGA-DCGAIQPGATCFKPNTKAAHASYAFNDYYQRNG  544

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
            R  GTC F GA  VV Q P  G+C+  + +
Sbjct  545  RASGTCDFAGAASVVYQEPA-GACDAKSSW  573



>tpg|DAA63007.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=695

 Score =   400 bits (1028),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 293/470 (62%), Gaps = 20/470 (4%)
 Frame = -3

Query  1657  FASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDA  1478
             F    L LL    + +G +G+NYGR+A+DLP PA VVQLLK  GIT V+LYD +  VL +
Sbjct  12    FLGAALPLLLCGAAEAGEVGVNYGRVANDLPDPASVVQLLKQSGITMVRLYDANPKVLTS  71

Query  1477  LSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANT  1304
             L+ +GI   V LPNE+L+AAA+  S+  +W ++N+  +   + I  VAVGNEVF    + 
Sbjct  72    LANTGIKVMVMLPNEELAAAASDPSYALQWARANVAAFYPATHIHCVAVGNEVFDSRPDL  131

Query  1303  TPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLS  1127
                LVPAM NV+ +LA+ G+A +VKVS+P+ FSA+Q SYPPS+G F+ ++   V+KPML 
Sbjct  132   NSNLVPAMANVHDALAQLGLADAVKVSTPVAFSAVQDSYPPSAGRFRDDIAQSVMKPMLG  191

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGV-----------VDPNNGLVYK  980
             FL++TGS+L +N YP+ AY  + D+ISLDYA+   N GV           +D +NG+ Y 
Sbjct  192   FLDRTGSYLTINIYPYLAYAEHPDQISLDYALGNPNPGVRVDDDDTGSIALDDDNGVTYH  251

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             SL DAQ+DA Y A++A+     +  + E+G PS G         +    +  A D +  P
Sbjct  252   SLLDAQLDATYYAMDAMGFTSLKAHVGETGHPSGGRPRPGRRPPRGGRRHLVAGDDDGYP  311

Query  799   -ASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLF  632
              AS  NA AY  N++ RVL+G  GTP RPD  + VY+F+LFNENQK  GP   E+N+GLF
Sbjct  312   VASIANAHAYVNNVINRVLSGNTGTPHRPDADMDVYIFALFNENQKGDGPDDIEQNFGLF  371

Query  631   YPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPI  452
             YP+EQKVY+           G       +WCVAN   G  RLQ ALDYACG G ADC  I
Sbjct  372   YPSEQKVYEFDFHHGGG-GGGGSGGAKASWCVANAAAGDSRLQAALDYACGHG-ADCSAI  429

Query  451   QPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFG  302
             QPG+ CY PNT +AHASYA N YYQ+  R  GTC F GA  VV Q P  G
Sbjct  430   QPGAACYEPNTKLAHASYALNDYYQRKGRASGTCDFAGAANVVYQAPADG  479


 Score =   117 bits (293),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = -3

Query  607  DVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYN  428
            ++ L   A  +  S A+   +WCVAN  VG  RLQ ALDYACG GA DCG IQPG+TC+ 
Sbjct  489  ELDLLFFAFSDTCSAAKA--SWCVANAAVGDSRLQAALDYACGHGA-DCGAIQPGATCFK  545

Query  427  PNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
            PNT  AHASYAFN YYQ+N R  GTC F GA  VV Q P
Sbjct  546  PNTKAAHASYAFNDYYQRNGRASGTCDFAGAASVVYQEP  584


 Score =   115 bits (289),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DC  IQPG+TC+ PNT VAHAS+AFNSYYQ+N 
Sbjct  617  SWCVANAAVGDARLQAALDYACGHGA-DCSTIQPGATCFEPNTKVAHASHAFNSYYQRNG  675

Query  367  RGPGTCYFGGAGYVVTQPP  311
            R  GTC F GA  VV Q P
Sbjct  676  RASGTCDFAGAASVVYQAP  694



>ref|XP_004968973.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Setaria italica]
Length=566

 Score =   396 bits (1017),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 220/466 (47%), Positives = 295/466 (63%), Gaps = 19/466 (4%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA  R+    + A+L   LL H+   +G +G++YGR+A+DLP PAKV QLLK  GIT V+
Sbjct  1     MALTRILVFVLGAALPF-LLFHA--EAGQMGVSYGRVANDLPDPAKVTQLLKDNGITMVR  57

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             +YD    VL +L+ +GI   V +PNE ++ AA + S+  +WV+  +  Y   + I  VAV
Sbjct  58    IYDAKQEVLRSLANTGIKVMVMVPNENIAEAARNPSYALQWVRDRVKAYYPATQIHGVAV  117

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF    + T  LVPAM NV A+LA+ G+A +VKVS+PI F+A++ ++PPS G FK E
Sbjct  118   GNEVFDSRPDLTRQLVPAMTNVQAALAQLGLADAVKVSTPIAFTAVENTFPPSRGRFKDE  177

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             +  PV+KPML FL++TGS+L +N YPF+AY      I+LDYA+   N GV D +  L Y 
Sbjct  178   IAEPVMKPMLQFLKRTGSYLTMNMYPFWAYYNQPQDINLDYALGNSNPGVPDDDTSLKYY  237

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             +L DA+ DA ++A++ + PG   + ++E+ WP +G  +    +     +     D   G 
Sbjct  238   NLLDAERDAAHSAMDHLVPG-VSLYLTETNWPPRGRPHQGGGHRGGRRLE----DDGDGV  292

Query  799   ASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLFY  629
              +  NA AY  NL+ RVL G  GTPLRPD  L VY+F+LFNENQK  GP   E+N+GLFY
Sbjct  293   FTIANAQAYVNNLINRVLAGNTGTPLRPDAALDVYIFALFNENQKGDGPDDIEQNFGLFY  352

Query  628   PNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQ  449
             PN QKVY+        G     A    +WCVAN  VG +RLQ ALDYACG G ADC  IQ
Sbjct  353   PNMQKVYEFDFH----GGVAPPAPPAASWCVANAAVGDDRLQAALDYACGHG-ADCSGIQ  407

Query  448   PGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             PG+ C+ P+TL+AHASYA NSYYQ   R  GTC F GA +VV + P
Sbjct  408   PGAVCFEPSTLLAHASYAVNSYYQNKGRASGTCDFAGAAHVVLEEP  453


 Score =   122 bits (306),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DCG IQPG  C+ PNT VAHASYAFNSYYQ+N 
Sbjct  462  SWCVANAAVGDGRLQAALDYACGHGA-DCGAIQPGGKCFEPNTRVAHASYAFNSYYQRNH  520

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFP  287
            R  G+C F GA  VV   P+ G+C  P
Sbjct  521  RASGSCDFAGAASVVYMAPKIGNCVLP  547



>ref|XP_008670470.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Zea mays]
Length=649

 Score =   398 bits (1022),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 285/450 (63%), Gaps = 21/450 (5%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +G+NYG +A+DLP+PA VVQLLK  GIT VK+YD ++  L +L+ +GI   V +PN 
Sbjct  22    AGEVGVNYGTVANDLPNPASVVQLLKQNGITMVKIYDANANALTSLANTGIKAMVMMPNA  81

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              L+ AA+  ++  +WVQ N++PY   + I  VAVGNEVF DP+     LVPAM NV A L
Sbjct  82    NLARAASDPTYAAQWVQDNVMPYYPATQINAVAVGNEVFDDPSVDKMDLVPAMTNVQAGL  141

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A  GVA  +KVSSPI F A+Q S+PPSSG F+ ++  PV+KPML  L++TGS+L +NAYP
Sbjct  142   AGLGVAGDIKVSSPIKFDALQVSWPPSSGRFRDDIAQPVMKPMLDLLQRTGSYLTINAYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F++Y ++   ISLDYA+   N GV D    L Y +L DAQVDA + A+ A+        +
Sbjct  202   FFSYYSDPRSISLDYALGNSNPGVSDDKANLRYDNLLDAQVDATHYAMEALGVSTVDAYV  261

Query  901   SESGWPSKGNRNA----AAYNGKKAAVNAAAYDGETG-----PASAVNAAAYNGNLVRRV  749
              ESGWP+KG        AA     AA  +A    +TG     PAS  NA AYN NL+ R+
Sbjct  262   GESGWPTKGVVGGKIPPAARRLLGAAEGSARRLLDTGDDAGSPASIPNARAYNNNLINRM  321

Query  748   LTG-GGTPLRPDEPLSVYLFSLFNENQKSGPIS---ERNYGLFYPNEQKVYDVPLTLAAL  581
             L+G  GTP RP+  + VY+F+LFNEN K    +   E+N+GLFYPNE KVY+        
Sbjct  322   LSGRTGTPHRPNANMDVYIFALFNENDKGSNGADDVEQNFGLFYPNETKVYEFSFQGGGG  381

Query  580   GNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHAS  401
                 S      +WCV N   G + LQ ALDYACG G ADC  IQP  +CY PNT++AHAS
Sbjct  382   PPGPSS----DSWCVGNAAAGGKALQDALDYACGHG-ADCSAIQPTGSCYEPNTVLAHAS  436

Query  400   YAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             YAFNSYY+KN R  GTC F GA  VV Q P
Sbjct  437   YAFNSYYKKNNRAAGTCDFNGAASVVYQAP  466


 Score =   107 bits (266),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            PTWCVA   VG  +LQ ALDYACG GA DC  IQ G  C+ PNT+ AHASYAFN YYQ+N
Sbjct  475  PTWCVAKPGVGDAQLQPALDYACGHGA-DCSAIQSGGGCFQPNTVAAHASYAFNDYYQRN  533

Query  370  ARGPGTCYFGGAGYVVTQPP  311
             R  GTC F GA  VV Q P
Sbjct  534  GRADGTCDFSGAAAVVNQDP  553


 Score =   104 bits (259),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVA   VG ++L+ ALDYACG GA DC  IQ G  C+ P+ + +HASYAFNSYYQ+N 
Sbjct  561  SWCVAKQGVGDDQLKQALDYACGHGA-DCSAIQQGGACFQPDNMPSHASYAFNSYYQRNG  619

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R    C F GAG VV Q P  G+C  P+
Sbjct  620  RASVACDFSGAGVVVYQQPTVGNCVLPS  647



>gb|EAZ24771.1| hypothetical protein OsJ_08544 [Oryza sativa Japonica Group]
Length=444

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 268/425 (63%), Gaps = 60/425 (14%)
 Frame = -3

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             +GI   VALPNEQL AAA+  S+   WV+ N+  Y   + I+ +AVGNEVF    N T  
Sbjct  39    TGIKVVVALPNEQLLAAASRPSYALAWVRRNVAAYYPATQIQGIAVGNEVFASAKNLTAQ  98

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             LVPAM NV+A+LA+  +   VKVSSPI  +A+  SYPPS+G F+ +L   V+KPML FL 
Sbjct  99    LVPAMTNVHAALARLSLDKPVKVSSPIALTALAGSYPPSAGVFREDLAQAVMKPMLDFLA  158

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QTGS+LM+NAYPF+AY  N D ISLDYA+F  N GV+D  +GL Y SL DAQ+DAV+ A+
Sbjct  159   QTGSYLMVNAYPFFAYSGNADVISLDYALFRPNAGVLDSGSGLKYYSLLDAQLDAVFTAV  218

Query  937   NAVKPGHF---RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNG  767
             +  K G++   RVV+SE+GWPSKG+                    ETG A+A NAAAYNG
Sbjct  219   S--KLGNYNAVRVVVSETGWPSKGDAK------------------ETG-AAAANAAAYNG  257

Query  766   NLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
             NLVRRVL+G  GTP RPD  + VYLF+LFNENQK GP SERNYG+FYPN+QKVYDV   L
Sbjct  258   NLVRRVLSGNAGTPRRPDADMDVYLFALFNENQKPGPTSERNYGVFYPNQQKVYDVEFVL  317

Query  589   ---------------AALG---NRG--------------SKAQVPPTWCVANGDVGPERL  506
                              LG   N G                      WCVAN   G ERL
Sbjct  318   GGNSAGGGGSSGKDNGGLGWQDNGGVNAGNAPAGAGGGVKATSTGEAWCVANAMAGEERL  377

Query  505   QVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYV  326
             Q ALDYACG G ADC  IQPG+ C+ PNT+VAHASYAFN YYQ+  R  GTC F GA YV
Sbjct  378   QKALDYACGPGGADCKAIQPGAACFEPNTMVAHASYAFNDYYQRKGRTIGTCDFAGAAYV  437

Query  325   VTQPP  311
             V Q P
Sbjct  438   VNQAP  442



>ref|NP_001059878.1| Os07g0538000 [Oryza sativa Japonica Group]
 dbj|BAC84487.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAD30397.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF21792.1| Os07g0538000 [Oryza sativa Japonica Group]
 gb|EEE67331.1| hypothetical protein OsJ_24583 [Oryza sativa Japonica Group]
Length=558

 Score =   391 bits (1005),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 214/465 (46%), Positives = 290/465 (62%), Gaps = 34/465 (7%)
 Frame = -3

Query  1666  LCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
             L +  +  L LL  S + +G +G+ YGR AD+L  P  VV LL++ GIT V+++D D  V
Sbjct  8     LRVLLATALPLLFLSHADAGELGVCYGRDADNLMDPQSVVSLLRANGITMVRIFDADPAV  67

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP  1313
             L AL+ +GI   VALPN  L +A    S+  RWV+S++VPY   ++I  VAVGNEVF   
Sbjct  68    LRALANTGIKVMVALPNTDLGSAGWDPSYAQRWVESSVVPYYPATLINGVAVGNEVFDQA  127

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKP  1136
              + T  LVPAM+NV+A+LA+ G+A +++VS+PI FS+++ S+PPS+G+F+ ++   V+ P
Sbjct  128   PHLTQQLVPAMRNVHAALARLGLADAIRVSTPITFSSVEVSFPPSAGAFRDDIAQSVMSP  187

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             M+ FL+QT S+ M+N YPF+AY   +  ISL+YA F  N GV DP +G+ Y SLFDA++D
Sbjct  188   MIDFLQQTDSYFMVNLYPFFAYADPSTGISLEYATFRPNAGVFDPVSGVTYYSLFDAELD  247

Query  955   AVYAAINAVKPGHFR-----------VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
             AVY AIN V   + R           + +SESG PS G          ++ V  A  DG+
Sbjct  248   AVYYAINKVSGSNERASLAQAGGRVPIRVSESGHPSGGR--------IRSGVTEANADGD  299

Query  808   TGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFY  629
             +  A+  NA AYN  L +RVL G        E +S Y+F+LFNEN+K GP  E N+GLFY
Sbjct  300   S-VATKANAQAYNNGLAKRVLFGASNM----EDVSAYIFALFNENKKGGPSIESNFGLFY  354

Query  628   PNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQ  449
             P+  KVYDV        + G       +WCVAN  +G  RLQ ALD+AC  G ADC  IQ
Sbjct  355   PDGTKVYDVDF------HGGGTCPTKESWCVANAAIGNARLQGALDWACSNG-ADCSAIQ  407

Query  448   PGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQP  314
              G  CY PNT+VAHASYAFN YYQ+N +    C F GA Y+V +P
Sbjct  408   QGKVCYEPNTMVAHASYAFNDYYQRNGKASSACNFAGAAYIVYKP  452


 Score =   119 bits (299),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVAN +VG  RLQ ALDYAC    ADC  IQPG  C++PNT VAHA+YAFN YYQ  
Sbjct  461  PSWCVANAEVGDMRLQAALDYACSS-CADCSAIQPGGRCFDPNTKVAHATYAFNDYYQTA  519

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C FGGA  +V Q PR G+C  P
Sbjct  520  GRASGSCDFGGAASIVNQAPRIGNCVLP  547



>gb|EEC82195.1| hypothetical protein OsI_26335 [Oryza sativa Indica Group]
Length=569

 Score =   391 bits (1005),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 214/465 (46%), Positives = 290/465 (62%), Gaps = 34/465 (7%)
 Frame = -3

Query  1666  LCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
             L +  +  L LL  S + +G +G+ YGR AD+L  P  VV LL++ GIT V+++D D  V
Sbjct  8     LRVLLATALPLLFLSHADAGELGVCYGRDADNLMDPQSVVSLLRANGITMVRIFDADPAV  67

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP  1313
             L AL+ +GI   VALPN  L +A    S+  RWV+S++VPY   ++I  VAVGNEVF   
Sbjct  68    LRALANTGIKVMVALPNTDLGSAGWDPSYAQRWVESSVVPYYPATLINGVAVGNEVFDQA  127

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKP  1136
              + T  LVPAM+NV+A+LA+ G+A +++VS+PI FS+++ S+PPS+G+F+ ++   V+ P
Sbjct  128   PHLTQQLVPAMRNVHAALARLGLADAIRVSTPIAFSSVEVSFPPSAGAFRDDIAQSVMSP  187

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             M+ FL+QT S+ M+N YPF+AY   +  ISL+YA F  N GV DP +G+ Y SLFDA++D
Sbjct  188   MIDFLQQTDSYFMVNLYPFFAYADPSTGISLEYATFRPNAGVFDPVSGVTYYSLFDAELD  247

Query  955   AVYAAINAVKPGHFR-----------VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
             AVY AIN V   + R           + +SESG PS G          ++ V  A  DG+
Sbjct  248   AVYYAINKVSGSNERASLAQAGGRVPIRVSESGHPSGGR--------IRSGVTEANADGD  299

Query  808   TGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFY  629
             +  A+  NA AYN  L +RVL G        E +S Y+F+LFNEN+K GP  E N+GLFY
Sbjct  300   S-VATKANAQAYNNGLAKRVLFGASNM----EDVSAYIFALFNENKKGGPSIESNFGLFY  354

Query  628   PNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQ  449
             P+  KVYDV        + G       +WCVAN  +G  RLQ ALD+AC  G ADC  IQ
Sbjct  355   PDGTKVYDVDF------HGGGTCPTKESWCVANAAIGNARLQGALDWACSNG-ADCSAIQ  407

Query  448   PGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQP  314
              G  CY PNT+VAHASYAFN YYQ+N +    C F GA Y+V +P
Sbjct  408   QGKVCYEPNTMVAHASYAFNDYYQRNGKASSACNFAGAAYIVYKP  452


 Score =   119 bits (299),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVAN +VG  RLQ ALDYAC    ADC  IQPG  C++PNT VAHA+YAFN YYQ  
Sbjct  461  PSWCVANAEVGDMRLQAALDYACSS-CADCSAIQPGGRCFDPNTKVAHATYAFNDYYQTA  519

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C FGGA  +V Q PR G+C  P
Sbjct  520  GRASGSCDFGGAASIVNQAPRIGNCVLP  547



>ref|XP_004968993.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Setaria italica]
Length=551

 Score =   390 bits (1001),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 291/451 (65%), Gaps = 26/451 (6%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +  +G++YGR+A+DLP PAKV QLLK  GIT V++YD    VL +L+ +GI   V +PNE
Sbjct  26    ASEVGVSYGRVANDLPDPAKVTQLLKDNGITMVRIYDAKQEVLRSLANTGIKVMVMVPNE  85

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              ++ AA + S+  +WV+ N+  Y   + I  VAVGNEVF    + T  LVPAM NV A+L
Sbjct  86    NIAEAARNPSYALQWVRDNVKAYYPATQIHGVAVGNEVFDSRPDLTRQLVPAMTNVQAAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+A +VKVS+PI F+A++ ++PPS G FK E+  PV+KPML FL++TGS+L +N YP
Sbjct  146   AQLGLADAVKVSTPIAFTAVENTFPPSRGRFKDEIAEPVMKPMLQFLKRTGSYLTMNMYP  205

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY      I+LDYA+   N GV D +  L Y +L DA+ DA ++A++ + PG   + +
Sbjct  206   FWAYYNQPHDINLDYALGNSNPGVPDDDTSLKYYNLLDAERDAAHSAMDDLVPG-VSLSL  264

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGG-GTPL  725
             +E+ WP  G  +    +     +     D   G  +  NA AY  NL+ RVLTG  GTPL
Sbjct  265   TETNWPPHGKPHHGGGHRGGRRLE----DDGDGVFTIANAQAYVNNLINRVLTGNTGTPL  320

Query  724   RPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP  551
             RP+ PL VY+F+LFNENQK  GP   E+N+GLFYPN QKVY       A   +GS A  P
Sbjct  321   RPNAPLDVYIFALFNENQKGDGPDDIEQNFGLFYPNMQKVY-------AFSFQGSGA--P  371

Query  550   P-----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
             P     +WCVAN  VG  RLQ ALD+AC  G ADCG IQPG++C+ P+T +AHASYAFNS
Sbjct  372   PGGQTASWCVANAAVGDSRLQAALDWACSHG-ADCGAIQPGASCFEPDTKLAHASYAFNS  430

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             YYQ+N +  G+C F GA  VV Q P   S +
Sbjct  431   YYQRNNKASGSCDFAGAASVVYQEPSMCSAK  461


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ AL++AC  GA DC   QPG+ C+ PNT VAHAS+AFNSYYQ+  
Sbjct  463  SWCVANAAVGDGRLQAALNWACSNGA-DCSDTQPGAACFEPNTKVAHASHAFNSYYQRKH  521

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GA  VV + PR G+C  P+
Sbjct  522  RASGTCDFAGAASVVYEEPRIGNCALPS  549



>ref|XP_004957929.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Setaria 
italica]
Length=507

 Score =   387 bits (995),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 230/493 (47%), Positives = 299/493 (61%), Gaps = 40/493 (8%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA  RL+ + +  +L   LL  S + +G +G++YGR+ +DL   A VV+LL   GIT V+
Sbjct  14    MALTRLFVVLLGTAL--PLLFFSPADAGEVGVSYGRLGNDLLDTASVVKLLNKSGITTVR  71

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             LYD + TVL AL+ +GI   V LPN+ L+AAAA  S   RWV  N+  +   + I  VAV
Sbjct  72    LYDANPTVLGALANTGIKVMVMLPNDDLAAAAADPSSALRWVLRNVAAHYPATRIHGVAV  131

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF +  + T  LVPAM NV+ +L K  +  +VKVS+PI F+A++ S+PPS+G F+ +
Sbjct  132   GNEVFEEARSLTWQLVPAMANVHTALVKLRLDEAVKVSTPIAFTALEASWPPSAGRFRRD  191

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             +  PV+KPML FLE+TGS+L +NAYPF+AY    DKISLDYA+     GV DP  GLVY 
Sbjct  192   IARPVMKPMLDFLERTGSYLTINAYPFFAYLEQPDKISLDYALGSSMTGVRDPVTGLVYH  251

Query  979   SLFDAQVDAVYAAINAV------------------KPGHFRVVISESGWPSKGNRNAAAY  854
             SL DAQ+DA Y A+  +                  +P   R  +SESGW S+        
Sbjct  252   SLLDAQLDATYFAMEKLGSSAGVRDEGNSSLGRGGRP-RVRAYVSESGWASR--GRRRPG  308

Query  853   NGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNE  677
                +A  + A        A+  NA AYN  L+ RVL+G  GTP RPD  + VY+F+LFNE
Sbjct  309   RRLEADGDGAPAPAPAAAATIANAKAYNNYLINRVLSGDTGTPYRPDVDMDVYIFALFNE  368

Query  676   NQKSGPIS--ERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQ  503
             NQK       ER++GLFYPN+ KVY+      AL          P+WCVAN  V   RLQ
Sbjct  369   NQKGWGADDIERHFGLFYPNQTKVYEFDFHGGAL----------PSWCVANAGVRDARLQ  418

Query  502   VALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVV  323
              ALDYACG G ADC  IQPG+ C+ PNT+VAHAS+AFNSYYQ+N R    C FGGA  VV
Sbjct  419   AALDYACGHG-ADCSDIQPGAPCFEPNTVVAHASHAFNSYYQRNHRAKAACNFGGAASVV  477

Query  322   TQPPRFGSCEFPT  284
                P+ G+C  P+
Sbjct  478   CHQPKIGNCVLPS  490



>gb|KCW70221.1| hypothetical protein EUGRSUZ_F03494 [Eucalyptus grandis]
Length=345

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 259/412 (63%), Gaps = 75/412 (18%)
 Frame = -3

Query  1597  INYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLSAA  1418
             +N+GRIA DLP P K              L+DT    L AL+GSGIS  VALPNEQLS+A
Sbjct  1     MNWGRIASDLPPPEK--------------LFDTYDGALTALAGSGISVVVALPNEQLSSA  46

Query  1417  AASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKYGV  1244
             A+ QSFTD WVQSNI  Y   + I T+AVGNEVF DP N T +LVPAM NVYASL KY +
Sbjct  47    ASDQSFTDSWVQSNISKYYPSTKIVTIAVGNEVFADPNNPTAFLVPAMNNVYASLVKYNL  106

Query  1243  APSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYE  1067
             A  + VSSPI   ++Q SYP S+GSFK +L+ PVIKPML FL +TGS+LM+N YPF+AY 
Sbjct  107   A-GISVSSPIAMRSLQASYPTSAGSFKSDLVEPVIKPMLEFLRKTGSYLMVNVYPFFAYM  165

Query  1066  ANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISESGW  887
             AN+D+ISLDYA+F  N G VDP +GL Y  LFDAQVDA              +V++E+GW
Sbjct  166   ANSDQISLDYALFKQNPGAVDPGSGLKYYGLFDAQVDA--------------LVMTETGW  211

Query  886   PSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPL  707
             PSKG+ N A                    A   NA A N N+++RVL G GTPLRP+  +
Sbjct  212   PSKGDANEAG-------------------AGLENAVANNRNMLKRVLMGSGTPLRPNNTM  252

Query  706   SVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP-----TW  542
                               +RNYGLFYP+EQKVY + LTL  L   G+  +VPP     TW
Sbjct  253   ------------------DRNYGLFYPDEQKVYSIRLTLEQL-ESGANNRVPPGPAGRTW  293

Query  541   CVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
             CVA+G    ++LQ  LDYACG+G ADC PIQ GS  Y PNT+ AHASYAFNS
Sbjct  294   CVADGRDWAKKLQAGLDYACGEGGADCQPIQRGSASYEPNTVEAHASYAFNS  345



>ref|XP_006658651.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=563

 Score =   387 bits (995),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 290/460 (63%), Gaps = 22/460 (5%)
 Frame = -3

Query  1642  LSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSG  1463
             L+L+  S + +G IG+ +G +AD+LP  + VVQLLK   IT V++YD D   L  L+ +G
Sbjct  17    LALMFFSPAEAGEIGVCWGTVADNLPDQSSVVQLLKKNSITMVRIYDADRKALTQLANTG  76

Query  1462  ISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLV  1289
             I   V+LPNE +S+AAAS S+  +WV++N+  Y   ++I  VAVGNEVF    + TP L 
Sbjct  77    IKVMVSLPNELVSSAAASPSYALQWVKNNVAAYYPATLINGVAVGNEVFDQAPSLTPQLA  136

Query  1288  PAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTG  1109
             PAM+NV A+LA  G+A +VKVS+P+ F A++ SYPPSSG FK EL+PV+  +L FL+Q+ 
Sbjct  137   PAMRNVQAALAGLGLADAVKVSTPVAFDAIKVSYPPSSGEFKDELVPVMSSVLDFLQQSS  196

Query  1108  SFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAV  929
             S+LM+N YPF+AY A  DKISL YA FG N GV D  +G+ Y SLFDAQ+DAVY AI+ V
Sbjct  197   SYLMVNIYPFFAYAAQPDKISLAYATFGSNAGVFDSTSGVTYYSLFDAQLDAVYYAIDRV  256

Query  928   KP--GHFRVVIS----ESGWPS-----KGNRNAAAYNGKKAAVNAAAYDGETGP-ASAVN  785
                 G  R   S     +G PS     + +       GK  A+   A D ++   A+  N
Sbjct  257   NSAGGSRRARASFAQARAGRPSRRVPVRASETGHPSGGKIGAMATIADDDDSSSVATKAN  316

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             A AYN  L+RRV++G      PD  +S Y+F+LFNE+ K G   ERN+GLFYP+  KVY+
Sbjct  317   AQAYNNGLIRRVVSGASG--MPD--VSAYIFALFNEDGKGGASIERNFGLFYPDMTKVYE  372

Query  604   VPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
             V       G  GS      +WCVAN   G  +LQ ALDYACG G ADCG IQ G  C++P
Sbjct  373   VDFV---HGAPGSSPGTAASWCVANPSAGDAQLQDALDYACGHG-ADCGAIQRGGRCFSP  428

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRF  305
             +T  AHASYA N YYQ+N R  G C FGGAG +V Q P  
Sbjct  429   DTKAAHASYALNDYYQRNGRAAGACNFGGAGIIVYQAPNL  468


 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVA  + G  RLQ ALDYACG GA DC  IQ G  C++P+T VAHA+YAFN YYQ+N 
Sbjct  475  SWCVAKAEGGDARLQAALDYACGHGA-DCSAIQRGGRCFDPDTKVAHATYAFNDYYQRNG  533

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R    C FGGAG VV Q P  G C  P+
Sbjct  534  RATSACDFGGAGSVVYQAPTIGHCVLPS  561



>ref|XP_002462970.1| hypothetical protein SORBIDRAFT_02g035520 [Sorghum bicolor]
 gb|EER99491.1| hypothetical protein SORBIDRAFT_02g035520 [Sorghum bicolor]
Length=661

 Score =   389 bits (999),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 282/460 (61%), Gaps = 33/460 (7%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+NYGR+A DLP PA VVQLLK  GIT V+LYD +  VL +L+ +GI   V LPNE+
Sbjct  23    GEVGVNYGRVAYDLPDPASVVQLLKQNGITMVRLYDANPKVLASLANTGIKVLVMLPNEE  82

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L+AAA+  S+  RW +SN+  +   + I  V+VGNEVF    +    LV AM NV+ +LA
Sbjct  83    LAAAASDPSYALRWARSNVAAFYPATRIHGVSVGNEVFDSRPDLNADLVAAMTNVHDALA  142

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYPF  1079
             + G+A +VKVS+P+ FSA+  SYPPSSG F+ ++   V+KPML FLE+TGS+L +N YP+
Sbjct  143   QLGLADAVKVSTPVAFSAVTDSYPPSSGRFRDDIAQSVMKPMLGFLERTGSYLTINIYPY  202

Query  1078  YAYEANTDKISLDYAVFGDNQGV------------------VDPNNGLVYKSLFDAQVDA  953
              AY  + D+ISLDYA+   N GV                   +   G+ Y SL DAQ+DA
Sbjct  203   LAYAEHPDQISLDYALGNSNPGVRVDDDDDDTAGLTLDDDDDNDGGGVTYYSLLDAQLDA  262

Query  952   VYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVN--AAAYDGETGP-ASAVNA  782
              Y A++ +     +  + E+G PS G         +    +  A   DG+  P AS  NA
Sbjct  263   TYYAMDDLGFTSLKAHVGETGHPSAGKPKTGRRPPRGGRRHLMAGDDDGDGYPVASVANA  322

Query  781   AAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLFYPNEQKV  611
              AY  N++ RVL+G  GTP RPD  + VY+F+LFNENQK  GP   E+N+GLFYPNEQKV
Sbjct  323   HAYVNNVINRVLSGKTGTPHRPDADMDVYIFALFNENQKGDGPDDIEQNFGLFYPNEQKV  382

Query  610   YDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCY  431
             Y+                   +WCVAN  VG  RLQ ALDYACG G ADC  IQPG+ CY
Sbjct  383   YEFDFHGGG-----GGGGAKASWCVANAAVGDSRLQTALDYACGHG-ADCSAIQPGAACY  436

Query  430   NPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
              PNT +AHASYAFN YYQKN R  GTC F GA  VV Q P
Sbjct  437   EPNTKLAHASYAFNDYYQKNGRASGTCDFAGAANVVYQAP  476


 Score =   122 bits (307),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DC  IQPG+TC+ P+T  AHAS+AFNSYYQ+N 
Sbjct  573  SWCVANAAVGDARLQAALDYACGHGA-DCSAIQPGATCFQPDTKAAHASHAFNSYYQRNG  631

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GA  VV Q P+ G+C  P+
Sbjct  632  RASGTCDFAGAASVVYQAPKIGNCMLPS  659


 Score =   113 bits (283),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DCG IQPG+TC+ P+T  AHASYAFN YYQ+  
Sbjct  487  SWCVANTAVGDARLQAALDYACGHGA-DCGAIQPGATCFAPDTKAAHASYAFNDYYQRKG  545

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCE  293
            R  GTC F GA  VV Q P  G+C+
Sbjct  546  RASGTCDFAGAASVVYQQPA-GACD  569



>ref|XP_004968994.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X2 
[Setaria italica]
Length=536

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 215/451 (48%), Positives = 286/451 (63%), Gaps = 41/451 (9%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +  +G++YGR+A+DLP PAKV QLLK  GIT V++YD    VL +L+ +GI   V +PNE
Sbjct  26    ASEVGVSYGRVANDLPDPAKVTQLLKDNGITMVRIYDAKQEVLRSLANTGIKVMVMVPNE  85

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              ++ AA + S+  +WV+ N+  Y   + I  VAVGNEVF    + T  LVPAM NV A+L
Sbjct  86    NIAEAARNPSYALQWVRDNVKAYYPATQIHGVAVGNEVFDSRPDLTRQLVPAMTNVQAAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+A +VKVS+PI F+A++ ++PPS G FK E+  PV+KPML FL++TGS+L +N YP
Sbjct  146   AQLGLADAVKVSTPIAFTAVENTFPPSRGRFKDEIAEPVMKPMLQFLKRTGSYLTMNMYP  205

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             F+AY      I+LDYA+   N GV D +  L Y +L DA+ DA ++A++ + PG   + +
Sbjct  206   FWAYYNQPHDINLDYALGNSNPGVPDDDTSLKYYNLLDAERDAAHSAMDDLVPG-VSLSL  264

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGG-GTPL  725
             +E+ WP  G  +                          NA AY  NL+ RVLTG  GTPL
Sbjct  265   TETNWPPHGKPHHGG-------------------GHRANAQAYVNNLINRVLTGNTGTPL  305

Query  724   RPDEPLSVYLFSLFNENQK-SGPIS-ERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP  551
             RP+ PL VY+F+LFNENQK  GP   E+N+GLFYPN QKVY       A   +GS A  P
Sbjct  306   RPNAPLDVYIFALFNENQKGDGPDDIEQNFGLFYPNMQKVY-------AFSFQGSGA--P  356

Query  550   P-----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
             P     +WCVAN  VG  RLQ ALD+AC  G ADCG IQPG++C+ P+T +AHASYAFNS
Sbjct  357   PGGQTASWCVANAAVGDSRLQAALDWACSHG-ADCGAIQPGASCFEPDTKLAHASYAFNS  415

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             YYQ+N +  G+C F GA  VV Q P   S +
Sbjct  416   YYQRNNKASGSCDFAGAASVVYQEPSMCSAK  446


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ AL++AC  GA DC   QPG+ C+ PNT VAHAS+AFNSYYQ+  
Sbjct  448  SWCVANAAVGDGRLQAALNWACSNGA-DCSDTQPGAACFEPNTKVAHASHAFNSYYQRKH  506

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GA  VV + PR G+C  P+
Sbjct  507  RASGTCDFAGAASVVYEEPRIGNCALPS  534



>ref|NP_001059886.2| Os07g0539400 [Oryza sativa Japonica Group]
 gb|EAZ40149.1| hypothetical protein OsJ_24593 [Oryza sativa Japonica Group]
 dbj|BAF21800.2| Os07g0539400 [Oryza sativa Japonica Group]
Length=561

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 214/448 (48%), Positives = 277/448 (62%), Gaps = 23/448 (5%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             S + +G +G+ YGR ADDL  P  VV LLK  GITKV++YD D TVL +LS +GI   VA
Sbjct  22    SRTEAGEVGVCYGRDADDLMDPPAVVNLLKENGITKVRIYDADPTVLRSLSNTGIKVMVA  81

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPY---KSIIETVAVGNEVFVDPANTTPYLVPAMKN  1274
             LPN+ L++A   Q     WV++NIVPY    + I  VAVGNEVF    N TP L+PAMKN
Sbjct  82    LPNKDLASAGHDQGSALDWVKTNIVPYYNQGTQINGVAVGNEVFRQAPNLTPQLLPAMKN  141

Query  1273  VYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLM  1097
             V  +LA+ G+A  +KVS+PI F A+  S+P S G F+  +   V+ PM+ FL+QT S+LM
Sbjct  142   VQTALARLGLADIIKVSTPINFDAVNVSWPSSKGVFQDSIAQSVMSPMIDFLQQTNSYLM  201

Query  1096  LNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH  917
             +N YP+ A+  +  +IS DYA FG N GVVDP + + Y SLFDAQ+DAVY AIN V    
Sbjct  202   VNFYPYIAWANSKGQISRDYATFGPNAGVVDPWSHITYYSLFDAQLDAVYYAINQVSGDS  261

Query  916   FRVVISESGW-------PSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
              R  ++++ W       P K +       G+   +   A D E   A+  NA A+N  ++
Sbjct  262   VRASMAQTRWGHPTPRVPVKCSECGHPSGGQFRKLTTQA-DAEVDVATKANAQAFNNGII  320

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RR L G      PD  +SVY+F+LFNEN+K+G   ERN+GLFYPN  KVY+V        
Sbjct  321   RRALFGASG--MPD--VSVYIFALFNENKKAGASVERNFGLFYPNGTKVYEVDF------  370

Query  577   NRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
             + G       +WCVAN  VG  RLQ ALD+AC  G ADC  IQ G  C+ PNT+VAHAS+
Sbjct  371   HGGGICPTKASWCVANLAVGNSRLQAALDWACSNG-ADCSAIQQGKPCFEPNTMVAHASF  429

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             AFN YYQ+  +  GTC F GA Y+V QP
Sbjct  430   AFNDYYQRMGQANGTCDFAGAAYIVFQP  457


 Score =   116 bits (290),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WC+AN  VG  RLQ ALDYACG   ADC  IQPG+ C+ PNT VAHASYAFN YYQ+ 
Sbjct  466  PSWCIANPAVGDMRLQAALDYACGS-CADCSAIQPGARCFEPNTKVAHASYAFNDYYQRV  524

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C FGGAG +  Q P  G+C  P
Sbjct  525  GRVSGSCDFGGAGSITYQAPEIGNCVLP  552



>ref|NP_001061351.1| Os08g0244500 [Oryza sativa Japonica Group]
 dbj|BAD05183.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD05454.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF23265.1| Os08g0244500 [Oryza sativa Japonica Group]
 gb|EAZ42021.1| hypothetical protein OsJ_26572 [Oryza sativa Japonica Group]
Length=577

 Score =   385 bits (988),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 219/452 (48%), Positives = 278/452 (62%), Gaps = 32/452 (7%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             S + +G IG+ YGR A DL  P   V LLK+ GI+ V+++D D TVL A++ +GI   VA
Sbjct  22    SRTDAGEIGVCYGRDAKDLIDPPAAVSLLKANGISAVRIFDADPTVLAAMANTGIKVMVA  81

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPYKS---IIETVAVGNEVFVDPANTTPYLVPAMKN  1274
             +PN  L+AA         WV SN+ PY+S   +I  VAVGNEVF      T  LV AM+N
Sbjct  82    IPNADLAAAGQDLRSATDWVASNVAPYRSRGTLISGVAVGNEVFRQRPELTGALVSAMRN  141

Query  1273  VYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLM  1097
             V+ +L    +A  VKVS+PI F A++ S PPS+G FK E+   V+KPM+ FL+QTGSF M
Sbjct  142   VHRALENLNLANDVKVSTPIAFDALKQSSPPSAGEFKDEIAQSVMKPMIDFLKQTGSFFM  201

Query  1096  LNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH  917
             +N YP++AY A  DKISL++A F  N GV+D N  + Y SLFDAQ+DAVYAAIN V  G 
Sbjct  202   VNLYPYFAYVAQPDKISLEFATFRPNAGVLDGNTDIRYFSLFDAQLDAVYAAINRVSGGS  261

Query  916   FRVVI-----------SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
               V +           SESG PS G    ++          AA D ++  A+  NA AYN
Sbjct  262   LTVSMARRDGILSVQASESGHPSGGRFPLSSM--------LAAADTDS-VATIANAQAYN  312

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
               L+RRV++ G + +R    +S Y+FSLFNEN+K GP  ERN+GLFYPN QKVY+V    
Sbjct  313   NGLIRRVVS-GASGMR---DVSAYIFSLFNENEKPGPTIERNFGLFYPNGQKVYEVDFRG  368

Query  589   AALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
                   G       +WCVA  DVG   LQ ALD+ACG G ADC  IQ GS C+ PNTLVA
Sbjct  369   GGG---GGACPTKTSWCVARADVGSAALQSALDFACGNG-ADCSAIQQGSVCFEPNTLVA  424

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             HASYAFN YYQ+  +  GTC F GA  +V +P
Sbjct  425   HASYAFNDYYQRKGQASGTCDFSGAASIVFKP  456


 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVA  +VG  RLQ ALDYACG   ADC  IQPG+ C++P+T VAHA+YAFN++YQ  
Sbjct  465  PSWCVAKSEVGDARLQNALDYACGS-CADCSAIQPGAQCFDPDTKVAHATYAFNNFYQTT  523

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C F GA  +V Q P+ G+C  P
Sbjct  524  GRASGSCDFAGAASIVNQQPKIGNCVLP  551



>dbj|BAC84505.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=583

 Score =   384 bits (985),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 275/444 (62%), Gaps = 23/444 (5%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +G+ YGR ADDL  P  VV LLK  GITKV++YD D TVL +LS +GI   VALPN+
Sbjct  48    AGEVGVCYGRDADDLMDPPAVVNLLKENGITKVRIYDADPTVLRSLSNTGIKVMVALPNK  107

Query  1432  QLSAAAASQSFTDRWVQSNIVPY---KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYAS  1262
              L++A   Q     WV++NIVPY    + I  VAVGNEVF    N TP L+PAMKNV  +
Sbjct  108   DLASAGHDQGSALDWVKTNIVPYYNQGTQINGVAVGNEVFRQAPNLTPQLLPAMKNVQTA  167

Query  1261  LAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAY  1085
             LA+ G+A  +KVS+PI F A+  S+P S G F+  +   V+ PM+ FL+QT S+LM+N Y
Sbjct  168   LARLGLADIIKVSTPINFDAVNVSWPSSKGVFQDSIAQSVMSPMIDFLQQTNSYLMVNFY  227

Query  1084  PFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVV  905
             P+ A+  +  +IS DYA FG N GVVDP + + Y SLFDAQ+DAVY AIN V     R  
Sbjct  228   PYIAWANSKGQISRDYATFGPNAGVVDPWSHITYYSLFDAQLDAVYYAINQVSGDSVRAS  287

Query  904   ISESGW-------PSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVL  746
             ++++ W       P K +       G+   +   A D E   A+  NA A+N  ++RR L
Sbjct  288   MAQTRWGHPTPRVPVKCSECGHPSGGQFRKLTTQA-DAEVDVATKANAQAFNNGIIRRAL  346

Query  745   TGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGS  566
              G      PD  +SVY+F+LFNEN+K+G   ERN+GLFYPN  KVY+V        + G 
Sbjct  347   FGASG--MPD--VSVYIFALFNENKKAGASVERNFGLFYPNGTKVYEVDF------HGGG  396

Query  565   KAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
                   +WCVAN  VG  RLQ ALD+AC  G ADC  IQ G  C+ PNT+VAHAS+AFN 
Sbjct  397   ICPTKASWCVANLAVGNSRLQAALDWACSNG-ADCSAIQQGKPCFEPNTMVAHASFAFND  455

Query  385   YYQKNARGPGTCYFGGAGYVVTQP  314
             YYQ+  +  GTC F GA Y+V QP
Sbjct  456   YYQRMGQANGTCDFAGAAYIVFQP  479


 Score =   116 bits (290),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WC+AN  VG  RLQ ALDYACG   ADC  IQPG+ C+ PNT VAHASYAFN YYQ+ 
Sbjct  488  PSWCIANPAVGDMRLQAALDYACGS-CADCSAIQPGARCFEPNTKVAHASYAFNDYYQRV  546

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C FGGAG +  Q P  G+C  P
Sbjct  547  GRVSGSCDFGGAGSITYQAPEIGNCVLP  574



>ref|NP_001175238.1| Os07g0539300 [Oryza sativa Japonica Group]
 dbj|BAC84503.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAG89880.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93966.1| Os07g0539300 [Oryza sativa Japonica Group]
Length=577

 Score =   382 bits (980),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 215/448 (48%), Positives = 279/448 (62%), Gaps = 32/448 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G IG+ YGR A++L  P   V LLK+ GI+ V+++D D TVLDA++ +GI   VA+PN 
Sbjct  27    AGEIGVCYGRDANNLIDPPAAVSLLKANGISAVRIFDADQTVLDAMANTGIKVMVAIPNA  86

Query  1432  QLSAAAASQSFTDRWVQSNIVPYKS---IIETVAVGNEVFVDPANTTPYLVPAMKNVYAS  1262
              L+AA         WV +N+VPY+S   +I  VAVGNEVF      T  LV AM+N++ +
Sbjct  87    DLAAAGQDLRSATDWVTNNVVPYRSRGTLINGVAVGNEVFRQRPELTGMLVSAMRNLHKA  146

Query  1261  LAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAY  1085
             L    +A  VKVS+PI F A++ S PPS+G FK E+   V+KPM+ FL+QTGS+ M+N Y
Sbjct  147   LENLNLANDVKVSTPIAFDALKQSSPPSAGEFKDEIAQSVMKPMIDFLKQTGSYFMVNLY  206

Query  1084  PFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVV  905
             P++AY A  DKISL++A F  N GV+D N G+ Y SLFDAQ+DAVYAAIN V  G   V 
Sbjct  207   PYFAYVAQPDKISLEFATFRPNAGVLDGNTGIRYFSLFDAQLDAVYAAINRVSGGSLTVS  266

Query  904   I-----------SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +           SESG PS G     +          AA D ++  A+  +A AYN  L+
Sbjct  267   MARRDGILSVQASESGHPSGGTFPLFSM--------LAAADTDS-IATIADAQAYNNGLI  317

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RRV++ G + +R    +S Y+FSLFNEN+K GP  ERN+GLFYPN QKVY+V        
Sbjct  318   RRVVS-GASGMR---DVSAYIFSLFNENEKPGPAIERNFGLFYPNGQKVYEVDFRGGGG-  372

Query  577   NRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
               G       +WCVA  DVG   LQ ALD+ACG G ADC  I+ GS C+ PNTLVAHASY
Sbjct  373   --GGACPTKTSWCVARTDVGSAALQSALDFACGNG-ADCSAIRQGSVCFEPNTLVAHASY  429

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             AFN YYQ+  +  GTC F GA  +V +P
Sbjct  430   AFNDYYQRKGQASGTCNFSGAASIVFKP  457


 Score =   112 bits (281),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVA  +VG  +LQ ALDYACG   ADC  IQPG+ C++P+T VAHA+YAFN +YQ  
Sbjct  466  PSWCVAKSEVGDAQLQNALDYACGS-CADCSAIQPGARCFDPDTKVAHATYAFNDFYQTT  524

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C F GA  +V Q P+ G+C  P
Sbjct  525  GRASGSCDFAGAASIVNQQPKIGNCVLP  552



>ref|XP_003562972.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Brachypodium 
distachyon]
Length=562

 Score =   381 bits (979),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 222/499 (44%), Positives = 286/499 (57%), Gaps = 64/499 (13%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA      + + A+L L     +V+ +G +G++YG   D+L  P+ VV LLK  GIT V+
Sbjct  1     MALTGSLIVLLGATLTLLYFLGAVAEAGEVGVSYGTNGDNLMDPSAVVDLLKKNGITMVR  60

Query  1510  LYDTDSTVLDALSGSGISTTVALPNE-QLSAAAASQSFTDRWVQSNIVPY--KSIIETVA  1340
             +YDTDS VL AL  +GI T V + N+ +L+AAA   S+  +W ++N++PY   + I  V 
Sbjct  61    VYDTDSKVLTALKNTGIKTVVGIRNDMELAAAAGDPSWAVQWAKNNVLPYYPATDIRGVT  120

Query  1339  VGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKP  1160
             VGNEVF   +     LVPAMKNV A+L   G+A ++KV++P+ F A++TS+PPS G FK 
Sbjct  121   VGNEVFKQVSQLNLQLVPAMKNVQAALVSLGLADAIKVTTPVAFDALKTSFPPSQGEFKD  180

Query  1159  ELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVY  983
             ++  PV+ PML FLEQTGS+LM+N YP+Y Y +    I L+YA F  N GVVDP  GL Y
Sbjct  181   DIAQPVMSPMLDFLEQTGSYLMVNIYPYYTYTSQPGTIDLNYATFRPNDGVVDPVTGLRY  240

Query  982   KSLFDAQVDAVYAAINAV-----------------KPGHFRVVISESGWPSKGNRNAAAY  854
              SLFDAQ+DAVY+AI+ V                 +  H  VV  ESGW S         
Sbjct  241   SSLFDAQLDAVYSAIDNVQQQVASSNGAVGTMLRGRRRHVPVVTGESGWCS---------  291

Query  853   NGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTG------------GGTPLRPDEP  710
                        Y  ++  AS  NA A+N NL +R   G             GTP RPD  
Sbjct  292   -----------YCPQSVGASMENAQAFNNNLAKRAHFGSASSSSSLAVVSDGTPARPDAD  340

Query  709   LSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVAN  530
             +SVY+F+LFNENQK  P  E+N+GLFYP+ + VY V  +               +WCVA 
Sbjct  341   ISVYIFALFNENQK--PADEQNFGLFYPSGKPVYQVDFSGG------GGGGGTASWCVAR  392

Query  529   GDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTC  350
              DV   RLQ ALDYAC  G ADC  IQPG  CY PNT +AHASYAFN YYQ   R  GTC
Sbjct  393   RDVSDARLQAALDYACNNG-ADCSAIQPGKVCYEPNTKLAHASYAFNDYYQSKGRASGTC  451

Query  349   YFGGAGYVVTQPPRFGSCE  293
              F GA  +V Q P  G C+
Sbjct  452   DFSGAASIVYQQP--GICD  468


 Score =   124 bits (310),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG+G ADC  IQPG  C++P+T VAHASYAFN YYQ+N 
Sbjct  473  SWCVANAAVGDARLQAALDYACGKGRADCSAIQPGGRCFSPDTKVAHASYAFNDYYQRNG  532

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R   +C F GAG VV Q P+ G+C  P+
Sbjct  533  RSSKSCDFSGAGSVVYQQPKIGNCVLPS  560



>gb|EEE67336.1| hypothetical protein OsJ_24592 [Oryza sativa Japonica Group]
Length=604

 Score =   382 bits (982),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 215/448 (48%), Positives = 279/448 (62%), Gaps = 32/448 (7%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G IG+ YGR A++L  P   V LLK+ GI+ V+++D D TVLDA++ +GI   VA+PN 
Sbjct  54    AGEIGVCYGRDANNLIDPPAAVSLLKANGISAVRIFDADQTVLDAMANTGIKVMVAIPNA  113

Query  1432  QLSAAAASQSFTDRWVQSNIVPYKS---IIETVAVGNEVFVDPANTTPYLVPAMKNVYAS  1262
              L+AA         WV +N+VPY+S   +I  VAVGNEVF      T  LV AM+N++ +
Sbjct  114   DLAAAGQDLRSATDWVTNNVVPYRSRGTLINGVAVGNEVFRQRPELTGMLVSAMRNLHKA  173

Query  1261  LAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAY  1085
             L    +A  VKVS+PI F A++ S PPS+G FK E+   V+KPM+ FL+QTGS+ M+N Y
Sbjct  174   LENLNLANDVKVSTPIAFDALKQSSPPSAGEFKDEIAQSVMKPMIDFLKQTGSYFMVNLY  233

Query  1084  PFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVV  905
             P++AY A  DKISL++A F  N GV+D N G+ Y SLFDAQ+DAVYAAIN V  G   V 
Sbjct  234   PYFAYVAQPDKISLEFATFRPNAGVLDGNTGIRYFSLFDAQLDAVYAAINRVSGGSLTVS  293

Query  904   I-----------SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
             +           SESG PS G     +          AA D ++  A+  +A AYN  L+
Sbjct  294   MARRDGILSVQASESGHPSGGTFPLFSM--------LAAADTDS-IATIADAQAYNNGLI  344

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RRV++ G + +R    +S Y+FSLFNEN+K GP  ERN+GLFYPN QKVY+V        
Sbjct  345   RRVVS-GASGMR---DVSAYIFSLFNENEKPGPAIERNFGLFYPNGQKVYEVDFRGGGG-  399

Query  577   NRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
               G       +WCVA  DVG   LQ ALD+ACG G ADC  I+ GS C+ PNTLVAHASY
Sbjct  400   --GGACPTKTSWCVARTDVGSAALQSALDFACGNG-ADCSAIRQGSVCFEPNTLVAHASY  456

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             AFN YYQ+  +  GTC F GA  +V +P
Sbjct  457   AFNDYYQRKGQASGTCNFSGAASIVFKP  484


 Score =   112 bits (281),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVA  +VG  +LQ ALDYACG   ADC  IQPG+ C++P+T VAHA+YAFN +YQ  
Sbjct  493  PSWCVAKSEVGDAQLQNALDYACGS-CADCSAIQPGARCFDPDTKVAHATYAFNDFYQTT  551

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C F GA  +V Q P+ G+C  P
Sbjct  552  GRASGSCDFAGAASIVNQQPKIGNCVLP  579



>gb|EAZ04201.1| hypothetical protein OsI_26344 [Oryza sativa Indica Group]
Length=561

 Score =   380 bits (977),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 210/448 (47%), Positives = 277/448 (62%), Gaps = 23/448 (5%)
 Frame = -3

Query  1624  SVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVA  1445
             S + +G +G+ YGR  DDL  P  VV LLK  GITKV++YD D TVL +LS +GI   VA
Sbjct  22    SRTEAGEVGVCYGRDGDDLMDPPAVVNLLKENGITKVRIYDADPTVLRSLSNTGIKVMVA  81

Query  1444  LPNEQLSAAAASQSFTDRWVQSNIVPY---KSIIETVAVGNEVFVDPANTTPYLVPAMKN  1274
             LPN+ L++A   Q     WV++N+VPY    + I  VAVGNEVF    + TP LVPAMKN
Sbjct  82    LPNKDLASAGHDQGSALDWVKTNVVPYYNQGTQINGVAVGNEVFRQAPDLTPQLVPAMKN  141

Query  1273  VYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLM  1097
             V A+LA  G+A  +KVS+PI F A+  S+PPS   F+  +   V+ PM+ FL+QT S+LM
Sbjct  142   VQAALASLGLADIIKVSTPINFDAVNESFPPSKAVFQDNVAQSVMSPMIDFLQQTNSYLM  201

Query  1096  LNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGH  917
             +N YP+ A+  +  +IS  YA FG N GVVDP + + Y SLFDAQ+DAVY AIN V    
Sbjct  202   VNFYPYIAWANSKGQISRGYATFGPNAGVVDPWSRITYYSLFDAQLDAVYYAINQVSGDS  261

Query  916   FRVVISESGW-------PSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
              R  ++++ W       P +G+      +G+ + +   A D E   A+  NA A+N  ++
Sbjct  262   VRASMAQARWGHPTPRVPVEGSEGGHPSDGQLSKLTTQA-DAEVDVATKANAQAFNNGII  320

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             RR L G    L     +SVY+F+LFNEN+K+G   ERN+GLFYP+  KVY+V        
Sbjct  321   RRALFGASGMLD----VSVYIFALFNENKKAGASVERNFGLFYPDGTKVYEVDF------  370

Query  577   NRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASY  398
             + G       +WCVAN  VG  RLQ ALD+AC  G ADC  IQ G  C+ PNT+VAHAS+
Sbjct  371   HGGGICPTKASWCVANLAVGNSRLQAALDWACNNG-ADCSAIQQGKPCFEPNTMVAHASF  429

Query  397   AFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             AFN YYQ+  +  GTC F GA Y+V QP
Sbjct  430   AFNDYYQRMGQANGTCDFAGAAYIVYQP  457


 Score =   116 bits (290),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WC+AN  VG  RLQ ALDYACG   ADC  IQPG+ C+ PNT VAHASYAFN YYQ+ 
Sbjct  466  PSWCIANPAVGDMRLQAALDYACGS-CADCSAIQPGARCFEPNTKVAHASYAFNDYYQRV  524

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C FGGAG +  Q P  G+C  P
Sbjct  525  GRVSGSCDFGGAGSITYQAPEIGNCVLP  552



>dbj|BAJ90025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1010

 Score =   393 bits (1009),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 219/470 (47%), Positives = 289/470 (61%), Gaps = 15/470 (3%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA  RL  L I  +  L L+  S + +G +G+ YGR+ D+L  PA VVQLLK  GIT V+
Sbjct  453   MAHTRLLLLAILGA-SLPLIFFSSAEAGEVGVCYGRVGDNLMDPAAVVQLLKKNGITTVR  511

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             +YDTD  VL A++ +GI    ALPNE L++AA   S+  RW + N+ PY   + I  V V
Sbjct  512   VYDTDPAVLRAMANTGIKVVAALPNEMLASAAGDPSYALRWARINLAPYYPATDIRGVTV  571

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF      TP L+ AM+NV A+L   G+  +VKV++PI F A++ S+PPS  +F+ +
Sbjct  572   GNEVFQQAPQLTPQLLTAMRNVRAALVTLGLGDAVKVTTPIAFDALKVSFPPSRSAFRDD  631

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             +   V+ PML FLEQTGS+LM+N YP+Y Y    + I L+YA F  N GV+DP  GL Y 
Sbjct  632   IARSVMSPMLDFLEQTGSYLMVNIYPYYTYTFQPNVIDLNYATFRPNAGVIDPVTGLRYS  691

Query  979   SLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGP  800
             +LFDAQ+DAVY A++ ++     V+ +  G  S+G R+      K       +Y      
Sbjct  692   NLFDAQLDAVYYAMDNLESSAGSVLRTAVGTVSRGRRSQRVPT-KTGESGWCSYCPNMVG  750

Query  799   ASAVNAAAYNGNLVRRVLTG-GGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPN  623
             A+  NA A+N NL++RV +G  GTP RPD  +S Y+F+LFNEN+K  P  E+N+GLFYP+
Sbjct  751   ATKENAQAFNANLIKRVRSGNAGTPYRPDADVSAYIFALFNENKK--PADEQNFGLFYPD  808

Query  622   EQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
              Q VY V       G   +      +WCVAN  VG  RLQ ALDYAC  G ADC  IQPG
Sbjct  809   GQPVYPVD-----FGPSPAPGPAAGSWCVANPAVGDTRLQAALDYACSNG-ADCSAIQPG  862

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
               CY PNT+VAHASYAFN +YQ+  R  GTC F GA  +V Q P  G C+
Sbjct  863   KPCYEPNTMVAHASYAFNDFYQRKGRASGTCDFSGAASIVFQQPA-GICD  911


 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -3

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             +WCVAN   G  RLQ AL+YACG GA DC  IQPG  C++P+T VAHASYAFN +YQ+N 
Sbjct  915   SWCVANAAAGDARLQAALEYACGHGA-DCSAIQPGGRCFDPDTKVAHASYAFNDFYQRND  973

Query  367   RGPGTCYFGGAGYVVTQPPRFGSCEFPTGY  278
             R  G+C F GAG VV Q P+ G+C  P+ +
Sbjct  974   RANGSCTFNGAGSVVYQQPKIGNCVLPSSH  1003



>dbj|BAJ92697.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   379 bits (974),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 217/476 (46%), Positives = 283/476 (59%), Gaps = 53/476 (11%)
 Frame = -3

Query  1636  LLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGIS  1457
             +L  S + +G +G++YGRI ++L  PA VVQLLK  GIT V++YDTDSTVL A+  +GI 
Sbjct  17    MLFFSRAEAGEVGVSYGRIGNNLMDPASVVQLLKRNGITMVRVYDTDSTVLTAMKNTGIK  76

Query  1456  TTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPA  1283
               VA+PNE ++ AAA  ++  +W ++N+VPY   + I  V VGNEVF      T  L+PA
Sbjct  77    VVVAVPNENVAIAAADPNWAVQWAKNNLVPYYPATDIRGVTVGNEVFNQAKGLTSQLLPA  136

Query  1282  MKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGS  1106
             MKNV A+L   G++ ++KV++PI F+A++ S+PPS   F+ ++   V+ PM+ FLEQTGS
Sbjct  137   MKNVQAALTGLGLSNAMKVTTPIAFNALKKSFPPSESLFQDDIAQSVMSPMIDFLEQTGS  196

Query  1105  FLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVK  926
             +LM N YP+Y Y +  D I+L+YA F  N GVVD   G+ Y +LFDAQ+DAVY AI+ ++
Sbjct  197   YLMANIYPYYTYTSQPDTINLNYATFRPNDGVVDNRTGIRYDNLFDAQLDAVYYAIDNLR  256

Query  925   PG-------------HFR---VVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPAS  794
                            H R   VV  ESGW S                    Y  +   A+
Sbjct  257   ASSTKRTVEAMLRGTHRRSVPVVTGESGWCS--------------------YCPQAVGAT  296

Query  793   AVNAAAYNGNLVRRVLTGGGTPLRPD---------EPLSVYLFSLFNENQKSGPISERNY  641
               NA AYN NLV+ V +GG +              + +SVY+F+LFNEN K  P+ ERN+
Sbjct  297   KENAQAYNANLVKHVQSGGASTTYSSLAVGAGTAADDISVYIFALFNENDK--PVDERNF  354

Query  640   GLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADC  461
             GLF P+ Q VY V    A      S      +WCVAN  VG  RLQ ALDYAC  G ADC
Sbjct  355   GLFEPSGQPVYAVDFR-AGSSPSPSPGPTKSSWCVANAAVGDARLQAALDYACSNG-ADC  412

Query  460   GPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             G IQPG  CY PNT VAHASYAFN YYQ+  R  GTC F GAG +V Q P  G C+
Sbjct  413   GAIQPGKPCYEPNTKVAHASYAFNDYYQRKGRASGTCDFSGAGSIVYQQPA-GICD  467


 Score =   117 bits (294),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ+ALDYACG GA DC  IQ G+ C++P+T VAHASYAFN YYQ+NA
Sbjct  473  SWCVANAAVGDTRLQIALDYACGNGA-DCSAIQRGARCFDPDTKVAHASYAFNDYYQRNA  531

Query  367  RGPGTCYFGGAGYVVTQPPRFGSC  296
            R   +C F GAG +V Q P+ G+C
Sbjct  532  RSANSCNFNGAGSIVYQQPKIGNC  555



>ref|XP_004135678.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 ref|XP_004158423.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN66191.1| hypothetical protein Csa_1G575070 [Cucumis sativus]
Length=501

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/462 (42%), Positives = 276/462 (60%), Gaps = 27/462 (6%)
 Frame = -3

Query  1651  SLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALS  1472
             SLFL LL H   GS ++G+ YGR ADDLP+P KV QL+K   I  +++YD++  VL A +
Sbjct  15    SLFLILLGH-CQGS-NVGVCYGRNADDLPTPNKVAQLVKLHNIKYIRIYDSNIQVLKAFA  72

Query  1471  GSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTP  1298
              +G+   + +PN  L   A  QS  D W++++I+PY   + I  + VG EV   P N + 
Sbjct  73    NTGVELMIGVPNSDLLPFAQFQSNVDTWLKNSILPYYPATKITYITVGAEVTESPNNVSA  132

Query  1297  YLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLE  1118
              +VPAM NV   L K G+   +KVSS      +  S+PPS G+F       +KP+L FL 
Sbjct  133   LVVPAMNNVLTGLKKAGLHKKIKVSSTHSLGVLSRSFPPSVGAFSSNYASFLKPLLEFLA  192

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             +  S  M+N YP+YAY  + + +SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+
Sbjct  193   ENQSPFMINIYPYYAYRESPNNVSLDYALFESSNEVIDPNTGLLYTNMFDAQIDALYFAL  252

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
              A+     RV+++E+GWPSKG+    +                   A+  NA  YN NL+
Sbjct  253   MALNFRTIRVMVTETGWPSKGSPKETS-------------------ATPDNAQTYNTNLI  293

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             R V+   GTP RP E L VY+FSLFNEN+K G  SERN+GLFYP++  VY++  T  ++ 
Sbjct  294   RHVINNTGTPARPGEELDVYIFSLFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKSVV  353

Query  577   NRGSKAQVPPT----WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
             +  ++A    +    WC+A+       LQ ALD+ACG G  DC PIQP   C+ P+TLV+
Sbjct  354   DMTAQANSTASNGTAWCIASTKASDMDLQNALDWACGSGNVDCTPIQPSQPCFEPDTLVS  413

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             HASYAFNSY+Q+N      C FGG G  V Q P + +C + T
Sbjct  414   HASYAFNSYFQQNGATDVACGFGGNGVKVNQDPSYDTCLYAT  455



>ref|XP_008450796.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=501

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 277/463 (60%), Gaps = 27/463 (6%)
 Frame = -3

Query  1651  SLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALS  1472
             SLFL LL H   GS ++G+ YGR ADDLP+P KV QL+K   I  +++YD++  VL A +
Sbjct  15    SLFLILLGH-CQGS-NVGVCYGRNADDLPTPNKVAQLVKLHNIKYIRIYDSNIQVLKAFA  72

Query  1471  GSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTP  1298
              +G+   + +PN  L   A  QS  D W++++I+PY   + I  + VG EV   P N + 
Sbjct  73    NTGVELMIGVPNSDLLPFAQFQSNVDTWLKNSILPYYPATKITYITVGAEVTESPNNVSA  132

Query  1297  YLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLE  1118
              +VPAM NV A L K G+   +KVSS      +  S+PPS G+F       +KP+L FL 
Sbjct  133   LVVPAMNNVLAGLKKAGLHKKIKVSSTHSLGVLSRSFPPSVGAFSSNYASFLKPLLEFLA  192

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             +  S  M+N YP+YAY  + + +SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+
Sbjct  193   ENQSPFMINIYPYYAYRESPNNVSLDYALFESSNEVIDPNTGLLYTNMFDAQIDALYFAL  252

Query  937   NAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLV  758
              A+     RV+++E+GWPSKG+    +                   A+  NA  YN NL+
Sbjct  253   MALNFRTIRVMVTETGWPSKGSPKETS-------------------ATPDNAQTYNTNLI  293

Query  757   RRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG  578
             R V+   GTP RP E L VY+FSLFNEN+K G  SERN+GLFYP++  VY++  T  ++ 
Sbjct  294   RHVINNTGTPARPGEELDVYIFSLFNENRKPGLDSERNWGLFYPDQTSVYNLDFTGKSVV  353

Query  577   NRGSKAQVPPT----WCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVA  410
             +  ++A    +    WC+A+       LQ ALD+ACG G  DC PIQP   C+ P+TL++
Sbjct  354   DMTAQANNTASNGTAWCIASSKASDMDLQNALDWACGSGNVDCTPIQPSQPCFEPDTLLS  413

Query  409   HASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             HASYAFNSY+Q+N      C FGG G  V Q P + +C + T 
Sbjct  414   HASYAFNSYFQQNGATDVACGFGGNGVRVNQDPSYDNCLYATA  456



>ref|XP_008653187.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Zea mays]
Length=562

 Score =   376 bits (966),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 212/464 (46%), Positives = 286/464 (62%), Gaps = 13/464 (3%)
 Frame = -3

Query  1672  YSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDS  1493
             ++L +  +  + LL    + +G +G+NYG +A+DLP+PA VVQLLK  GIT VK+YD ++
Sbjct  3     FTLRLGTAFLVLLLFSCAAEAGEVGVNYGMVANDLPNPASVVQLLKQNGITMVKIYDANA  62

Query  1492  TVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFV  1319
             TVL +L+ +GI   V +PN+ L+ AA    +  +WVQ N+  Y  ++ I  VAVGNEVF 
Sbjct  63    TVLTSLANTGIKAMVMMPNQNLAHAARDPVYAAQWVQDNVKKYLPRTQINAVAVGNEVFD  122

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVI  1142
             DP      LVPAMKNV  +LA  G+A +VKVS+PI FSA++ S+PPS   F+ ++  PV+
Sbjct  123   DPNVDKMTLVPAMKNVQKALADLGLANAVKVSTPIAFSAVRDSFPPSGSRFRDDIAQPVM  182

Query  1141  KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQ  962
             KPML  L++TGSFL +N YP        D I LDYA+      V+D +N   Y SL DAQ
Sbjct  183   KPMLQLLQRTGSFLTVNIYPCLTQMQQPDDIPLDYALGNAQHAVLDGSNK--YYSLLDAQ  240

Query  961   VDAVYAAINAVKPGHFRVVISESGWPSKGN--RNAAAYNGKKAAVNAAAYDGETGP-ASA  791
             +DA + A+ A+  G+   V+ E+G P+KG   ++     G  ++      DG + P AS 
Sbjct  241   LDATHYAMEALGFGNVEAVLGETGCPNKGKIGKHRPPRRGVGSSRRRLLDDGGSEPEASV  300

Query  790   VNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQKSGPIS--ERNYGLFYPNE  620
              NA AYN  ++ RVL+G  GTP RP   + VY+F+LFNEN KS      E N+GLFYPN 
Sbjct  301   ANARAYNNYVINRVLSGNTGTPHRPRADMHVYIFALFNENNKSADPDDVENNFGLFYPNM  360

Query  619   QKVYDVPL-TLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
             QK+YD         G +        +WCVAN  VG +RLQ ALDYACG G ADC  IQP 
Sbjct  361   QKIYDFNFRGGGGGGGQPPAGPAAASWCVANAAVGDDRLQQALDYACGHG-ADCSAIQPS  419

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
              +C+ P+T +AHASYAF+SYYQ+N R    C F GA  +V Q P
Sbjct  420   GSCFEPDTKLAHASYAFDSYYQRNGRATSACDFSGAASIVYQAP  463


 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVA    G  +LQ ALDYACG GA DC  IQ G +C+ P+T+ AHASYAFNSYYQ+N
Sbjct  472  PSWCVAKPGAGGAQLQQALDYACGHGA-DCSAIQSGGSCFQPDTVAAHASYAFNSYYQRN  530

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             R    C F GAG +V Q P+ G+C  P+
Sbjct  531  GRARVACDFSGAGSIVYQQPKVGNCVLPS  559



>gb|AAD10386.1| beta-1,3-glucanase precursor [Oryza sativa Japonica Group]
Length=377

 Score =   369 bits (948),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 210/374 (56%), Positives = 260/374 (70%), Gaps = 29/374 (8%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA P      I A + L LL  S S +G++GINYGR+A+DLP+PA VVQL+K QGI +VK
Sbjct  1     MALPGGLRALILA-VALPLLFLSASEAGTVGINYGRVANDLPNPAAVVQLMKQQGIAQVK  59

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             LYDT+ TVL AL+ +GI   VALPNEQL AAA+  S+   WV+ N+  Y   + I+ +AV
Sbjct  60    LYDTEPTVLRALANTGIKVVVALPNEQLLAAASRPSYALAWVRRNVAAYYPATQIQGIAV  119

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPE  1157
             GNEVF    N T  LVPAM NV+A+LA+  +   VKVSSPI  +A+  SYPPS+G F+ +
Sbjct  120   GNEVFASAKNLTAQLVPAMTNVHAALARLSLDKPVKVSSPIALTALAGSYPPSAGVFRED  179

Query  1156  LI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYK  980
             L   V+KPML FL QTGS+LM+NAYPF+AY  NTD ISLDYA+F  N GV+D  +GL Y 
Sbjct  180   LAQAVMKPMLDFLAQTGSYLMVNAYPFFAYSGNTDVISLDYALFRPNAGVLDSGSGLKYY  239

Query  979   SLFDAQVDAVYAAINAVKPGHF---RVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
             SL DAQ+DAV+ A++  K G++   RVV+SE+GWPSKG+                    E
Sbjct  240   SLLDAQLDAVFTAVS--KLGNYNAVRVVVSETGWPSKGDAK------------------E  279

Query  808   TGPASAVNAAAYNGNLVRRVLTGGG-TPLRPDEPLSVYLFSLFNENQKSGPISERNYGLF  632
             TG A+A NAAAYNGNLVRRVL+G   TP RPD  + VYLF+LFNENQK GP SERNYG+F
Sbjct  280   TG-AAAANAAAYNGNLVRRVLSGNARTPRRPDADMDVYLFALFNENQKPGPTSERNYGVF  338

Query  631   YPNEQKVYDVPLTL  590
             YPN+QKVYDV   L
Sbjct  339   YPNQQKVYDVEFVL  352



>ref|XP_010249473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 276/470 (59%), Gaps = 38/470 (8%)
 Frame = -3

Query  1666  LCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTV  1487
             L +  S +  L R S     +IG+ YGR ADDLP+P KV QL+    I  V++YD++  V
Sbjct  12    LLVLLSFYTELCRAS-----TIGVCYGRNADDLPTPDKVAQLVHLHNIKYVRIYDSNIQV  66

Query  1486  LDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP  1313
             L A + +G+   + +PN  L   +  QS  D W+++NI+PY   + I  + VG EV   P
Sbjct  67    LKAFANTGVELMIGIPNSDLLPFSQFQSNADTWLRNNIMPYYPATKITYITVGAEVTESP  126

Query  1312  ANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPM  1133
              N +  ++PAM+NV+ +L K G+   +KVSS      +  S+PPS+G+F P+    +KPM
Sbjct  127   TNISALVIPAMRNVHTALKKAGLHKKIKVSSTHSLGVLSRSFPPSAGAFDPKHAFFLKPM  186

Query  1132  LSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDA  953
             L FL +  S  M++ YP+YAY  +  K+SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA
Sbjct  187   LEFLAENESPFMVDIYPYYAYRDSPTKVSLDYALFESSSEVIDPNTGLLYTNMFDAQIDA  246

Query  952   VYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAY  773
             +Y A+ A+     +++++E+GWPSKG+    A                   A+  NA  Y
Sbjct  247   LYFALMALNFRTIKIMVTETGWPSKGSPKETA-------------------ATPDNAQTY  287

Query  772   NGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT  593
             N NL+R V+   GTP +P E L VY+FSLFNEN+K G  SERN+GLFYP++  VY V LT
Sbjct  288   NSNLIRHVVNDTGTPAKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSVYSVDLT  347

Query  592   LAALGNRG----SKAQVPP---TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTC  434
                   RG    ++A +     TWC+A+       LQ ALD+ CG G  DC  IQP   C
Sbjct  348   -----GRGAVDITEANITSSNGTWCIASSTASELDLQNALDWTCGPGNVDCSAIQPSQAC  402

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             Y P+TLV+HAS+AFNSYYQ+N      C FGG G    + P + +C + T
Sbjct  403   YQPDTLVSHASFAFNSYYQQNGATDVACSFGGTGVKTNKNPSYDNCLYMT  452



>ref|XP_008653186.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform X1 
[Zea mays]
 tpg|DAA63002.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=647

 Score =   376 bits (966),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 212/464 (46%), Positives = 286/464 (62%), Gaps = 13/464 (3%)
 Frame = -3

Query  1672  YSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDS  1493
             ++L +  +  + LL    + +G +G+NYG +A+DLP+PA VVQLLK  GIT VK+YD ++
Sbjct  3     FTLRLGTAFLVLLLFSCAAEAGEVGVNYGMVANDLPNPASVVQLLKQNGITMVKIYDANA  62

Query  1492  TVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFV  1319
             TVL +L+ +GI   V +PN+ L+ AA    +  +WVQ N+  Y  ++ I  VAVGNEVF 
Sbjct  63    TVLTSLANTGIKAMVMMPNQNLAHAARDPVYAAQWVQDNVKKYLPRTQINAVAVGNEVFD  122

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVI  1142
             DP      LVPAMKNV  +LA  G+A +VKVS+PI FSA++ S+PPS   F+ ++  PV+
Sbjct  123   DPNVDKMTLVPAMKNVQKALADLGLANAVKVSTPIAFSAVRDSFPPSGSRFRDDIAQPVM  182

Query  1141  KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQ  962
             KPML  L++TGSFL +N YP        D I LDYA+      V+D +N   Y SL DAQ
Sbjct  183   KPMLQLLQRTGSFLTVNIYPCLTQMQQPDDIPLDYALGNAQHAVLDGSNK--YYSLLDAQ  240

Query  961   VDAVYAAINAVKPGHFRVVISESGWPSKGN--RNAAAYNGKKAAVNAAAYDGETGP-ASA  791
             +DA + A+ A+  G+   V+ E+G P+KG   ++     G  ++      DG + P AS 
Sbjct  241   LDATHYAMEALGFGNVEAVLGETGCPNKGKIGKHRPPRRGVGSSRRRLLDDGGSEPEASV  300

Query  790   VNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQKSGPIS--ERNYGLFYPNE  620
              NA AYN  ++ RVL+G  GTP RP   + VY+F+LFNEN KS      E N+GLFYPN 
Sbjct  301   ANARAYNNYVINRVLSGNTGTPHRPRADMHVYIFALFNENNKSADPDDVENNFGLFYPNM  360

Query  619   QKVYDVPL-TLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
             QK+YD         G +        +WCVAN  VG +RLQ ALDYACG G ADC  IQP 
Sbjct  361   QKIYDFNFRGGGGGGGQPPAGPAAASWCVANAAVGDDRLQQALDYACGHG-ADCSAIQPS  419

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
              +C+ P+T +AHASYAF+SYYQ+N R    C F GA  +V Q P
Sbjct  420   GSCFEPDTKLAHASYAFDSYYQRNGRATSACDFSGAASIVYQAP  463


 Score =   109 bits (273),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DC  IQPG  C+ P+   +HASYAFN YYQ+N 
Sbjct  558  SWCVANPGVGDARLQTALDYACGHGA-DCRAIQPGGACFQPDNKASHASYAFNGYYQRNN  616

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R    C F GAG +V Q P+ G+C  P+
Sbjct  617  RARVACDFSGAGSIVYQQPKVGNCVLPS  644


 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVA    G  +LQ ALDYACG GA DC  IQ G +C+ P+T+ AHASYAFNSYYQ+N
Sbjct  472  PSWCVAKPGAGGAQLQQALDYACGHGA-DCSAIQSGGSCFQPDTVAAHASYAFNSYYQRN  530

Query  370  ARGPGTCYFGGAGYVVTQPPRF  305
             R    C F GAG +V Q P F
Sbjct  531  GRARVACDFSGAGSIVYQQPSF  552



>gb|KDP33779.1| hypothetical protein JCGZ_07350 [Jatropha curcas]
Length=499

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 279/466 (60%), Gaps = 28/466 (6%)
 Frame = -3

Query  1660  IFA-SLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVL  1484
             IFA SL L+LL +   GS +IG+ YGR ADDLP+P KV QL++   I  +++YD++  VL
Sbjct  8     IFAVSLLLTLLVY-CRGS-TIGVCYGRNADDLPTPDKVAQLVRQHNIKYLRIYDSNIQVL  65

Query  1483  DALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA  1310
              A + +G+   V +PN  L A +  QS  D W++++I+PY   + I  + VG EV     
Sbjct  66    KAFANTGVELMVGVPNSDLLALSQFQSNADSWLRNSILPYYPATKITYITVGAEVTESTN  125

Query  1309  NTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPML  1130
             N +  +VPAM NV  +L K G+   +KVSS      +  S+PPS+G+F       +KPML
Sbjct  126   NASAQVVPAMHNVLTALRKVGLHKKIKVSSTHSLGILSRSFPPSAGAFNSSHAYFLKPML  185

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL +  S  M++ YP+YAY  + + ISLDYAVF  +  V+DPN GL+Y ++FDAQ+DA+
Sbjct  186   EFLAENQSPFMIDIYPYYAYRDSPNNISLDYAVFESSSEVIDPNTGLLYTNMFDAQIDAL  245

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             Y A+ A+     +V+++E+GWPSKG+    A                   A+  NA  YN
Sbjct  246   YFALMALNFRTIKVMVTETGWPSKGSTKEKA-------------------ATPENAQTYN  286

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT-  593
              NL+R V+   GTP +P E L VY+FSLFNEN+K G  SERN+GLFYP++  +Y++  T 
Sbjct  287   TNLIRHVINNAGTPAKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSIYNLDFTG  346

Query  592   ---LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPN  422
                +    N    +    TWC+A+ +     LQ ALD+ACG G  DC  IQP   C+ P+
Sbjct  347   RGVIDIPKNTNLTSLNSTTWCIASSNASQLDLQSALDWACGPGNVDCSAIQPSQPCFEPD  406

Query  421   TLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             TL++HASYAFNSYYQ+N      C FGGAG  V + P + +C + T
Sbjct  407   TLLSHASYAFNSYYQQNGASDVACSFGGAGVKVDKDPSYDNCLYMT  452



>ref|XP_003569762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/448 (43%), Positives = 275/448 (61%), Gaps = 29/448 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G  GI YGR ADDLP+P KVVQL++ Q I  V++YDT+  V+ A + +G+   V +PN  
Sbjct  26    GKTGICYGRNADDLPAPDKVVQLIQKQSIKHVRIYDTNIDVIKAFANTGVELMVGVPNAD  85

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L A A  QS  D W++++I+PY   ++I  + VG E+   P N +  +VPAM+NV+ +L 
Sbjct  86    LLAFAQYQSNVDTWLKNSILPYYPATMITYITVGAEITESPVNVSALVVPAMRNVHTALK  145

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFY  1076
             K G+   + +SS      +  S+PPS+G+F     P +KPML FL +  +  M++ YP+Y
Sbjct  146   KVGLHKKITISSTHSLGILSRSFPPSAGAFNSSYAPFLKPMLEFLLENQAPFMVDLYPYY  205

Query  1075  AYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             AY+ +   +SL+YA+F   +QGV+DPN GLVY ++FDAQVD+++ A+ A+     +++I+
Sbjct  206   AYQNSPSNVSLNYALFSTQSQGVIDPNTGLVYTNMFDAQVDSIFFALMALNFKTLKIMIT  265

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG               AA    ETG A+  NA  YN NL+R V+   GTP +P
Sbjct  266   ETGWPNKG---------------AAK---ETG-ATTDNAQTYNTNLIRHVVNDSGTPAKP  306

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR-----GSKAQV  554
              E + VY+FSLFNEN+K G  SERN+GLF P++  +Y   L  +  GN      G+    
Sbjct  307   GEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYS--LDWSGRGNVDIMTGGNLTNS  364

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               TWCVA+ +V    LQ  L++ACG G  DC  IQP   CY P+TLV+HASYAFNSYYQ+
Sbjct  365   NGTWCVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQ  424

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             N      C FGGAG   T+ P + +C +
Sbjct  425   NGANDVACGFGGAGVRTTKDPSYDTCVY  452



>ref|XP_010232285.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 isoform X2 [Brachypodium 
distachyon]
Length=497

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/448 (43%), Positives = 275/448 (61%), Gaps = 29/448 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G  GI YGR ADDLP+P KVVQL++ Q I  V++YDT+  V+ A + +G+   V +PN  
Sbjct  26    GKTGICYGRNADDLPAPDKVVQLIQKQSIKHVRIYDTNIDVIKAFANTGVELMVGVPNAD  85

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L A A  QS  D W++++I+PY   ++I  + VG E+   P N +  +VPAM+NV+ +L 
Sbjct  86    LLAFAQYQSNVDTWLKNSILPYYPATMITYITVGAEITESPVNVSALVVPAMRNVHTALK  145

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFY  1076
             K G+   + +SS      +  S+PPS+G+F     P +KPML FL +  +  M++ YP+Y
Sbjct  146   KVGLHKKITISSTHSLGILSRSFPPSAGAFNSSYAPFLKPMLEFLLENQAPFMVDLYPYY  205

Query  1075  AYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             AY+ +   +SL+YA+F   +QGV+DPN GLVY ++FDAQVD+++ A+ A+     +++I+
Sbjct  206   AYQNSPSNVSLNYALFSTQSQGVIDPNTGLVYTNMFDAQVDSIFFALMALNFKTLKIMIT  265

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG               AA    ETG A+  NA  YN NL+R V+   GTP +P
Sbjct  266   ETGWPNKG---------------AAK---ETG-ATTDNAQTYNTNLIRHVVNDSGTPAKP  306

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR-----GSKAQV  554
              E + VY+FSLFNEN+K G  SERN+GLF P++  +Y   L  +  GN      G+    
Sbjct  307   GEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYS--LDWSGRGNVDIMTGGNLTNS  364

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               TWCVA+ +V    LQ  L++ACG G  DC  IQP   CY P+TLV+HASYAFNSYYQ+
Sbjct  365   NGTWCVASTNVSETALQNGLNWACGPGNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQ  424

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             N      C FGGAG   T+ P + +C +
Sbjct  425   NGANDVACGFGGAGVRTTKDPSYDTCVY  452



>gb|EMT15518.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=530

 Score =   370 bits (950),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 281/472 (60%), Gaps = 35/472 (7%)
 Frame = -3

Query  1678  RLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDT  1499
             R ++  + A LFL L+ H     G  GI YGR ADDLP P KV QL++ Q I  V++YDT
Sbjct  3     RRHAAAVSAFLFLLLVGHC--HGGKTGICYGRNADDLPGPDKVAQLIRQQSIKYVRIYDT  60

Query  1498  DSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEV  1325
             +  V+ A + + +   V +PN  L A +  QS  D W++++I+PY   +II  + VG E+
Sbjct  61    NIDVIKAFANTSVELMVGVPNADLLAFSQYQSNVDTWLKNSILPYYPATIITYITVGAEI  120

Query  1324  FVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPV  1145
                P N +  +VPAM+NV+A+L K G+   + +SS      +  S+PPS+G+F       
Sbjct  121   TESPINVSALVVPAMRNVHAALKKVGLHKKITISSTHSLGVLSRSFPPSAGAFNSSYAHF  180

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFD  968
             +KPML FL +  +  M++ YP+YAY+ +   +SL+YA+F   ++GV+DPN GLVY ++FD
Sbjct  181   LKPMLEFLVENQAPFMVDLYPYYAYQNSPSNVSLNYALFSPQSEGVIDPNTGLVYTNMFD  240

Query  967   AQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAV  788
             AQVD+++ A+ A+     +++I+E+GWP KG                     ETG A+  
Sbjct  241   AQVDSIFFALMALNFKTLKIMITETGWPHKGAAK------------------ETG-ATPD  281

Query  787   NAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVY  608
             NA  YN NL+R V+   GTP +P E + VY+FSLFNEN+K G  SERN+GLF P++  +Y
Sbjct  282   NAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIY  341

Query  607   DVPLT------LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQP  446
              +  T      +   GNR +      TWCVA+ +V    LQ  L++ACG G  DC  IQP
Sbjct  342   SIDWTGRGNVDIMTGGNRSNG-----TWCVASTNVSETALQNGLNWACGPGNVDCSAIQP  396

Query  445   GSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
                CY P+TLV+HASYAFNSYYQ+N      C FGGAG   T+ P + +C +
Sbjct  397   SQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCVY  448



>dbj|BAJ93567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   371 bits (952),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 215/487 (44%), Positives = 281/487 (58%), Gaps = 60/487 (12%)
 Frame = -3

Query  1672  YSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDS  1493
             + L +   + + LL    +  G +G+ YGR+A +LP P  VVQL+K  GIT V++YDT+ 
Sbjct  12    HLLAVLLGIAVPLLFSPRAEGGEVGVCYGRMAGNLPDPTSVVQLIKRNGITMVRIYDTNP  71

Query  1492  TVLDALSGSGISTTVALPNEQLSAAAASQS-FTDRWVQSNIVPY--KSIIETVAVGNEVF  1322
             TVL AL+ + I  TV L NE+L   AA ++ F  RWVQSN+  Y   ++I  V +GNEVF
Sbjct  72    TVLAALANTDIKVTVELTNEELPLVAADENDFAFRWVQSNVKAYYPATLINGVTIGNEVF  131

Query  1321  VDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPEL-IPV  1145
              +       LVPAMK V+A+L + G+A +VKV++PI F A+ TS+PPS G+F+ ++ + V
Sbjct  132   KEAPQLNSQLVPAMKKVHAALDRLGLADAVKVTTPIAFDALMTSFPPSKGAFRDDIALSV  191

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
             + PM+ FL+QT S+LM+N YP+ AY +  D +S+DY +F  N GV D N+G  Y SL DA
Sbjct  192   MSPMVDFLKQTRSYLMVNIYPYLAYLSTPD-MSIDYLLFRPNAGVHDRNSGQTYYSLLDA  250

Query  964   QVDAVYAAINAVKPGHFR-------------VVISESGWPSKGNRNAAAYNGKKAAVNAA  824
             Q+DAVY A++ +     R             V   E   PSKG+R               
Sbjct  251   QLDAVYYAMDKLPSSSLRGMRKLTSLDEDVLVTCGEIHHPSKGHR---------------  295

Query  823   AYDGETGPASAVNAAAYNGNLVRRVLTGG----------GTPLRPDEPLSVYLFSLFNEN  674
                   G  +  NA A+   L+ +VL GG          GTP RP+  LSVY+F LFNEN
Sbjct  296   ------GVGTLANAQAFTDGLLSKVLGGGNSDPLATSAVGTPHRPNADLSVYIFELFNEN  349

Query  673   QKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVAL  494
              K  P  E+++GLFYPNEQ VY V       G   S       +CVA    G   LQ AL
Sbjct  350   NK--PEDEQDFGLFYPNEQPVYPVDFVHGGAGTGES-------YCVAKATAGDAALQAAL  400

Query  493   DYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             DYACG GA DCG IQPG  CY PNT +AHASYAFN YYQKN R    C FGGAG +V Q 
Sbjct  401   DYACGHGA-DCGAIQPGKPCYEPNTKLAHASYAFNDYYQKNGRASSACDFGGAGTIVNQA  459

Query  313   PRFGSCE  293
             P  G C+
Sbjct  460   PS-GRCD  465


 Score =   125 bits (314),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG ERLQ ALDYACG GA DC  IQPG+ C+NP+T VAHAS+AFN YYQ++ 
Sbjct  469  SWCVANSAVGAERLQRALDYACGHGA-DCTDIQPGARCFNPDTKVAHASFAFNDYYQRHG  527

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GAG +V Q P+ G+C  P+
Sbjct  528  RAAGTCDFAGAGTIVRQAPKIGNCVLPS  555



>ref|XP_004968992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Setaria italica]
Length=541

 Score =   370 bits (950),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 213/468 (46%), Positives = 290/468 (62%), Gaps = 30/468 (6%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             MA  R   + +  +   +LL  S   +G +G++YGR+AD+LP P  VVQLL+  GIT V+
Sbjct  1     MALARFLLVLVLGA---TLLFSSAEAAG-VGVSYGRVADNLPDPGSVVQLLQHNGITMVR  56

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAV  1337
             +YDT+  VL +L+ +GI   V +PNE L+ AA + S+   WV++N+  +   + I  ++V
Sbjct  57    IYDTNPQVLTSLANTGIKVMVMVPNENLADAARNPSYALEWVRTNVAAFLPATKIHGISV  116

Query  1336  GNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQT-SYPPSSGSFKP  1160
             GNEVF   ++    LVPAM NV+ +L K G+  +VKV++P+ F A++  ++PPS+G FK 
Sbjct  117   GNEVFKWRSDLNLQLVPAMTNVHDALVKLGLTDAVKVTTPVAFDALKDPTFPPSAGRFKD  176

Query  1159  ELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTD--KISLDYAVFGDNQGVVDPNNGL  989
             E+   V+KPML FL++T S+L +N YPF AY AN     ISLDYA+   N GV + + G 
Sbjct  177   EIAQSVMKPMLQFLQKTSSYLTMNIYPFLAY-ANQQPGTISLDYALGNPNTGVSEVDAGP  235

Query  988   VYKSLFDAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGE  809
              Y SL DAQ+DA Y A+  +      + ++ESGWPS+G      + G +  ++    D  
Sbjct  236   TYTSLLDAQLDATYYAMEGLGFPDVSLYVTESGWPSRG----VIHRGGRRLLDTG--DDG  289

Query  808   TGPASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNENQKSGPIS-ERNYGL  635
             +  AS  NA AYN NL++RVL+G  GTP RPD  + VY+F+LFNE+ K  P   E  +GL
Sbjct  290   SEAASVANAQAYNDNLIKRVLSGKTGTPHRPDADMDVYIFALFNEDNKGSPDDVEAYFGL  349

Query  634   FYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGP  455
             F  N +KVY+          +G+ A    +WCVAN  VG  RLQ ALDYACG G ADC  
Sbjct  350   FDHNMKKVYEFSF-------QGAPAA---SWCVANAAVGDARLQAALDYACGNG-ADCDA  398

Query  454   IQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPP  311
             IQPG TC+ PNT VAHASYAFNSYYQ   R  GTC F GA  VV Q P
Sbjct  399   IQPGETCFQPNTKVAHASYAFNSYYQNKGRAAGTCDFNGAASVVYQAP  446


 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG   LQ AL+YACG GA DC  IQPG+ C+ PNT VAHASYAFNSYYQ N 
Sbjct  452  SWCVANASVGDAWLQSALEYACGHGA-DCSAIQPGAACFEPNTKVAHASYAFNSYYQYNG  510

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFP  287
            R  GTC F GAG VV QP + G+C  P
Sbjct  511  RANGTCDFNGAGSVVYQPQKIGNCVLP  537



>gb|EPS64814.1| hypothetical protein M569_09966 [Genlisea aurea]
Length=341

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 256/363 (71%), Gaps = 27/363 (7%)
 Frame = -3

Query  1675  LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTD  1496
             + SL  F  LFL     S + +  IG+NYGR+AD+LPS  +V  LLK+ G+T+VK+YDTD
Sbjct  1     MKSLINFVLLFLI----SSAAATPIGVNYGRVADNLPSAFRVSNLLKTVGVTRVKIYDTD  56

Query  1495  STVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPYKSI-IETVAVGNEVFV  1319
             +TVL+A  G+GIS  V LPN++L  AA SQ+FTD W+++NI+PY++  I  +A+GNEVF 
Sbjct  57    ATVLNAFGGTGISVIVCLPNDKLGLAAGSQTFTDNWIRANILPYRATWITAIAIGNEVFS  116

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPEL-IPVI  1142
             DPAN   +LV AM+N++ASL + G+   +KVSSP+    +Q+SYPPS+G+FK ++ + VI
Sbjct  117   DPANLG-FLVSAMENMHASLVRLGLDSRIKVSSPVPLDVLQSSYPPSAGAFKSDVALSVI  175

Query  1141  KPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQ-GVVDPNNGLVYKSLFDA  965
              PML  + +TGS+ M+N YPF+AY AN+ +ISLDYA+   N   VVDP   LVY +LFDA
Sbjct  176   APMLGIMRRTGSYFMVNIYPFFAYSANSRQISLDYALGNPNAPHVVDPKTNLVYTNLFDA  235

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             QVDAVYAA+ A+  G   ++++E+GWPS G+ N                  E G A   N
Sbjct  236   QVDAVYAAMAALGFGDVNIMVTETGWPSAGDPN------------------EIG-AGLNN  276

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             AAAY+GNL RRVL G GTP+RP  PL VYLF+LFNE++K GP SERNYGLFYP+ ++V++
Sbjct  277   AAAYDGNLARRVLAGSGTPMRPHTPLDVYLFALFNEDRKPGPTSERNYGLFYPDMRRVFN  336

Query  604   VPL  596
             +PL
Sbjct  337   IPL  339



>gb|EMT31770.1| Glucan endo-1,3-beta-glucosidase 13 [Aegilops tauschii]
Length=563

 Score =   370 bits (949),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 287/469 (61%), Gaps = 35/469 (7%)
 Frame = -3

Query  1633  LRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGIST  1454
             L  S++  G +G+ YGR+A DLP PA VVQLLK   IT V++YDTD TVL +L+ + I  
Sbjct  15    LLFSLAEGGEVGVCYGRVATDLPDPASVVQLLKKNSITMVRIYDTDPTVLRSLANTNIKV  74

Query  1453  TVALPNEQLSAAAASQ-SFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPA  1283
             TV L NE+L  AAA Q +F  RWVQSN+  Y   ++I  V +GNEVF + ++    LVPA
Sbjct  75    TVELTNEELPLAAADQNNFALRWVQSNVKAYYPATLINGVTIGNEVFKEASHLNSQLVPA  134

Query  1282  MKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPEL-IPVIKPMLSFLEQTGS  1106
             MKNV A+LAK G+A +VKV++PI F A++TS+PPS+G+FK ++ + V+ PM+ FL+QTGS
Sbjct  135   MKNVQAALAKLGLADAVKVTTPIAFDALKTSFPPSAGAFKDDIALSVMSPMVDFLQQTGS  194

Query  1105  FLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVK  926
             +LM+N YP+ AY  +T  +S++Y +F  N GV D  +G  Y SLFDA++DAVY A+  + 
Sbjct  195   YLMVNFYPYLAY-LDTPGMSINYLLFRPNNGVPDTVSGQTYFSLFDAELDAVYYAMEKLP  253

Query  925   P---------------GHFRVVISESGWPSKGNRNAAAYNGKK---AAVNAAAYDGETGP  800
                             G   V   E G P+KG++        +   A +      G +  
Sbjct  254   SSSMHVGGMRKLTAGGGSLDVHQGEHGHPNKGHKGVGTPQNAQDFMAGLTLQVLQGNSAT  313

Query  799   ASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNE  620
             A+A      NG+ +       GTP RP+  L+VY+F+LFNEN K  P  E+++GLFYPN+
Sbjct  314   AAA------NGHNLLAASAVRGTPHRPNADLNVYIFALFNENNK--PEDEQDFGLFYPNQ  365

Query  619   QKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
             Q VY  P+     G  G   Q   ++CVAN  VG   LQ ALDYACG G ADC  IQ G 
Sbjct  366   QPVYPNPIDFVHGGTIGGPLQA--SYCVANAAVGDVALQAALDYACGNG-ADCSAIQSGK  422

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
              CY PNT +AHASYAFN YYQKN R    C F GAG +V Q P  G+C+
Sbjct  423   PCYEPNTKLAHASYAFNDYYQKNGRVRSACDFSGAGTIVNQAPS-GACD  470


 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVAN  VG  RLQ ALDYACG+G ADC  IQPG+ C++P+T VAHAS+AFNSYYQ+ 
Sbjct  473  PSWCVANAAVGDTRLQAALDYACGRGGADCTDIQPGARCFDPDTKVAHASFAFNSYYQRR  532

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             R  GTC F GAG +V Q P+ G+C  P+
Sbjct  533  GRATGTCDFAGAGTIVRQAPKIGNCVLPS  561



>ref|XP_006658648.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Oryza brachyantha]
Length=562

 Score =   370 bits (949),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 211/483 (44%), Positives = 283/483 (59%), Gaps = 45/483 (9%)
 Frame = -3

Query  1690  MAFPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVK  1511
             M F  L    + A+  L L       +G +G+ YGR A+DL  P+ VV LLK  GIT V+
Sbjct  1     MTFTHLLRSLLLATA-LPLFSIYRVEAGEVGVCYGRDANDLMDPSAVVNLLKEHGITMVR  59

Query  1510  LYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY---KSIIETVA  1340
             +YD D  VL +LS  GI   VALPN  L++A   +     W+++ +VP+    + I  VA
Sbjct  60    IYDADQAVLGSLSNKGIKVMVALPNRDLASAGRDEGSALDWLETYVVPHYHRGTQINGVA  119

Query  1339  VGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKP  1160
             VGNEVF    + TP L+PAM+N+ A+LA+ G+A ++KVS+PI F +++ S+PPSS  F+ 
Sbjct  120   VGNEVFQQAPDLTPQLLPAMRNMQAALARLGLADAIKVSTPISFESVRASHPPSSAVFQD  179

Query  1159  ELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVY  983
              +   V++PM+ FLEQ  S+LM+N YP+ A   +   ISL+YA FG N GVVDPN+ + Y
Sbjct  180   SIAQSVMRPMIDFLEQIDSYLMVNFYPYIACAKSNGTISLEYATFGPNAGVVDPNSDITY  239

Query  982   KSLFDAQVDAVYAAINAVKP-------------GHFR----VVISESGWPSKGNRNAAAY  854
              SLFDAQ+DAVY AIN V               GH +    V  SE G PS         
Sbjct  240   YSLFDAQLDAVYYAINKVSSDSVRASMPQERVRGHLKSRVSVKCSECGHPS---------  290

Query  853   NGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNE  677
              G + ++     D E    +  NA A+N  ++RR L G  G P      +SVY+F+LFNE
Sbjct  291   -GGRLSMLTTQADAEEDVPTKANAQAFNNGIIRRALFGASGLP-----NVSVYIFALFNE  344

Query  676   NQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVA  497
             N+K+GP  ERN+GLFYPN  KVY+V        N GS   +  +WCVAN  +G  RLQ A
Sbjct  345   NEKAGPSVERNFGLFYPNGTKVYEVDF------NGGSVCPMKASWCVANYAIGNARLQSA  398

Query  496   LDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQ  317
             L +AC  G ADC  IQ G  C+ PNT+VAHASYAFN YYQ+  +    C F GA Y+V +
Sbjct  399   LSWACSNG-ADCSSIQQGKPCFEPNTIVAHASYAFNDYYQRMGQDDKACDFAGAAYIVYE  457

Query  316   PPR  308
             P +
Sbjct  458   PSK  460


 Score =   118 bits (296),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVAN  VG  RLQ ALDYACG   ADC  IQPG+ C+ P+T VAHASYAFN YYQ+ 
Sbjct  467  PSWCVANPAVGDARLQSALDYACGS-CADCSDIQPGARCFEPDTKVAHASYAFNDYYQRV  525

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C FGGAG +V Q P  G+C  P
Sbjct  526  GRASGSCDFGGAGSIVYQAPEIGNCVLP  553



>emb|CDM84006.1| unnamed protein product [Triticum aestivum]
Length=494

 Score =   367 bits (942),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/472 (41%), Positives = 281/472 (60%), Gaps = 35/472 (7%)
 Frame = -3

Query  1678  RLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDT  1499
             R ++  + A LFL L+ H     G  GI YGR ADDLP P KV QL++ Q I  V++YD+
Sbjct  3     RRHAAAVSAFLFLLLVGHC--HGGKTGICYGRNADDLPGPDKVAQLVRQQSIKYVRIYDS  60

Query  1498  DSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEV  1325
             +  V+ A + + +   V +PN  L A +  QS  D W++++I+PY   ++I  + VG E+
Sbjct  61    NVDVIKAFANTSVELMVGVPNADLLAFSQYQSNVDTWLKNSILPYYPATVITYITVGAEI  120

Query  1324  FVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPV  1145
                P N +  +VPAM+NV+A+L K G+   + +SS      +  S+PPS+G+F       
Sbjct  121   TESPINVSALVVPAMRNVHAALKKVGLHKKITISSTHSLGVLSRSFPPSAGAFNSSYAHF  180

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFD  968
             +KPML FL +  +  M++ YP+YAY+ +   +SL+YA+F   ++GV+DPN GLVY ++FD
Sbjct  181   LKPMLEFLVENQAPFMVDLYPYYAYQNSPSNVSLNYALFSPQSEGVIDPNTGLVYTNMFD  240

Query  967   AQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAV  788
             AQVD+++ A+ A+     +++I+E+GWP KG                     ETG A+  
Sbjct  241   AQVDSIFFALMALNFKTLKIMITETGWPHKGAAK------------------ETG-ATPD  281

Query  787   NAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVY  608
             NA  YN NL+R V+   GTP +P E + VY+FSLFNEN+K G  SERN+GLF P++  +Y
Sbjct  282   NAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIY  341

Query  607   DVPLT------LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQP  446
              +  T      +   GNR +      TWCVA+ +V    LQ  L++ACG G  DC  IQP
Sbjct  342   SIDWTGRGNVDIMTGGNRSNG-----TWCVASTNVSETALQNGLNWACGPGNVDCSAIQP  396

Query  445   GSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
                CY P+TLV+HASYAFNSYYQ+N      C FGGAG   T+ P + +C +
Sbjct  397   SQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCVY  448



>gb|KHG26459.1| hypothetical protein F383_04538 [Gossypium arboreum]
Length=488

 Score =   367 bits (941),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/446 (42%), Positives = 268/446 (60%), Gaps = 24/446 (5%)
 Frame = -3

Query  1603  IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLS  1424
             +G+ YGR ADDLP+P KVV+L+K   I  V++YD++  VL A + +G+   VA+PN  L 
Sbjct  10    VGVCYGRSADDLPTPDKVVELIKLHNIKYVRIYDSNIQVLKAFANTGVELMVAVPNSDLL  69

Query  1423  AAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKY  1250
             A +  QS  D W++++I+PY   + I  + VG EV   P N +  +VPAM NV  +L K 
Sbjct  70    AFSQFQSNADSWLKNSILPYYPATKITYITVGLEVTESPNNASALVVPAMHNVLTALKKA  129

Query  1249  GVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFYAY  1070
             G+   +KVSS      +  S+PPS+G+F       +KPML FL +  S  M++ YP+YAY
Sbjct  130   GLHKRIKVSSTHSLGVLSRSFPPSAGAFNSSHASFLKPMLEFLAENQSPFMIDLYPYYAY  189

Query  1069  EANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISESG  890
               +  K+SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+ A+     +V+++E+G
Sbjct  190   RDSPQKVSLDYALFESSSEVIDPNTGLLYTNMFDAQIDALYFALMALNFKTIKVMVTETG  249

Query  889   WPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEP  710
             WPSKG+                    E G A+  NA  YN NL+R VL   GTP +P E 
Sbjct  250   WPSKGSPK------------------EKG-ATPDNAQTYNTNLIRHVLNDTGTPTKPGEE  290

Query  709   LSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT---LAALGNRGSKAQVPPTWC  539
             L VY+FSLFNEN+K G  SERN+GLFYP++  +Y++  T   +  + N    ++   TWC
Sbjct  291   LDVYIFSLFNENRKPGLESERNWGLFYPDKTSIYNLDFTGKGVLDMTNSTDGSKNGTTWC  350

Query  538   VANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGP  359
             +A+       LQ A+D+ACG G  DC  IQP   C+ P+ L +HAS+AFNSYYQ+N    
Sbjct  351   IASSKASEADLQNAIDWACGPGNVDCSAIQPSQPCFEPDNLASHASFAFNSYYQQNGASD  410

Query  358   GTCYFGGAGYVVTQPPRFGSCEFPTG  281
               C FGG G  V + P + +C + T 
Sbjct  411   VACSFGGKGVKVDKDPSYDNCIYLTA  436



>ref|XP_003562973.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Brachypodium 
distachyon]
Length=548

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 206/446 (46%), Positives = 270/446 (61%), Gaps = 21/446 (5%)
 Frame = -3

Query  1612  SGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNE  1433
             +G +G++YGRI ++L  PA VVQLL   GIT +++YDTD  VL++++ +GI   V LPNE
Sbjct  25    AGEVGVSYGRIGNNLMDPASVVQLLNQNGITSIRVYDTDEAVLNSMANTGIKILVGLPNE  84

Query  1432  QLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
              +++AA   S+  RWVQ N+  +   + I  V VGNEVF   +  T  LVPAMKNV A+L
Sbjct  85    LVASAADDPSYALRWVQDNVKRHYPDAKINGVTVGNEVFNQASQLTSKLVPAMKNVQAAL  144

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLEQTGSFLMLNAYP  1082
             A+ G+A ++KV++PI  +A++ S PPS G+F+ ++   V+ PML FL+QTGS+LM+N YP
Sbjct  145   ARLGLADAIKVTTPIALNALKQSSPPSQGAFRDDIAQSVMSPMLDFLDQTGSYLMVNIYP  204

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFR--V  908
             +Y Y+      SL YA  G N GV+D   G+ Y SLFDAQ+ AV+ A    + GH R  V
Sbjct  205   YYTYKDQQGDFSLAYATSGQNDGVLDSGTGVRYYSLFDAQLAAVHYANR--RRGHPRVHV  262

Query  907   VISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNL-VRRVLTGGGT  731
             V+ E+GW S  N      N   +  NAA+Y      ++  ++    G +   R L  G  
Sbjct  263   VVGETGWCSYCN------NAVASKENAASYVNNVIRSTHSSSGGSAGTMGSNRTLAVGAA  316

Query  730   PLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP  551
                 +   SVY+F+LFNENQK  P  E+N+GLFYPN Q VY V          G      
Sbjct  317   GAGTNGDFSVYIFALFNENQK--PADEQNFGLFYPNGQAVYQVDFRGGGG---GGGGGGT  371

Query  550   PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
              +WCVA  DVG  RLQ ALDYACG G ADC  IQPG  CY PNT  AHASYAFN YYQ  
Sbjct  372   ASWCVARSDVGDARLQAALDYACGHG-ADCSAIQPGKACYEPNTKAAHASYAFNDYYQSK  430

Query  370   ARGPGTCYFGGAGYVVTQPPRFGSCE  293
              R  GTC F GA  VV Q P  G+C+
Sbjct  431   GRASGTCDFAGAASVVYQQPS-GTCD  455


 Score =   123 bits (308),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALDYACG GA DCG IQPG+ C++PNT VAHASYA N YYQ+N 
Sbjct  460  SWCVANAAVGDARLQAALDYACGHGA-DCGAIQPGAQCFDPNTKVAHASYAMNDYYQRNG  518

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R   +C FGGAG VV Q P  G+C  P+
Sbjct  519  RTARSCDFGGAGSVVHQAPNTGNCVLPS  546



>ref|XP_010688353.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   367 bits (941),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 273/466 (59%), Gaps = 26/466 (6%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             IFA+  L  L    SGS  IGI YGR  DDLP+P K  +L+K   I  V++YD++  VL 
Sbjct  8     IFAASLLLTLLALCSGS-KIGICYGRNGDDLPTPDKAAELIKQHNIKYVRIYDSNIQVLK  66

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             A + +G+   + +PN  L A +  QS  D W++++I+PY   + I  + VG EV     N
Sbjct  67    AFANTGVELMIGVPNSDLLAFSQFQSNVDSWLKNSILPYYPTTKITCITVGAEVTEATNN  126

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLS  1127
              + ++VPAMKNV+ +L K G+   +KVSS      +  S+PPS+G+F       +KPML 
Sbjct  127   ASTFVVPAMKNVFTALKKAGLHKKIKVSSTHSLGVLSRSFPPSAGAFSSHFAYYLKPMLE  186

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVY  947
             FL +  S  M++ YP+YAY  +   +SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y
Sbjct  187   FLAENQSPFMVDIYPYYAYRDSPTNVSLDYALFQSSSEVIDPNTGLLYTNMFDAQIDALY  246

Query  946   AAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNG  767
              A+ A+     +V+++E+GWPSKG+    A                   A+  NA  YN 
Sbjct  247   FALMALNFRTIKVMVTETGWPSKGSPKETA-------------------ATPDNAQIYNT  287

Query  766   NLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLA  587
             NL+R V+   GTP +P E L VY+FSLFNEN+K G  SERN+GLFYP    VY++  T  
Sbjct  288   NLIRHVINDTGTPAKPGEELDVYIFSLFNENRKPGMESERNWGLFYPGGTSVYNLDFTGK  347

Query  586   ALGNRGSKAQ----VPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
             ++    S         PTWC+A+ +   E L  AL++ACG G  DC PIQP   CY PNT
Sbjct  348   SVTEMASGVNGTNTTEPTWCIASSNATEEDLNNALNWACGPGNVDCTPIQPSQPCYEPNT  407

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
              V+HAS+AFNSYYQ+N      C FGGAG  V + P +  C + T 
Sbjct  408   PVSHASFAFNSYYQQNGATDIACGFGGAGLKVAKDPSYDKCLYLTA  453



>ref|XP_007160277.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
 gb|ESW32271.1| hypothetical protein PHAVU_002G307800g [Phaseolus vulgaris]
Length=501

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/461 (41%), Positives = 274/461 (59%), Gaps = 26/461 (6%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             IFA+    LL    SGS  IG+ YGR ADDLP+P KV QL++   I  V++YD++  VL 
Sbjct  8     IFAASLFLLLLDCCSGSF-IGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDSNIQVLK  66

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             A + +G+   + +PN  L + +  QS TDRW++++++PY   + I  + VG EV   P N
Sbjct  67    AFANTGVELMIGVPNSDLLSLSQFQSNTDRWLKNSVLPYYPATKITYITVGAEVTESPDN  126

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLS  1127
             T+  +VPAM NV  +L K G+   +KVSS      +  S+PPS+G+F       +KPML 
Sbjct  127   TSSLVVPAMTNVLTALKKLGLHKKIKVSSTHSLGVLSRSFPPSAGAFNSSHAHFLKPMLE  186

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVY  947
             FL +  S  M++ YP+YAY  + +K+ LDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y
Sbjct  187   FLAENQSPFMIDIYPYYAYRDSRNKVPLDYALFDASSEVIDPNTGLLYTNMFDAQIDAIY  246

Query  946   AAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNG  767
              A+ A+     +V+++E+GWPSKG+    A                   A+  NA  YN 
Sbjct  247   FALMALNFRTIKVMVTETGWPSKGSPKETA-------------------ATPDNAQTYNT  287

Query  766   NLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLA  587
             NL+R V+   GTP +P E L VY+FSLFNEN+K G  SERN+GLFYP++  VY +  T  
Sbjct  288   NLIRHVINNTGTPAKPGEELDVYVFSLFNENRKPGLESERNWGLFYPDQTSVYSLDFTGR  347

Query  586   ALGNRGSKAQVPP----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
                +  ++A +      TWC+A+       LQ A+D+ACG G  DC  IQP   C+ P+ 
Sbjct  348   GAVDMTTQANITKSNGTTWCIASTKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDN  407

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             L +HAS+AFNSYYQ+N      C FGG G  V + P + +C
Sbjct  408   LASHASFAFNSYYQQNGASDVACSFGGTGVKVDKDPSYDNC  448



>ref|NP_200470.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q9FJU9.1|E1313_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 13; AltName: Full=(1->3)-beta-glucan 
endohydrolase 13; Short=(1->3)-beta-glucanase 
13; AltName: Full=Beta-1,3-endoglucanase 13; Short=Beta-1,3-glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09876.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAL91612.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AAM91467.1| AT5g56590/MIK19_3 [Arabidopsis thaliana]
 gb|AED96784.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=506

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/451 (40%), Positives = 276/451 (61%), Gaps = 26/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+P+KVVQL++   I  V++YD +S VL A   + I   + +PN  
Sbjct  24    GKVGVCYGRSADDLPTPSKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSD  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA-NTTPYLVPAMKNVYASL  1259
             L+A + SQS  D W++++++PY   + I  + VG E   DP  N + ++VPAM+NV  +L
Sbjct  84    LNAFSQSQSNVDTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTAL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  144   RKVGLSRRIKVSTTLSLGILSRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPY  203

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  204   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  263

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E   AS+ NA  YN N++R V+T  GTP +P
Sbjct  264   ETGWPTKGSPK------------------EKAAASSDNAETYNSNIIRHVVTNQGTPAKP  305

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG-----NRGSKAQV  554
              E ++VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T  + G     +  + +  
Sbjct  306   GEAMNVYIFSLFNENRKAGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGS  365

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q+
Sbjct  366   SNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQ  425

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             N      C FGGAG  V + P +  C + T 
Sbjct  426   NRATDVACSFGGAGVKVNKDPSYDKCIYITA  456



>gb|EMS51674.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=571

 Score =   369 bits (947),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 208/462 (45%), Positives = 282/462 (61%), Gaps = 19/462 (4%)
 Frame = -3

Query  1648  LFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSG  1469
             L + +LR++V  +G +G+ YGR  ++L  PA VVQLLK  GIT V++YDTD  VLDA+  
Sbjct  34    LEVGVLRNTVE-AGEVGVCYGRNGNNLMDPASVVQLLKKNGITSVRVYDTDQGVLDAMKN  92

Query  1468  SGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPY  1295
             SGI   VA+PNE L +AA    +  +W  +N++PY   + I  V VGNEVF   +  T  
Sbjct  93    SGIKMVVAVPNEMLPSAAGDPDWAIQWANNNLLPYYPATDIRGVTVGNEVFKQASEHTSP  152

Query  1294  LVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-PVIKPMLSFLE  1118
             LVPAMKNV A+LA  G+A +VKV++PI   A++ S+PPS G FK ++   V+ PM+ FL 
Sbjct  153   LVPAMKNVQAALAGLGLADAVKVTTPIALDALKVSFPPSEGEFKDDIAQSVMSPMIDFLA  212

Query  1117  QTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI  938
             QTGS+LM+N YP+YAY ++   + ++Y  F  N GV D  +GL Y SL++AQ+DAVY A+
Sbjct  213   QTGSYLMVNIYPYYAYASSNGAMDINYVTFRPNGGVGDSRSGLTYYSLYEAQLDAVYYAM  272

Query  937   NAVKPGHFRVVISESGWPSKGNRN---AAAYNGKKAAVNAAAYDGETGPASAVNAAAYNG  767
               +     R    +      G R         G +++    AY  ++   +  +A AY  
Sbjct  273   ERLGSSSSRNHTKKMRVLRGGRRAPKPKVPAVGGESSPGGCAYCPQSLGFTKADAQAYTN  332

Query  766   NLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLA  587
             NL++  L+G GTP RP+  +SVY+F LFNEN+K     E+NYGLFYPN Q VY V     
Sbjct  333   NLIKLALSGAGTPHRPEFDISVYIFELFNENEKP-TAEEQNYGLFYPNGQPVYQVDF---  388

Query  586   ALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAH  407
               G++ S      +WC AN  VG  RLQ ALD+ACG G ADC  IQPG  CY P+T VAH
Sbjct  389   GAGDKSS------SWCEANAAVGDARLQAALDWACGNG-ADCSAIQPGKPCYEPDTKVAH  441

Query  406   ASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             A+YAFN YYQ+  R  GTC F GA  +V + P  G+C+   G
Sbjct  442   ATYAFNDYYQRKGRAGGTCDFSGAASIVYRQPA-GTCDPKAG  482


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            +WCVAN  VG  RLQ ALD+ACG GA DC  IQPG+ C++P+T VAHASYAFN YYQ+N 
Sbjct  483  SWCVANAAVGDARLQAALDWACGHGA-DCSAIQPGARCFDPDTKVAHASYAFNDYYQRNG  541

Query  367  RGPGTCYFGGAGYVVTQPPRFGSC  296
            R   +C+FGGAG VV Q P+ G+C
Sbjct  542  RSGSSCHFGGAGSVVHQAPKIGNC  565



>emb|CDY64970.1| BnaAnng19910D [Brassica napus]
Length=503

 Score =   366 bits (940),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 185/451 (41%), Positives = 273/451 (61%), Gaps = 28/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL+K   I  V++YD++S VL A + + I   + +PN  
Sbjct  21    GKVGVCYGRSADDLPTPAKVVQLIKQHNIKYVRIYDSNSQVLKAFANTTIELMIGVPNSD  80

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP-ANTTPYLVPAMKNVYASL  1259
             L A +  QS  D W++++++PY   + I  + VG E   DP  N +  +VPAM+NV  +L
Sbjct  81    LKAFSQFQSNADTWLKNSVLPYYPTTKITYITVGAESTDDPHTNASSLVVPAMQNVLTAL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  141   KKVGLSRRIKVSTTLSLGVLSRSFPPSAGAFNSSYAYFLRPMLEFLAENQSPFMVDLYPY  200

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  201   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  260

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E G AS  NA  YN N++R  +T  GTP +P
Sbjct  261   ETGWPTKGSPK------------------EKGAASPDNAETYNSNIIRHTVTNQGTPSKP  302

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRG------SKAQ  557
              E + VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T    G RG      S+ +
Sbjct  303   GEAMDVYIFSLFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKNGGFRGNSRGGNSRGR  362

Query  556   VPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQ  377
                +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q
Sbjct  363   -SESWCIASSKASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQ  421

Query  376   KNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             +N      C FGG G  V + P +  C + T
Sbjct  422   QNGGTDVACSFGGVGVKVNKDPSYDKCVYIT  452



>ref|XP_006280336.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
 gb|EOA13234.1| hypothetical protein CARUB_v10026261mg [Capsella rubella]
Length=508

 Score =   366 bits (940),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/451 (40%), Positives = 274/451 (61%), Gaps = 26/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL+K   I  V++YD +S VL A   + I   + +PN  
Sbjct  26    GKVGVCYGRSADDLPTPAKVVQLIKQHNIDYVRIYDYNSQVLKAFGNTSIELMIGVPNSD  85

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA-NTTPYLVPAMKNVYASL  1259
             L+A + SQS  + W++++++PY   + I  + VG E   DP  N + ++VPAM+NV  +L
Sbjct  86    LNAFSQSQSTVNTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTAL  145

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  146   RKVGLSRRIKVSTTLSLGILSRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPY  205

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  206   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALMALNFRTIKIMVT  265

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E   AS  NA  YN N++R V+T  GTP +P
Sbjct  266   ETGWPTKGSPK------------------EKAAASPDNAETYNSNIIRHVVTNQGTPAKP  307

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT-----LAALGNRGSKAQV  554
              E ++VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T       +  +  + +  
Sbjct  308   GEAMNVYIFSLFNENRKTGLESERNWGLFYPDQTSVYQLDFTGKSNAFHSNSSGTNSSGN  367

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q+
Sbjct  368   SNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQ  427

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             N      C FGGAG  V + P +  C + T 
Sbjct  428   NRATDVACSFGGAGVKVNKDPSYDKCIYITA  458



>ref|XP_010483135.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Camelina sativa]
Length=509

 Score =   366 bits (939),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 272/451 (60%), Gaps = 26/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL++   I  V++YD +S VL A   + I   + +PN  
Sbjct  27    GKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSD  86

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA-NTTPYLVPAMKNVYASL  1259
             L+A + SQ+  D W++++++PY   + I  + VG E   DP  N + ++VPAM+NV   L
Sbjct  87    LNAFSQSQTNVDTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTGL  146

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  147   RKVGLSKRIKVSTTLSLGVLSRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPY  206

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  207   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  266

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E   AS  NA  YN N++R V+T  GTP +P
Sbjct  267   ETGWPTKGSPK------------------EKAAASPDNAETYNSNIIRHVVTNQGTPAKP  308

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQV-----  554
              E ++VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T  + G   + +       
Sbjct  309   GEAMNVYIFSLFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSRGN  368

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+ LV+HAS+ FNSY+Q+
Sbjct  369   SNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQ  428

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             N      C FGGAG  V + P +  C + T 
Sbjct  429   NRATDVACSFGGAGVKVNKDPSYDKCIYITA  459



>ref|XP_002514201.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF48155.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=511

 Score =   365 bits (938),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 197/472 (42%), Positives = 277/472 (59%), Gaps = 39/472 (8%)
 Frame = -3

Query  1660  IFA-SLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVL  1484
             IFA SL L+LL     GS +IG+ YGR ADDLP+P KV QL++ Q I  +++YD++  VL
Sbjct  8     IFAISLLLTLLVF-CRGS-TIGVCYGRNADDLPTPDKVAQLVQQQKIKYLRIYDSNIQVL  65

Query  1483  DALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA  1310
              A + +G+   V +PN  L A +  QS  D W++++I+PY   + I  + VG EV   P 
Sbjct  66    KAFANTGVELMVGVPNSDLLALSQFQSNADSWLKNSILPYYPATKITYITVGAEVTEAPN  125

Query  1309  NTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPML  1130
             N +  +VPAM NV  +L K G+   +KVSS      +  S+PPS+G+F       +KPML
Sbjct  126   NASALVVPAMHNVLTALKKVGLHKRIKVSSTHSLGVLSRSFPPSAGAFNSSHAFFLKPML  185

Query  1129  SFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAV  950
              FL +  S  M+N YP+YA+  + + ++LDYA+F  +  V+DPN GL+Y ++FDAQ+DA+
Sbjct  186   EFLAENQSPFMINIYPYYAFRDSPNNVTLDYALFQSSSEVIDPNTGLLYTNMFDAQIDAL  245

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             Y A+ A+     +V+++E+GWPSKG+    A                   A+  NA  YN
Sbjct  246   YFALTALNFRTIKVMVTETGWPSKGSLKETA-------------------ATPDNAQTYN  286

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVY------  608
              NL+R V+   GTP +P E L +Y+FSLFNEN+K G  SERN+GLFYP    VY      
Sbjct  287   TNLIRHVINNSGTPAKPGEELDIYIFSLFNENRKPGLESERNWGLFYPGGTSVYTLDFTG  346

Query  607   ----DVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
                 DVP   +  G  G+      TWC+A+ +     LQ ALD+ACG G  DC  IQP  
Sbjct  347   RGVVDVPKNTSITGFNGTT-----TWCIASNNASQLDLQNALDWACGSGNVDCSAIQPSQ  401

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
              C+ P+TLV+HAS+AFN YYQ+N      C FGG G  V + P + +C + T
Sbjct  402   PCFEPDTLVSHASFAFNGYYQQNGATDVACSFGGTGVKVDKDPSYDNCLYMT  453



>ref|XP_006853717.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
 gb|ERN15184.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
Length=548

 Score =   367 bits (941),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/463 (41%), Positives = 274/463 (59%), Gaps = 38/463 (8%)
 Frame = -3

Query  1642  LSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSG  1463
             ++L+    S +  IGI YGR  DDLP+P K VQL++   I  V++YD++  VL A + +G
Sbjct  1     MTLVDKESSVASIIGICYGRNGDDLPTPDKAVQLIQGHSIKYVRIYDSNIQVLKAFANTG  60

Query  1462  ISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLV  1289
             I   + +PN  L A +  QS  D WV++NI+PY   + I  + VG EV   P N +  +V
Sbjct  61    IELMIGIPNADLLAFSQYQSNADTWVKNNILPYYPSTKITYITVGAEVTESPVNVSSLVV  120

Query  1288  PAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTG  1109
             PAM NV+ +L K G+   +K+S+      +  S+PPS+G+F P+    IKP+L FL +  
Sbjct  121   PAMTNVHNALRKAGLNKRIKISTTHSLGVLSRSFPPSAGAFDPKFASFIKPLLEFLVENQ  180

Query  1108  SFLMLNAYPFYAYEANTDKISLDYAVFGD-NQGVVDPNNGLVYKSLFDAQVDAVYAAINA  932
             S  M++ YP+YAY+ +   ++LDYA+F   +  V+D N GL+Y ++FDAQ+DA+Y A+ A
Sbjct  181   SPFMVDLYPYYAYKDSPTNVTLDYALFNSTSSAVIDQNTGLIYTNMFDAQIDALYFALTA  240

Query  931   VKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRR  752
             V     RV+++ESGWP+KG+    A                   A+  NA  YN NL+R 
Sbjct  241   VNFNTIRVMVTESGWPNKGSSKETA-------------------ATPDNAQTYNTNLIRH  281

Query  751   VLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT-------  593
             V+   GTPL+P E + VY+FSLFNEN+K G  SERN+G+FYP +  VY++  +       
Sbjct  282   VINDTGTPLKPGEEIDVYIFSLFNENRKPGLDSERNWGVFYPGQTSVYNLDFSGREGGLV  341

Query  592   --LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNT  419
               ++A G  GS       WC+A+ +     L+ ALD+ACG G  DC  IQP   C+ P+T
Sbjct  342   VNVSAGGGNGS-------WCIASPNASERDLKNALDWACGSGNVDCSAIQPSQACFQPDT  394

Query  418   LVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             L +HASYAFNSYYQ+N      C FGG G + T+ P + +C +
Sbjct  395   LASHASYAFNSYYQQNGASTIACDFGGTGMITTKNPSYDNCLY  437



>emb|CDY32869.1| BnaC09g33160D [Brassica napus]
Length=503

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 270/450 (60%), Gaps = 26/450 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL+K   I  V++YD +S VL A + + I   + +PN  
Sbjct  21    GKVGVCYGRSADDLPTPAKVVQLIKQHNIKYVRIYDYNSQVLKAFANTSIELMIGVPNSD  80

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP-ANTTPYLVPAMKNVYASL  1259
             L   +  QS  D W++++++PY   + I  + VG E   DP  N + ++VPAM+NV  +L
Sbjct  81    LKPFSQFQSNADTWLKNSVLPYYPTTKITYITVGAESTDDPHTNASSFVVPAMQNVLTAL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  141   KKVGLSRRIKVSTTLSLGVLSRSFPPSAGAFNSSYAYFLRPMLEFLAENQSPFMVDLYPY  200

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  201   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  260

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E G AS  NA  YN N++R  +T  GTP +P
Sbjct  261   ETGWPTKGSPK------------------EKGAASPDNAETYNSNIIRHTVTNQGTPSKP  302

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR-----GSKAQV  554
              E + VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T    G R     G+    
Sbjct  303   GEAMDVYIFSLFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKNGGFRSNSSGGNSRGR  362

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q+
Sbjct  363   SESWCIASSKASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQ  422

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             N      C FGG G  V + P +  C + T
Sbjct  423   NGGTDVACSFGGVGVKVNKDPSYDKCVYIT  452



>ref|XP_002864470.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40729.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/451 (40%), Positives = 274/451 (61%), Gaps = 26/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL++   I  V++YD +S VL A   + I   + +PN  
Sbjct  24    GKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSD  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA-NTTPYLVPAMKNVYASL  1259
             L+A + SQS  D W++++++PY   + I  + VG E   DP  N + ++VPAM+NV  +L
Sbjct  84    LNAFSQSQSNVDTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTAL  143

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  144   RKVGLSRRIKVSTTLSLGILSRSFPPSAGAFNSSYAYFLRPMLEFLAENNSPFMIDLYPY  203

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  204   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  263

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E   AS  NA  YN N++  V+T  GTP +P
Sbjct  264   ETGWPTKGSPK------------------EKAAASPDNAETYNSNIIHHVVTNQGTPAKP  305

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG-----NRGSKAQV  554
              E ++VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T  + G     +  + +  
Sbjct  306   GEAMNVYIFSLFNENRKAGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGS  365

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q+
Sbjct  366   SNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQ  425

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             N      C FGGAG  V + P +  C + T 
Sbjct  426   NRATDVACSFGGAGVKVNKDPSYDKCIYITA  456



>ref|XP_006644680.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=493

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/465 (41%), Positives = 280/465 (60%), Gaps = 31/465 (7%)
 Frame = -3

Query  1660  IFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLD  1481
             + A  FL L+ H + G   +GI YGR ADDLP+P KVVQL++ Q +  V++YDT+  V+ 
Sbjct  6     LVAVFFLLLVGHCLGGK--VGICYGRNADDLPAPDKVVQLIQQQSLKYVRIYDTNIDVIK  63

Query  1480  ALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPAN  1307
             A + +G+   V +PN  L   A  QS  D W++++I+PY   ++I  + VG EV  +P N
Sbjct  64    AFANTGVELMVGVPNSDLLPFAQYQSNVDTWLKNSILPYYPATMITYITVGAEVTENPVN  123

Query  1306  TTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLS  1127
              +  +VPAM+NV+ +L K G+   + +SS      +  S+PPS+G+F       +KPML 
Sbjct  124   VSALVVPAMRNVHTALKKVGLHKKITISSTHSLGILSRSFPPSAGAFNSSYAYFLKPMLE  183

Query  1126  FLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFDAQVDAV  950
             FL +  +  M++ YP+YAY+ +   +SL+YA+F    Q V+DPN GLVY ++FDAQ+D++
Sbjct  184   FLVENQAPFMVDLYPYYAYQNSPSNVSLNYALFSPQAQDVIDPNTGLVYTNMFDAQIDSI  243

Query  949   YAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYN  770
             + A+ A+     +++++E+GWP+KG            AV       ETG A++ NA  YN
Sbjct  244   FFALMALNFKTLKIMVTETGWPNKG------------AVK------ETG-ATSDNAQTYN  284

Query  769   GNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTL  590
              NL+R V+   GTP +P E + VY+FSLFNEN+K G  SERN+GLF+P++  +Y +  T 
Sbjct  285   TNLIRHVVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFFPDQSSIYSLDWT-  343

Query  589   AALGNR-----GSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNP  425
                GN      G+      TWCVA+ +     LQ  L++ACG G  DC  IQP   CY P
Sbjct  344   -GRGNVDIMTGGNITNANGTWCVASANASETDLQNGLNWACGPGNVDCSAIQPSQPCYQP  402

Query  424   NTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             +TL +HASYAFNSYYQ+N      C FGG G   T+ P + +C +
Sbjct  403   DTLASHASYAFNSYYQQNGANDVACDFGGTGMRTTKDPSYDTCVY  447



>ref|XP_009120169.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Brassica rapa]
Length=503

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/450 (41%), Positives = 270/450 (60%), Gaps = 26/450 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL+K   I  V++YD++S VL A + + I   + +PN  
Sbjct  21    GKVGVCYGRSADDLPTPAKVVQLIKQHNIKYVRIYDSNSQVLKAFANTTIELMIGVPNSD  80

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDP-ANTTPYLVPAMKNVYASL  1259
             L   +  QS  D W++++++PY   + I  + VG E   DP  N +  +VPAM+NV  +L
Sbjct  81    LKPFSQFQSNADTWLKNSVLPYYPTTKITYITVGAESTDDPHTNASSLVVPAMQNVLTAL  140

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  141   KKVGLSRRIKVSTTLSLGVLSRSFPPSAGAFNSSYAYFLRPMLEFLAENQSPFMVDLYPY  200

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  201   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  260

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E G AS  NA  YN N+VR  +T  GTP +P
Sbjct  261   ETGWPTKGSPK------------------EKGAASPDNAETYNSNIVRHTVTNQGTPSKP  302

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNR-----GSKAQV  554
              E + VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T    G R     G+    
Sbjct  303   GEAMDVYIFSLFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKNGGFRSNSSGGNSRGR  362

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q+
Sbjct  363   SESWCIASSKASEIELRGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQ  422

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             N      C FGG G  V + P +  C + T
Sbjct  423   NGGTDVACSFGGVGVKVNKDPSYDKCVYIT  452



>ref|XP_008672638.1| PREDICTED: uncharacterized protein LOC100278152 isoform X2 [Zea 
mays]
 gb|ACN28065.1| unknown [Zea mays]
 tpg|DAA57721.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
 tpg|DAA57722.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=496

 Score =   364 bits (934),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/446 (42%), Positives = 274/446 (61%), Gaps = 25/446 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G IG+ YGR ADDLP+P KV QL++ Q I  V++YDT+  V+ A + +G+   V +PN  
Sbjct  24    GKIGVCYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVGVPNSD  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L A A  QS  D W++++I+PY   ++I  + VG EV   P N +  +VPAM+NV+ +L 
Sbjct  84    LLAFAQYQSNVDTWLKNSILPYYPDTMITYITVGAEVTESPTNVSALVVPAMRNVHTALK  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFY  1076
             K G+   + +SS      +  S+PPS+G+F       +KPML FL +  +  M++ YP+Y
Sbjct  144   KAGLHKKITISSTHSLGILSRSFPPSAGAFNSSYAYFLKPMLQFLVENQAPFMVDLYPYY  203

Query  1075  AYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             AY+ +   +SL+YA+F  ++Q V+DPN GLVY ++FDAQVD+++ A+ A+     +++I+
Sbjct  204   AYQNSRSNVSLNYALFSPESQDVIDPNTGLVYTNMFDAQVDSIFFALMALNFKTLKIMIT  263

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             ESGWP+KG            AV       ETG A+  NA  YN NL+R V+   GTP +P
Sbjct  264   ESGWPNKG------------AVK------ETG-ATPDNAQTYNTNLIRHVVNDSGTPAKP  304

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP---  548
              E + VY+FSLFNEN+K G  SERN+GLF+P++  +Y +  T     +  + A +     
Sbjct  305   GEEIDVYIFSLFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANG  364

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             TWC+A+ +     LQ AL++ACG G  DC  IQP   CY P+TL +HASYAFNSYYQ+N 
Sbjct  365   TWCIASTNASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNG  424

Query  367   RGPGTCYFGGAGYVVTQPPRFGSCEF  290
                  C FGGAG   T+ P + +C +
Sbjct  425   ANVVACDFGGAGIRTTKDPSYDTCVY  450



>ref|XP_004513066.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cicer arietinum]
Length=506

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 271/462 (59%), Gaps = 30/462 (6%)
 Frame = -3

Query  1654  ASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDAL  1475
             ASLFL LL     GS  +GI YGR ADDLPSP KV QL++   I  V++YD++  VL A 
Sbjct  12    ASLFL-LLLDCCHGSF-VGICYGRNADDLPSPDKVAQLVQDHKIKYVRIYDSNIQVLKAF  69

Query  1474  SGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTT  1301
             + +G+   + +PN  L   +  Q+  D W+++NI+PY   + I  + VG EV   P N +
Sbjct  70    TNTGVELMIGIPNLDLLPFSQFQTNADTWLRNNILPYYPATKITYITVGAEVTESPENVS  129

Query  1300  PYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFL  1121
               +VPAM NV  +L K G+   +KVSS      +  S+PPS+G+F       +KP+L FL
Sbjct  130   ALVVPAMTNVLTALKKAGLHKKIKVSSTHSLGVLSRSFPPSAGAFDSRHARFLKPLLEFL  189

Query  1120  EQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAA  941
              +  S  M++ YP+YA+  + +K+ LDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A
Sbjct  190   AENQSPFMIDLYPYYAFRDSPNKVPLDYALFESSSEVIDPNTGLLYTNMFDAQIDAIYFA  249

Query  940   INAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNL  761
             + A+     +V+++E+GWPSKG+    A                   A+  NA  YN NL
Sbjct  250   LMALNFRTIKVMVTETGWPSKGSPKETA-------------------ATPDNAQTYNTNL  290

Query  760   VRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDV------P  599
             +R ++   GTP +PDE L VY+FSLFNEN+K G  SERN+GLFYP++  VY +      P
Sbjct  291   IRHIINETGTPAKPDEELDVYVFSLFNENRKPGLESERNWGLFYPDQTSVYSLDFTGRSP  350

Query  598   LTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACG-QGAADCGPIQPGSTCYNPN  422
             + + A  N         TWC+A+       LQ A+++ACG  G  DC  IQP   C+ P+
Sbjct  351   VDMNADANATRSNGTTTTWCIASSKATQMDLQNAINWACGTSGNVDCTAIQPSQPCFQPD  410

Query  421   TLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
              LV+HASYAFNSYYQ+N      C FGG G +V + P +  C
Sbjct  411   NLVSHASYAFNSYYQQNGASDVACSFGGTGVIVDKDPTYDDC  452



>emb|CDP03239.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   364 bits (934),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 276/470 (59%), Gaps = 26/470 (6%)
 Frame = -3

Query  1678  RLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDT  1499
             R + L +  SL L L+   V     +G+ YGR ADDLP+P K VQL+++  I  V++YD+
Sbjct  3     RSFILVLVTSLLLMLI--GVCQGSKVGVCYGRNADDLPTPDKAVQLIQNHNIKYVRIYDS  60

Query  1498  DSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEV  1325
             +  VL A + SGI   + +PN  L   +  QS  D W+++NI+PY   + I  + VG E 
Sbjct  61    NIQVLKAFANSGIELVIGIPNSDLLPFSQFQSNADTWLRNNILPYYPATKITYITVGAEA  120

Query  1324  FVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPV  1145
                P N +  +VPAM+NV+ +L K G+   +KVS+      +  SYPPS+G+F       
Sbjct  121   TEVPNNVSAMVVPAMQNVFTALRKAGLHKKIKVSTTHSLGVLSRSYPPSAGAFNSSYAFF  180

Query  1144  IKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDA  965
             ++P+L FL +  S  M++ YP+YAY  ++  +SLDYA+F  +  V+DPN GL+Y ++FDA
Sbjct  181   LRPLLEFLAENQSPFMVDTYPYYAYRDSSSNVSLDYALFESSSEVIDPNTGLLYTNMFDA  240

Query  964   QVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVN  785
             Q+DA+Y A+ A+     +++++E+GWPSKG+         K  V           A+A N
Sbjct  241   QIDAIYFALMALNFRTIKIMVTETGWPSKGS--------PKETV-----------ATADN  281

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
             A  YN NL+R V+   GTP +P + L VY+FSLFNEN+K G  SERN+GLF+P++  VY+
Sbjct  282   AQTYNTNLIRHVINDTGTPAKPGQELDVYIFSLFNENRKPGLESERNWGLFFPDQTSVYN  341

Query  604   VPLTLAALGNRGSKAQVP---PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTC  434
             +  T     +  + A +     TWCVA  +     LQ ALD+ACG G  DC  IQP   C
Sbjct  342   LDFTGRGTVDITTGANITSSNETWCVAASNASDADLQNALDWACGSGNVDCSAIQPSQPC  401

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
             + P+ L++HASYAFN YYQ+N      C FGG G    + P + +C + T
Sbjct  402   FEPDNLISHASYAFNGYYQQNGATDIACSFGGNGLRTNKNPSYDNCIYAT  451



>ref|XP_007012989.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY30608.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=505

 Score =   364 bits (934),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/448 (42%), Positives = 269/448 (60%), Gaps = 29/448 (6%)
 Frame = -3

Query  1603  IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLS  1424
             +G+ YGR ADDLP+P KV QL++   I  +++YD++  VL A + +G+   V +PN  L 
Sbjct  26    VGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDSNIQVLKAFANTGVELMVGVPNSDLL  85

Query  1423  AAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKY  1250
             A +  QS  D W++++I+PY   + I  + VG EV   P N +  +VPAM+N+  +L K 
Sbjct  86    AFSQFQSNADSWLKNSILPYYPATKITYITVGLEVTESPDNASALVVPAMQNILTALKKV  145

Query  1249  GVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFYAY  1070
             G+   +KVSS      +  S+PPS+G+F       +KPML FL +  S  M++ YP+YAY
Sbjct  146   GLHKRIKVSSTHSLGVLSRSFPPSAGAFNSSHAYFLKPMLEFLAENQSPFMIDLYPYYAY  205

Query  1069  EANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISESG  890
               + + +SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+ A+     R++++E+G
Sbjct  206   RDSPNNVSLDYALFESSSEVIDPNTGLLYTNMFDAQIDALYFALMALNFRTIRIMVTETG  265

Query  889   WPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEP  710
             WPSKG+    A                   A+  NA  YN NL+R V+   GTP +P E 
Sbjct  266   WPSKGSSKEKA-------------------ATPDNAQTYNTNLIRHVINDSGTPAKPGEE  306

Query  709   LSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT------LAALGNRGSKAQVPP  548
             L VY+FSLFNEN+K G  SERN+GLFYP++  VY++  T      +   GN G+K+    
Sbjct  307   LDVYIFSLFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGN-GTKSN-GT  364

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             TWC+A+       LQ ALD+ACG G  DC  IQP   C+ P+ LV+HAS+AFNSYYQ+N 
Sbjct  365   TWCIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  424

Query  367   RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
                  C FGG G  V + P + +C + T
Sbjct  425   ASDVACSFGGNGVKVDKDPSYDNCIYLT  452



>ref|XP_010446151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=473

 Score =   363 bits (931),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 273/451 (61%), Gaps = 26/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL++   I  V++YD +S VL A   + I   + +PN  
Sbjct  27    GKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSD  86

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA-NTTPYLVPAMKNVYASL  1259
             L+A + SQ+  D W++++++PY   + I  + VG E   DP  N + ++VPAM+NV   L
Sbjct  87    LNAFSQSQANVDTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTGL  146

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  147   RKVGLSKRIKVSTTLSLGVLSRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPY  206

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  207   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  266

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E   AS  NA  YN N++R V+T  GTP +P
Sbjct  267   ETGWPTKGSPK------------------EKAAASPDNAETYNSNIIRHVVTNQGTPAKP  308

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG-----NRGSKAQV  554
              E ++VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T  + G     +  + +  
Sbjct  309   GEAMNVYIFSLFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGN  368

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+ LV+HAS+ FNSY+Q+
Sbjct  369   SNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQ  428

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             N      C FGGAG  V + P +  C + T 
Sbjct  429   NRATDVACSFGGAGVKVNKDPSYDKCIYITA  459



>gb|EMS58549.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=604

 Score =   367 bits (942),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 214/467 (46%), Positives = 288/467 (62%), Gaps = 43/467 (9%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR+A DLP PA VVQLLK  GIT V++YDTD TVL +L+ + I  TV L NE+
Sbjct  28    GEVGVCYGRVATDLPDPASVVQLLKKNGITMVRIYDTDPTVLRSLANTNIKVTVELTNEE  87

Query  1429  LSAAAASQ-SFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASL  1259
             L  AAA Q +F  +WVQSN+  Y   ++I  V VGNEVF + +     LVPAMKNV A+L
Sbjct  88    LPLAAADQNNFALQWVQSNVKAYYPATLINGVTVGNEVFKEASQLNSQLVPAMKNVQAAL  147

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPEL-IPVIKPMLSFLEQTGSFLMLNAYP  1082
             AK G+A +VKV++PI F A+  S+PPS+G+F+ ++ + V+ PM+ FL+QTGS+LM+N YP
Sbjct  148   AKLGMADAVKVTTPIAFDALNPSFPPSAGTFRDDIALSVMSPMVDFLQQTGSYLMVNFYP  207

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAI-----NAVKPGH  917
             + AY A T  +S+DY +F  N GV+D  +G  Y SLFDAQ+DAVY A+     +++  G 
Sbjct  208   YLAYLA-TPGMSIDYLLFRPNNGVLDTGSGQTYFSLFDAQLDAVYYAMEKLPSSSMHVGG  266

Query  916   FRVVIS----------ESGWPSKGN------RNAAAYNGKKAAVNAAAYDGETGPASAVN  785
              R + +          E G P+KG+      +NA  +    A +      G +G A+A  
Sbjct  267   MRKLTAGGGTPEVHHGEEGHPNKGHGGVGTPQNAQDF---MAGLTHQVLQGNSGTAAANG  323

Query  784   AAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD  605
                   + VR      GTP RP+  L+VY+F+LFNEN K  P  ++++GLFYPN+Q VY 
Sbjct  324   HRPLTASAVR------GTPHRPNADLNVYIFALFNENNK--PEDDQDFGLFYPNQQPVYP  375

Query  604   VPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQ---GAADCGPIQPGSTC  434
              P+     G  G   Q  P++CVAN  VG   LQ ALD+AC       ADC  IQPG  C
Sbjct  376   NPIDFVHGGTSGGPLQ--PSYCVANAAVGDAALQAALDFACDNRDGNRADCSAIQPGQPC  433

Query  433   YNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCE  293
             + P+T +AHASYAFN YYQKN R    C F GAG +V Q P  G+C+
Sbjct  434   FEPDTKLAHASYAFNDYYQKNGRVKSACDFSGAGTIVNQAPS-GACD  479


 Score =   118 bits (295),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVAN  VG  RLQ ALDYACG GAA+C  IQPG+ C++P+T VAHAS+AFNSYYQ  
Sbjct  482  PSWCVANAAVGDTRLQAALDYACGPGAANCTDIQPGARCFDPDTKVAHASFAFNSYYQLR  541

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEF  290
             R  GTC F GAG +V Q P   + EF
Sbjct  542  GRATGTCDFAGAGIIVQQAPSKLASEF  568



>ref|XP_004968988.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Setaria 
italica]
Length=652

 Score =   369 bits (946),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 223/483 (46%), Positives = 291/483 (60%), Gaps = 38/483 (8%)
 Frame = -3

Query  1690  MAFPR-LYSLCIFASLFLSLLRHSVSGSGSIGINYGRIA--DDLPSPAKVVQLLKSQGIT  1520
             MA  R L  + + A+L L LL H    S  +G++YG +A   +LP PAKV +LLK  GIT
Sbjct  1     MALTRGLIVVVLGATLPLLLLSHEAEAS-EVGVSYGTVAVAGNLPDPAKVSKLLKDNGIT  59

Query  1519  KVKLYDTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIET  1346
              V++YD + +VL +L+ +GI   V +PNE ++AAA   S+  +WVQ+N+  Y   + I  
Sbjct  60    MVRIYDANPSVLTSLANTGIKVMVMMPNENIAAAATDTSYALQWVQNNVKAYYPATQING  119

Query  1345  VAVGNEVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQT-SYPPSSGS  1169
             VAVGNEVF    + T  LVPAM NV+ +L + G+  ++KVS+P+ F A++  ++PPS+G 
Sbjct  120   VAVGNEVFDSSPDLTSKLVPAMTNVHDALVQLGLDDAIKVSTPVAFDALKDPTFPPSAGR  179

Query  1168  FKPELI-PVIKPMLSFLEQTGSFLMLNAYPFYAYEANT-DKISLDYAVFGDNQGVVDPNN  995
             FK E+   V+KPM+ FL++TGS L +N YPF+AY       ISLDYA+   N GV+D   
Sbjct  180   FKDEIAQSVMKPMIDFLQRTGSSLTMNIYPFFAYATQKPGTISLDYALGNSNPGVLDDQT  239

Query  994   GLVYKSLFDAQVDAVYAAINAVKPGH-------------FRVVISESGWPSKGNRNAAAY  854
             GL+Y +L DAQ DA Y A+ A+                   +  +ESGW +KG       
Sbjct  240   GLMYYNLLDAQRDAAYYAVEALGQSSVASTMKASGQDVGVSMTYTESGWSNKGTIKHGG-  298

Query  853   NGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGG-GTPLRPDEPLSVYLFSLFNE  677
              G+K        D E G AS  NA AYN NL+ RVL+G  GTP RPD  + VY+F+LFNE
Sbjct  299   -GRK------LLDTE-GAASIANAQAYNNNLINRVLSGKTGTPHRPDAGMDVYIFALFNE  350

Query  676   NQK-SGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPPTWCVANGDVGPERLQV  500
             N K S    E N+GLFYPN QKVYD   T    G+    AQ   +WCVAN  VG  RLQ 
Sbjct  351   NGKGSSDDVESNFGLFYPNMQKVYDFSFT----GSGAPPAQPTASWCVANAAVGDARLQA  406

Query  499   ALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVT  320
             ALDYACG G ADC  IQPG +C++P+T +AHASYA NSYYQ   R    C F GA  VV 
Sbjct  407   ALDYACGHG-ADCSAIQPGGSCFDPDTKLAHASYAVNSYYQNKGRAASACDFNGAASVVF  465

Query  319   QPP  311
             Q P
Sbjct  466   QKP  468


 Score =   122 bits (305),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -3

Query  547  TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
            TWCVAN  VG  RLQ ALDYAC  GA DC  IQ G  C+ P+T VAHASYAFNSYYQ+  
Sbjct  564  TWCVANSAVGDARLQTALDYACSNGA-DCSAIQAGGACFQPDTKVAHASYAFNSYYQRKG  622

Query  367  RGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
            R  GTC F GAG +V Q P+FG+C  P+
Sbjct  623  RAAGTCDFSGAGSIVNQAPKFGNCVLPS  650


 Score =   110 bits (276),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = -3

Query  553  PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
            P TWCVAN  VG  RLQ  LDYAC  GA DC  IQPG +C+ P+T VAHASYAFNSYYQ 
Sbjct  476  PMTWCVANTAVGDARLQAGLDYACANGA-DCSAIQPGGSCFQPDTKVAHASYAFNSYYQN  534

Query  373  NARGPGTCYFGGAGYVVTQPPRFGSCE  293
              R  G+C F GA  VV Q P  G+C+
Sbjct  535  KGRADGSCDFNGAASVVNQQPA-GTCD  560



>gb|EMS49856.1| Glucan endo-1,3-beta-glucosidase 13 [Triticum urartu]
Length=494

 Score =   363 bits (932),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/470 (41%), Positives = 278/470 (59%), Gaps = 35/470 (7%)
 Frame = -3

Query  1672  YSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDS  1493
             ++  + A LFL L+ H     G  GI YGR ADDLP P KV QL++ Q I  V++YDT++
Sbjct  5     HAAAVSAFLFLLLVGHC--HGGKTGICYGRNADDLPGPDKVAQLIQQQSIKYVRIYDTNA  62

Query  1492  TVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFV  1319
              V+ A + + +   V +PN  L A +  QS  D W++++I+PY   + I  + VG E+  
Sbjct  63    DVIKAFANTSVELMVGVPNADLLAFSQYQSNVDTWLKNSILPYYPATAITHITVGAEITE  122

Query  1318  DPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIK  1139
              P N +  +VPAM+NV+A+L K  +   + +SS      +  S+PPS+G+F       +K
Sbjct  123   SPINVSALVVPAMRNVHAALKKVDLHKKITISSTHSLGVLSRSFPPSAGAFNSSYAHFLK  182

Query  1138  PMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFDAQ  962
             PML FL +  +  M++ YP+YAY+ +   +SL+YA+F   +QGV+DPN GLVY ++FDAQ
Sbjct  183   PMLEFLVENQAPFMVDLYPYYAYQNSPSNVSLNYALFSPQSQGVIDPNTGLVYTNMFDAQ  242

Query  961   VDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNA  782
             VD+++ A+ A+     +++I+E+GWP KG                     ETG A   NA
Sbjct  243   VDSIFFALMALNFKTLKIMITETGWPHKGAPK------------------ETG-AIPDNA  283

Query  781   AAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDV  602
               YN NL+R V+   GTP +P E + VY+FSLFNEN+K G  SERN+GLF P++  +Y +
Sbjct  284   QTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNENRKPGIESERNWGLFSPDQSSIYSI  343

Query  601   PLT------LAALGNRGSKAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGS  440
               T      +   GNR +      TWCVA+ +V    LQ  L++ACG G  DC  IQP  
Sbjct  344   DWTGRGNVDIMTGGNRSNG-----TWCVASTNVSETALQNGLNWACGPGNVDCSAIQPSQ  398

Query  439   TCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEF  290
              CY P+TLV+HASYAFNSYYQ+N      C FGGAG   T+ P + +C +
Sbjct  399   PCYQPDTLVSHASYAFNSYYQQNGATDVACGFGGAGMRTTKDPSYDTCVY  448



>gb|KHN16652.1| Glucan endo-1,3-beta-glucosidase 13 [Glycine soja]
Length=498

 Score =   363 bits (932),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 192/469 (41%), Positives = 275/469 (59%), Gaps = 27/469 (6%)
 Frame = -3

Query  1684  FPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLY  1505
              P  +SL IFA+    LL    SGS  +G+ YGR ADDLP+P KV QL++   I  V++Y
Sbjct  1     MPTGFSL-IFAASLFLLLLDCCSGSF-VGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIY  58

Query  1504  DTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGN  1331
             D++  VL A + +GI   + +PN  L + +  QS  D W++++++PY   + I  + VG 
Sbjct  59    DSNIQVLKAFANTGIELMIGVPNSDLLSFSQFQSNADSWLKNSVLPYYPATKITYITVGA  118

Query  1330  EVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI  1151
             EV   P N + ++VPAM NV  +L K G+   +KVSS      +  S+PPS+G+F     
Sbjct  119   EVTESPNNASSFVVPAMTNVLTALKKLGLHKKIKVSSTHSLGVLSRSFPPSAGAFNSSHA  178

Query  1150  PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLF  971
               +KPML FL +  S  M++ YP+YAY  +  K+SLDYA+F  +  V+DPN GL+Y ++F
Sbjct  179   HFLKPMLEFLAENQSPFMIDIYPYYAYRDSRSKVSLDYALFDASSEVIDPNTGLLYTNMF  238

Query  970   DAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASA  791
             DAQ+DA+Y A+ A+     +V+++E+GWPSKG+    A                   A+ 
Sbjct  239   DAQIDAIYFALMALNFRTIKVMVTETGWPSKGSPKETA-------------------ATP  279

Query  790   VNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKV  611
              NA  YN NL+R V+   GTP +P E L VY+FSLFNEN+K G  SERN+GLFYP++  V
Sbjct  280   DNAQTYNTNLIRHVINNTGTPAKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSV  339

Query  610   YDVPLTLAALGNRGSKAQVPP----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
             Y +  T     +  ++A +      TWC+A+       LQ A+D+ACG G  DC  IQP 
Sbjct  340   YSLDFTGRGAVDMTTEANITKSNGTTWCIASSKASQIDLQNAIDWACGPGNVDCTAIQPS  399

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
               C+ P+ L +HAS+AFNSYYQ+N      C FGG G  V + P +  C
Sbjct  400   QPCFEPDNLASHASFAFNSYYQQNGASDVACSFGGTGVKVDKDPSYDKC  448



>ref|XP_006584807.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Glycine 
max]
Length=498

 Score =   363 bits (932),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 192/469 (41%), Positives = 275/469 (59%), Gaps = 27/469 (6%)
 Frame = -3

Query  1684  FPRLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLY  1505
              P  +SL IFA+    LL    SGS  +G+ YGR ADDLP+P KV QL++   I  V++Y
Sbjct  1     MPTGFSL-IFAASLFLLLLDCCSGSF-VGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIY  58

Query  1504  DTDSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGN  1331
             D++  VL A + +GI   + +PN  L + +  QS  D W++++++PY   + I  + VG 
Sbjct  59    DSNIQVLKAFANTGIELMIGVPNSDLLSFSQFQSNADSWLKNSVLPYYPATKIAYITVGA  118

Query  1330  EVFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI  1151
             EV   P N + ++VPAM NV  +L K G+   +KVSS      +  S+PPS+G+F     
Sbjct  119   EVTESPNNASSFVVPAMTNVLTALKKLGLHKKIKVSSTHSLGVLSRSFPPSAGAFNSSHA  178

Query  1150  PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLF  971
               +KPML FL +  S  M++ YP+YAY  +  K+SLDYA+F  +  V+DPN GL+Y ++F
Sbjct  179   HFLKPMLEFLAENQSPFMIDIYPYYAYRDSRSKVSLDYALFDASSEVIDPNTGLLYTNMF  238

Query  970   DAQVDAVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASA  791
             DAQ+DA+Y A+ A+     +V+++E+GWPSKG+    A                   A+ 
Sbjct  239   DAQIDAIYFALMALNFRTIKVMVTETGWPSKGSPKETA-------------------ATP  279

Query  790   VNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKV  611
              NA  YN NL+R V+   GTP +P E L VY+FSLFNEN+K G  SERN+GLFYP++  V
Sbjct  280   DNAQTYNTNLIRHVINNTGTPAKPGEELDVYIFSLFNENRKPGLESERNWGLFYPDQTSV  339

Query  610   YDVPLTLAALGNRGSKAQVPP----TWCVANGDVGPERLQVALDYACGQGAADCGPIQPG  443
             Y +  T     +  ++A +      TWC+A+       LQ A+D+ACG G  DC  IQP 
Sbjct  340   YSLDFTGRGAVDMTTEANITKSNGTTWCIASSKASQIDLQNAIDWACGPGNVDCTAIQPS  399

Query  442   STCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
               C+ P+ L +HAS+AFNSYYQ+N      C FGG G  V + P +  C
Sbjct  400   QPCFEPDNLASHASFAFNSYYQQNGASDVACSFGGTGVKVDKDPSYDKC  448



>ref|XP_010476823.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Camelina 
sativa]
Length=503

 Score =   363 bits (932),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 273/451 (61%), Gaps = 26/451 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+PAKVVQL++   I  V++YD +S VL A   + I   + +PN  
Sbjct  27    GKVGVCYGRSADDLPTPAKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSD  86

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPA-NTTPYLVPAMKNVYASL  1259
             L+A + SQ+  D W++++++PY   + I  + VG E   DP  N + ++VPAM+NV   L
Sbjct  87    LNAFSQSQTNVDTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTGL  146

Query  1258  AKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPF  1079
              K G++  +KVS+ +    +  S+PPS+G+F       ++PML FL +  S  M++ YP+
Sbjct  147   RKVGLSKRIKVSTTLSLGVLSRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPY  206

Query  1078  YAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             YAY  + + +SLDY +F  +  V+DPN GL+YK++FDAQVDA+Y A+ A+     +++++
Sbjct  207   YAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVT  266

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             E+GWP+KG+                    E   AS  NA  YN N++R V+T  GTP +P
Sbjct  267   ETGWPTKGSPK------------------EKAAASPDNAETYNSNIIRHVVTDQGTPAKP  308

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALG-----NRGSKAQV  554
              E ++VY+FSLFNEN+K+G  SERN+GLFYP++  VY +  T  + G     +  + +  
Sbjct  309   GESMNVYIFSLFNENRKTGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGN  368

Query  553   PPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               +WC+A+       L+ ALD+ACG G  DC  IQP   C+ P+ LV+HAS+ FNSY+Q+
Sbjct  369   SNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDNLVSHASFVFNSYFQQ  428

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
             N      C FGGAG  V + P +  C + T 
Sbjct  429   NRATDVACSFGGAGVKVNKDPSYDKCIYITA  459



>ref|XP_006580483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Glycine max]
Length=499

 Score =   363 bits (931),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 184/446 (41%), Positives = 266/446 (60%), Gaps = 26/446 (6%)
 Frame = -3

Query  1612  SGS-IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPN  1436
             SGS +G+ YGR ADDLP+P KV QL++   I  V++YD++  VL A + +GI   + +PN
Sbjct  22    SGSFVGVCYGRSADDLPTPDKVAQLVQLHKIKYVRIYDSNLQVLKAFANTGIELMIGVPN  81

Query  1435  EQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYAS  1262
               L + +  QS  D W++++++PY   + I  + VG EV   P N + ++VPAM NV  +
Sbjct  82    SDLLSLSQFQSNADSWLKNSVLPYYPATKITYITVGAEVTESPNNASSFVVPAMTNVLTA  141

Query  1261  LAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYP  1082
             L K G+   +KVSS      +  S+PPS+G+F       +KPML FL +  S  M++ YP
Sbjct  142   LKKLGLHKKIKVSSTHSLGVLSRSFPPSAGAFNSSHAHFLKPMLEFLAENQSPFMIDIYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             +YAY  +  K+SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+ A+     +V++
Sbjct  202   YYAYRDSRSKVSLDYALFEASSEVIDPNTGLLYTNMFDAQIDAIYFALMALNFRTIKVMV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+    A                   A+  NA  YN NL+R V+   GTP +
Sbjct  262   TETGWPSKGSPKEIA-------------------ATPDNAQTYNTNLIRHVINNTGTPAK  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVP---  551
             P E L VY+FSLFNEN+K G  SERN+GLFYP++  VY +  T     +  ++A +    
Sbjct  303   PGEELDVYIFSLFNENRKPGMESERNWGLFYPDQTSVYSLDFTGRGAVDMTTEANITRSN  362

Query  550   -PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQK  374
               TWC+A+       LQ A+D+ACG G  DC  IQP   C+ P+ L +HAS+AFNSYYQ+
Sbjct  363   GTTWCIASSKASQIDLQNAIDWACGPGNVDCTAIQPSQPCFEPDNLASHASFAFNSYYQQ  422

Query  373   NARGPGTCYFGGAGYVVTQPPRFGSC  296
             N      C FGG G  V + P + +C
Sbjct  423   NGASDVACSFGGTGVTVDKDPSYDNC  448



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   362 bits (930),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 187/446 (42%), Positives = 267/446 (60%), Gaps = 25/446 (6%)
 Frame = -3

Query  1603  IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLS  1424
             IG+ YGR ADDLP+P KV QL+K Q I  V++YD++  V+ A +  G+   V +PN  L 
Sbjct  25    IGVCYGRNADDLPTPDKVAQLVKLQQIKYVRIYDSNIQVIKAFANIGVELMVGVPNSDLL  84

Query  1423  AAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKY  1250
             A +  QS  D W+ ++I+PY   ++I  + VG E+   P N +  +VPAM NV+ +L K 
Sbjct  85    AFSQYQSNVDTWLNNSILPYYPATMITYITVGAEITESPVNVSSLVVPAMTNVHTALKKA  144

Query  1249  GVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFYAY  1070
             G+   +KVSS      +  S+PPS+G+F       +KPML FL +  S  M++ YP+YAY
Sbjct  145   GLHKRIKVSSTHSLGVLSRSFPPSAGAFNSSYAFFLKPMLEFLVENQSPFMVDLYPYYAY  204

Query  1069  EANTDKISLDYAVFGDNQG-VVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISES  893
               +   +SL+YA+F  +   V+DPN GLVY ++FDAQ+DA++ A+ A+     +V+++ES
Sbjct  205   RDSPSNVSLNYALFSSSSSDVIDPNTGLVYSNMFDAQLDAIFFALMALNFRTLKVMVTES  264

Query  892   GWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDE  713
             GWP+KG+    A                   A+  NA  YN NL+R V+   GTP +P E
Sbjct  265   GWPNKGSAKETA-------------------ATPDNAQTYNTNLIRHVINDTGTPAKPGE  305

Query  712   PLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP---TW  542
              + VY+FSLFNEN+K G  SERN+GLFYP++  +Y + LT     +  + A +     TW
Sbjct  306   EIDVYIFSLFNENRKPGLESERNWGLFYPDQTSIYSLDLTGRGNVDVITGANITSSNGTW  365

Query  541   CVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARG  362
             CVA+ +     LQ ALD+ACG G  DC  IQP   CY P+TL++HASYAFNSYYQ+N   
Sbjct  366   CVASSNASELDLQNALDWACGPGNVDCSAIQPSQPCYQPDTLLSHASYAFNSYYQQNGAT  425

Query  361   PGTCYFGGAGYVVTQPPRFGSCEFPT  284
                C FGG G  +T+ P +  C + T
Sbjct  426   DVACSFGGTGVKITKDPSYDKCVYAT  451



>ref|NP_001059883.1| Os07g0539100 [Oryza sativa Japonica Group]
 dbj|BAC84500.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF21797.1| Os07g0539100 [Oryza sativa Japonica Group]
 dbj|BAG88368.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90302.1| unnamed protein product [Oryza sativa Japonica Group]
Length=553

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 214/471 (45%), Positives = 287/471 (61%), Gaps = 38/471 (8%)
 Frame = -3

Query  1678  RLYSLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDT  1499
             +L +L +  +L L LL  S + +G IG+ YGR A +L  P +VV+LL +  IT V++YDT
Sbjct  6     KLSALLVATALPLLLL--STADAGEIGVCYGRDASNLIDPPEVVKLLNANSITMVRIYDT  63

Query  1498  DSTVLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY---KSIIETVAVGNE  1328
             D TVL+AL+ +GI   V LPN+ L++A A       WV++N+VPY    ++I  VAVGNE
Sbjct  64    DPTVLNALANTGIKVMVMLPNKDLASAGADVGSATNWVKNNVVPYLNQGTLINGVAVGNE  123

Query  1327  VFVDPANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELI-  1151
             VF      T  LV AM+NV  +LA   +A  +KVS+PI F A+  S+PPS G FK  +  
Sbjct  124   VFKQQPELTGMLVSAMQNVQMALANLNLADGIKVSTPIAFDALDVSFPPSDGRFKDSIAQ  183

Query  1150  PVIKPMLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLF  971
              V+KPM+ FL +TGS+L++N YP YA    +  IS++YA F  N GV+D   G++Y SLF
Sbjct  184   SVMKPMIDFLVRTGSYLLVNLYPMYAAADPSTHISIEYATFRPNSGVLDEKTGIMYFSLF  243

Query  970   DAQVDAVYAAINAVKPGHFR----------VVISESGWPSKGNRNAAAYNGKKAAVNAAA  821
             DA++DAVYAAI+ V  G  R          V ++E+G  S             A +NA A
Sbjct  244   DAELDAVYAAISKVSGGSLRASLAQGDQMLVQVAETGHSSGNTFGGPVVVEADADLNAIA  303

Query  820   YDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNY  641
                 T P    NA AYN  L+RRVL+  G+P + D  +S Y+FSLFNEN K GP +E ++
Sbjct  304   ----TIP----NAKAYNNGLIRRVLS--GSPGKHD--VSAYIFSLFNENLKPGPATEGHF  351

Query  640   GLFYPNEQKVYDVPLTLAALGNRGSKAQVP--PTWCVANGDVGPERLQVALDYACGQGAA  467
             GLFYPN Q+VY+V         +G ++  P   +WCVAN +V    LQ ALD+AC  G A
Sbjct  352   GLFYPNGQQVYEVNF-------QGGRSPCPTNASWCVANPNVDNAALQRALDWACNNG-A  403

Query  466   DCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQP  314
             DC  IQ G  CY PNTLVAHASYAFN YYQ+  +  GTC F G  ++V +P
Sbjct  404   DCSAIQLGKACYEPNTLVAHASYAFNDYYQRKGQASGTCNFNGVAFIVYKP  454


 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = -3

Query  550  PTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKN  371
            P+WCVA   VG  +LQ ALDYACG   ADC  IQ G+ C+NP+T VAHA+YAFN YYQ  
Sbjct  463  PSWCVAKDSVGEAQLQNALDYACGS-CADCSAIQRGAQCFNPDTKVAHATYAFNDYYQTA  521

Query  370  ARGPGTCYFGGAGYVVTQPPRFGSCEFP  287
             R  G+C F GA  +VTQ P+ G+C  P
Sbjct  522  GRASGSCDFAGAATIVTQQPKIGNCLLP  549



>ref|NP_001144992.1| uncharacterized protein LOC100278152 precursor [Zea mays]
 gb|ACG44298.1| hypothetical protein [Zea mays]
Length=477

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/439 (43%), Positives = 271/439 (62%), Gaps = 25/439 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G IG+ YGR ADDLP+P KV QL++ Q I  V++YDT+  V+ A + +G+   V +PN  
Sbjct  24    GKIGVCYGRNADDLPAPDKVAQLIQQQSIKYVRIYDTNIDVIKAFANTGVELMVGVPNSD  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L A A  QS  D W++++I+PY   ++I  + VG EV   PAN +  +VPAM+NV+ +L 
Sbjct  84    LLAFAQYQSNVDTWLKNSILPYYPDTMITYITVGAEVTESPANVSALVVPAMRNVHTALK  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFY  1076
             K G+   + +SS      +  S+PPS+G+F       +KPML FL +  +  M++ YP+Y
Sbjct  144   KAGLHKKITISSTHSLGILSRSFPPSAGAFNSSYAYFLKPMLQFLVENQAPFMVDLYPYY  203

Query  1075  AYEANTDKISLDYAVFG-DNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVIS  899
             AY+ +   +SL+YA+F  ++Q V+DPN GLVY ++FDAQVD+++ A+ A+     +++I+
Sbjct  204   AYQNSRSNVSLNYALFSPESQDVIDPNTGLVYTNMFDAQVDSIFFALMALNFKTLKIMIT  263

Query  898   ESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRP  719
             ESGWP+KG            AV       ETG A+  NA  YN NL+R V+   GTP +P
Sbjct  264   ESGWPNKG------------AVK------ETG-ATPDNAQTYNTNLIRHVVNDSGTPAKP  304

Query  718   DEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLTLAALGNRGSKAQVPP---  548
              E + VY+FSLFNEN+K G  SERN+GLF+P++  +Y +  T     +  + A +     
Sbjct  305   GEEIDVYIFSLFNENRKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANG  364

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             TWC+A+ +     LQ AL++ACG G  DC  IQP   CY P+TL +HASYAFNSYYQ+N 
Sbjct  365   TWCIASTNASETDLQNALNWACGPGNVDCSAIQPSQPCYQPDTLTSHASYAFNSYYQQNG  424

Query  367   RGPGTCYFGGAGYVVTQPP  311
                  C FGGAG   T+ P
Sbjct  425   ANVVACDFGGAGIRTTKDP  443



>gb|AIR93910.1| glucanase [Cicer arietinum]
Length=454

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/450 (42%), Positives = 268/450 (60%), Gaps = 34/450 (8%)
 Frame = -3

Query  1612  SGS-IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPN  1436
             SGS IGI YGR ADDLP+P KV QL++   I  V++YD++  VL A + +G+   + +PN
Sbjct  22    SGSFIGICYGRNADDLPTPDKVAQLVQLHKIKYVRIYDSNIQVLKAFANTGVELMIGVPN  81

Query  1435  EQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYAS  1262
               L + +  QS  D W++++++PY   + I  + VG EV     NT+  +VPAM NV  +
Sbjct  82    SDLLSLSQFQSNADAWLKNSVLPYYPATKITYITVGAEVTESSYNTSSLVVPAMSNVLTA  141

Query  1261  LAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYP  1082
             L K G+   +KVSS      +  S+PPS+G+F       +KPML FL +  S  M++ YP
Sbjct  142   LKKLGLHKKIKVSSTHSLGVLSRSFPPSAGAFNSSHAHFLKPMLEFLAENQSPFMIDIYP  201

Query  1081  FYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVI  902
             +YAY  +++K+SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+ A+     +V++
Sbjct  202   YYAYRDSSNKVSLDYALFHASSEVIDPNTGLLYTNMFDAQIDAIYFALMALNFRTIKVMV  261

Query  901   SESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLR  722
             +E+GWPSKG+    A                   A+  NA  YN NL+R V+   GTP +
Sbjct  262   TETGWPSKGSPKEKA-------------------ATPDNAQTYNTNLIRHVINNTGTPAK  302

Query  721   PDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYD--------VPLTLAALGNRGS  566
             P E L +Y+FSLFNEN+K G  SERN+GLFYP++  VY+        + +T AA   R +
Sbjct  303   PGEELDIYIFSLFNENRKPGLESERNWGLFYPDQTSVYNLDFTGRGAIDMTTAANVTRSN  362

Query  565   KAQVPPTWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNS  386
             K     +WC+A+       LQ ALD+ACG G  DC  IQP   C+ P+ L +HAS+AFNS
Sbjct  363   KT----SWCIASTKASEIDLQNALDWACGPGNVDCRAIQPSQPCFEPDNLASHASFAFNS  418

Query  385   YYQKNARGPGTCYFGGAGYVVTQPPRFGSC  296
             YYQ+N      C FGG G  V + P +  C
Sbjct  419   YYQQNGASDVACSFGGTGVKVDKDPSYDKC  448



>ref|XP_010545323.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=501

 Score =   362 bits (928),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/449 (40%), Positives = 266/449 (59%), Gaps = 25/449 (6%)
 Frame = -3

Query  1609  GSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQ  1430
             G +G+ YGR ADDLP+P KV QL++   I  V++YD+D  VL A + SGI   + +PN  
Sbjct  24    GKVGVCYGRSADDLPTPDKVSQLIRQHNIKYVRIYDSDVQVLKAFANSGIELMIGVPNSD  83

Query  1429  LSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLA  1256
             L + +  QS  D W++++++P+   + I  + VG EV  D  N +  +VPAM+NV  +L 
Sbjct  84    LLSFSHHQSNVDTWLKNSVLPFYPATKITHITVGAEVTEDTHNASSLVVPAMQNVLTALR  143

Query  1255  KYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFY  1076
             K G++  +KVSS      +  S+PPS+G+F       ++PML FL +  S  M++ YP++
Sbjct  144   KVGLSRRIKVSSTHSLGILSRSFPPSAGAFNSSFAYFLRPMLEFLAENQSPFMIDLYPYF  203

Query  1075  AYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISE  896
             AY  +   +SL+YA+F  +  V+DPN GL+YK++FDAQVDA+  A+ A+     +++++E
Sbjct  204   AYRDSPSNVSLNYALFQSSSEVIDPNTGLLYKNMFDAQVDALNFALTALNFRTIKIMVTE  263

Query  895   SGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPD  716
             +GWPSKG+    A N                     NA  YN NL+R +L   GTP +P 
Sbjct  264   TGWPSKGSPKEKAANPD-------------------NAETYNTNLIRHILANQGTPAKPG  304

Query  715   EPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT----LAALGNRGSKAQVPP  548
             E + VY+FSLFNEN+KSG  SERN+GLFYP++  VY +  T    L    N         
Sbjct  305   EAMDVYVFSLFNENRKSGLDSERNWGLFYPDQTSVYHLDFTGKNNLIPSSNSSVTNSSGT  364

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             +WC+A+     + L+ ALD+ACG G  DC  IQP   C+ P+TLV+HAS+ FNSY+Q+N 
Sbjct  365   SWCIASSKASEKDLRSALDWACGPGNVDCTAIQPSQPCFEPDTLVSHASFVFNSYFQQNG  424

Query  367   RGPGTCYFGGAGYVVTQPPRFGSCEFPTG  281
                  C FGGAG  V + P + +C + T 
Sbjct  425   ATDVACSFGGAGVKVNKDPSYDNCLYVTA  453



>gb|EPS73640.1| hypothetical protein M569_01113 [Genlisea aurea]
Length=508

 Score =   362 bits (929),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/474 (40%), Positives = 277/474 (58%), Gaps = 36/474 (8%)
 Frame = -3

Query  1669  SLCIFASLFLSLLRHSVSGSGSIGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDST  1490
             S+ +  + F  LL       G++GI YGR ADDLP+P K VQL+KSQ I   ++YD++  
Sbjct  4     SVAVILATFHLLLFSGFCNGGTVGICYGRNADDLPTPDKAVQLIKSQNIKYARIYDSNIQ  63

Query  1489  VLDALSGSGISTTVALPNEQLSAAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVD  1316
             V+ A + +GI   + +PN  L   +  QS  D W++++++PY   + I  + VG EV   
Sbjct  64    VIKAFANTGIELVIGIPNSDLLPFSQFQSNADTWLRNSVLPYYPATKINFITVGAEVTEA  123

Query  1315  PANTTPYLVPAMKNVYASLAKYGVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKP  1136
             P N +  LVPAM+NV+ +L K G+   +KVSS      +  S+PPS+G+F  +    ++P
Sbjct  124   PNNVSAMLVPAMQNVFTALRKAGLHRRIKVSSTHSLGVLSRSFPPSAGAFNSKHAFFLRP  183

Query  1135  MLSFLEQTGSFLMLNAYPFYAYEANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVD  956
             ML FL +  S  M++ YP+YAY  ++  +SLDYA+F  +  V+DPN GL+Y ++ DAQ+D
Sbjct  184   MLEFLAENDSPFMVDVYPYYAYADSSSNVSLDYALFESSSEVIDPNTGLLYTNMLDAQID  243

Query  955   AVYAAINAVKPGHFRVVISESGWPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAA  776
             A+  A+  +     +++I+E+GWPSKG+ N                  ETG A+  NA  
Sbjct  244   AINYALMGLNFKTIKIMITETGWPSKGSPN------------------ETG-ATPDNAQT  284

Query  775   YNGNLVRRVLTGGGTPLRPDEPLSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPL  596
             YN NL+R ++  GGTP +P   +  Y+FSLFNEN+K G  SERN+G+F+P++  VY++  
Sbjct  285   YNTNLIRHIVNDGGTPAKPGVAMDAYVFSLFNENRKPGLDSERNWGVFFPDQTSVYNLDF  344

Query  595   TLAALGNRGSKAQVP----------PTWCVANGDVGPERLQVALDYACGQGAADCGPIQP  446
             T      RG  A+ P           +WC+A        LQ  LD+ACG G  DC PIQP
Sbjct  345   T-----GRGVVARPPDANNTTISNGTSWCIAVMGASEADLQHGLDWACGSGNVDCTPIQP  399

Query  445   GSTCYNPNTLVAHASYAFNSYYQKNARGPGTCYFGGAGYVVTQPPRFGSCEFPT  284
                C+ P+ L +HASYAFNSYYQ+N      C FGGAG+  ++ P + SC + T
Sbjct  400   KQPCFEPDNLASHASYAFNSYYQQNGASEVACAFGGAGFRTSKNPSYDSCIYAT  453



>ref|XP_007012992.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
 gb|EOY30611.1| O-Glycosyl hydrolases family 17 protein isoform 4 [Theobroma 
cacao]
Length=475

 Score =   360 bits (925),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 185/440 (42%), Positives = 265/440 (60%), Gaps = 29/440 (7%)
 Frame = -3

Query  1603  IGINYGRIADDLPSPAKVVQLLKSQGITKVKLYDTDSTVLDALSGSGISTTVALPNEQLS  1424
             +G+ YGR ADDLP+P KV QL++   I  +++YD++  VL A + +G+   V +PN  L 
Sbjct  26    VGVCYGRNADDLPTPDKVAQLVQLHKIKYLRIYDSNIQVLKAFANTGVELMVGVPNSDLL  85

Query  1423  AAAASQSFTDRWVQSNIVPY--KSIIETVAVGNEVFVDPANTTPYLVPAMKNVYASLAKY  1250
             A +  QS  D W++++I+PY   + I  + VG EV   P N +  +VPAM+N+  +L K 
Sbjct  86    AFSQFQSNADSWLKNSILPYYPATKITYITVGLEVTESPDNASALVVPAMQNILTALKKV  145

Query  1249  GVAPSVKVSSPIGFSAMQTSYPPSSGSFKPELIPVIKPMLSFLEQTGSFLMLNAYPFYAY  1070
             G+   +KVSS      +  S+PPS+G+F       +KPML FL +  S  M++ YP+YAY
Sbjct  146   GLHKRIKVSSTHSLGVLSRSFPPSAGAFNSSHAYFLKPMLEFLAENQSPFMIDLYPYYAY  205

Query  1069  EANTDKISLDYAVFGDNQGVVDPNNGLVYKSLFDAQVDAVYAAINAVKPGHFRVVISESG  890
               + + +SLDYA+F  +  V+DPN GL+Y ++FDAQ+DA+Y A+ A+     R++++E+G
Sbjct  206   RDSPNNVSLDYALFESSSEVIDPNTGLLYTNMFDAQIDALYFALMALNFRTIRIMVTETG  265

Query  889   WPSKGNRNAAAYNGKKAAVNAAAYDGETGPASAVNAAAYNGNLVRRVLTGGGTPLRPDEP  710
             WPSKG+    A                   A+  NA  YN NL+R V+   GTP +P E 
Sbjct  266   WPSKGSSKEKA-------------------ATPDNAQTYNTNLIRHVINDSGTPAKPGEE  306

Query  709   LSVYLFSLFNENQKSGPISERNYGLFYPNEQKVYDVPLT------LAALGNRGSKAQVPP  548
             L VY+FSLFNEN+K G  SERN+GLFYP++  VY++  T      +   GN G+K+    
Sbjct  307   LDVYIFSLFNENRKPGMESERNWGLFYPDQTSVYNLDFTGKGAVDMTNSGN-GTKSN-GT  364

Query  547   TWCVANGDVGPERLQVALDYACGQGAADCGPIQPGSTCYNPNTLVAHASYAFNSYYQKNA  368
             TWC+A+       LQ ALD+ACG G  DC  IQP   C+ P+ LV+HAS+AFNSYYQ+N 
Sbjct  365   TWCIASSKASESDLQNALDWACGSGNVDCSAIQPSQPCFEPDNLVSHASFAFNSYYQQNG  424

Query  367   RGPGTCYFGGAGYVVTQPPR  308
                  C FGG G  V + PR
Sbjct  425   ASDVACSFGGNGVKVDKDPR  444



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5015338356684