BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24719_g1_i2 len=2062 path=[2335:0-390 2725:391-394 58:395-429
@4838@!:430-1572 3901:1573-1589 3918:1590-2061]

Length=2062
                                                                      Score     E

ref|XP_009782930.1|  PREDICTED: laccase-4-like                          952   0.0     
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         950   0.0     
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             950   0.0     
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          948   0.0     
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              946   0.0     
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          943   0.0     
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         943   0.0     
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             941   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          934   0.0     
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          929   0.0     
ref|XP_007026973.1|  Laccase 17                                         924   0.0     
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             924   0.0     
gb|KHF97742.1|  Laccase-17 -like protein                                923   0.0     
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         923   0.0     
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              921   0.0     Vitis vinifera
ref|XP_002531562.1|  laccase, putative                                  919   0.0     Ricinus communis
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              917   0.0     
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   917   0.0     Vitis vinifera
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   916   0.0     
ref|XP_007026974.1|  Laccase 17                                         915   0.0     
ref|XP_007026975.1|  Laccase 17                                         915   0.0     
emb|CBI30528.3|  unnamed protein product                                914   0.0     
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         907   0.0     
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         906   0.0     
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             905   0.0     
ref|XP_010107320.1|  hypothetical protein L484_009454                   902   0.0     
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         902   0.0     
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         902   0.0     
ref|XP_002284473.1|  PREDICTED: laccase-17                              898   0.0     Vitis vinifera
emb|CBI31631.3|  unnamed protein product                                898   0.0     
ref|XP_002282823.1|  PREDICTED: laccase-17                              896   0.0     Vitis vinifera
emb|CBI16199.3|  unnamed protein product                                896   0.0     
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         893   0.0     
emb|CBI30529.3|  unnamed protein product                                893   0.0     
gb|KHN16229.1|  Laccase-17                                              892   0.0     
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         892   0.0     
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         892   0.0     
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              892   0.0     
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              891   0.0     
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         890   0.0     Vitis vinifera
gb|AAB17194.1|  laccase                                                 890   0.0     Liriodendron tulipifera
gb|KHN24986.1|  Laccase-17                                              889   0.0     
gb|KHN16226.1|  Laccase-17                                              889   0.0     
emb|CBI31651.3|  unnamed protein product                                889   0.0     
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             889   0.0     
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         888   0.0     
ref|XP_002278215.1|  PREDICTED: laccase-17                              888   0.0     Vitis vinifera
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         887   0.0     
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             887   0.0     
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         887   0.0     
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             887   0.0     
gb|AAB17192.1|  laccase                                                 887   0.0     Liriodendron tulipifera
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         887   0.0     
emb|CAN60069.1|  hypothetical protein VITISV_012401                     887   0.0     Vitis vinifera
ref|XP_006602579.1|  PREDICTED: laccase-17-like isoform X2              886   0.0     
ref|XP_009597234.1|  PREDICTED: laccase-4-like                          885   0.0     
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   885   0.0     
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         885   0.0     
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         885   0.0     
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1              884   0.0     
ref|XP_002282815.1|  PREDICTED: laccase-17                              884   0.0     Vitis vinifera
ref|XP_007022468.1|  Laccase 17                                         884   0.0     
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         884   0.0     
gb|KHN14004.1|  Laccase-17                                              883   0.0     
gb|AAB17193.1|  laccase                                                 883   0.0     Liriodendron tulipifera
ref|XP_003530894.1|  PREDICTED: laccase-17-like                         883   0.0     
emb|CDP06593.1|  unnamed protein product                                882   0.0     
ref|XP_003632204.1|  PREDICTED: laccase-17                              881   0.0     
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         880   0.0     
gb|KHN24984.1|  Laccase-17                                              880   0.0     
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         879   0.0     
emb|CDP06592.1|  unnamed protein product                                879   0.0     
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         879   0.0     
emb|CAN60348.1|  hypothetical protein VITISV_005802                     879   0.0     Vitis vinifera
ref|XP_002299296.1|  laccase family protein                             879   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         878   0.0     
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             878   0.0     
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         877   0.0     
gb|KHN16224.1|  Laccase-17                                              876   0.0     
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         876   0.0     
ref|XP_009621093.1|  PREDICTED: laccase-17-like                         875   0.0     
ref|XP_009587566.1|  PREDICTED: laccase-17-like                         873   0.0     
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   873   0.0     
ref|XP_007016607.1|  Laccase 17                                         872   0.0     
ref|XP_009774063.1|  PREDICTED: laccase-17-like                         871   0.0     
ref|XP_002278275.1|  PREDICTED: laccase-17                              871   0.0     Vitis vinifera
ref|XP_002531824.1|  laccase, putative                                  870   0.0     Ricinus communis
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         870   0.0     
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         870   0.0     
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         870   0.0     
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             870   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         869   0.0     
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             869   0.0     
ref|XP_010092993.1|  hypothetical protein L484_007174                   869   0.0     
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          869   0.0     
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         869   0.0     
gb|KHN16225.1|  Laccase-17                                              868   0.0     
ref|XP_009796361.1|  PREDICTED: laccase-17-like                         868   0.0     
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 868   0.0     
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         868   0.0     
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         867   0.0     
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 867   0.0     
ref|XP_008223967.1|  PREDICTED: laccase-17                              867   0.0     
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   867   0.0     
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             867   0.0     
ref|XP_007016584.1|  Laccase 17                                         867   0.0     
ref|XP_010264410.1|  PREDICTED: laccase-17-like                         867   0.0     
gb|AES79165.2|  laccase/diphenol oxidase family protein                 865   0.0     
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          865   0.0     
ref|XP_002271047.2|  PREDICTED: laccase-17                              864   0.0     Vitis vinifera
ref|XP_008384938.1|  PREDICTED: laccase-2-like                          864   0.0     
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         864   0.0     
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         864   0.0     
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             864   0.0     
ref|XP_004302730.1|  PREDICTED: laccase-17-like                         863   0.0     
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    863   0.0     
emb|CBI30527.3|  unnamed protein product                                863   0.0     
emb|CAN72263.1|  hypothetical protein VITISV_037366                     863   0.0     Vitis vinifera
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          863   0.0     
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         863   0.0     
gb|KHN07178.1|  Laccase-17                                              860   0.0     
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         859   0.0     
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         859   0.0     
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         858   0.0     
ref|XP_010264408.1|  PREDICTED: laccase-17-like                         858   0.0     
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         858   0.0     
ref|XP_008356891.1|  PREDICTED: laccase-2                               857   0.0     
ref|XP_002520231.1|  laccase, putative                                  857   0.0     Ricinus communis
ref|XP_003623041.1|  Laccase                                            857   0.0     
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         857   0.0     
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         857   0.0     
ref|XP_010043648.1|  PREDICTED: laccase-17-like                         855   0.0     
ref|XP_004246869.2|  PREDICTED: laccase-17-like                         855   0.0     
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             854   0.0     
ref|XP_003622947.1|  Laccase                                            854   0.0     
emb|CDP01507.1|  unnamed protein product                                853   0.0     
ref|XP_009597231.1|  PREDICTED: laccase-17-like                         852   0.0     
ref|XP_009375916.1|  PREDICTED: laccase-2-like                          852   0.0     
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                852   0.0     
ref|XP_006341009.1|  PREDICTED: laccase-17-like                         851   0.0     
ref|XP_011042451.1|  PREDICTED: laccase-17-like                         850   0.0     
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                850   0.0     
ref|XP_010106521.1|  hypothetical protein L484_025281                   850   0.0     
ref|XP_006363101.1|  PREDICTED: laccase-17-like                         850   0.0     
ref|XP_003622953.1|  Laccase                                            850   0.0     
ref|XP_006400889.1|  hypothetical protein EUTSA_v10013109mg             849   0.0     
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         849   0.0     
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         848   0.0     
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         848   0.0     
ref|XP_009364426.1|  PREDICTED: laccase-2-like                          847   0.0     
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   847   0.0     
ref|XP_002317505.2|  hypothetical protein POPTR_0011s12100g             847   0.0     Populus trichocarpa [western balsam poplar]
emb|CDY09232.1|  BnaA02g06580D                                          847   0.0     
emb|CDY31581.1|  BnaA10g12900D                                          847   0.0     
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         847   0.0     
ref|XP_010031544.1|  PREDICTED: laccase-17-like                         847   0.0     
ref|XP_010443793.1|  PREDICTED: laccase-17                              846   0.0     
ref|XP_011029469.1|  PREDICTED: laccase-17-like                         846   0.0     
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          846   0.0     
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         845   0.0     
ref|XP_002317504.2|  hypothetical protein POPTR_0011s12090g             845   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006341211.1|  PREDICTED: laccase-17-like                         845   0.0     
ref|XP_011089492.1|  PREDICTED: laccase-17                              844   0.0     
ref|XP_008222248.1|  PREDICTED: laccase-2                               844   0.0     
ref|XP_010535559.1|  PREDICTED: laccase-17                              843   0.0     
ref|XP_010256880.1|  PREDICTED: laccase-4-like                          843   0.0     
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             842   0.0     
ref|XP_011019845.1|  PREDICTED: laccase-2-like                          842   0.0     
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         841   0.0     
emb|CAN73336.1|  hypothetical protein VITISV_033042                     839   0.0     Vitis vinifera
ref|XP_002308164.1|  hypothetical protein POPTR_0006s08740g             839   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009419259.1|  PREDICTED: laccase-4-like                          839   0.0     
ref|XP_010541373.1|  PREDICTED: laccase-17                              841   0.0     
ref|XP_010483648.1|  PREDICTED: laccase-17-like                         840   0.0     
ref|XP_009414328.1|  PREDICTED: laccase-17-like                         838   0.0     
ref|XP_010455850.1|  PREDICTED: laccase-17-like                         837   0.0     
ref|NP_200810.1|  laccase 17                                            837   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016364.1|  Laccase 2                                          838   0.0     
ref|XP_004246356.1|  PREDICTED: laccase-17-like                         837   0.0     
ref|XP_010046415.1|  PREDICTED: laccase-17-like                         837   0.0     
ref|XP_009796024.1|  PREDICTED: laccase-2-like                          835   0.0     
ref|XP_006280235.1|  hypothetical protein CARUB_v10026150mg             835   0.0     
ref|XP_002864664.1|  hypothetical protein ARALYDRAFT_496140             835   0.0     
emb|CDX71061.1|  BnaC03g11450D                                          834   0.0     
ref|XP_009126628.1|  PREDICTED: laccase-17-like                         834   0.0     
ref|XP_002520232.1|  laccase, putative                                  834   0.0     Ricinus communis
gb|KFK27539.1|  hypothetical protein AALP_AA8G396300                    833   0.0     
ref|XP_010039666.1|  PREDICTED: laccase-17-like                         832   0.0     
ref|XP_002531565.1|  laccase, putative                                  831   0.0     Ricinus communis
emb|CDX88735.1|  BnaA03g09140D                                          831   0.0     
ref|XP_010541371.1|  PREDICTED: laccase-17-like                         831   0.0     
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         831   0.0     
ref|XP_009760365.1|  PREDICTED: laccase-17-like                         830   0.0     
ref|XP_008803092.1|  PREDICTED: laccase-17-like                         830   0.0     
emb|CAA74105.1|  laccase                                                828   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          827   0.0     
ref|XP_009630096.1|  PREDICTED: laccase-17-like                         828   0.0     
ref|XP_006488364.1|  PREDICTED: laccase-17-like                         827   0.0     
ref|XP_006429120.1|  hypothetical protein CICLE_v10011363mg             827   0.0     
gb|KDO51175.1|  hypothetical protein CISIN_1g008090mg                   827   0.0     
ref|XP_011095204.1|  PREDICTED: laccase-17-like                         826   0.0     
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          826   0.0     
ref|XP_009131958.1|  PREDICTED: laccase-17                              826   0.0     
ref|XP_006480879.1|  PREDICTED: laccase-17-like                         825   0.0     
ref|XP_006856865.1|  hypothetical protein AMTR_s00055p00189700          825   0.0     
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          825   0.0     
ref|XP_008359730.1|  PREDICTED: laccase-17-like                         825   0.0     
ref|XP_004514389.1|  PREDICTED: laccase-17-like                         823   0.0     
ref|XP_004246425.1|  PREDICTED: laccase-17-like                         823   0.0     
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          823   0.0     
gb|EYU41744.1|  hypothetical protein MIMGU_mgv1a025875mg                822   0.0     
ref|XP_007026983.1|  Laccase 17 isoform 1                               823   0.0     
ref|XP_010906603.1|  PREDICTED: laccase-17-like                         822   0.0     
gb|KHG14663.1|  Laccase-4                                               819   0.0     
ref|NP_001105875.1|  putative laccase precursor                         822   0.0     Zea mays [maize]
ref|XP_010245131.1|  PREDICTED: laccase-17-like                         822   0.0     
ref|XP_009345405.1|  PREDICTED: laccase-17-like                         821   0.0     
gb|AAB17191.1|  laccase                                                 821   0.0     Liriodendron tulipifera
ref|XP_009338597.1|  PREDICTED: laccase-17-like                         821   0.0     
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          821   0.0     
ref|XP_002298223.2|  hypothetical protein POPTR_0001s18500g             820   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004970543.1|  PREDICTED: laccase-12/13-like                      820   0.0     
ref|XP_010047833.1|  PREDICTED: laccase-17-like                         820   0.0     
ref|XP_006644993.1|  PREDICTED: laccase-4-like                          819   0.0     
ref|XP_006341212.1|  PREDICTED: laccase-17-like                         819   0.0     
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          819   0.0     Sorghum bicolor [broomcorn]
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      818   0.0     Zea mays [maize]
dbj|BAJ99773.1|  predicted protein                                      817   0.0     
ref|XP_010039668.1|  PREDICTED: laccase-17-like                         816   0.0     
ref|XP_009603099.1|  PREDICTED: laccase-2-like                          817   0.0     
ref|XP_003530212.1|  PREDICTED: laccase-17-like                         817   0.0     
ref|XP_007132049.1|  hypothetical protein PHAVU_011G062600g             818   0.0     
gb|EYU41740.1|  hypothetical protein MIMGU_mgv1a026682mg                816   0.0     
ref|XP_002313424.1|  hypothetical protein POPTR_0009s03940g             816   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006592190.1|  PREDICTED: laccase-2-like isoform X2               817   0.0     
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          816   0.0     
gb|ACN34362.1|  unknown                                                 816   0.0     Zea mays [maize]
ref|XP_008369916.1|  PREDICTED: laccase-17-like                         816   0.0     
ref|XP_006592189.1|  PREDICTED: laccase-2-like isoform X1               816   0.0     
emb|CAN80346.1|  hypothetical protein VITISV_003134                     817   0.0     Vitis vinifera
gb|KEH22909.1|  laccase/diphenol oxidase family protein                 815   0.0     
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          815   0.0     Sorghum bicolor [broomcorn]
ref|XP_008387791.1|  PREDICTED: laccase-17-like                         815   0.0     
gb|KDP35659.1|  hypothetical protein JCGZ_09097                         815   0.0     
ref|XP_011032272.1|  PREDICTED: laccase-2-like                          815   0.0     
ref|XP_009407501.1|  PREDICTED: laccase-4-like                          815   0.0     
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          815   0.0     
ref|XP_007208011.1|  hypothetical protein PRUPE_ppa003319mg             815   0.0     
ref|XP_006586249.1|  PREDICTED: laccase-17-like isoform X2              813   0.0     
gb|AFW84624.1|  putative laccase family protein                         814   0.0     
ref|NP_001044772.1|  Os01g0842400                                       814   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     814   0.0     Zea mays [maize]
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          813   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006350913.1|  PREDICTED: laccase-2-like                          814   0.0     
gb|EMT20803.1|  Laccase-4                                               813   0.0     
ref|XP_008240736.1|  PREDICTED: laccase-17-like                         812   0.0     
ref|XP_011043780.1|  PREDICTED: laccase-2-like                          812   0.0     
ref|XP_009388612.1|  PREDICTED: laccase-4-like                          810   0.0     
gb|EEC71777.1|  hypothetical protein OsI_04389                          811   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          810   0.0     
ref|XP_007140515.1|  hypothetical protein PHAVU_008G119200g             810   0.0     
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         810   0.0     
ref|XP_003562893.1|  PREDICTED: laccase-4-like                          810   0.0     
ref|XP_006649837.1|  PREDICTED: laccase-10-like                         809   0.0     
gb|KHN14002.1|  Laccase-17                                              808   0.0     
gb|EEC71780.1|  hypothetical protein OsI_04394                          808   0.0     Oryza sativa Indica Group [Indian rice]
emb|CDM80721.1|  unnamed protein product                                808   0.0     
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      808   0.0     
ref|XP_006379354.1|  hypothetical protein POPTR_0009s15860g             808   0.0     
ref|XP_006379352.1|  hypothetical protein POPTR_0009s15840g             808   0.0     
ref|XP_002465485.1|  hypothetical protein SORBIDRAFT_01g039690          808   0.0     Sorghum bicolor [broomcorn]
ref|XP_003551482.1|  PREDICTED: laccase-17-like                         807   0.0     
emb|CDM84967.1|  unnamed protein product                                807   0.0     
ref|XP_006603494.1|  PREDICTED: laccase-17-like                         804   0.0     
gb|KHN40291.1|  Laccase-17                                              806   0.0     
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      805   0.0     
ref|NP_001044773.1|  Os01g0842500                                       805   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049699.1|  Os03g0273200                                       804   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008801588.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4          802   0.0     
gb|KDO52343.1|  hypothetical protein CISIN_1g008085mg                   801   0.0     
ref|XP_006424872.1|  hypothetical protein CICLE_v10028036mg             804   0.0     
emb|CDP09087.1|  unnamed protein product                                801   0.0     
ref|XP_004984718.1|  PREDICTED: laccase-10-like                         800   0.0     
ref|XP_010414434.1|  PREDICTED: laccase-2 isoform X1                    801   0.0     
ref|XP_003539077.1|  PREDICTED: laccase-2-like isoform X1               800   0.0     
ref|XP_006590981.1|  PREDICTED: laccase-2-like isoform X2               800   0.0     
ref|XP_010922290.1|  PREDICTED: laccase-17-like                         799   0.0     
ref|XP_010414436.1|  PREDICTED: laccase-2 isoform X3                    800   0.0     
dbj|BAJ84890.1|  predicted protein                                      798   0.0     
ref|XP_008785568.1|  PREDICTED: laccase-17-like                         797   0.0     
gb|AAC04576.1|  putative high-pI laccase                                796   0.0     
ref|XP_003558240.1|  PREDICTED: laccase-10-like                         797   0.0     
ref|XP_009416152.1|  PREDICTED: laccase-4-like                          796   0.0     
dbj|BAJ96691.1|  predicted protein                                      795   0.0     
gb|EMT21652.1|  Laccase-4                                               796   0.0     
gb|EMS51326.1|  Laccase-4                                               796   0.0     
ref|XP_007207312.1|  hypothetical protein PRUPE_ppa003714mg             794   0.0     
ref|XP_007150345.1|  hypothetical protein PHAVU_005G145800g             796   0.0     
gb|ABW81166.1|  unknown                                                 794   0.0     
emb|CAN66454.1|  hypothetical protein VITISV_020528                     793   0.0     
ref|XP_006293883.1|  hypothetical protein CARUB_v10022868mg             794   0.0     
ref|NP_180477.1|  laccase 2                                             792   0.0     
ref|NP_001131665.1|  uncharacterized protein LOC100193025 precursor     792   0.0     
ref|XP_010557244.1|  PREDICTED: laccase-2-like                          791   0.0     
ref|XP_010922291.1|  PREDICTED: laccase-17-like                         791   0.0     
ref|XP_009144396.1|  PREDICTED: laccase-2                               791   0.0     
emb|CDP06596.1|  unnamed protein product                                790   0.0     
ref|XP_006409959.1|  hypothetical protein EUTSA_v10016434mg             789   0.0     
ref|XP_010685719.1|  PREDICTED: laccase-17-like                         789   0.0     
ref|XP_002881031.1|  hypothetical protein ARALYDRAFT_901874             788   0.0     
gb|AAL73968.1|AF465468_1  laccase LAC5-6                                788   0.0     
gb|ABW74558.1|  putative laccase                                        788   0.0     
gb|EMS51767.1|  Laccase-4                                               787   0.0     
gb|KHN24985.1|  Laccase-17                                              786   0.0     
emb|CDY65666.1|  BnaC04g54790D                                          787   0.0     
dbj|BAN10307.1|  laccase                                                785   0.0     
ref|XP_008442532.1|  PREDICTED: laccase-17-like                         783   0.0     
ref|XP_010107305.1|  hypothetical protein L484_009439                   783   0.0     
gb|ABW81073.1|  unknown                                                 781   0.0     
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      780   0.0     
ref|XP_004302731.1|  PREDICTED: laccase-17-like                         780   0.0     
ref|XP_003606701.1|  Laccase                                            780   0.0     
gb|KDP42231.1|  hypothetical protein JCGZ_02961                         780   0.0     
gb|EMS48628.1|  Laccase-12/13                                           778   0.0     
ref|XP_010685718.1|  PREDICTED: laccase-17-like                         779   0.0     
ref|XP_004507172.1|  PREDICTED: laccase-2-like                          778   0.0     
ref|XP_002520541.1|  laccase, putative                                  776   0.0     
gb|AAK37825.1|AF132121_1  laccase                                       775   0.0     
ref|XP_003568310.1|  PREDICTED: laccase-12/13-like                      775   0.0     
ref|XP_004137936.1|  PREDICTED: laccase-17-like                         775   0.0     
dbj|BAJ91763.1|  predicted protein                                      774   0.0     
ref|XP_004166507.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    773   0.0     
ref|XP_007140299.1|  hypothetical protein PHAVU_008G100500g             768   0.0     
gb|EYU41745.1|  hypothetical protein MIMGU_mgv1a003538mg                769   0.0     
ref|XP_006846062.1|  hypothetical protein AMTR_s00012p00061910          768   0.0     
ref|NP_001055747.1|  Os05g0458600                                       767   0.0     
ref|XP_002439916.1|  hypothetical protein SORBIDRAFT_09g022510          766   0.0     
ref|XP_002531561.1|  laccase, putative                                  756   0.0     
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      757   0.0     
ref|XP_010043504.1|  PREDICTED: laccase-17                              755   0.0     
ref|XP_010521875.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2-like     754   0.0     
ref|XP_003564594.1|  PREDICTED: putative laccase-5                      752   0.0     
emb|CAN66149.1|  hypothetical protein VITISV_025911                     749   0.0     
ref|XP_002863053.1|  hypothetical protein ARALYDRAFT_497195             748   0.0     
gb|KCW88963.1|  hypothetical protein EUGRSUZ_A01282                     746   0.0     
gb|AAK37828.1|AF132124_1  laccase                                       740   0.0     
emb|CDM84963.1|  unnamed protein product                                736   0.0     
gb|KEH30177.1|  laccase/diphenol oxidase family protein                 734   0.0     
gb|AAK37827.1|AF132123_1  laccase                                       735   0.0     
ref|XP_004970548.1|  PREDICTED: putative laccase-5-like                 732   0.0     
ref|XP_002456622.1|  hypothetical protein SORBIDRAFT_03g039570          730   0.0     
gb|KCW85519.1|  hypothetical protein EUGRSUZ_B02316                     728   0.0     
ref|XP_008777229.1|  PREDICTED: laccase-17-like                         727   0.0     
ref|XP_003566184.1|  PREDICTED: putative laccase-11                     728   0.0     
gb|EPS68485.1|  hypothetical protein M569_06281                         721   0.0     
gb|AAK37823.1|  laccase                                                 724   0.0     
ref|XP_006409960.1|  hypothetical protein EUTSA_v10016434mg             723   0.0     
gb|ACG47007.1|  L-ascorbate oxidase precursor                           719   0.0     
gb|EEC74953.1|  hypothetical protein OsI_10938                          712   0.0     
ref|NP_001055746.1|  Os05g0458500                                       711   0.0     
gb|AAU44018.1|  putative laccase                                        706   0.0     
ref|XP_004961862.1|  PREDICTED: putative laccase-11-like                707   0.0     
sp|Q0DHL5.2|LAC11_ORYSJ  RecName: Full=Putative laccase-11; AltNa...    706   0.0     
gb|AAK37830.1|AF132126_1  laccase                                       707   0.0     
ref|XP_002441216.1|  hypothetical protein SORBIDRAFT_09g022460          704   0.0     
gb|ACN39933.1|  unknown                                                 703   0.0     
ref|NP_001105874.1|  putative laccase precursor                         701   0.0     
ref|XP_006654509.1|  PREDICTED: LOW QUALITY PROTEIN: putative lac...    697   0.0     
dbj|BAN10308.1|  laccase                                                696   0.0     
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             696   0.0     
gb|AFW78258.1|  putative laccase family protein                         696   0.0     
ref|XP_002308209.2|  laccase family protein                             694   0.0     
gb|EMT04658.1|  Laccase-12/13                                           695   0.0     
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             692   0.0     
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          692   0.0     
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    692   0.0     
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          690   0.0     
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          690   0.0     
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          690   0.0     
ref|XP_010099199.1|  hypothetical protein L484_002030                   689   0.0     
ref|XP_002322962.2|  laccase family protein                             690   0.0     
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          689   0.0     
ref|XP_002308208.2|  laccase family protein                             689   0.0     
ref|XP_007026985.1|  Laccase 17 isoform 3                               687   0.0     
gb|EMT05481.1|  Putative laccase-11                                     691   0.0     
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    689   0.0     
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    688   0.0     
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          685   0.0     
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               685   0.0     
ref|XP_004233973.1|  PREDICTED: laccase-11                              685   0.0     
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          684   0.0     
ref|NP_001105921.1|  putative laccase precursor                         685   0.0     
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          684   0.0     
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          683   0.0     
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          682   0.0     
gb|AAK37829.1|AF132125_1  laccase                                       682   0.0     
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          682   0.0     
gb|KHG18161.1|  Laccase-4 -like protein                                 682   0.0     
gb|AAC49536.1|  diphenol oxidase                                        681   0.0     
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          681   0.0     
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     681   0.0     
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          680   0.0     
gb|KHG01609.1|  Laccase-11 -like protein                                680   0.0     
ref|XP_004246339.1|  PREDICTED: laccase-4                               679   0.0     
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          679   0.0     
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             679   0.0     
ref|XP_002519529.1|  laccase, putative                                  679   0.0     
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          679   0.0     
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         678   0.0     
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          678   0.0     
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             677   0.0     
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          677   0.0     
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          677   0.0     
ref|XP_010256659.1|  PREDICTED: laccase-4                               676   0.0     
ref|XP_010092971.1|  hypothetical protein L484_018908                   672   0.0     
gb|KHN40289.1|  Laccase-17                                              673   0.0     
ref|XP_010553253.1|  PREDICTED: laccase-4                               676   0.0     
ref|NP_001172647.1|  Os01g0844050                                       675   0.0     
gb|EMT14964.1|  Putative laccase-5                                      679   0.0     
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         676   0.0     
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         675   0.0     
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         675   0.0     
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         675   0.0     
emb|CDP06511.1|  unnamed protein product                                675   0.0     
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          674   0.0     
ref|XP_011035200.1|  PREDICTED: laccase-4                               674   0.0     
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          674   0.0     
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         674   0.0     
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            674   0.0     
ref|XP_010104682.1|  hypothetical protein L484_022065                   674   0.0     
ref|XP_002520425.1|  laccase, putative                                  673   0.0     
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         673   0.0     
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          672   0.0     
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          672   0.0     
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             672   0.0     
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         672   0.0     
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               671   0.0     
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             672   0.0     
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          672   0.0     
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          672   0.0     
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          672   0.0     
gb|KHN36103.1|  Laccase-11                                              671   0.0     
ref|XP_003604619.1|  Laccase 1a                                         671   0.0     
ref|XP_010101806.1|  hypothetical protein L484_023595                   671   0.0     
ref|XP_003612035.1|  Laccase-11                                         672   0.0     
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          671   0.0     
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         671   0.0     
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          671   0.0     
gb|KHN06247.1|  Laccase-4                                               671   0.0     
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          671   0.0     
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             671   0.0     
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          670   0.0     
ref|XP_007046899.1|  Laccase 11                                         670   0.0     
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             669   0.0     
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   669   0.0     
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         669   0.0     
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         669   0.0     
gb|AES98533.2|  laccase/diphenol oxidase family protein                 669   0.0     
ref|XP_010685615.1|  PREDICTED: laccase-4                               669   0.0     
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         669   0.0     
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         669   0.0     
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          669   0.0     
emb|CDP14064.1|  unnamed protein product                                669   0.0     
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          669   0.0     
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         669   0.0     
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          669   0.0     
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         669   0.0     
ref|XP_002280416.1|  PREDICTED: laccase-4                               668   0.0     
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    669   0.0     
emb|CDO97037.1|  unnamed protein product                                669   0.0     
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         668   0.0     
ref|XP_008338318.1|  PREDICTED: laccase-11-like                         668   0.0     
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         667   0.0     
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             668   0.0     
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         668   0.0     
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          667   0.0     
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         668   0.0     
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          667   0.0     
ref|XP_003558760.1|  PREDICTED: laccase-22                              667   0.0     
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         667   0.0     
ref|XP_010104683.1|  hypothetical protein L484_022066                   667   0.0     
ref|XP_002278638.1|  PREDICTED: laccase-4                               667   0.0     
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         667   0.0     
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             667   0.0     
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             667   0.0     
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             667   0.0     
ref|XP_008220423.1|  PREDICTED: laccase-4                               666   0.0     
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                666   0.0     
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         666   0.0     
ref|XP_008355354.1|  PREDICTED: laccase-4                               666   0.0     
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 665   0.0     
ref|XP_008785423.1|  PREDICTED: laccase-22                              665   0.0     
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          665   0.0     
ref|XP_002533894.1|  laccase, putative                                  665   0.0     
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         665   0.0     
ref|XP_010679744.1|  PREDICTED: laccase-11                              665   0.0     
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             664   0.0     
gb|EPS60103.1|  laccase 1a                                              664   0.0     
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          664   0.0     
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         665   0.0     



>ref|XP_009782930.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=579

 Score =   952 bits (2462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/556 (84%), Positives = 507/556 (91%), Gaps = 2/556 (0%)
 Frame = +3

Query  177   VALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvk  356
             +ALAKHAGITRHYKF+I+MQN+TRLCQTKSIVTVNG+FPGPRIIAREGDR+V+KVVNHV+
Sbjct  25    LALAKHAGITRHYKFNIQMQNMTRLCQTKSIVTVNGQFPGPRIIAREGDRLVIKVVNHVQ  84

Query  357   ynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRAT  536
             YN+TIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLR T
Sbjct  85    YNLTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRVT  144

Query  537   LYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTING  716
             LYGPIVILPKKG AYPFPQPFKE+PI+FGEWWKADTE IIS+A QTGGAPNISDA+TING
Sbjct  145   LYGPIVILPKKGAAYPFPQPFKEIPILFGEWWKADTETIISKALQTGGAPNISDAYTING  204

Query  717   LPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFN  896
             LPG  YNCSAKD+FKLKVK GKTYLLRL+NAALNDELFFSIANH+LTVVE DAVYVKPF 
Sbjct  205   LPGLFYNCSAKDTFKLKVKPGKTYLLRLVNAALNDELFFSIANHNLTVVEVDAVYVKPFK  264

Query  897   TNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnkt  1073
             TN +LITPGQTTNVLLKT   HPNAT+L++ARPYATGPA FDNSTT GILEY   ++N  
Sbjct  265   TNTILITPGQTTNVLLKTKHFHPNATFLMAARPYATGPAAFDNSTTTGILEYHQPSNNTK  324

Query  1074  ttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCP  1253
              +N  PL  P LP+FNDT+FAT+F KK+RSLAN  FPANVPKKVD+ FFFTVGLG+ PCP
Sbjct  325   KSNTFPLLKPKLPIFNDTTFATSFVKKIRSLANGKFPANVPKKVDKHFFFTVGLGLNPCP  384

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
             +NQTCQGP NNTK AASVNNISFVQP  ALLQ+HFFNQSKGVYT DFPANPP KFNYTGN
Sbjct  385   KNQTCQGP-NNTKLAASVNNISFVQPNVALLQSHFFNQSKGVYTTDFPANPPFKFNYTGN  443

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP NI VT+ TKVV L FN+SVELVMQDTSII AESHPLHLHGFNFFV+GQGFGNY+ +K
Sbjct  444   PPNNIFVTTGTKVVVLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSK  503

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP+ FNLVDPAERNTVGVP GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+VMDGK
Sbjct  504   DPANFNLVDPAERNTVGVPPGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWMVMDGK  563

Query  1794  GRKQKLQPPPADLPKC  1841
             G KQKL PPPADLPKC
Sbjct  564   GPKQKLPPPPADLPKC  579



>ref|XP_011094885.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=562

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/558 (84%), Positives = 512/558 (92%), Gaps = 3/558 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++AL+KH  IT HYKFDIK+QNVTRLCQTKSIVTVNG+FPGP I AREGDR++VKVVN+V
Sbjct  6     ELALSKHPRITMHYKFDIKLQNVTRLCQTKSIVTVNGQFPGPTITAREGDRLLVKVVNNV  65

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             +YNV+IHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT+TGQRGTLFWHAHISWLR 
Sbjct  66    QYNVSIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRGTLFWHAHISWLRV  125

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPIVILPK+GV YPFPQP+KEVPIIFGEWWKADTERII+QA QTGGAPNISDAFTIN
Sbjct  126   TLYGPIVILPKRGVPYPFPQPYKEVPIIFGEWWKADTERIINQALQTGGAPNISDAFTIN  185

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+F LKVK GKTY+LRLINAALNDELFFSIANH+LTVV+ADAVYVKPF
Sbjct  186   GLPGPLYNCSAKDTFILKVKPGKTYMLRLINAALNDELFFSIANHNLTVVDADAVYVKPF  245

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnk  1070
              TN VLITPGQTTNVLLKT  HHPNAT+L++ARPY+TGPA FDNSTT+GILEY   +++ 
Sbjct  246   KTNTVLITPGQTTNVLLKTKNHHPNATFLMAARPYSTGPAAFDNSTTSGILEYHLPSNST  305

Query  1071  tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC  1250
               TNKLPL  P+LP+FNDT+FATNF KKLRSLAN+NFPA VP++VDRRFFFTVGLG+IPC
Sbjct  306   KKTNKLPLLKPSLPIFNDTTFATNFNKKLRSLANSNFPAKVPQRVDRRFFFTVGLGLIPC  365

Query  1251  PQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYT  1427
                N TCQGP NNT  AA+VNN+SFV P TALLQAHFFNQSKGVYT DFPANPP KFNYT
Sbjct  366   TNPNGTCQGP-NNTMLAAAVNNVSFVMPNTALLQAHFFNQSKGVYTTDFPANPPFKFNYT  424

Query  1428  GNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDP  1607
             GNPP+NIMV+S TKVV L FN+SVELVMQDTSIIGAESHPLHLHGFNFFV+ QGFGN++P
Sbjct  425   GNPPSNIMVSSGTKVVVLPFNTSVELVMQDTSIIGAESHPLHLHGFNFFVLAQGFGNFNP  484

Query  1608  NKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMD  1787
             NKDP+KFNLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKM WIVMD
Sbjct  485   NKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWIVMD  544

Query  1788  GKGRKQKLQPPPADLPKC  1841
             G  R QKL PPP+DLPKC
Sbjct  545   GNRRNQKLPPPPSDLPKC  562



>ref|XP_006429124.1| hypothetical protein CICLE_v10011358mg [Citrus clementina]
 gb|ESR42364.1| hypothetical protein CICLE_v10011358mg [Citrus clementina]
Length=581

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/566 (82%), Positives = 509/566 (90%), Gaps = 2/566 (0%)
 Frame = +3

Query  147   LAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             LA F  W+  + ALAKHA +TRHYKF+I+M+NV RLCQTKSIVTVNG+FPGPRIIAREGD
Sbjct  17    LALFAMWILPEPALAKHARVTRHYKFNIEMKNVRRLCQTKSIVTVNGQFPGPRIIAREGD  76

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             R+++KVVNHVKYNVT+HWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT+TGQRGTLF
Sbjct  77    RLLIKVVNHVKYNVTLHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRGTLF  136

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAHISWLRATLYGPIVILPK+  +YPFPQPFKEVP+IFGEWWKADTE+II+QA QTG A
Sbjct  137   WHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPMIFGEWWKADTEKIINQALQTGAA  196

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PNISDAFTINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV
Sbjct  197   PNISDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVV  256

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             E DAVYVKP  T +VLITPGQTTNVLLK     PNA++LI+ARPYATGPA FDN+TTAG+
Sbjct  257   ETDAVYVKPIKTKVVLITPGQTTNVLLKAKHKSPNASFLIAARPYATGPASFDNTTTAGV  316

Query  1044  LEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFF  1223
             LEY   +N     KLPL  P LP FNDT+FA  F+KK+RSLA A FPA VP+KVDRRFFF
Sbjct  317   LEYEQPNNANKNKKLPLLKPALPKFNDTNFAMQFSKKIRSLATAKFPAKVPRKVDRRFFF  376

Query  1224  TVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPAN  1403
             TVGLG+ PCPQNQTCQGP NNT  AAS+NN+SF QP  ALLQAHFFN+SKGVYT DFPAN
Sbjct  377   TVGLGLSPCPQNQTCQGP-NNTMLAASINNVSFAQPNIALLQAHFFNKSKGVYTTDFPAN  435

Query  1404  PPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIG  1583
             PP KFNYTG PP+NIMV+S T+ V L FN+SVE+VMQDTSIIGAESHPLHLHGFNFFV+G
Sbjct  436   PPFKFNYTGTPPSNIMVSSGTRAVALPFNASVEVVMQDTSIIGAESHPLHLHGFNFFVVG  495

Query  1584  QGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  1763
             QGFGN+DP+KDP+KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL
Sbjct  496   QGFGNFDPSKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  555

Query  1764  KMAWIVMDGKGRKQKLQPPPADLPKC  1841
             KMAWIV DGKG KQKL PPP+DLPKC
Sbjct  556   KMAWIVNDGKGPKQKLPPPPSDLPKC  581



>ref|XP_004246355.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=579

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/576 (81%), Positives = 514/576 (89%), Gaps = 3/576 (1%)
 Frame = +3

Query  120   FAKRFIIFVLAAFCWVSGD-VALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPG  296
             F K + +F+L  F  V  D +ALAKH GITRHYKF+I+MQNVTRLCQTK+IVTVNG+FPG
Sbjct  5     FLKTYNLFLLVIFFLVLVDTLALAKHEGITRHYKFNIQMQNVTRLCQTKNIVTVNGKFPG  64

Query  297   PRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT  476
             PRIIAREGDR+V+KVVN+V++NVTIHWHGVRQLRSGWADGPAYITQCPIQ GQSYVYNFT
Sbjct  65    PRIIAREGDRLVIKVVNNVQHNVTIHWHGVRQLRSGWADGPAYITQCPIQRGQSYVYNFT  124

Query  477   ITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERII  656
             ITGQRGTLFWHAHISWLR TLYGPIVILPKKGVAYPFPQPFKEVPI+FGEWWKADTE+I+
Sbjct  125   ITGQRGTLFWHAHISWLRVTLYGPIVILPKKGVAYPFPQPFKEVPILFGEWWKADTEKIV  184

Query  657   SQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFS  836
             +QA QTGG PNISDA+TINGLPG L+NCSAKD+FKLKVK GKTYLLR++NAALNDELFFS
Sbjct  185   NQALQTGGPPNISDAYTINGLPGLLHNCSAKDTFKLKVKPGKTYLLRVVNAALNDELFFS  244

Query  837   IANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAP  1016
             IANHSLTVVE DAVYVKPFN NI+LITPGQTTNVLLKT   HP AT+L+SARPYATGPA 
Sbjct  245   IANHSLTVVEVDAVYVKPFNANIILITPGQTTNVLLKTKHFHPKATFLMSARPYATGPAS  304

Query  1017  FDNSTTAGILEY-stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANV  1193
             FDNSTT GILEY   ++N   +NK PL    LP+FNDT+FAT+F KK+RSLANA FPANV
Sbjct  305   FDNSTTTGILEYHQHSNNTKKSNKFPLLNSKLPIFNDTTFATSFVKKIRSLANAKFPANV  364

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             PK+VD+ FFFTVGLG+ PCP+NQTCQGP NNTK AASVNN+SFVQP  ALLQ+H+FNQSK
Sbjct  365   PKRVDKHFFFTVGLGLNPCPKNQTCQGP-NNTKLAASVNNVSFVQPNVALLQSHYFNQSK  423

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFP NPP KFNYTGNPP N  VTS TKVV L FN+SVELVMQDTSII AESHPLH
Sbjct  424   GVYTTDFPVNPPFKFNYTGNPPNNSFVTSGTKVVMLPFNTSVELVMQDTSIISAESHPLH  483

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGNY+ +KDP+ FNLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHC
Sbjct  484   LHGFNFFVVGQGFGNYNSSKDPANFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHC  543

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLEVHTSWGLKM W+V DGK  KQKL PPPADLPKC
Sbjct  544   HLEVHTSWGLKMVWMVTDGKSPKQKLLPPPADLPKC  579



>ref|XP_006480874.1| PREDICTED: laccase-17-like isoform X1 [Citrus sinensis]
Length=581

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/566 (82%), Positives = 508/566 (90%), Gaps = 2/566 (0%)
 Frame = +3

Query  147   LAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             LA F  W+  + ALAKHA +TRHYKF+I+M+NV RLCQTKSIVTVNG+FPGPRIIAREGD
Sbjct  17    LALFAMWILPEPALAKHARVTRHYKFNIEMKNVRRLCQTKSIVTVNGQFPGPRIIAREGD  76

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             R+++KVVNHVKYNVT+HWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT+TGQRGTLF
Sbjct  77    RLLIKVVNHVKYNVTLHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRGTLF  136

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAHISWLRATLYGPIVILPK+  +YPFPQPFKEVP+IFGEWWKADTE+II+QA QTG A
Sbjct  137   WHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPMIFGEWWKADTEKIINQALQTGAA  196

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PNISDAFTINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV
Sbjct  197   PNISDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVV  256

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             E DAVYVKP  T +VLITPGQTTNVLLK     PNA++LI+ARPYATGPA FDN+TTAG+
Sbjct  257   ETDAVYVKPIKTKVVLITPGQTTNVLLKAKHKSPNASFLIAARPYATGPASFDNTTTAGV  316

Query  1044  LEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFF  1223
             LEY   +N     KLPL  P LP FNDT+FA  F+KK+RSLA A FPA VP+KVDR FFF
Sbjct  317   LEYEQPNNANKNKKLPLLKPALPKFNDTNFAMQFSKKIRSLATAKFPAKVPRKVDRLFFF  376

Query  1224  TVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPAN  1403
             TVGLG+ PCPQNQTCQGP NNT  AAS+NN+SF QP  ALLQAHFFN+SKGVYT DFPAN
Sbjct  377   TVGLGLSPCPQNQTCQGP-NNTMLAASINNVSFAQPNIALLQAHFFNKSKGVYTTDFPAN  435

Query  1404  PPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIG  1583
             PP KFNYTG PP+NI+V+S T+ V L FN+SVE+VMQDTSIIGAESHPLHLHGFNFFV+G
Sbjct  436   PPFKFNYTGTPPSNILVSSGTRAVALPFNASVEVVMQDTSIIGAESHPLHLHGFNFFVVG  495

Query  1584  QGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  1763
             QGFGN+DP+KDP+KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL
Sbjct  496   QGFGNFDPSKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  555

Query  1764  KMAWIVMDGKGRKQKLQPPPADLPKC  1841
             KMAWIV DGKG KQKL PPP+DLPKC
Sbjct  556   KMAWIVNDGKGPKQKLPPPPSDLPKC  581



>ref|XP_006363100.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=579

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/556 (83%), Positives = 504/556 (91%), Gaps = 2/556 (0%)
 Frame = +3

Query  177   VALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvk  356
             + LAKH GITRHYKF+I+MQNVTRLCQTK+IVTVNG+FPGPRIIAREGDR+V+KVVN+V+
Sbjct  25    LTLAKHEGITRHYKFNIQMQNVTRLCQTKNIVTVNGKFPGPRIIAREGDRLVIKVVNNVQ  84

Query  357   ynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRAT  536
             +NVTIHWHGVRQLRSGWADGPAYITQCPIQ GQSYVYNFTI GQRGTLFWHAHISWLR T
Sbjct  85    HNVTIHWHGVRQLRSGWADGPAYITQCPIQRGQSYVYNFTIIGQRGTLFWHAHISWLRVT  144

Query  537   LYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTING  716
             LYGPIVILPKKGVAYPFPQPFKEVPI+FGEWWKADTE+II+QA QTGG PNISDA+TING
Sbjct  145   LYGPIVILPKKGVAYPFPQPFKEVPILFGEWWKADTEKIINQALQTGGPPNISDAYTING  204

Query  717   LPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFN  896
             LPG LYNCSAKD+FKLKVK GKTYLLR++NAALNDELFFSIANH+LTVVE DAVYVKPFN
Sbjct  205   LPGLLYNCSAKDTFKLKVKPGKTYLLRVVNAALNDELFFSIANHNLTVVEVDAVYVKPFN  264

Query  897   TNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktt  1076
             TNI+LITPGQTTN+LLKT   HPNAT+L+SARPYATGPA FDNSTT GILEY   SN T 
Sbjct  265   TNIILITPGQTTNILLKTKHFHPNATFLMSARPYATGPASFDNSTTTGILEYHKPSNNTK  324

Query  1077  tnkL-PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCP  1253
              + + PL  P LP+FNDT+FAT+F KK+RSLANA FPANVPKKVD++FFFTVGLG+ PCP
Sbjct  325   KSNIFPLLKPKLPIFNDTTFATSFVKKIRSLANAKFPANVPKKVDKQFFFTVGLGLNPCP  384

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
             +NQTCQGP NNTK AASVNN+SFVQP  ALLQ+H+FNQSKGVYT DFP NPP KFNYTGN
Sbjct  385   KNQTCQGP-NNTKLAASVNNVSFVQPNVALLQSHYFNQSKGVYTTDFPVNPPFKFNYTGN  443

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N  VTS TKVV L FN+SVELVMQDTSII AESHPLHLHGFNFFV+GQGFGNY+ + 
Sbjct  444   PPNNSFVTSGTKVVMLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSN  503

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP+ FNLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKM W+V DGK
Sbjct  504   DPANFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWMVNDGK  563

Query  1794  GRKQKLQPPPADLPKC  1841
               KQKL PPPADLPKC
Sbjct  564   SPKQKLPPPPADLPKC  579



>ref|XP_011019838.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=579

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/576 (80%), Positives = 512/576 (89%), Gaps = 7/576 (1%)
 Frame = +3

Query  132   FIIFVLAAFC--WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             F+  ++ + C  W+  ++A+AKHA ITRHYKFDIKMQNVTR+C+TKSIVTVNG+ PGPRI
Sbjct  5     FLRILVTSLCALWIFSELAVAKHASITRHYKFDIKMQNVTRMCRTKSIVTVNGQIPGPRI  64

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             IAREGDR+++KVVNHV+YNVT+HWHG+RQLRSGWADGPAY+TQCPIQTGQSY+YNFT+TG
Sbjct  65    IAREGDRLLIKVVNHVQYNVTLHWHGIRQLRSGWADGPAYVTQCPIQTGQSYIYNFTVTG  124

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTLFWHAHISWLRATL+GPIVILPKKGV+YPFPQP KEVPIIFGEWWKADTE+IISQA
Sbjct  125   QRGTLFWHAHISWLRATLHGPIVILPKKGVSYPFPQPHKEVPIIFGEWWKADTEKIISQA  184

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGGAPNISDA+TING PG LYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIAN
Sbjct  185   LQTGGAPNISDAYTINGHPGLLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIAN  244

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             HSLTVVEADAVYVKPF T+IVLITPGQTTNVLL      PN+T+L++ARPYATGPA FDN
Sbjct  245   HSLTVVEADAVYVKPFKTHIVLITPGQTTNVLLMAKAKAPNSTFLMAARPYATGPASFDN  304

Query  1026  STTAGILEY----stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANV  1193
             +TTAGILEY    S  ++K+   KLPL  P+LPVFNDT+FAT F KK+RSLANA FPA V
Sbjct  305   TTTAGILEYDHNPSATNSKSKNKKLPLLKPSLPVFNDTTFATKFVKKIRSLANARFPAKV  364

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             PKKVDRRFFFT+GLG++PC QN+TCQGP NNT  AASVNN+SFVQP  ALLQ+HF N+SK
Sbjct  365   PKKVDRRFFFTIGLGLLPCSQNKTCQGP-NNTMLAASVNNVSFVQPNIALLQSHFLNRSK  423

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFP NPP KFNYTG PP+NIM    TKVV L FN+SVELVMQDTSIIGAESHPLH
Sbjct  424   GVYTTDFPTNPPFKFNYTGTPPSNIMTAKGTKVVVLPFNTSVELVMQDTSIIGAESHPLH  483

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNF V+GQGFGN+DP KDP KFNLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHC
Sbjct  484   LHGFNFVVVGQGFGNFDPKKDPVKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHC  543

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLEVHTSWGLKMAW+V DGK   QKL PPP+DLPKC
Sbjct  544   HLEVHTSWGLKMAWVVNDGKRPSQKLPPPPSDLPKC  579



>ref|XP_002309069.1| hypothetical protein POPTR_0006s08780g [Populus trichocarpa]
 gb|EEE92592.1| hypothetical protein POPTR_0006s08780g [Populus trichocarpa]
Length=579

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/576 (80%), Positives = 510/576 (89%), Gaps = 7/576 (1%)
 Frame = +3

Query  132   FIIFVLAAFC--WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             F+  ++ A C  W+  ++ +AKHAGITRHYKFDIK+QNVTRLC+TKSIVTVNG+ PGPRI
Sbjct  5     FLRILVTALCALWIFSELVVAKHAGITRHYKFDIKLQNVTRLCRTKSIVTVNGQIPGPRI  64

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             IAREGDR+++KVVNHV+YNVT+HWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+TG
Sbjct  65    IAREGDRLLIKVVNHVQYNVTLHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVTG  124

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTLFWHAHISWLRATLYGPIVILPKKGV+YPFP P KEVPIIFGEWWKADTE+IISQA
Sbjct  125   QRGTLFWHAHISWLRATLYGPIVILPKKGVSYPFPLPHKEVPIIFGEWWKADTEKIISQA  184

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              +TGGAPNISDA+TING PG LYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIAN
Sbjct  185   LKTGGAPNISDAYTINGHPGLLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIAN  244

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             HSLTVVEADAVYVKPF T+IVLITPGQTTNVLL      PN+T+L++ARPYATGP  FDN
Sbjct  245   HSLTVVEADAVYVKPFKTHIVLITPGQTTNVLLMAKAKAPNSTFLMAARPYATGPGSFDN  304

Query  1026  STTAGILEY----stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANV  1193
             +TTAGILEY    S  ++K+   KLPL  P+LPVFNDT+FAT F KK+RSLANA FPA V
Sbjct  305   TTTAGILEYDQNPSATNSKSKNKKLPLLKPSLPVFNDTTFATKFVKKIRSLANARFPAKV  364

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             PKKVDRRFFFT+GLG +PC QN+TCQGP NNT FAASVNN+SFVQP  ALLQ+HF N+SK
Sbjct  365   PKKVDRRFFFTIGLGSLPCSQNKTCQGP-NNTMFAASVNNVSFVQPNIALLQSHFLNRSK  423

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFP NPP KFNYTG PP+N M    TKVV L FN+SVELVMQDTSIIGAESHPLH
Sbjct  424   GVYTTDFPTNPPFKFNYTGTPPSNTMTAKGTKVVVLPFNTSVELVMQDTSIIGAESHPLH  483

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+DP KDP KFNLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHC
Sbjct  484   LHGFNFFVVGQGFGNFDPKKDPVKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHC  543

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLEVHTSWGLKMAW+V DGK   QKL PPP+DLPKC
Sbjct  544   HLEVHTSWGLKMAWVVNDGKRPSQKLPPPPSDLPKC  579



>ref|XP_009602033.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=579

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/581 (79%), Positives = 511/581 (88%), Gaps = 5/581 (1%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGD--VALAKHAG-ITRHYKFDIKMQNVTRLCQTKSIVTV  278
             MV  F K  +  ++  F W   D  +ALAKHAG +TR YKF+I+M+NVTRLCQTKSIVTV
Sbjct  1     MVSFFLKSSLFLLIITF-WALADHKLALAKHAGRMTRQYKFNIQMKNVTRLCQTKSIVTV  59

Query  279   NGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQS  458
             NG+ PGP I  REGDR+++KVVNHV+YN++IHWHGVRQLRS WADGPAYITQCPIQTGQ+
Sbjct  60    NGQLPGPTITTREGDRLLIKVVNHVQYNISIHWHGVRQLRSAWADGPAYITQCPIQTGQN  119

Query  459   YVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKA  638
             YVYNFTITGQRGTLFWHAHISWLR T+YG IVILPKKGVAYPFPQPFKEVPIIFGEWW  
Sbjct  120   YVYNFTITGQRGTLFWHAHISWLRVTVYGAIVILPKKGVAYPFPQPFKEVPIIFGEWWND  179

Query  639   DTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALN  818
             DTE  I+QA QTGGAPNISDA TINGLPG  YNCS K++F+LKVK GKTYLLRLINAAL+
Sbjct  180   DTETNINQALQTGGAPNISDAHTINGLPGLFYNCSTKNTFRLKVKPGKTYLLRLINAALD  239

Query  819   DELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPY  998
             DELFFSIANH+LTVVE DAVY+KPF TNI+LITPGQTTN+LLKT THHPNAT+L++ARPY
Sbjct  240   DELFFSIANHTLTVVEVDAVYIKPFKTNIILITPGQTTNLLLKTMTHHPNATFLMAARPY  299

Query  999   ATGPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             ++GPA FDN+TT  ILEY    +   +NK P+  PTLP+FNDT+F TNF+KK++SLANA 
Sbjct  300   SSGPAAFDNTTTTAILEYENQPSTKKSNKFPVLRPTLPIFNDTNFVTNFSKKIKSLANAK  359

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPANVPK +D RFFFTVGLG+ PCPQNQTCQGP NNTKFAAS+NN+SFVQP  ALLQAHF
Sbjct  360   FPANVPKNIDSRFFFTVGLGLHPCPQNQTCQGP-NNTKFAASINNVSFVQPNIALLQAHF  418

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             FNQS GVYT DFPANP  KFNYTGNPPTNI VTS TKVV LS+N+ VELV+QDTSI+GAE
Sbjct  419   FNQSNGVYTTDFPANPTFKFNYTGNPPTNIFVTSGTKVVVLSYNTRVELVLQDTSILGAE  478

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQGFGNY+P++DP  FNLVDPAERNTVGVP+GGWVAIRFLADNPG 
Sbjct  479   SHPLHLHGFNFFVVGQGFGNYNPSQDPVNFNLVDPAERNTVGVPAGGWVAIRFLADNPGV  538

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL PPPADLPKC
Sbjct  539   WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLPPPPADLPKC  579



>ref|XP_009788568.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=579

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/581 (78%), Positives = 509/581 (88%), Gaps = 5/581 (1%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGD--VALAKHAG-ITRHYKFDIKMQNVTRLCQTKSIVTV  278
             MV  F K  +  ++  F W   D  +ALAKHAG +TR YKF+I+M+NVTRLCQTKSIVTV
Sbjct  1     MVSFFLKNSLFLLIVTF-WALADHKLALAKHAGKMTRQYKFNIQMKNVTRLCQTKSIVTV  59

Query  279   NGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQS  458
             NG+ PGP I AREGDR+++KVVNHV+YN++IHWHGVRQLRS WADGPAYITQCPIQTGQS
Sbjct  60    NGQLPGPTITAREGDRLLIKVVNHVQYNISIHWHGVRQLRSAWADGPAYITQCPIQTGQS  119

Query  459   YVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKA  638
             YVYNFT+TGQRGTLFWHAHISWLR T+YG IVILPKKGVAYPFPQPFKE PIIFGEWW  
Sbjct  120   YVYNFTLTGQRGTLFWHAHISWLRVTVYGAIVILPKKGVAYPFPQPFKEFPIIFGEWWNE  179

Query  639   DTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALN  818
             DTE  I+QA QTGGAPNISDA TINGLPG  YNCS K++F+LKVK GKTYLLRLINAAL+
Sbjct  180   DTETNINQALQTGGAPNISDAHTINGLPGLFYNCSTKNTFRLKVKPGKTYLLRLINAALD  239

Query  819   DELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPY  998
             DELFFSIANH+LTVVE DA Y+KPF TN +LITPGQTTN+LLKT  HHPNAT+L++ARPY
Sbjct  240   DELFFSIANHTLTVVEVDAGYIKPFETNTILITPGQTTNLLLKTMPHHPNATFLMAARPY  299

Query  999   ATGPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             ++GPA FDN+TT  ILEY    +   +NK P+  PTLP+FNDT+F  NF+KK++SLANA 
Sbjct  300   SSGPATFDNTTTTAILEYENQPSTKKSNKFPVLRPTLPIFNDTNFVANFSKKIKSLANAQ  359

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPANVPKKVD RFFFTVGLG+ PCPQNQTCQGP NNTKFAAS+NN+SF+QP  ALLQAHF
Sbjct  360   FPANVPKKVDSRFFFTVGLGLHPCPQNQTCQGP-NNTKFAASINNVSFIQPNIALLQAHF  418

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             FNQSKGVYT DFPANPP KFNYTGNPPTNI VTS TKVV L +N+ VELV+QDTSI+GAE
Sbjct  419   FNQSKGVYTTDFPANPPFKFNYTGNPPTNIFVTSGTKVVVLPYNTRVELVLQDTSILGAE  478

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQGFGNY+P++DP+ FNLVDPAERNTVGVP+GGWVAIRFLADNPG 
Sbjct  479   SHPLHLHGFNFFVVGQGFGNYNPSQDPANFNLVDPAERNTVGVPAGGWVAIRFLADNPGT  538

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAWIV DGKGRKQKL PPPADLPKC
Sbjct  539   WFMHCHLEVHTSWGLKMAWIVKDGKGRKQKLPPPPADLPKC  579



>ref|XP_007026973.1| Laccase 17 [Theobroma cacao]
 gb|EOY07475.1| Laccase 17 [Theobroma cacao]
Length=583

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/581 (79%), Positives = 510/581 (88%), Gaps = 5/581 (1%)
 Frame = +3

Query  111   VCLFAKRFIIFVLAAFCWVS--GDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             V L +  FI  +L A C VS   D+ALAKHAGITRHYKFDI+MQNVTRLCQTKSIVTVNG
Sbjct  4     VLLTSSAFIRLLLLALCAVSLLPDLALAKHAGITRHYKFDIRMQNVTRLCQTKSIVTVNG  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDR+++KVVNHV+YNVT+HWHG+RQLR+GWADGPAYITQCPIQTGQSYV
Sbjct  64    QFPGPRIIAREGDRLLIKVVNHVQYNVTLHWHGIRQLRTGWADGPAYITQCPIQTGQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLRATLYGPIVILPK+  +YPFPQPFKEVPIIFGEWWKADT
Sbjct  124   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPIIFGEWWKADT  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E II+QA  TGGAPNISDAFTINGLPGP YNCSAK++FKLKVK GKTYLLRLINAALNDE
Sbjct  184   ETIINQAMATGGAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLINAALNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFF IANH++TVVEADAVYVKPF T+++LITPGQTTNVLLK  +  P A + +SARPYAT
Sbjct  244   LFFRIANHTVTVVEADAVYVKPFKTDVLLITPGQTTNVLLKAKSKTPGANFALSARPYAT  303

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPV--FNDTSFATNFTKKLRSLANAN  1178
             GPA FDN+TT GILEY  +++ + +N   L      +  FND+++A  F +K+RSLA A 
Sbjct  304   GPATFDNTTTIGILEYEISASASNSNNKKLPLLKAKLPQFNDSTYAMKFNQKIRSLATAK  363

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPA VPK VDRRFFFTVGLG++PC QNQTCQGP NNT+ AA+VNN+SFVQP  ALLQA+F
Sbjct  364   FPAKVPKNVDRRFFFTVGLGILPCSQNQTCQGP-NNTRPAAAVNNVSFVQPNIALLQAYF  422

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             FN+SKGVYT +FPANPPVKFNYTG PP NIM+ S TKVV L FN+SVELVMQDTSI+GAE
Sbjct  423   FNRSKGVYTTNFPANPPVKFNYTGTPPKNIMLDSGTKVVVLPFNTSVELVMQDTSILGAE  482

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQG GN+DP KDP+KFNL DPAERNTVGVPSGGWVAIRFLADNPG 
Sbjct  483   SHPLHLHGFNFFVLGQGVGNFDPKKDPAKFNLRDPAERNTVGVPSGGWVAIRFLADNPGV  542

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+V DG GRKQKL PPPADLPKC
Sbjct  543   WFMHCHLEVHTSWGLKMAWVVNDGNGRKQKLLPPPADLPKC  583



>ref|XP_006445791.1| hypothetical protein CICLE_v10018047mg [Citrus clementina]
 ref|XP_006485483.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR59031.1| hypothetical protein CICLE_v10018047mg [Citrus clementina]
Length=582

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/561 (81%), Positives = 496/561 (88%), Gaps = 2/561 (0%)
 Frame = +3

Query  162   WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkv  341
             W+  ++ALAKH GITRHYKF IKMQN+TRLCQTKSIVTVNG+FPGPRIIAREGDR++++V
Sbjct  23    WILSELALAKHEGITRHYKFHIKMQNITRLCQTKSIVTVNGQFPGPRIIAREGDRLLIRV  82

Query  342   vnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHIS  521
             +N+VKYNVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQSYVYNFT+TGQRGTLFWHAHIS
Sbjct  83    INNVKYNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVTGQRGTLFWHAHIS  142

Query  522   WLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDA  701
             WLRATLYGPI+ILPK+  +YPFPQPF+EVPIIFGEWWKAD E II++A QTGGAPNISDA
Sbjct  143   WLRATLYGPIIILPKQQASYPFPQPFEEVPIIFGEWWKADMETIINEAMQTGGAPNISDA  202

Query  702   FTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVY  881
             FTINGLPGP YNC+AKD+FKLKV  GKTYLLR+INAALNDELFFSIANH+LTVVE DAVY
Sbjct  203   FTINGLPGPFYNCAAKDTFKLKVTPGKTYLLRMINAALNDELFFSIANHTLTVVETDAVY  262

Query  882   VKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-  1058
             VKP  T +VLITPGQ+TNVLLK  +  PNA +LI+ARPYATGPA FDN+TTAG+LEY   
Sbjct  263   VKPIETKVVLITPGQSTNVLLKAKSKAPNANFLIAARPYATGPASFDNTTTAGVLEYDQP  322

Query  1059  nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLG  1238
             N   T    L      LP FNDT+F   F KK+RSLA A FPA VPKKVDRRFFFTVGLG
Sbjct  323   NGITTKNLPLLKPAALLPKFNDTNFVMQFNKKIRSLATAKFPAKVPKKVDRRFFFTVGLG  382

Query  1239  VIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKF  1418
             + PCPQNQTCQGP NN K AASVNN+SFVQP  ALLQAHFFN+SKGVYT DFPANPP KF
Sbjct  383   LSPCPQNQTCQGP-NNMKLAASVNNVSFVQPNVALLQAHFFNRSKGVYTTDFPANPPFKF  441

Query  1419  NYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGN  1598
             NYTG PP+NIMV S TKVV L FN+SVE+VMQDTSII AESHPLHLHGFNFFV+ QGFGN
Sbjct  442   NYTGTPPSNIMVGSGTKVVVLPFNASVEVVMQDTSIIVAESHPLHLHGFNFFVVAQGFGN  501

Query  1599  YDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWI  1778
             +DPNKDP+KFNLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWI
Sbjct  502   FDPNKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWI  561

Query  1779  VMDGKGRKQKLQPPPADLPKC  1841
             V DGKG KQKL PPP+DLPKC
Sbjct  562   VNDGKGPKQKLPPPPSDLPKC  582



>gb|KHF97742.1| Laccase-17 -like protein [Gossypium arboreum]
Length=583

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/573 (78%), Positives = 507/573 (88%), Gaps = 3/573 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             + + F+     W+  D+ALAKHAGITRHYKF+IKMQNVTRLCQTKSIVTVNG+FPGPRII
Sbjct  12    KALFFLSLCSVWLLPDLALAKHAGITRHYKFNIKMQNVTRLCQTKSIVTVNGQFPGPRII  71

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDR+++KVVNHV+YNVTIHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFTITGQ
Sbjct  72    AREGDRLLIKVVNHVQYNVTIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTITGQ  131

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLRATLYGPIVILPK+  +YPFPQPFKEVPI+FGEWWKADTE II+QA 
Sbjct  132   RGTLFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPIVFGEWWKADTETIINQAM  191

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
              TGGAPNISDAFTINGLPGP YNCSAK++FKLKVK GKTYLLRL+NAALNDELFF +ANH
Sbjct  192   ATGGAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLVNAALNDELFFRVANH  251

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +LTVVEADAVYVKPF T+IV+ITPGQTTNVLLK  +  PNA + +SARPYATGPA FDN+
Sbjct  252   TLTVVEADAVYVKPFKTDIVVITPGQTTNVLLKAKSKTPNAKFAMSARPYATGPATFDNT  311

Query  1029  TTAGILEYstnsnktttnkL--PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             TT GILEY  +++ +++N +  PL    LP FND+++A  F +K+RSLA   FP  VPKK
Sbjct  312   TTIGILEYKKSASASSSNNMNIPLLKAKLPQFNDSTYAMKFNQKIRSLATRKFPVKVPKK  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VDRRFFFTVGLG++PC +NQTCQGP NN + AA +NN+SFVQP TALLQAHFFN+SKGVY
Sbjct  372   VDRRFFFTVGLGILPCSKNQTCQGP-NNIRPAAGINNVSFVQPNTALLQAHFFNRSKGVY  430

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T +FP NPP KFNYTG PP NIM+ S TK+V L++N++VELVMQDTSI+GAESHPLHLHG
Sbjct  431   TTNFPTNPPFKFNYTGTPPKNIMLDSGTKLVSLNYNTNVELVMQDTSILGAESHPLHLHG  490

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+ QG GN+DP KDP+KFNL+DPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  491   FNFFVLAQGIGNFDPKKDPAKFNLIDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  550

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAW+V DGKG KQKL PPPADLPKC
Sbjct  551   VHTSWGLKMAWVVNDGKGPKQKLMPPPADLPKC  583



>ref|XP_010037821.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW49587.1| hypothetical protein EUGRSUZ_K03111 [Eucalyptus grandis]
Length=589

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/573 (78%), Positives = 501/573 (87%), Gaps = 4/573 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R   F L A  ++   +A AKH G+TRHYKFDIKMQNVTRLCQTKSIVTVNG+ PGPRII
Sbjct  19    RAAFFTLCALVFLPA-LAQAKHGGVTRHYKFDIKMQNVTRLCQTKSIVTVNGQLPGPRII  77

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDR+++KVVN+V+YNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQ+YVYNFT+TGQ
Sbjct  78    AREGDRLLIKVVNNVQYNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQTYVYNFTVTGQ  137

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLRATLYGPIVILPKK  +YPFPQPFKEVPI+FGEWWKADTE IISQA 
Sbjct  138   RGTLFWHAHISWLRATLYGPIVILPKKHASYPFPQPFKEVPIVFGEWWKADTETIISQAL  197

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             +TGGAPN+SDA+T+NG PGPLYNCSAKD+FKLKVK GKTYLLRLINA LNDELFFSIANH
Sbjct  198   KTGGAPNLSDAYTMNGFPGPLYNCSAKDTFKLKVKPGKTYLLRLINAVLNDELFFSIANH  257

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +LT+VE DAVYVKPF T+ VLITPGQTTNVLL+  +  PN T++++ARPYATGP  FDN+
Sbjct  258   TLTIVETDAVYVKPFKTHTVLITPGQTTNVLLRAKSKAPNVTFVMAARPYATGPGAFDNT  317

Query  1029  TTAGILEYs--tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             T  G LEY+  ++ +K   +KLP+  PTLP FNDT+FA  F +KLRSL  A FPA VP+ 
Sbjct  318   TVTGFLEYAKPSSPSKPKASKLPILKPTLPKFNDTAFAMKFAQKLRSLNTARFPAKVPQT  377

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD++FFFTVGLGV PCP+NQTCQGP NNT  AAS+NN+SFV P+TALLQAHFF QS GVY
Sbjct  378   VDKKFFFTVGLGVNPCPKNQTCQGP-NNTMLAASINNVSFVMPSTALLQAHFFKQSNGVY  436

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFP  PP KFNYTG PP+N++VTS TKVV L FN++VELVMQDTSIIGAESHPLHLHG
Sbjct  437   TTDFPTKPPFKFNYTGTPPSNMLVTSGTKVVVLPFNTTVELVMQDTSIIGAESHPLHLHG  496

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+ P +DP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  497   FNFFVVGQGFGNFKPKRDPKNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  556

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAW+VMDGKGRKQKL PPPADLPKC
Sbjct  557   VHTSWGLKMAWVVMDGKGRKQKLPPPPADLPKC  589



>ref|XP_002268628.2| PREDICTED: laccase-17-like isoform X1 [Vitis vinifera]
Length=577

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/581 (78%), Positives = 503/581 (87%), Gaps = 6/581 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M  C    R ++F L A  W   ++ LAKHAGITRHY FDIK+Q VTRLCQTKSIVTVNG
Sbjct  1     MSSCFL--RVMLFALCAL-WNLPELVLAKHAGITRHYNFDIKLQKVTRLCQTKSIVTVNG  57

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDRV++KVVN+V+ N+TIHWHG+RQLRSGWADGPAY+TQCPIQTGQSYV
Sbjct  58    QFPGPRIIAREGDRVLIKVVNNVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYV  117

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLRATLYGP+VILPK+GV YPFPQPFKEVPIIFGEWWKADT
Sbjct  118   YNFTITGQRGTLFWHAHISWLRATLYGPLVILPKRGVPYPFPQPFKEVPIIFGEWWKADT  177

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I+QA QTGGAPN+SDA+TINGLPGPLYNCSAKD+F+LKVK GKTYLLRLINAALNDE
Sbjct  178   ETMINQAMQTGGAPNVSDAYTINGLPGPLYNCSAKDTFRLKVKPGKTYLLRLINAALNDE  237

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH++TVVE DAVYVKPF TN ++ITPGQTTN+LLKT +H PNAT+L++AR YAT
Sbjct  238   LFFSIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYAT  297

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkL--PLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             GPA FDNSTTAGILEY   S+ + T      +  P LP FNDT FA +F+KKLRSLA   
Sbjct  298   GPAAFDNSTTAGILEYEHMSSMSNTKNKRPSVHRPALPTFNDTLFAMSFSKKLRSLATTK  357

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPA VP+ V RRFFFTVGLG+I C +NQ C GP NNT  AA++NN+SFVQP+TALLQAHF
Sbjct  358   FPAKVPQTVSRRFFFTVGLGLIQCSRNQACPGP-NNTMVAAAINNVSFVQPSTALLQAHF  416

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             F +SKGVYT DFPANPP KFNYTG PP+NI+V S TKVV L FN+ VELV+QDTSIIGAE
Sbjct  417   FGKSKGVYTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAE  476

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNF V+GQGFGN+DP KDPS FNLVDP ERNTVGVPSGGWVAIRF ADNPG 
Sbjct  477   SHPLHLHGFNFHVVGQGFGNFDPKKDPSNFNLVDPIERNTVGVPSGGWVAIRFRADNPGV  536

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+VMDGK   QKL PPPADLPKC
Sbjct  537   WFMHCHLEVHTSWGLKMAWVVMDGKRPNQKLPPPPADLPKC  577



>ref|XP_002531562.1| laccase, putative [Ricinus communis]
 gb|EEF30828.1| laccase, putative [Ricinus communis]
Length=585

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/574 (79%), Positives = 506/574 (88%), Gaps = 5/574 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +F L + C +  ++ +AKHAGITRHYKF I +QNVTRLCQTKSIVTVNG+FPGPRII
Sbjct  14    RATVFALFSLC-IFPEMIVAKHAGITRHYKFTIILQNVTRLCQTKSIVTVNGQFPGPRII  72

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDR+++KVVNHV+YNVT+HWHGVRQLRSGWADGPAYI QCPIQTGQSYVYNFT+TGQ
Sbjct  73    AREGDRLLIKVVNHVQYNVTLHWHGVRQLRSGWADGPAYIAQCPIQTGQSYVYNFTVTGQ  132

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLRA+LYGPIVILPKK  +YPFPQP KEVPIIFGEWWKADTE II+QA 
Sbjct  133   RGTLFWHAHISWLRASLYGPIVILPKKDASYPFPQPHKEVPIIFGEWWKADTEVIINQAM  192

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             +TGGAPN+SDAFTINGLPGPLYNCSAKD+FKLKVK GKTY+LRLINAALNDELFFSIANH
Sbjct  193   RTGGAPNVSDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRLINAALNDELFFSIANH  252

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +LTVVE DAVYVKPF T+ V+ITPGQTTNVLLK     PNAT+L++ARPYATGPA FDN+
Sbjct  253   TLTVVETDAVYVKPFKTHTVIITPGQTTNVLLKAKAKAPNATFLMAARPYATGPAAFDNT  312

Query  1029  TTAGILEYs---tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPK  1199
             TTAGILEY     +S+K  + K PL  P+LP+FNDT+F+  F+KK+RSLA   FPA VP+
Sbjct  313   TTAGILEYENPSLSSSKNKSKKFPLLKPSLPMFNDTAFSMRFSKKVRSLATVKFPAKVPQ  372

Query  1200  KVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGV  1379
             KVDR FFFTVGLG++PC +NQTCQGP NNT+ AAS+NN+SFVQP  ALLQAHFF+QSKGV
Sbjct  373   KVDRHFFFTVGLGILPCSRNQTCQGP-NNTRVAASINNVSFVQPNIALLQAHFFDQSKGV  431

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             YT DFPANPP KFNYTG PPTNIM TS TKVV L FN++VELV+QDT II AESHPLHLH
Sbjct  432   YTTDFPANPPFKFNYTGTPPTNIMATSGTKVVVLPFNTNVELVLQDTGIISAESHPLHLH  491

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNFFV+GQGFGN+D   DP+KFNL DPAERNT+GVPSGGWVAIRFLADNPGAWFMHCHL
Sbjct  492   GFNFFVVGQGFGNFDAKNDPAKFNLFDPAERNTIGVPSGGWVAIRFLADNPGAWFMHCHL  551

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             EVHTSWGLKMAWIV DGK   QKL PPP+DLPKC
Sbjct  552   EVHTSWGLKMAWIVTDGKRPHQKLPPPPSDLPKC  585



>ref|XP_010654256.1| PREDICTED: laccase-17-like isoform X2 [Vitis vinifera]
Length=573

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/579 (77%), Positives = 501/579 (87%), Gaps = 6/579 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M  C    R ++F L A  W   ++ LAKHAGITRHY FDIK+Q VTRLCQTKSIVTVNG
Sbjct  1     MSSCFL--RVMLFALCAL-WNLPELVLAKHAGITRHYNFDIKLQKVTRLCQTKSIVTVNG  57

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDRV++KVVN+V+ N+TIHWHG+RQLRSGWADGPAY+TQCPIQTGQSYV
Sbjct  58    QFPGPRIIAREGDRVLIKVVNNVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYV  117

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLRATLYGP+VILPK+GV YPFPQPFKEVPIIFGEWWKADT
Sbjct  118   YNFTITGQRGTLFWHAHISWLRATLYGPLVILPKRGVPYPFPQPFKEVPIIFGEWWKADT  177

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I+QA QTGGAPN+SDA+TINGLPGPLYNCSAKD+F+LKVK GKTYLLRLINAALNDE
Sbjct  178   ETMINQAMQTGGAPNVSDAYTINGLPGPLYNCSAKDTFRLKVKPGKTYLLRLINAALNDE  237

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH++TVVE DAVYVKPF TN ++ITPGQTTN+LLKT +H PNAT+L++AR YAT
Sbjct  238   LFFSIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYAT  297

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP  1184
             GPA FDNSTTAGILEY   S         +  P LP+FNDT FA  F+KKLRSLA+  FP
Sbjct  298   GPAAFDNSTTAGILEYEHMSKSNRKPS--VLKPALPMFNDTIFAMKFSKKLRSLASNKFP  355

Query  1185  ANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFN  1364
             A VP+ V+RRFFFTVGLG+I C +NQ C GP NNT  AA++NN+SFVQP+TALLQAHFF 
Sbjct  356   AKVPQTVNRRFFFTVGLGLIQCSRNQACPGP-NNTMVAAAINNVSFVQPSTALLQAHFFG  414

Query  1365  QSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESH  1544
             +SKGVYT DFPANP  KFNYTG PP+NI+V S TKVV L FN+ VELV+QDTSIIGAESH
Sbjct  415   KSKGVYTTDFPANPTFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESH  474

Query  1545  PLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWF  1724
             PLHLHGFNF+V+GQGFGN+DP KDP+ FNLVDP ERNTVGVPSGGWVAIRF ADNPG WF
Sbjct  475   PLHLHGFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWF  534

Query  1725  MHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             MHCHLEVHTSWGLKMAW+V DGK   QKL PPP+DLPKC
Sbjct  535   MHCHLEVHTSWGLKMAWVVTDGKRPNQKLPPPPSDLPKC  573



>ref|XP_002269038.2| PREDICTED: laccase-17 isoform X2 [Vitis vinifera]
Length=577

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/581 (77%), Positives = 505/581 (87%), Gaps = 6/581 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M  C+   R I+F + A  W   D+ LAKHAG TRHYKFDIK+Q VTRLCQTKSIVTVNG
Sbjct  1     MGSCIM--RIIMFAVCAM-WFLPDLVLAKHAGSTRHYKFDIKLQTVTRLCQTKSIVTVNG  57

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDRV++KVVNHV+ N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYV
Sbjct  58    QFPGPRIIAREGDRVIIKVVNHVQNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYV  117

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLRAT+YG +VILPK+GV YPFPQPFKEVPIIFGEWWKAD 
Sbjct  118   YNFTITGQRGTLFWHAHISWLRATVYGSLVILPKRGVPYPFPQPFKEVPIIFGEWWKADI  177

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I+QA QTGGAPN+SDA+T+NGLPGPLYNCSAKD+F+LKVK GKTYLLRLINAALNDE
Sbjct  178   ETMINQAMQTGGAPNVSDAYTMNGLPGPLYNCSAKDAFRLKVKPGKTYLLRLINAALNDE  237

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH++TVVE DAVYVKPF TN ++ITPGQTTN+LLKT +H PNAT+L++AR YAT
Sbjct  238   LFFSIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYAT  297

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkL--PLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             GPA FDNSTTAGILEY   S+ + T      +  P LP+FNDT FA  F+KKLRSLA+  
Sbjct  298   GPAAFDNSTTAGILEYEHKSSVSNTKNRKPSVLKPALPMFNDTIFAMKFSKKLRSLASNK  357

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPA VP+ V+RRFFFTVGLG+I C +NQ C GP NNT  AA++NN+SFVQP+TALLQAHF
Sbjct  358   FPAKVPQTVNRRFFFTVGLGLIQCSRNQACPGP-NNTMVAAAINNVSFVQPSTALLQAHF  416

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             F +SKGVYT DFPANPP KFNYTG PP+NI+V S TKVV L FN+ VELV+QDTSIIGAE
Sbjct  417   FGKSKGVYTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAE  476

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNF+V+GQGFGN+DP KDP+ FNLVDP ERNTVGVPSGGWVAIRF ADNPG 
Sbjct  477   SHPLHLHGFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFHADNPGV  536

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+VMDGK   QKL PPP+DLPKC
Sbjct  537   WFMHCHLEVHTSWGLKMAWVVMDGKRPNQKLPPPPSDLPKC  577



>ref|XP_010654257.1| PREDICTED: laccase-17 isoform X1 [Vitis vinifera]
Length=577

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/574 (78%), Positives = 503/574 (88%), Gaps = 5/574 (1%)
 Frame = +3

Query  132   FIIFVLAAFC--WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             F+  +L AFC  WV  ++  AKHAG TRHYKFDIK+Q VTRLCQTKSIVTVNG+FPGPRI
Sbjct  5     FVRVMLFAFCAFWVLPELVFAKHAGTTRHYKFDIKLQTVTRLCQTKSIVTVNGQFPGPRI  64

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             IAREGDRV++KVVNHV+ N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFTITG
Sbjct  65    IAREGDRVIIKVVNHVQNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  124

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTLFWHAHISWLRAT+YG +VILPK+GV YPFPQPFKEVPIIFGEWWKAD E +I+QA
Sbjct  125   QRGTLFWHAHISWLRATVYGSLVILPKRGVPYPFPQPFKEVPIIFGEWWKADIETMINQA  184

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGGAPN+SDA+T+NGLPGPLYNCSAKD+F+LKVK GKTYLLRLINAALNDELFFSIAN
Sbjct  185   MQTGGAPNVSDAYTMNGLPGPLYNCSAKDAFRLKVKPGKTYLLRLINAALNDELFFSIAN  244

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             H++TVVE DAVYVKPF TN ++ITPGQTTN+LLKT +H PNAT+L++AR YATGPA FDN
Sbjct  245   HTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPAAFDN  304

Query  1026  STTAGILEYstnsnktttnkL--PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPK  1199
             STTAGILEY   S+ + T      +  P LP+FNDT FA  F+KKLRSLA+  FPA VP+
Sbjct  305   STTAGILEYEHKSSVSNTKNRKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQ  364

Query  1200  KVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGV  1379
              V+RRFFFTVGLG+I C +NQ C GP NNT  AA++NN+SFVQP+TALLQAHFF +SKGV
Sbjct  365   TVNRRFFFTVGLGLIQCSRNQACPGP-NNTMVAAAINNVSFVQPSTALLQAHFFGKSKGV  423

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             YT DFPANPP KFNYTG PP+NI+V S TKVV L FN+ VELV+QDTSIIGAESHPLHLH
Sbjct  424   YTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLH  483

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNF+V+GQGFGN+DP KDP+ FNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCHL
Sbjct  484   GFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFHADNPGVWFMHCHL  543

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             EVHTSWGLKMAW+VMDGK   QKL PPP+DLPKC
Sbjct  544   EVHTSWGLKMAWVVMDGKRPNQKLPPPPSDLPKC  577



>ref|XP_007026974.1| Laccase 17 [Theobroma cacao]
 gb|EOY07476.1| Laccase 17 [Theobroma cacao]
Length=583

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/581 (78%), Positives = 505/581 (87%), Gaps = 5/581 (1%)
 Frame = +3

Query  111   VCLFAKRFIIFVLAAFCWVS--GDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             V L +  FI   L A C VS   D+A+AKHAGITRHY FDI+MQNVTRLCQTKSIVTVNG
Sbjct  4     VLLTSSAFIRVFLLALCAVSLLPDLAVAKHAGITRHYNFDIRMQNVTRLCQTKSIVTVNG  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDR+++KVVNHV+YNVT+HWHG+RQLR+GWADGPAYITQCPIQTGQSYV
Sbjct  64    QFPGPRIIAREGDRLLIKVVNHVQYNVTLHWHGIRQLRTGWADGPAYITQCPIQTGQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLRATLYGPIVILPK+  +YPFPQPFKEVPIIFGEWWKADT
Sbjct  124   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPIIFGEWWKADT  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E II+QA  TGGAPNISDAFTINGLPGP YNCSAK++FKLKVK GKTYLLRLINAALNDE
Sbjct  184   ETIINQAMATGGAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLINAALNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFF IANH++TVVEADAVYVKPF T+IVLITPGQTTNVLLK  +    A + +SARPYAT
Sbjct  244   LFFRIANHTVTVVEADAVYVKPFKTDIVLITPGQTTNVLLKAKSKTSGANFALSARPYAT  303

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPV--FNDTSFATNFTKKLRSLANAN  1178
             GPA FDN+TT GILEY  +++ + +N   L      +  FND+++A  F +K+RSLA A 
Sbjct  304   GPATFDNTTTIGILEYEKSASASNSNNKKLPLLKAKLPEFNDSTYAMKFNQKIRSLATAK  363

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPA VPK VDRRFFFTVGLG++PC Q QTCQGP NNT+ AA+VNN+SFVQP  ALLQAHF
Sbjct  364   FPAKVPKNVDRRFFFTVGLGILPCSQKQTCQGP-NNTRPAAAVNNVSFVQPNIALLQAHF  422

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             FN+SKGVYT +FPANPP KFNY G PP NIM+ S TKV+ L FN+SVELVMQDTSI+GAE
Sbjct  423   FNRSKGVYTTNFPANPPFKFNYIGTPPKNIMLDSGTKVMVLPFNTSVELVMQDTSILGAE  482

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQG GN+D  KDP+KFNLVDPAERNTVGVPSGGWVAIRFLADNPG 
Sbjct  483   SHPLHLHGFNFFVLGQGVGNFDSKKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGV  542

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+V DGKGRKQKL PPPAD+PKC
Sbjct  543   WFMHCHLEVHTSWGLKMAWVVNDGKGRKQKLLPPPADIPKC  583



>ref|XP_007026975.1| Laccase 17 [Theobroma cacao]
 gb|EOY07477.1| Laccase 17 [Theobroma cacao]
Length=583

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/581 (78%), Positives = 504/581 (87%), Gaps = 5/581 (1%)
 Frame = +3

Query  111   VCLFAKRFIIFVLAAFC--WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             V L +  F   +  A C  W+  D+ALAKHAGITRHYKF+I+MQNVTRLCQTKSIVTVNG
Sbjct  4     VLLTSSAFFRALFLALCAVWLLPDLALAKHAGITRHYKFNIRMQNVTRLCQTKSIVTVNG  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDR+++KVVNHV+YNVT+HWHG+RQLR+GWADGPAYITQCPIQTGQSYV
Sbjct  64    QFPGPRIIAREGDRLLIKVVNHVQYNVTLHWHGIRQLRTGWADGPAYITQCPIQTGQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLRATLYGPIVILPK+  ++PFPQPFKEVPIIFGEWWKADT
Sbjct  124   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKRHASFPFPQPFKEVPIIFGEWWKADT  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E II+QA  TGGAPNISDAFTINGLPGP YNCSAK++FKLKVK GKTYLLRLINAALNDE
Sbjct  184   ETIINQAMATGGAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLINAALNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFF IANH++TVVEADAVYVKPF T+IVLITPGQTTNVLLK  +  P A + +SARPYAT
Sbjct  244   LFFRIANHTVTVVEADAVYVKPFKTDIVLITPGQTTNVLLKAKSKAPGANFALSARPYAT  303

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPV--FNDTSFATNFTKKLRSLANAN  1178
             G A FDN+TT GILEY  +++ + +    L      +  FND+++A  F +KLRSLA   
Sbjct  304   GIATFDNTTTIGILEYEKSASASNSKNKKLPLLKAKLPQFNDSTYAMKFNQKLRSLATTK  363

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FP  V K VDRRFFFTVGLG++PC QNQTCQGP NNT+ AA+VNN+SFVQP  ALLQAHF
Sbjct  364   FPVKVSKNVDRRFFFTVGLGILPCSQNQTCQGP-NNTRPAAAVNNVSFVQPNIALLQAHF  422

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             FN+SKGVYT +FPANPP KFNYTG PP NIM+ S TKVV L FN+SVELVMQDTSI+GAE
Sbjct  423   FNRSKGVYTTNFPANPPFKFNYTGTPPRNIMLDSGTKVVVLPFNTSVELVMQDTSILGAE  482

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQG GN+DP KDP+KFNLVDPAERNTVGVPSGGWVAIRFLADNPG 
Sbjct  483   SHPLHLHGFNFFVLGQGVGNFDPKKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGV  542

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+V DGKGRKQKL PPPADLPKC
Sbjct  543   WFMHCHLEVHTSWGLKMAWVVNDGKGRKQKLLPPPADLPKC  583



>emb|CBI30528.3| unnamed protein product [Vitis vinifera]
Length=1829

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/574 (78%), Positives = 503/574 (88%), Gaps = 5/574 (1%)
 Frame = +3

Query  132   FIIFVLAAFC--WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             F+  +L AFC  WV  ++  AKHAG TRHYKFDIK+Q VTRLCQTKSIVTVNG+FPGPRI
Sbjct  1257  FVRVMLFAFCAFWVLPELVFAKHAGTTRHYKFDIKLQTVTRLCQTKSIVTVNGQFPGPRI  1316

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             IAREGDRV++KVVNHV+ N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFTITG
Sbjct  1317  IAREGDRVIIKVVNHVQNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  1376

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTLFWHAHISWLRAT+YG +VILPK+GV YPFPQPFKEVPIIFGEWWKAD E +I+QA
Sbjct  1377  QRGTLFWHAHISWLRATVYGSLVILPKRGVPYPFPQPFKEVPIIFGEWWKADIETMINQA  1436

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGGAPN+SDA+T+NGLPGPLYNCSAKD+F+LKVK GKTYLLRLINAALNDELFFSIAN
Sbjct  1437  MQTGGAPNVSDAYTMNGLPGPLYNCSAKDAFRLKVKPGKTYLLRLINAALNDELFFSIAN  1496

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             H++TVVE DAVYVKPF TN ++ITPGQTTN+LLKT +H PNAT+L++AR YATGPA FDN
Sbjct  1497  HTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPAAFDN  1556

Query  1026  STTAGILEYstnsnktttnkL--PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPK  1199
             STTAGILEY   S+ + T      +  P LP+FNDT FA  F+KKLRSLA+  FPA VP+
Sbjct  1557  STTAGILEYEHKSSVSNTKNRKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQ  1616

Query  1200  KVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGV  1379
              V+RRFFFTVGLG+I C +NQ C GP NNT  AA++NN+SFVQP+TALLQAHFF +SKGV
Sbjct  1617  TVNRRFFFTVGLGLIQCSRNQACPGP-NNTMVAAAINNVSFVQPSTALLQAHFFGKSKGV  1675

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             YT DFPANPP KFNYTG PP+NI+V S TKVV L FN+ VELV+QDTSIIGAESHPLHLH
Sbjct  1676  YTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLH  1735

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNF+V+GQGFGN+DP KDP+ FNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCHL
Sbjct  1736  GFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFHADNPGVWFMHCHL  1795

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             EVHTSWGLKMAW+VMDGK   QKL PPP+DLPKC
Sbjct  1796  EVHTSWGLKMAWVVMDGKRPNQKLPPPPSDLPKC  1829


 Score =   265 bits (678),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkv  341
            W   D+ LAKHAG TRHYKFDIK+Q VTRLCQ+K+IVTVNG+FPGPRIIAREGDRV++KV
Sbjct  2    WFLPDLVLAKHAGSTRHYKFDIKLQKVTRLCQSKNIVTVNGQFPGPRIIAREGDRVIIKV  61

Query  342  vnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHIS  521
            VNHV+ N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSY+YNFTITGQRGTLFWHAHIS
Sbjct  62   VNHVQNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYLYNFTITGQRGTLFWHAHIS  121

Query  522  WLRATLYGPIVILPKKGVAYPFPQPFKEVPIIF  620
            WLRAT+YG +VILPK+GV YPFPQPFKEVPIIF
Sbjct  122  WLRATVYGSLVILPKRGVPYPFPQPFKEVPIIF  154



>ref|XP_010683865.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=584

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/572 (76%), Positives = 486/572 (85%), Gaps = 2/572 (0%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
              + +F+L          ALAKH GITR Y F++KMQNVTRLCQTKSIVT+NG+FPGP+I+
Sbjct  14    HYTLFLLVCTSMAGHKYALAKHTGITRRYNFEVKMQNVTRLCQTKSIVTINGQFPGPKIV  73

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
              REGDR+ + V+NHVKYNVT+HWHGVRQLRSGWADGPAYITQCPIQ+GQSYVYNFTITGQ
Sbjct  74    TREGDRLEITVINHVKYNVTVHWHGVRQLRSGWADGPAYITQCPIQSGQSYVYNFTITGQ  133

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR TLYGPI+ILPK G  YPFP P+KEVPI+FGEWWKADTE +I+QA 
Sbjct  134   RGTLFWHAHISWLRVTLYGPIIILPKHGDFYPFPHPYKEVPIVFGEWWKADTEAVINQAM  193

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             +TG APN+SDAFTINGLPGPLYNCS KD FKLKVK GKTYLLRLINAALNDELFFSIANH
Sbjct  194   KTGSAPNLSDAFTINGLPGPLYNCSTKDVFKLKVKPGKTYLLRLINAALNDELFFSIANH  253

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +LTVVE DA+Y KPF TNI+LITPGQTTNVLL T  +HPNA++L++ARPYATGPA FDN+
Sbjct  254   TLTVVEVDAIYTKPFKTNIILITPGQTTNVLLTTNNYHPNASFLMAARPYATGPATFDNT  313

Query  1029  TTAGILEYstnsnktttnkLP-LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
             TTA ILEY+ + +       P L  P LP FNDTSFA  FT KLRSLAN+ FPANVPKK+
Sbjct  314   TTAAILEYAHDPSLKHKRTKPKLIKPKLPFFNDTSFAAKFTNKLRSLANSKFPANVPKKI  373

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             DR FFFTVGLG++PCP NQTCQGP NNT  AA+VNN+SF+QP  ALLQAHFF+QS GV+T
Sbjct  374   DRHFFFTVGLGLLPCPNNQTCQGP-NNTMIAAAVNNVSFIQPKIALLQAHFFSQSNGVFT  432

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFP  PP  FNYTG PP N+M+   TKVV L FN+SVELVMQDTSIIGAESHPLHLHGF
Sbjct  433   TDFPTKPPFSFNYTGTPPNNLMLNKGTKVVTLPFNTSVELVMQDTSIIGAESHPLHLHGF  492

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+GQGFGN+D  KDP+KFNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCHLEV
Sbjct  493   NFFVVGQGFGNFDSKKDPTKFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEV  552

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAWIV DG  + QKL PPP+DLP C
Sbjct  553   HTSWGLKMAWIVSDGNEKNQKLLPPPSDLPTC  584



>ref|XP_010275879.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=584

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/575 (77%), Positives = 495/575 (86%), Gaps = 6/575 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R I+ VL    W+  +  +A+H+GITRHYKFDIK++NVTRLC TKSIVTVNG+FPGPRI+
Sbjct  12    RAILMVLGTL-WLLPEFMVAQHSGITRHYKFDIKLKNVTRLCHTKSIVTVNGQFPGPRIV  70

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRV++KVVN V+ N+T+HWHG+RQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQ
Sbjct  71    AREGDRVLIKVVNQVQNNITLHWHGIRQLRSGWADGPAYVTQCPIQTGQAYVYNFTITGQ  130

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+TLYGP+VILPK+  +YPF +P+KEVPIIFGEWW  D E +ISQA 
Sbjct  131   RGTLFWHAHISWLRSTLYGPVVILPKRNASYPFTKPYKEVPIIFGEWWNTDPEAVISQAL  190

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH
Sbjct  191   QTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANH  250

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             SLTVV+ DAVYVKPF+T  +LITPGQTTNVLLKT  H+PNAT+L++ARPY TG   FDNS
Sbjct  251   SLTVVDVDAVYVKPFDTETLLITPGQTTNVLLKTKPHYPNATFLMAARPYVTGLGTFDNS  310

Query  1029  TTAGILEYst----nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             TTAGILEY       + ++++    L  PTLP  NDT+ ATNF K+LRSLA A FPANVP
Sbjct  311   TTAGILEYQLPSTTTTTRSSSAAKKLLKPTLPPLNDTTLATNFAKRLRSLATAQFPANVP  370

Query  1197  KKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKG  1376
             + VDRRFFFTVGLG  PCPQNQTCQGP N TKF+AS+NN+SF  P TALLQAHFF Q+KG
Sbjct  371   QTVDRRFFFTVGLGSSPCPQNQTCQGP-NGTKFSASINNVSFALPNTALLQAHFFGQAKG  429

Query  1377  VYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHL  1556
             VYT DFP NPP  FNYTG PP N  V +ATKVV L FN+SVELVMQDTSI+GAESHPLHL
Sbjct  430   VYTTDFPTNPPFPFNYTGTPPNNTFVNNATKVVVLPFNTSVELVMQDTSILGAESHPLHL  489

Query  1557  HGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCH  1736
             HGFNFFV+GQGFGN+DPNKDP+ FNLVDP ERNTVGVPSGGWVAIRF+ADNPG WFMHCH
Sbjct  490   HGFNFFVVGQGFGNFDPNKDPASFNLVDPVERNTVGVPSGGWVAIRFIADNPGVWFMHCH  549

Query  1737  LEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LEVHTSWGLKMAW VMDGK   QKL PPP+DLPKC
Sbjct  550   LEVHTSWGLKMAWAVMDGKLPNQKLPPPPSDLPKC  584



>ref|XP_007140298.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
 gb|ESW12292.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
Length=625

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/553 (78%), Positives = 484/553 (88%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG FPGPRI+AREGDR+++KVVNHV+ N++IH
Sbjct  73    GGITRHYHFDIKYQNVSRLCHTKSMVTVNGLFPGPRIVAREGDRLLIKVVNHVQNNISIH  132

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL SGWADGPAY+TQCPIQTGQSYVYNFTI GQRGTLFWHAHISWLR+TLYGPI+
Sbjct  133   WHGIRQLGSGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLFWHAHISWLRSTLYGPII  192

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK GV YPF +P+KEVPIIFGEWW AD E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  193   ILPKLGVPYPFTKPYKEVPIIFGEWWNADPEAVITQALQTGGGPNVSDAYTINGLPGPLY  252

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS+KD+FKLKVKAGKTYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF+T+ +LI
Sbjct  253   NCSSKDTFKLKVKAGKTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFDTDTILI  312

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttn  1082
             TPGQTTNVLLKT + +PNAT+ +SARPYATG   FDNST AGILEY     +  +  +  
Sbjct  313   TPGQTTNVLLKTKSKYPNATFFMSARPYATGQGTFDNSTVAGILEYEVPPHSLHSTNSVK  372

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             KL LF P LP  NDTSFATNF  KLRSLA++ FPANVP+KVD+ FFFTVGLG  PC +NQ
Sbjct  373   KLSLFKPILPALNDTSFATNFASKLRSLASSQFPANVPQKVDKHFFFTVGLGTTPCQKNQ  432

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN TKF+ASVNN+S++QPTTALLQAHFF QS GVYT DFP  P V FNYTG PP 
Sbjct  433   TCQGPTNTTKFSASVNNVSYIQPTTALLQAHFFGQSNGVYTTDFPTKPLVPFNYTGTPPN  492

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNYDPNKDP+
Sbjct  493   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPA  552

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
             KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DGK   
Sbjct  553   KFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPN  612

Query  1803  QKLQPPPADLPKC  1841
             QKL PPP DLPKC
Sbjct  613   QKLLPPPEDLPKC  625



>ref|XP_010107320.1| hypothetical protein L484_009454 [Morus notabilis]
 gb|EXC14800.1| hypothetical protein L484_009454 [Morus notabilis]
Length=590

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/578 (75%), Positives = 497/578 (86%), Gaps = 8/578 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             + I F L A  WV  ++A AKHAGITRHYKFDIK+Q VTRLCQTKSIVTVNG+FPGPRII
Sbjct  14    KAIFFTLCAILWVFPELAFAKHAGITRHYKFDIKLQKVTRLCQTKSIVTVNGQFPGPRII  73

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGD +++KV NHV  N+TIHWHG+RQLRSGWADGPAY+TQCPIQTGQ+Y+YNFT+TGQ
Sbjct  74    AREGDTLLIKVANHVPNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQTYLYNFTVTGQ  133

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLRAT+YGPIVILPK+ V YPFPQPFKEVPIIFGEWWKADTER+I+QA+
Sbjct  134   RGTLFWHAHISWLRATVYGPIVILPKRNVPYPFPQPFKEVPIIFGEWWKADTERVINQAT  193

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTG APN+SDA+T+NGLPGPLYNCSAKD+FKLKVK GKTYLLRL+NAALN+ELFFS+ANH
Sbjct  194   QTGLAPNVSDAYTMNGLPGPLYNCSAKDTFKLKVKPGKTYLLRLVNAALNNELFFSVANH  253

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +LTVVE DAVYVKPF T  +LITPGQTTNVLL+T    PNAT++++ARPY +GPA FDNS
Sbjct  254   TLTVVEVDAVYVKPFKTQTILITPGQTTNVLLRTKPKAPNATFVMAARPYISGPAAFDNS  313

Query  1029  TTAGILEYstnsn-------ktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPA  1187
             TT  +LEY   S+           NKLPL  P LP  NDTSF   + +K+RSLANA FPA
Sbjct  314   TTTALLEYEKASSPNDKKKKNNNRNKLPLVRPVLPQLNDTSFPFKYNQKIRSLANAKFPA  373

Query  1188  NVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQ  1367
              VPK VDR+FFFTVGLG+  C + Q CQGP NNT+  A++NN+SFV P TALLQAHFFN+
Sbjct  374   KVPKAVDRKFFFTVGLGLGSCSKRQACQGP-NNTRVLAAINNVSFVLPNTALLQAHFFNK  432

Query  1368  SKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP  1547
             +KGVYT DFPANPP KFNYTGNPP+N++V + TKVV L + +SVELV+QDTSIIGAESHP
Sbjct  433   TKGVYTTDFPANPPFKFNYTGNPPSNMLVNTGTKVVVLPYKTSVELVLQDTSIIGAESHP  492

Query  1548  LHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  1727
             LHLHGFNFFV+G G GN+DP KDPSKFNL+DPAERNTVGVPSGGWVAIRFLADNPG WFM
Sbjct  493   LHLHGFNFFVVGLGSGNFDPKKDPSKFNLLDPAERNTVGVPSGGWVAIRFLADNPGVWFM  552

Query  1728  HCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HCHLEVHTSWGLKMAW+V+DGK   QKL PPP+DLPKC
Sbjct  553   HCHLEVHTSWGLKMAWVVLDGKRPHQKLPPPPSDLPKC  590



>ref|XP_009338594.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
 ref|XP_009338602.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=585

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/572 (78%), Positives = 498/572 (87%), Gaps = 4/572 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I FV+ AF  +  + A AKHA  TRHYKFDIK+QNVTRLCQTKSIVTVNG+FPGPRIIAR
Sbjct  15    IFFVVCAFLCMFPEPAFAKHARFTRHYKFDIKLQNVTRLCQTKSIVTVNGQFPGPRIIAR  74

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+V+KVVNHV++N+T+HWHGVRQ++SGWADGPAYITQCPIQ GQSY+YNFTITGQRG
Sbjct  75    EGDRLVIKVVNHVQHNLTLHWHGVRQMKSGWADGPAYITQCPIQIGQSYIYNFTITGQRG  134

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLRAT+YGPIVILPK+ V YPFPQPFKEVPIIFGEWWKADTE +ISQA QT
Sbjct  135   TLFWHAHISWLRATVYGPIVILPKRHVPYPFPQPFKEVPIIFGEWWKADTETVISQALQT  194

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G  PN+SDA+TINGLPGPLYNCSAKD++KLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  195   GLGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTL  254

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVEADAVYVKPF T  VLITPGQTTNVLL+T    PNA ++++ARPY +GPA FDNSTT
Sbjct  255   TVVEADAVYVKPFKTQTVLITPGQTTNVLLRTKFKSPNAKFVMAARPYVSGPAAFDNSTT  314

Query  1035  AGILEYstnsnkt--ttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP-ANVPKKV  1205
              G+LEY   S+ T     K  LFTP LP  NDT F+  + KK+ SLAN  FP ANVPK V
Sbjct  315   TGLLEYEVASSSTNNKNKKKQLFTPVLPKLNDTLFSMKYNKKILSLANPKFPAANVPKTV  374

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
              + FFFTVGLGV+PC +NQTCQGP NNT+ AA++NN++FVQP TALLQAHFFNQSKGVYT
Sbjct  375   QKHFFFTVGLGVLPCSKNQTCQGP-NNTRLAAAINNVTFVQPNTALLQAHFFNQSKGVYT  433

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFPANP  KFNYTG+PP+NI V+S TKVV L FN++VE+V+QDTSIIGAESHPLHLHGF
Sbjct  434   TDFPANPAFKFNYTGSPPSNIAVSSGTKVVVLPFNTTVEVVLQDTSIIGAESHPLHLHGF  493

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+G G GN+DP  DP K+NLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLEV
Sbjct  494   NFFVLGLGSGNFDPKNDPKKYNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEV  553

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAW+V+DGK R QKL PPP+DLPKC
Sbjct  554   HTSWGLKMAWVVLDGKRRNQKLPPPPSDLPKC  585



>ref|XP_010683867.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/570 (77%), Positives = 491/570 (86%), Gaps = 2/570 (0%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F+L     +   +  AKH  ITR YKF+IKMQNVTRLCQTKSIVTVNG+FPGPRIIAR
Sbjct  1     MLFLLICSSTIDPQLVSAKHLSITRRYKFEIKMQNVTRLCQTKSIVTVNGQFPGPRIIAR  60

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+ +KVVNHVK NVTIHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+ GQRG
Sbjct  61    EGDRLEIKVVNHVKNNVTIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVKGQRG  120

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLRATLYGPIVILPK+GV YPFP PFKEVPIIFGEWWKADTE +I+QA +T
Sbjct  121   TLFWHAHISWLRATLYGPIVILPKRGVPYPFPHPFKEVPIIFGEWWKADTETVINQAMKT  180

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G APN+SDAFTING PGPLYNCSAKDSFKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  181   GSAPNLSDAFTINGFPGPLYNCSAKDSFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  240

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             T+VEADA+Y KP  TN +LITPGQTTNVLLK   HHP+A++L++ARPYATGPA FDN+TT
Sbjct  241   TIVEADAIYTKPIKTNTILITPGQTTNVLLKAKKHHPHASFLMAARPYATGPATFDNTTT  300

Query  1035  AGILEYstn-snktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDR  1211
             A +LEY+ N S  +   K+PL  P LP FNDTSFA  FT KL+SLAN  FPANVPKK+DR
Sbjct  301   AAVLEYAYNPSQNSNVTKIPLIKPKLPFFNDTSFAAKFTSKLKSLANTRFPANVPKKIDR  360

Query  1212  RFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTAD  1391
              FFFTVGLG++ C +NQ C GP NNT   A++NN+SFV P  ALLQAHFF QS GV+  +
Sbjct  361   HFFFTVGLGLLQCSKNQNCSGP-NNTMVGAAINNVSFVLPNIALLQAHFFRQSNGVFATN  419

Query  1392  FPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNF  1571
             FP  PP KFNYTGNPP+NI+++  TKVV L FN+SVE+V+QDTSIIGAESHPLHLHGFNF
Sbjct  420   FPTKPPFKFNYTGNPPSNIILSKGTKVVVLPFNASVEVVLQDTSIIGAESHPLHLHGFNF  479

Query  1572  FVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHT  1751
             FV+GQGFGN+D  KDP+ FNL+DP ERNTVGVPSGGWVAIRF ADNPGAWFMHCHLEVHT
Sbjct  480   FVVGQGFGNFDSKKDPTNFNLIDPIERNTVGVPSGGWVAIRFRADNPGAWFMHCHLEVHT  539

Query  1752  SWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SWGLKMAWIVMDGK + QKL PPPAD+PKC
Sbjct  540   SWGLKMAWIVMDGKRKNQKLPPPPADIPKC  569



>ref|XP_002284473.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=585

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/572 (77%), Positives = 491/572 (86%), Gaps = 6/572 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +F   A C +  ++ALA+ +GITRHYKFDIK+QNVTRLC TKSI+TVNG+FPGPRI+ARE
Sbjct  16    VFSCMALCLLP-ELALAQDSGITRHYKFDIKLQNVTRLCHTKSILTVNGQFPGPRIVARE  74

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR+++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+ GQRGT
Sbjct  75    GDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGT  134

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             LFWHAHISWLR+TLYGP++ILPK+ V YPF +P KEVPIIFGEWW ADTE +ISQA QTG
Sbjct  135   LFWHAHISWLRSTLYGPLIILPKRNVPYPFEKPHKEVPIIFGEWWNADTEAVISQALQTG  194

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDA+TINGLPGPLYNCSAKD+FKL+VKA KTYLLRLINAALNDELFFSIANH+LT
Sbjct  195   GGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKASKTYLLRLINAALNDELFFSIANHTLT  254

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VV+ADA+YVKPF T+ +LI PGQTTNVLLKT  H PNA +LI+ARPY TG   FDNST A
Sbjct  255   VVDADAIYVKPFETDTLLIAPGQTTNVLLKTKPHFPNAAFLITARPYVTGLGTFDNSTVA  314

Query  1038  GILEYstnsnk----tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
             GILEY   S       +  KLPLF PTLP  NDTSFATNFT +LRSLA+  FPANVP+KV
Sbjct  315   GILEYELPSASPHSTVSIKKLPLFKPTLPPLNDTSFATNFTNRLRSLASPQFPANVPQKV  374

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             DR FFFT+GLG  PC QNQTCQGP N TKFAASVNN+SF   TTALLQAHF  QS GVY 
Sbjct  375   DRHFFFTIGLGTSPCDQNQTCQGP-NGTKFAASVNNVSFASSTTALLQAHFSGQSNGVYN  433

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFP  P + FNYTG PP N +V++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGF
Sbjct  434   PDFPITPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGF  493

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+GQGFGNYDPNKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+
Sbjct  494   NFFVVGQGFGNYDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEI  553

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  554   HTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  585



>emb|CBI31631.3| unnamed protein product [Vitis vinifera]
Length=1050

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/573 (77%), Positives = 490/573 (86%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++FV+    W+  +  LA  AGITRHYKF+IK+QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  480   VLFVVLNTLWLFPE--LASSAGITRHYKFNIKLQNVTRLCHTKSIVSVNGQFPGPHIIAR  537

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVVKVVNHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  538   EGDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  597

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  598   TLFWHAHISWLRSTLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  657

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  658   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  717

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  718   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  777

Query  1035  AGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGIL Y      + +      LPLF PTLP  NDTSFA NFT KLRSLAN  FPANVP+K
Sbjct  778   AGILHYEPPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQK  837

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGPTN T F+ASVNN+SFV PTTA+LQAHFF QSKGVY
Sbjct  838   VDQRFFFTVGLGTNPCPQNQTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVY  897

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFP  P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI+G ESHPLHLHG
Sbjct  898   TTDFPTTPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHG  957

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  958   FNFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  1017

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAWIVMDGK   QKL PPP+DLPKC
Sbjct  1018  VHTSWGLKMAWIVMDGKLPNQKLPPPPSDLPKC  1050


 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/449 (74%), Positives = 375/449 (84%), Gaps = 6/449 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W   +  LA  +GITRHYKF+I++QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  14    VLFLVLNSLWYLPE--LANGSGITRHYKFNIELQNVTRLCHTKSIVSVNGQFPGPPIIAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVVKVVNHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  72    EGDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+I PKK V YPF +P+KEVPIIFGEWW  D E +I+QA Q 
Sbjct  132   TLFWHAHISWLRSTLYGPIIIFPKKNVPYPFAKPYKEVPIIFGEWWNTDPEAVITQALQN  191

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SD +TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  192   GGGPNVSDGYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  251

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  252   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGSGTFDNSTV  311

Query  1035  AGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGIL Y      + +      LPLF PTLP  NDTSFA NFT+KLRSLAN  FPANVP+K
Sbjct  312   AGILHYEPPPKSSPSAPSFENLPLFKPTLPPLNDTSFAANFTRKLRSLANTQFPANVPQK  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+T F+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  372   VDKRFFFTVGLGTNPCPQNQTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVY  431

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATK  1469
             T DFPA P   FNYTG PP N MV++ TK
Sbjct  432   TTDFPATPIFPFNYTGTPPNNTMVSNGTK  460



>ref|XP_002282823.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/573 (77%), Positives = 490/573 (86%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++FV+    W+  +  LA  AGITRHYKF+IK+QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  14    VLFVVLNTLWLFPE--LASSAGITRHYKFNIKLQNVTRLCHTKSIVSVNGQFPGPHIIAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVVKVVNHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  72    EGDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  132   TLFWHAHISWLRSTLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  191

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  192   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  251

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  252   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  311

Query  1035  AGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGIL Y      + +      LPLF PTLP  NDTSFA NFT KLRSLAN  FPANVP+K
Sbjct  312   AGILHYEPPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQK  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGPTN T F+ASVNN+SFV PTTA+LQAHFF QSKGVY
Sbjct  372   VDQRFFFTVGLGTNPCPQNQTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVY  431

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFP  P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI+G ESHPLHLHG
Sbjct  432   TTDFPTTPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHG  491

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  492   FNFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  551

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAWIVMDGK   QKL PPP+DLPKC
Sbjct  552   VHTSWGLKMAWIVMDGKLPNQKLPPPPSDLPKC  584



>emb|CBI16199.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/567 (77%), Positives = 489/567 (86%), Gaps = 6/567 (1%)
 Frame = +3

Query  153   AFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvv  332
             A C +  ++ALA+ +GITRHYKFDIK+QNVTRLC TKSI+TVNG+FPGPRI+AREGDR++
Sbjct  2     ALCLLP-ELALAQDSGITRHYKFDIKLQNVTRLCHTKSILTVNGQFPGPRIVAREGDRLL  60

Query  333   vkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHA  512
             +KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+ GQRGTLFWHA
Sbjct  61    IKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGTLFWHA  120

Query  513   HISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNI  692
             HISWLR+TLYGP++ILPK+ V YPF +P KEVPIIFGEWW ADTE +ISQA QTGG PN+
Sbjct  121   HISWLRSTLYGPLIILPKRNVPYPFEKPHKEVPIIFGEWWNADTEAVISQALQTGGGPNV  180

Query  693   SDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEAD  872
             SDA+TINGLPGPLYNCSAKD+FKL+VKA KTYLLRLINAALNDELFFSIANH+LTVV+AD
Sbjct  181   SDAYTINGLPGPLYNCSAKDTFKLRVKASKTYLLRLINAALNDELFFSIANHTLTVVDAD  240

Query  873   AVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY  1052
             A+YVKPF T+ +LI PGQTTNVLLKT  H PNA +LI+ARPY TG   FDNST AGILEY
Sbjct  241   AIYVKPFETDTLLIAPGQTTNVLLKTKPHFPNAAFLITARPYVTGLGTFDNSTVAGILEY  300

Query  1053  stnsnk----tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFF  1220
                S       +  KLPLF PTLP  NDTSFATNFT +LRSLA+  FPANVP+KVDR FF
Sbjct  301   ELPSASPHSTVSIKKLPLFKPTLPPLNDTSFATNFTNRLRSLASPQFPANVPQKVDRHFF  360

Query  1221  FTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPA  1400
             FT+GLG  PC QNQTCQGP N TKFAASVNN+SF   TTALLQAHF  QS GVY  DFP 
Sbjct  361   FTIGLGTSPCDQNQTCQGP-NGTKFAASVNNVSFASSTTALLQAHFSGQSNGVYNPDFPI  419

Query  1401  NPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVI  1580
              P + FNYTG PP N +V++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+
Sbjct  420   TPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVV  479

Query  1581  GQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWG  1760
             GQGFGNYDPNKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWG
Sbjct  480   GQGFGNYDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWG  539

Query  1761  LKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LKMAW+V+DGK   QKL PPPADLPKC
Sbjct  540   LKMAWVVLDGKLPNQKLLPPPADLPKC  566



>gb|KDP35658.1| hypothetical protein JCGZ_09096 [Jatropha curcas]
Length=576

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/555 (81%), Positives = 497/555 (90%), Gaps = 9/555 (2%)
 Frame = +3

Query  186   AKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynv  365
             AKHAGITRHYKF+I MQNVTRLCQTKSIVTVNG+FPGPRIIAREGDR+++KVVNHV+YNV
Sbjct  28    AKHAGITRHYKFNIVMQNVTRLCQTKSIVTVNGKFPGPRIIAREGDRLLIKVVNHVQYNV  87

Query  366   TIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYG  545
             T+HWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT+TGQRGTLFWHAHISWLRAT+YG
Sbjct  88    TLHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRGTLFWHAHISWLRATIYG  147

Query  546   PIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPG  725
             P+VILP+K  +YPF QP KEVPIIFGEWWKADTE II+QA QTGGAPNISDAFTINGLPG
Sbjct  148   PLVILPRKHSSYPFQQPHKEVPIIFGEWWKADTETIINQAMQTGGAPNISDAFTINGLPG  207

Query  726   PLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNI  905
             PLYNCSAKD+FKLKVK GKTYLLRLINAALNDE+FFSIANH+LTVVE DAVYVKPFNT +
Sbjct  208   PLYNCSAKDTFKLKVKPGKTYLLRLINAALNDEIFFSIANHTLTVVETDAVYVKPFNTPV  267

Query  906   VLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY---stnsnktt  1076
             +LITPGQT+NVLLK     PNAT+L++ARPY+TGPA FDN+TTAGILEY   S +++K  
Sbjct  268   LLITPGQTSNVLLKAKPKAPNATFLMAARPYSTGPAAFDNTTTAGILEYENPSVSNSKNK  327

Query  1077  tnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQ  1256
               KL L  P+LPVFNDT+F+  F+KK+RSLA   FPA VP+KVD+RFFFTVGLG++PC Q
Sbjct  328   NKKLLLLKPSLPVFNDTTFSMKFSKKIRSLATTKFPAKVPQKVDKRFFFTVGLGMLPCSQ  387

Query  1257  NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNP  1436
             NQ CQ   NNT+ AAS+NN+SFVQP  ALLQAHFFN+SKGVYT DFPANPP KFNYTG P
Sbjct  388   NQNCQ---NNTRVAASINNVSFVQPNIALLQAHFFNKSKGVYTTDFPANPPFKFNYTGTP  444

Query  1437  PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKD  1616
             PTNIM   AT VV L F +SVELV+QDTSII AESHPLHLHGFNFFV+GQGFGN+DP+KD
Sbjct  445   PTNIM---ATAVVVLPFTTSVELVLQDTSIISAESHPLHLHGFNFFVVGQGFGNFDPSKD  501

Query  1617  PSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKG  1796
             P+KFNLVDPAERNT+GVP+GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V DGK 
Sbjct  502   PAKFNLVDPAERNTIGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVTDGKR  561

Query  1797  RKQKLQPPPADLPKC  1841
               QKL PPP+DLPKC
Sbjct  562   LNQKLPPPPSDLPKC  576



>emb|CBI30529.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/581 (76%), Positives = 489/581 (84%), Gaps = 22/581 (4%)
 Frame = +3

Query  99    LRMMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTV  278
               M  C    R ++F L A  W   ++ LAKHAGITRHY FDIK+Q VTRLCQTKSIVTV
Sbjct  26    FEMSSCFL--RVMLFALCAL-WNLPELVLAKHAGITRHYNFDIKLQKVTRLCQTKSIVTV  82

Query  279   NGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQS  458
             NG+FPGPRIIAREGDRV++KVVN+V+ N+TIHWHG+RQLRSGWADGPAY+TQCPIQTGQS
Sbjct  83    NGQFPGPRIIAREGDRVLIKVVNNVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQS  142

Query  459   YVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKA  638
             YVYNFTITGQRGTLFWHAHISWLRATLYGP+VILPK+GV YPFPQPFKEVPIIFGEWWKA
Sbjct  143   YVYNFTITGQRGTLFWHAHISWLRATLYGPLVILPKRGVPYPFPQPFKEVPIIFGEWWKA  202

Query  639   DTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALN  818
             DTE +I+QA QTGGAPN+SDA+TINGLPGPLYNCSAKD+F+LKVK GKTYLLRLINAALN
Sbjct  203   DTETMINQAMQTGGAPNVSDAYTINGLPGPLYNCSAKDTFRLKVKPGKTYLLRLINAALN  262

Query  819   DELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPY  998
             DELFFSIANH++TVVE DAVYVKPF TN ++ITPGQTTN+LLKT +H PNAT+L++AR Y
Sbjct  263   DELFFSIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSY  322

Query  999   ATGPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             ATGPA FDNSTTAGILEY   S+                   ++       KLRSLA   
Sbjct  323   ATGPAAFDNSTTAGILEYEHMSSM------------------SNTKNKRPSKLRSLATTK  364

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPA VP+ V RRFFFTVGLG+I C +NQ C GP NNT  AA++NN+SFVQP+TALLQAHF
Sbjct  365   FPAKVPQTVSRRFFFTVGLGLIQCSRNQACPGP-NNTMVAAAINNVSFVQPSTALLQAHF  423

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             F +SKGVYT DFPANPP KFNYTG PP+NI+V S TKVV L FN+ VELV+QDTSIIGAE
Sbjct  424   FGKSKGVYTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAE  483

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNF V+GQGFGN+DP KDPS FNLVDP ERNTVGVPSGGWVAIRF ADNPG 
Sbjct  484   SHPLHLHGFNFHVVGQGFGNFDPKKDPSNFNLVDPIERNTVGVPSGGWVAIRFRADNPGV  543

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+VMDGK   QKL PPPADLPKC
Sbjct  544   WFMHCHLEVHTSWGLKMAWVVMDGKRPNQKLPPPPADLPKC  584



>gb|KHN16229.1| Laccase-17 [Glycine soja]
Length=580

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/553 (78%), Positives = 479/553 (87%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG+FPGPRI+AREGDR+++KV +HV+ N++IH
Sbjct  28    GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGDRLLIKVTSHVQNNISIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTLFWHAHISWLR+TLYGPI+
Sbjct  88    WHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLFWHAHISWLRSTLYGPII  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+G  YPF +P+KEVP+IFGEWW  D E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  148   ILPKQGAPYPFTKPYKEVPVIFGEWWNTDPEAVITQALQTGGGPNVSDAYTINGLPGPLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK GK YLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF TN +LI
Sbjct  208   NCSAKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFATNTILI  267

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttn  1082
             TPGQTTNVLLKT +H+PNAT+L++ARPYATG   FDN+T AGIL+Y     T+ +  +  
Sbjct  268   TPGQTTNVLLKTKSHYPNATFLMTARPYATGLGTFDNTTVAGILQYKTPPNTHHSAASLK  327

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
              LPL  P LP  NDTSFAT F  KLRSLA+A FPANVP+KVD  FFFTVGLG  PCPQNQ
Sbjct  328   NLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQNQ  387

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN TKFAASVNN+SF+QPTTALLQAHFF QS GVY+  FP +P V FNYTG PP 
Sbjct  388   TCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPPN  447

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP 
Sbjct  448   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDPV  507

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
              FNLVDP ERNTVGVPSGGWVAIRFL DNPG WFMHCHLEVHTSWGLKMAWIV+DGK   
Sbjct  508   NFNLVDPVERNTVGVPSGGWVAIRFLTDNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPN  567

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLP C
Sbjct  568   QKLLPPPADLPNC  580



>ref|XP_010256874.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=583

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/556 (78%), Positives = 486/556 (87%), Gaps = 5/556 (1%)
 Frame = +3

Query  186   AKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynv  365
             A+H+GITRHYKF+IK+QNVTRLC TKSIVTVNG+FPGPRI+AREGDRV+VKVVNHV+ N+
Sbjct  29    AQHSGITRHYKFEIKLQNVTRLCHTKSIVTVNGKFPGPRIVAREGDRVLVKVVNHVQNNI  88

Query  366   TIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYG  545
             T+HWHG+RQL+SGWADGPAYITQCP+QTGQSYVYNFTITGQRGTLFWHAHISWLR+TLYG
Sbjct  89    TLHWHGIRQLQSGWADGPAYITQCPMQTGQSYVYNFTITGQRGTLFWHAHISWLRSTLYG  148

Query  546   PIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPG  725
             PIVILPK+  +YPF +P+KEVPIIFGEWW AD E +I+QA QTGG PN+SDA+TINGLPG
Sbjct  149   PIVILPKRNSSYPFAKPYKEVPIIFGEWWNADPEAVINQALQTGGGPNVSDAYTINGLPG  208

Query  726   PLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNI  905
             PLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFF+IANH+ TVV+ DAVYVKP +T+ 
Sbjct  209   PLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFNIANHTFTVVDVDAVYVKPLDTDT  268

Query  906   VLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnkt  1073
             ++I PGQTTNVLLKT  H PNAT+L++ARPY TG   FDNSTTAGILEY     + S  +
Sbjct  269   LVIAPGQTTNVLLKTKPHFPNATFLMAARPYLTGLGTFDNSTTAGILEYEPSDSSLSINS  328

Query  1074  ttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCP  1253
             +  KL LF P LPV NDTSF  NFT +LRSLA A FPANVP+ VD++FFFTVGLG  PCP
Sbjct  329   SIKKLQLFKPVLPVLNDTSFVANFTNRLRSLATAEFPANVPQTVDKQFFFTVGLGTSPCP  388

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
             QNQTCQGP N TKF+ASVNN+SF  PTTALLQAHF  Q+ GVYT DFP NPP+ FNYTG 
Sbjct  389   QNQTCQGP-NGTKFSASVNNVSFAMPTTALLQAHFLGQANGVYTTDFPTNPPLHFNYTGT  447

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N +VT+ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNK
Sbjct  448   PPNNTLVTNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  507

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP+ FNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCHLEVHTSWGLKMAW+VMDGK
Sbjct  508   DPANFNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCHLEVHTSWGLKMAWVVMDGK  567

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPP DLPKC
Sbjct  568   LPNQKLPPPPFDLPKC  583



>ref|XP_003532315.1| PREDICTED: laccase-17-like [Glycine max]
Length=579

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/553 (77%), Positives = 487/553 (88%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG+FPGPRI+AREGD +++KV NHV+ N++IH
Sbjct  27    GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGDNLLIKVTNHVQNNISIH  86

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+T+ GQRGTL+WHAHISWLR+TLYGP++
Sbjct  87    WHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTVVGQRGTLWWHAHISWLRSTLYGPLI  146

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILP+ GV YPF +P+KEVPIIFGEWW AD E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  147   ILPQYGVPYPFTKPYKEVPIIFGEWWNADPEAVITQALQTGGGPNVSDAYTINGLPGPLY  206

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF+T+ +LI
Sbjct  207   NCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFDTDTILI  266

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstn----snktttn  1082
             +PGQT+NVLLKT +H+PNAT+L+SARPYATG   FDNST A ILEY  +     + T+  
Sbjct  267   SPGQTSNVLLKTKSHYPNATFLMSARPYATGQGTFDNSTVAAILEYEVSPHALHSTTSIK  326

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             KL LF P LP  NDTSFATNF+ KLRSLA+A FPANVP+K+D+ FFFTVGLG  PC QNQ
Sbjct  327   KLSLFKPILPALNDTSFATNFSNKLRSLASAQFPANVPQKIDKHFFFTVGLGTTPCSQNQ  386

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN+TKFAASVNN+SF+QPTTALLQ+HFF QS GVY+  FP +P + FNYTG PP 
Sbjct  387   TCQGPTNSTKFAASVNNVSFIQPTTALLQSHFFGQSNGVYSPYFPISPLIPFNYTGTPPN  446

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP+
Sbjct  447   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPA  506

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
              FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DG+   
Sbjct  507   NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELPN  566

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLPKC
Sbjct  567   QKLLPPPADLPKC  579



>ref|XP_006480875.1| PREDICTED: laccase-17-like isoform X2 [Citrus sinensis]
Length=532

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/537 (82%), Positives = 481/537 (90%), Gaps = 5/537 (1%)
 Frame = +3

Query  231   MQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWA  410
             M+NV RLCQTKSIVTVNG+FPGPRIIAREGDR+++KVVNHVKYNVT+HW+ +    SGWA
Sbjct  1     MKNVRRLCQTKSIVTVNGQFPGPRIIAREGDRLLIKVVNHVKYNVTLHWYEI----SGWA  56

Query  411   DGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFP  590
             DGPAYITQCPIQTGQSYVYNFT+TGQRGTLFWHAHISWLRATLYGPIVILPK+  +YPFP
Sbjct  57    DGPAYITQCPIQTGQSYVYNFTVTGQRGTLFWHAHISWLRATLYGPIVILPKRHASYPFP  116

Query  591   QPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKV  770
             QPFKEVP+IFGEWWKADTE+II+QA QTG APNISDAFTINGLPGPLYNCSAKD+FKLKV
Sbjct  117   QPFKEVPMIFGEWWKADTEKIINQALQTGAAPNISDAFTINGLPGPLYNCSAKDTFKLKV  176

Query  771   KAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKT  950
             K GKTYLLR+INAALNDELFFSIANH+LTVVE DAVYVKP  T +VLITPGQTTNVLLK 
Sbjct  177   KPGKTYLLRMINAALNDELFFSIANHTLTVVETDAVYVKPIKTKVVLITPGQTTNVLLKA  236

Query  951   TTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTS  1130
                 PNA++LI+ARPYATGPA FDN+TTAG+LEY   +N     KLPL  P LP FNDT+
Sbjct  237   KHKSPNASFLIAARPYATGPASFDNTTTAGVLEYEQPNNANKNKKLPLLKPALPKFNDTN  296

Query  1131  FATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVN  1310
             FA  F+KK+RSLA A FPA VP+KVDR FFFTVGLG+ PCPQNQTCQGP NNT  AAS+N
Sbjct  297   FAMQFSKKIRSLATAKFPAKVPRKVDRLFFFTVGLGLSPCPQNQTCQGP-NNTMLAASIN  355

Query  1311  NISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFN  1490
             N+SF QP  ALLQAHFFN+SKGVYT DFPANPP KFNYTG PP+NI+V+S T+ V L FN
Sbjct  356   NVSFAQPNIALLQAHFFNKSKGVYTTDFPANPPFKFNYTGTPPSNILVSSGTRAVALPFN  415

Query  1491  SSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVP  1670
             +SVE+VMQDTSIIGAESHPLHLHGFNFFV+GQGFGN+DP+KDP+KFNLVDPAERNTVGVP
Sbjct  416   ASVEVVMQDTSIIGAESHPLHLHGFNFFVVGQGFGNFDPSKDPAKFNLVDPAERNTVGVP  475

Query  1671  SGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIV DGKG KQKL PPP+DLPKC
Sbjct  476   SGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVNDGKGPKQKLPPPPSDLPKC  532



>ref|XP_003532290.1| PREDICTED: laccase-17-like isoform X1 [Glycine max]
Length=581

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/582 (75%), Positives = 491/582 (84%), Gaps = 4/582 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M +  F     IF+ +   W+  ++ LAKHA ITRHY F++++QNVTRLCQTKSIVT+NG
Sbjct  1     MELASFCSLRAIFLFSCALWIMPELTLAKHAKITRHYNFNVQLQNVTRLCQTKSIVTING  60

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             RFPGPR+IAREGDR+V+KV N+V YNVTIHWHGVRQLRS WADGPAY+TQCPIQTGQ++V
Sbjct  61    RFPGPRVIAREGDRLVIKVTNNVPYNVTIHWHGVRQLRSAWADGPAYVTQCPIQTGQTFV  120

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFT+TGQRGTL+WHAHISWLR TLYGPIVILPKK V YPFPQ FKEVPIIFGEWWKADT
Sbjct  121   YNFTVTGQRGTLWWHAHISWLRTTLYGPIVILPKKHVPYPFPQTFKEVPIIFGEWWKADT  180

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I+QA QTG APN+S+A+TING PG LYN + KD+FKLKVKAGKTYLLRLINAALN+E
Sbjct  181   ETVINQAMQTGLAPNLSNAYTINGFPGFLYNGTTKDTFKLKVKAGKTYLLRLINAALNNE  240

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFF IANH+LTVVEADAVYVKPF TN VLITPGQT NVLLKT +  PNA ++I+ARPYAT
Sbjct  241   LFFGIANHTLTVVEADAVYVKPFRTNYVLITPGQTINVLLKTKSKAPNAAFVIAARPYAT  300

Query  1005  GPAPFDNSTTAGILEYstnsnktttn---kLPLFTPTLPVFNDTSFATNFTKKLRSLANA  1175
             GPA FDN+T  G+LEY  +S   T     KL L  P LP FNDT FA  F KK+RSLANA
Sbjct  301   GPAAFDNTTATGLLEYKKSSVSNTKTKNKKLRLLRPVLPKFNDTIFAMKFNKKVRSLANA  360

Query  1176  NFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH  1355
              FPA VPK VD+ FFFTVGLG+  CP+NQ CQGP NNT+  A+VNN+SFV P  ALLQAH
Sbjct  361   RFPAKVPKTVDKHFFFTVGLGISSCPKNQACQGP-NNTRVTAAVNNVSFVMPNIALLQAH  419

Query  1356  FFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGA  1535
             FFN+SKGVYT DFPANPP +FNYTG PP NIM++S TK V L FN+SVEL++QDTSIIGA
Sbjct  420   FFNKSKGVYTTDFPANPPFRFNYTGTPPNNIMISSGTKAVVLPFNASVELILQDTSIIGA  479

Query  1536  ESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             ESHPLHLHGFNFFV+GQG GN+DP KDPSKFNLVDPAERNT+GVPSGGWVA+RF ADNPG
Sbjct  480   ESHPLHLHGFNFFVVGQGNGNFDPKKDPSKFNLVDPAERNTIGVPSGGWVAVRFFADNPG  539

Query  1716  AWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              WFMHCHLEVHTSWGLKMAWIV DGK   QKL PPP+DLPKC
Sbjct  540   VWFMHCHLEVHTSWGLKMAWIVQDGKLHHQKLPPPPSDLPKC  581



>ref|XP_002278232.1| PREDICTED: laccase-17-like [Vitis vinifera]
Length=583

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/573 (76%), Positives = 493/573 (86%), Gaps = 7/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W+  ++A    AGITRHYKF+IK+QNVTRLC TK+IV+VNG+FPGPRIIAR
Sbjct  14    VLFLVLNSLWLFPELA---SAGITRHYKFNIKLQNVTRLCHTKNIVSVNGQFPGPRIIAR  70

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVV VVNHV  NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  71    EGDRVVVNVVNHVPNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  130

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+T+YGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  131   TLFWHAHISWLRSTVYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  190

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  191   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  250

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  251   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  310

Query  1035  AGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AG+L Y     ++ + ++   LP+F PTLP  NDTSFA NFT+KLRSLAN+ FPANVPKK
Sbjct  311   AGLLHYEPPQKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKK  370

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+TKF+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  371   VDKRFFFTVGLGTSPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVY  430

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPA P   FNYTG PP N M ++ TKVV L FN++VELV+QDTSI+G ESHPLHLHG
Sbjct  431   TTDFPATPIFPFNYTGTPPNNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHG  490

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRF+ADNPG WFMHCHLE
Sbjct  491   FNFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLE  550

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAWIV DGK   QKL PPP+DLP+C
Sbjct  551   VHTSWGLKMAWIVKDGKLPNQKLPPPPSDLPQC  583



>gb|AAB17194.1| laccase [Liriodendron tulipifera]
Length=585

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/561 (78%), Positives = 490/561 (87%), Gaps = 6/561 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             +++ AKHAGITRHYKF+I++QNVTRLC TKSIVTVNGRFPGP+I AREGDRVVVKVVNHV
Sbjct  26    ELSHAKHAGITRHYKFNIRLQNVTRLCHTKSIVTVNGRFPGPKIFAREGDRVVVKVVNHV  85

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             + N+T+HWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNF I  QRGTLFWHAHISWLRA
Sbjct  86    QNNITLHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFRIISQRGTLFWHAHISWLRA  145

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             T+YGPIVILPK GV YPF +P+KEVPIIFGEW+ ADTE II+QA QTGG PN+SDA+TIN
Sbjct  146   TIYGPIVILPKHGVPYPFIKPYKEVPIIFGEWFNADTEAIITQALQTGGGPNVSDAYTIN  205

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSA+D+F+L VK GKTYLLRLINAALNDELFFSIANH+LT+V+ DA+YVKPF
Sbjct  206   GLPGPLYNCSARDTFRLSVKPGKTYLLRLINAALNDELFFSIANHTLTIVDVDAIYVKPF  265

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnkt  1073
             +T+I+LITPGQTTNVLLKT  H+PNAT+ +SARPYATG   FDN+TT GILEY   ++  
Sbjct  266   DTDILLITPGQTTNVLLKTKPHYPNATFFMSARPYATGRGTFDNTTTVGILEYQKPNSSH  325

Query  1074  ttnk-----LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLG  1238
              +N      LPLF P+LP  NDT+FA N+T++LRSLANA FPANVP+ VDRRFFFTVGLG
Sbjct  326   PSNAIGIKNLPLFRPSLPGLNDTAFAANYTRRLRSLANAQFPANVPQTVDRRFFFTVGLG  385

Query  1239  VIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKF  1418
               PCP+NQTCQGP N TKFAASVNN+SFV PTTALLQ HFF QS GVYT +FP NPP  F
Sbjct  386   TQPCPKNQTCQGP-NGTKFAASVNNVSFVLPTTALLQTHFFGQSNGVYTTNFPTNPPFPF  444

Query  1419  NYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGN  1598
             NYTG PP N MV++ TKVV L FN+SVELVMQDTSI GAESHPLHLHGFNFFV+GQGFGN
Sbjct  445   NYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGFNFFVVGQGFGN  504

Query  1599  YDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWI  1778
             Y+PNKDPS FNL+DP ERNTVGVP+GGWVAIRF  DNPG WFMHCHLEVHTSWGLKMAW+
Sbjct  505   YNPNKDPSNFNLIDPVERNTVGVPAGGWVAIRFQTDNPGVWFMHCHLEVHTSWGLKMAWV  564

Query  1779  VMDGKGRKQKLQPPPADLPKC  1841
             V+DGK   QKL  PP+DLPKC
Sbjct  565   VLDGKLPNQKLPSPPSDLPKC  585



>gb|KHN24986.1| Laccase-17 [Glycine soja]
Length=579

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/553 (77%), Positives = 485/553 (88%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG+FPGPRI+AREGD +++KV NHV+ N++IH
Sbjct  27    GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGDNLLIKVTNHVQNNISIH  86

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+T+ GQRGTL+WHAHISWLR+TLYGP++
Sbjct  87    WHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTVVGQRGTLWWHAHISWLRSTLYGPLI  146

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILP+ GV YPF +P+KEVPIIFGEWW AD E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  147   ILPQYGVPYPFTKPYKEVPIIFGEWWNADPEAVITQALQTGGGPNVSDAYTINGLPGPLY  206

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF+T+ +LI
Sbjct  207   NCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFDTDTILI  266

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstn----snktttn  1082
              PGQT+N LLKT +H+PNAT+L+SARPYATG   FDNST A ILEY  +     + T+  
Sbjct  267   APGQTSNGLLKTKSHYPNATFLMSARPYATGQGTFDNSTVAAILEYEVSPHALHSTTSIK  326

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             KL LF P LP  NDTSFATNF+ KLRSLA+A FPANVP+K+D+ FFFTVGLG  PC QNQ
Sbjct  327   KLSLFKPILPALNDTSFATNFSNKLRSLASAQFPANVPQKIDKHFFFTVGLGTTPCSQNQ  386

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN+TKFAASVNN+SF+QPTTALLQ+HFF QS GVY+  FP +P + FNYTG PP 
Sbjct  387   TCQGPTNSTKFAASVNNVSFIQPTTALLQSHFFGQSNGVYSPYFPISPLIPFNYTGTPPN  446

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP+
Sbjct  447   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPA  506

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
              FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DG+   
Sbjct  507   NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELPN  566

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLPKC
Sbjct  567   QKLLPPPADLPKC  579



>gb|KHN16226.1| Laccase-17 [Glycine soja]
Length=578

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/583 (75%), Positives = 492/583 (84%), Gaps = 9/583 (2%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M V LF  +  +F+L+   +   + ALA   G TRHY F+I+ QNVTRLC TKS+VTVNG
Sbjct  1     MGVSLF--QIPLFLLSLIIFGIFEHALA---GTTRHYHFEIRHQNVTRLCHTKSMVTVNG  55

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRI+AREGDR+++KV NHV  N+TIHWHG+RQL+SGWADGPAY+TQCPIQ GQSYV
Sbjct  56    QFPGPRIVAREGDRLLIKVTNHVSNNITIHWHGIRQLQSGWADGPAYVTQCPIQRGQSYV  115

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YN+TI GQRGTL+WHAHISWLR+TLYGP++ILPK    YPF +P KEVPI+FGEWW AD 
Sbjct  116   YNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKLNAQYPFAKPHKEVPIVFGEWWNADP  175

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I+QA QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK GK YLLRLINAALNDE
Sbjct  176   EAVITQALQTGGGPNVSDAYTINGLPGPLYNCSDKDTFKLKVKPGKIYLLRLINAALNDE  235

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+LTVVEADAVYVKPF TN +LITPGQTTNVLLKT +H+PNAT+L++ARPYAT
Sbjct  236   LFFSIANHTLTVVEADAVYVKPFATNTILITPGQTTNVLLKTKSHYPNATFLMTARPYAT  295

Query  1005  GPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLAN  1172
             G   FDN+T AGIL+Y     T+ +  +   LPL  P LP  NDTSFAT F  KLRSLA+
Sbjct  296   GLGTFDNTTVAGILQYKTPPNTHHSAASLKNLPLLKPILPALNDTSFATKFNNKLRSLAS  355

Query  1173  ANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQA  1352
             A FPANVP+KVD  FFFTVGLG  PCPQNQTCQGPTN TKFAASVNN+SF+QPTTALLQ 
Sbjct  356   AQFPANVPQKVDTHFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQT  415

Query  1353  HFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIG  1532
             HFF QS GVYTADFPA P + FNYTG PP N MV++ TKVV L FN+SVELVMQDTSI+G
Sbjct  416   HFFGQSNGVYTADFPAKPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILG  475

Query  1533  AESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNP  1712
             AESHPLHLHGFNFF +GQGFGN+DPNKDP+ FNL+DP ERNTVGVPSGGWVAIRFLADNP
Sbjct  476   AESHPLHLHGFNFFAVGQGFGNFDPNKDPANFNLLDPIERNTVGVPSGGWVAIRFLADNP  535

Query  1713  GAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             G WFMHCHLEVHTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  536   GVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLFPPPADLPKC  578



>emb|CBI31651.3| unnamed protein product [Vitis vinifera]
Length=1094

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/573 (76%), Positives = 488/573 (85%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W+S +  LA  AG+TRHYKF IK+QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  524   VMFIVLNTLWLSPE--LASSAGVTRHYKFHIKLQNVTRLCHTKSIVSVNGQFPGPPIIAR  581

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGD+VVVKV+NHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  582   EGDQVVVKVINHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  641

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLRATLYGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  642   TLFWHAHISWLRATLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  701

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK G+TYLLRLINAALNDELFFSIANH+L
Sbjct  702   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGRTYLLRLINAALNDELFFSIANHTL  761

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  762   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  821

Query  1035  AGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
              G+L Y T    + +      LPLF PTLP  NDTSFA NFT KLRSLAN+ FPANVP+K
Sbjct  822   TGLLHYETPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTHKLRSLANSQFPANVPQK  881

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+TKF+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  882   VDKRFFFTVGLGTNPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVY  941

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPA P   FNYTG PP N MV + TKVV L FN+SVELV+QDTSI+G ESHPLHLHG
Sbjct  942   TTDFPATPIFPFNYTGTPPNNTMVNNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHG  1001

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCH E
Sbjct  1002  FNFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFE  1061

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VH SWGLKM W+VMDGK   QKL PPP+DLP+C
Sbjct  1062  VHMSWGLKMVWMVMDGKLPNQKLPPPPSDLPQC  1094


 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/504 (74%), Positives = 431/504 (86%), Gaps = 7/504 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W+  ++A    AGITRHYKF+IK+QNVTRLC TK+IV+VNG+FPGPRIIAR
Sbjct  4     VLFLVLNSLWLFPELA---SAGITRHYKFNIKLQNVTRLCHTKNIVSVNGQFPGPRIIAR  60

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVV VVNHV  NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  61    EGDRVVVNVVNHVPNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  120

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+T+YGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  121   TLFWHAHISWLRSTVYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  180

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  181   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  240

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  241   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  300

Query  1035  AGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AG+L Y     ++ + ++   LP+F PTLP  NDTSFA NFT+KLRSLAN+ FPANVPKK
Sbjct  301   AGLLHYEPPQKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKK  360

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+TKF+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  361   VDKRFFFTVGLGTSPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVY  420

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPA P   FNYTG PP N M ++ TKVV L FN++VELV+QDTSI+G ESHPLHLHG
Sbjct  421   TTDFPATPIFPFNYTGTPPNNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHG  480

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNL  1634
             FNFFV+GQGFGN+D  KDP KFNL
Sbjct  481   FNFFVVGQGFGNFDSKKDPPKFNL  504



>ref|XP_007208294.1| hypothetical protein PRUPE_ppa003308mg [Prunus persica]
 gb|EMJ09493.1| hypothetical protein PRUPE_ppa003308mg [Prunus persica]
Length=586

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/573 (77%), Positives = 499/573 (87%), Gaps = 5/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I+F + AF  V  + ALAKHA +TRHYKF+IK QNV RLCQTKSIVTVNG+FPGPRIIAR
Sbjct  15    ILFAVCAFLCVFPEPALAKHARVTRHYKFNIKSQNVKRLCQTKSIVTVNGQFPGPRIIAR  74

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+V+KVVNHV++N+T+HWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFT+TGQRG
Sbjct  75    EGDRLVIKVVNHVQHNLTLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRG  134

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TL+WHAHISWLRAT+YGPIVILPK+ V YPFPQPF+EVPIIFGEWWKADTE +ISQA QT
Sbjct  135   TLWWHAHISWLRATVYGPIVILPKRHVPYPFPQPFQEVPIIFGEWWKADTEAVISQALQT  194

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G  PN+SDA+TINGLPGPLYNCSAKD++KLKVK G+TYLLRLINAAL++ELFFSIANH+L
Sbjct  195   GSGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGRTYLLRLINAALDNELFFSIANHTL  254

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVE DAVY+KPF T  VLITPGQTTNVLL+T +  P AT++++ARPY TGPA FDNSTT
Sbjct  255   TVVETDAVYIKPFKTQTVLITPGQTTNVLLRTKSKSPKATFVMAARPYVTGPAAFDNSTT  314

Query  1035  AGILEYstnsn----ktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
              G LEY T+S          KLPL  P LP  NDT F+ N+ KK+RSLANA FPANVPK 
Sbjct  315   TGRLEYETSSVKANKNKNKKKLPLLKPVLPKLNDTLFSMNYNKKIRSLANAKFPANVPKA  374

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             V++ FFFTVGLGV  C +NQTCQGP NNT+  A++NN++FVQP TALLQAHFFNQSKGVY
Sbjct  375   VNKNFFFTVGLGVSTCSKNQTCQGP-NNTRVVAAINNVTFVQPNTALLQAHFFNQSKGVY  433

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPANPP KFNYTG PP+NI V+S TKVV L FN+SVELV+QDTSIIGAESHPLHLHG
Sbjct  434   TTDFPANPPFKFNYTGTPPSNIAVSSGTKVVVLPFNTSVELVLQDTSIIGAESHPLHLHG  493

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+G G GN+DP  DP K+NLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  494   FNFFVVGFGSGNFDPKNDPKKYNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  553

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAW+V+DGK R QKL PPP+DLPKC
Sbjct  554   VHTSWGLKMAWVVLDGKRRNQKLLPPPSDLPKC  586



>ref|XP_004514392.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=576

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/573 (77%), Positives = 492/573 (86%), Gaps = 4/573 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R ++ VL A  W+  ++A AKHA  TRHYKF+IK+QNVTRLCQTKSIVTVNG+FPGPRII
Sbjct  6     RAMLLVLCAM-WILPELAHAKHARTTRHYKFNIKLQNVTRLCQTKSIVTVNGQFPGPRII  64

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRVV+KVVNHV+YNV+IHWHG+RQ+RSGWADGPAYITQCPIQ GQSY+YNFTI GQ
Sbjct  65    AREGDRVVIKVVNHVQYNVSIHWHGIRQIRSGWADGPAYITQCPIQPGQSYLYNFTIIGQ  124

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTL+WHAHISWLRATL+GPIVILPK+ V YPFP PFKE+PI+ GEWWKADTE II+QA 
Sbjct  125   RGTLWWHAHISWLRATLHGPIVILPKRHVPYPFPHPFKEIPIVLGEWWKADTETIINQAI  184

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTG APN SDA TINGLPGPL+NCSAKD+FKL+V+ GKTYLLR+INAALNDE+FFSIANH
Sbjct  185   QTGLAPNTSDAHTINGLPGPLHNCSAKDTFKLEVQPGKTYLLRIINAALNDEMFFSIANH  244

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADAVYVKPF TNIVLITPGQTTNVLLKT +  PNA ++I++RPYATGPA FDN+
Sbjct  245   TLHVVEADAVYVKPFKTNIVLITPGQTTNVLLKTKSKTPNAKFVIASRPYATGPASFDNT  304

Query  1029  TTAGILEYstnsnk--tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             T  G+LEY  +S         L LF PTLP FNDT FA NF KK+ SL NA FPA VPK 
Sbjct  305   TAIGLLEYKKHSLSNPKNNKNLKLFKPTLPKFNDTLFAMNFNKKVFSLNNAKFPAKVPKT  364

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             +DR FFFTVGLG+  C +N+ CQGP NNT+ AA++NN+SFV P TALLQAHF N+SKGV+
Sbjct  365   IDRHFFFTVGLGISQCSKNEACQGP-NNTRVAAAINNVSFVMPNTALLQAHFLNKSKGVF  423

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFP NPP KFNYTG PP NIMV+S TKVV L +NS VELV+QDTSIIGAESHPLHLHG
Sbjct  424   TTDFPNNPPFKFNYTGTPPKNIMVSSGTKVVVLPYNSRVELVLQDTSIIGAESHPLHLHG  483

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQG GN+DP  DPSKFNLVDPAERNT GVPSGGWVA+RFLADNPG WFMHCHLE
Sbjct  484   FNFFVVGQGNGNFDPKNDPSKFNLVDPAERNTAGVPSGGWVALRFLADNPGVWFMHCHLE  543

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAWIV DGK R QKL PPP+DLPKC
Sbjct  544   VHTSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  576



>ref|XP_002278215.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/573 (76%), Positives = 488/573 (85%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W+S +  LA  AG+TRHYKF IK+QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  14    VMFIVLNTLWLSPE--LASSAGVTRHYKFHIKLQNVTRLCHTKSIVSVNGQFPGPPIIAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGD+VVVKV+NHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  72    EGDQVVVKVINHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLRATLYGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  132   TLFWHAHISWLRATLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  191

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK G+TYLLRLINAALNDELFFSIANH+L
Sbjct  192   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGRTYLLRLINAALNDELFFSIANHTL  251

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  252   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  311

Query  1035  AGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
              G+L Y T    + +      LPLF PTLP  NDTSFA NFT KLRSLAN+ FPANVP+K
Sbjct  312   TGLLHYETPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTHKLRSLANSQFPANVPQK  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+TKF+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  372   VDKRFFFTVGLGTNPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVY  431

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPA P   FNYTG PP N MV + TKVV L FN+SVELV+QDTSI+G ESHPLHLHG
Sbjct  432   TTDFPATPIFPFNYTGTPPNNTMVNNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHG  491

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCH E
Sbjct  492   FNFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFE  551

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VH SWGLKM W+VMDGK   QKL PPP+DLP+C
Sbjct  552   VHMSWGLKMVWMVMDGKLPNQKLPPPPSDLPQC  584



>ref|XP_008240716.1| PREDICTED: laccase-17-like [Prunus mume]
Length=584

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/571 (77%), Positives = 497/571 (87%), Gaps = 3/571 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I F + AF  V  + ALAKHA +TRHYKF+IK QNV RLCQTKSIVTVNG+FPGPRIIAR
Sbjct  15    IFFAVCAFLCVFPEPALAKHARVTRHYKFNIKSQNVKRLCQTKSIVTVNGQFPGPRIIAR  74

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+V+KVVN V++N+T+HWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG
Sbjct  75    EGDRLVIKVVNRVQHNLTLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  134

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TL+WHAHISWLRAT+YGPIVILPK+ + YPFPQPF+EVPIIFGEWWKADTE +ISQA QT
Sbjct  135   TLWWHAHISWLRATVYGPIVILPKRHIPYPFPQPFQEVPIIFGEWWKADTEAVISQALQT  194

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G  PN+SDA+TINGLPGPLYNCSAKD++KLKVK G+TYLLRLINAAL++ELFFSIANH++
Sbjct  195   GSGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGRTYLLRLINAALDNELFFSIANHTV  254

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVEADAVY+KPF    VLITPGQTTNVLL+T    P AT++++ARPY TGPA FDNSTT
Sbjct  255   TVVEADAVYIKPFKIQTVLITPGQTTNVLLRTKFKSPKATFVMAARPYVTGPAAFDNSTT  314

Query  1035  AGILEYstnsnkttt--nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
              G+LEY T+S K      KLPL  P LP  NDT F+ N+ KK+RSLANA FPANVPK V+
Sbjct  315   TGLLEYETSSVKANKNKKKLPLLKPVLPKLNDTLFSMNYNKKIRSLANAKFPANVPKAVN  374

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             + FFFTVGLGV  C + QTCQGP NNT+  A+VNN++FVQP TALLQAHFFNQSKGVYT 
Sbjct  375   KNFFFTVGLGVSTCSKKQTCQGP-NNTRVVAAVNNVTFVQPNTALLQAHFFNQSKGVYTT  433

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFPANPP KFNYTG PP+NI V+S TKVV L FN+SVELV+QDTSIIGAESHPLHLHGFN
Sbjct  434   DFPANPPFKFNYTGTPPSNIAVSSGTKVVVLPFNTSVELVLQDTSIIGAESHPLHLHGFN  493

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FFV+G G GN+DP  DP K+NLVDPAERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVH
Sbjct  494   FFVVGFGSGNFDPKNDPKKYNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  553

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             TSWGLKMAW+V+DGK R QKL PPP+DLPKC
Sbjct  554   TSWGLKMAWVVLDGKRRNQKLLPPPSDLPKC  584



>ref|XP_006424671.1| hypothetical protein CICLE_v10030166mg [Citrus clementina]
 ref|XP_006488193.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR37911.1| hypothetical protein CICLE_v10030166mg [Citrus clementina]
Length=580

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/570 (76%), Positives = 487/570 (85%), Gaps = 6/570 (1%)
 Frame = +3

Query  147   LAAFCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             L   C       LA+ A G+TRHYKFDIK+QNVTRLC TKSI++VNG+FPGPRI+AREGD
Sbjct  12    LGVICSFINLCLLAEPALGVTRHYKFDIKLQNVTRLCNTKSIISVNGKFPGPRIVAREGD  71

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             ++++KV+NHV+ N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFTI GQRGTL+
Sbjct  72    QLLIKVMNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTIVGQRGTLW  131

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAH+SWLR+TLYGPI+ILPK+G+ YPF +P+KEVPIIFGEW+KAD E IISQA QTGG 
Sbjct  132   WHAHLSWLRSTLYGPIIILPKRGIPYPFTKPYKEVPIIFGEWFKADPETIISQALQTGGG  191

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV
Sbjct  192   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  251

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             EADA+YVKPF T  +LI PGQTTNVLLKT  H+P+AT+ + ARPY TG   FDNST AGI
Sbjct  252   EADAIYVKPFETETLLIAPGQTTNVLLKTKPHYPSATFFMKARPYVTGQGTFDNSTVAGI  311

Query  1044  LEYst----nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDR  1211
             LEY      + +  +   LPLF P LP  NDTSFAT+FT KLRSLA+  FPANVP+ VDR
Sbjct  312   LEYEKPLNFHLSSNSIKNLPLFKPVLPALNDTSFATSFTNKLRSLASTQFPANVPQNVDR  371

Query  1212  RFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTAD  1391
             RFFFTVGLG  PC  NQTCQGP N T F ASVNNISFV PTTALLQAHF  +S GVYT D
Sbjct  372   RFFFTVGLGTSPCQSNQTCQGP-NGTMFQASVNNISFVMPTTALLQAHFTGKSDGVYTPD  430

Query  1392  FPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNF  1571
             FP +P + FNYTG PP N MV++ TK+V L FNSSVEL+MQDTSI+GAESHPLHLHGFNF
Sbjct  431   FPTSPLIAFNYTGTPPNNTMVSNGTKLVVLPFNSSVELIMQDTSILGAESHPLHLHGFNF  490

Query  1572  FVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHT  1751
             FV+GQGFGN+DPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHT
Sbjct  491   FVVGQGFGNFDPNKDPTKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  550

Query  1752  SWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SWGLKMAWIV+DGK   QKL PPPADLP+C
Sbjct  551   SWGLKMAWIVLDGKHPNQKLPPPPADLPQC  580



>ref|XP_006602563.1| PREDICTED: laccase-17-like [Glycine max]
Length=578

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/553 (77%), Positives = 478/553 (86%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG TRHY F+I+ QNVTRLC TKS+VTVNG+FPGPRI+AREGDR+++KV NHV  N+TIH
Sbjct  26    AGTTRHYHFEIRHQNVTRLCHTKSMVTVNGQFPGPRIVAREGDRLLIKVTNHVSNNITIH  85

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL+SGWADGPAY+TQCPIQ GQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++
Sbjct  86    WHGIRQLQSGWADGPAYVTQCPIQRGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLI  145

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK    YPF +P KEVPI+FGEWW AD E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  146   ILPKLNAQYPFAKPHKEVPIVFGEWWNADPEAVITQALQTGGGPNVSDAYTINGLPGPLY  205

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS KD+FKLKVK GK YLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF TN +LI
Sbjct  206   NCSDKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFATNTILI  265

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttn  1082
             TPGQTTNVLLKT +H+PNAT+L++ARPYA+G   FDN+T AGIL+Y     T+ +  +  
Sbjct  266   TPGQTTNVLLKTKSHYPNATFLMTARPYASGLGTFDNTTVAGILQYKTPPNTHHSAASLK  325

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
              LPL  P LP  NDTSFAT F  KLRSLA+A FPANVP+KVD  FFFTVGLG  PCPQNQ
Sbjct  326   NLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQNQ  385

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN TKFAASVNN+SF+QPTTALLQ HFF QS GVYTADFPA P + FNYTG PP 
Sbjct  386   TCQGPTNATKFAASVNNVSFIQPTTALLQTHFFGQSNGVYTADFPAKPLIPFNYTGTPPN  445

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFF +GQGFGN+DPNKDP+
Sbjct  446   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFAVGQGFGNFDPNKDPA  505

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
              FNL+DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   
Sbjct  506   NFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPN  565

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLPKC
Sbjct  566   QKLFPPPADLPKC  578



>ref|XP_007140513.1| hypothetical protein PHAVU_008G119000g [Phaseolus vulgaris]
 gb|ESW12507.1| hypothetical protein PHAVU_008G119000g [Phaseolus vulgaris]
Length=584

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/581 (76%), Positives = 493/581 (85%), Gaps = 11/581 (2%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGR  287
             M  +F   F + +L        ++A  KHA +TRHYKF+IKMQN TRLCQTKSIVTVNG+
Sbjct  12    MKAMFLMLFALMILP-------ELAHGKHARVTRHYKFNIKMQNFTRLCQTKSIVTVNGQ  64

Query  288   FPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVY  467
             FPGPRIIAREGDRVV+KVVNHV+YNV++HWHGVRQLRSGWADGPAYITQCPIQ GQSYVY
Sbjct  65    FPGPRIIAREGDRVVIKVVNHVQYNVSLHWHGVRQLRSGWADGPAYITQCPIQRGQSYVY  124

Query  468   NFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTE  647
             NFT+ GQRGTL+WHAHISWLR TLYGPIVILPK+ V YPF QPF+EVPI+ GEWWKADTE
Sbjct  125   NFTVIGQRGTLWWHAHISWLRTTLYGPIVILPKRHVPYPFTQPFREVPIVLGEWWKADTE  184

Query  648   RIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDEL  827
              II+QA+QTG APN+SDA TINGLPGP+ NC AKD+FKLKVK GK YLLRLINAALNDE+
Sbjct  185   AIINQATQTGLAPNVSDAHTINGLPGPVSNCPAKDTFKLKVKPGKPYLLRLINAALNDEM  244

Query  828   FFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATG  1007
             FFSIANH+LTVVEADAVYVKPF+T IVLITPGQT NVLL+  +  PNAT+ ISARPYATG
Sbjct  245   FFSIANHTLTVVEADAVYVKPFSTKIVLITPGQTVNVLLRAKSKAPNATFAISARPYATG  304

Query  1008  PAPFDNSTTAGILEYst---nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             PA FDN+T  G L Y     +SNK+ T KLPL  P  P FND+ FA NF  K+RSLANA 
Sbjct  305   PAAFDNTTATGFLVYKKPSLSSNKSNTKKLPLLRPVFPKFNDSVFAMNFHNKVRSLANAR  364

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPA VPK VDRRFFFTVGLG+  C +NQ CQGP NNT+ AA+VNN++FV P  ALLQAHF
Sbjct  365   FPAKVPKTVDRRFFFTVGLGLSQCSKNQQCQGP-NNTRVAAAVNNVTFVMPNIALLQAHF  423

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             FNQSKGVYT DFPANPP KFNYTG PP+NIMV+S TKVV L FN+SVELV+QDTSIIGAE
Sbjct  424   FNQSKGVYTTDFPANPPFKFNYTGTPPSNIMVSSGTKVVVLPFNTSVELVLQDTSIIGAE  483

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFF++GQG GN+DP +DP KFNLVDPAERNT GVPSGGWVA+RFLADNPG 
Sbjct  484   SHPLHLHGFNFFIVGQGNGNFDPKRDPKKFNLVDPAERNTAGVPSGGWVALRFLADNPGV  543

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAWIV DGK R QKL PPP+DLPKC
Sbjct  544   WFMHCHLEVHTSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  584



>gb|AAB17192.1| laccase [Liriodendron tulipifera]
Length=585

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/561 (77%), Positives = 488/561 (87%), Gaps = 6/561 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++A A   GITRHYKFDI++QNVTRLC TKSIVTVNG+FPGP+I+AREGDRVVVKVVNHV
Sbjct  26    EIARANQEGITRHYKFDIRLQNVTRLCHTKSIVTVNGQFPGPKIVAREGDRVVVKVVNHV  85

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             + N+T+HWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTI GQ GTLFWHAHISWLR+
Sbjct  86    QNNITLHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTIIGQTGTLFWHAHISWLRS  145

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPIVILPK+G+ YPF +P+KEV IIFGEW+  DTE II+QA QTGG PN+SDA+TIN
Sbjct  146   TLYGPIVILPKRGIPYPFIKPYKEVSIIFGEWFNVDTEAIITQALQTGGGPNVSDAYTIN  205

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSA+D+F+L VK GKTYLLRLINAALNDELFFSIANH+LT+V+ DAVYVKPF
Sbjct  206   GLPGPLYNCSARDTFRLSVKPGKTYLLRLINAALNDELFFSIANHTLTIVDVDAVYVKPF  265

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-----  1058
             +TNI+LITPGQTTNVL+KT  H+PNAT+ + ARPYATG   FDNSTT G+LEY       
Sbjct  266   DTNILLITPGQTTNVLIKTKPHYPNATFFMGARPYATGLGTFDNSTTVGLLEYQKPNSSH  325

Query  1059  nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLG  1238
             +SN     +LPLF P+LP  NDT+FA N+TK+LRSLANA FPANVP+ +++ FFFTVGLG
Sbjct  326   SSNAVGMKQLPLFRPSLPSLNDTAFAANYTKRLRSLANAQFPANVPQTINKSFFFTVGLG  385

Query  1239  VIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKF  1418
               PCP+NQTCQGP N TKFAASVNN+SFV PTTALLQ HFF QS GVYTA+FP NP   F
Sbjct  386   SEPCPKNQTCQGP-NGTKFAASVNNVSFVMPTTALLQGHFFGQSNGVYTANFPTNPQFPF  444

Query  1419  NYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGN  1598
             NYTG PP N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN
Sbjct  445   NYTGTPPNNTMVSNGTKVVVLPFNASVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGN  504

Query  1599  YDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWI  1778
             Y+PNKDPS FNLVDP ERNTVGVPSG WVAIRF ADNPG WFMHCHLEVHTSWGLKMAW+
Sbjct  505   YNPNKDPSNFNLVDPVERNTVGVPSGSWVAIRFQADNPGVWFMHCHLEVHTSWGLKMAWV  564

Query  1779  VMDGKGRKQKLQPPPADLPKC  1841
             V+DGK   QKL PPP+DLPKC
Sbjct  565   VLDGKLPNQKLPPPPSDLPKC  585



>ref|XP_004137934.1| PREDICTED: laccase-17-like [Cucumis sativus]
 ref|XP_004156653.1| PREDICTED: laccase-17-like [Cucumis sativus]
 gb|KGN58859.1| hypothetical protein Csa_3G734120 [Cucumis sativus]
Length=572

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/579 (75%), Positives = 495/579 (85%), Gaps = 8/579 (1%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGR  287
             MV L  K   IFV    C++   V    +A ITRHYKF I++QNVTRLCQTK+IVTVNG+
Sbjct  1     MVALSQK--AIFVNILLCFILNIV----NARITRHYKFQIQLQNVTRLCQTKTIVTVNGQ  54

Query  288   FPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVY  467
             FPGPRIIAREGDR+++KVVNHV+ N+++HWHGVRQ RSGWADGPAY+TQCPIQTGQSYVY
Sbjct  55    FPGPRIIAREGDRLLIKVVNHVQNNISLHWHGVRQRRSGWADGPAYVTQCPIQTGQSYVY  114

Query  468   NFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTE  647
             NFT+ GQRGTLFWHAHISWLR+TLYGPI+ILPK    YPFPQPFKEVPIIFGEWWKADTE
Sbjct  115   NFTVDGQRGTLFWHAHISWLRSTLYGPIIILPKTHQPYPFPQPFKEVPIIFGEWWKADTE  174

Query  648   RIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDEL  827
              +I+QA Q GGAPNISDAFT NGLPGP YNCSA+D+FKLKVK GK+YLLRLINAALNDEL
Sbjct  175   NVINQAMQNGGAPNISDAFTFNGLPGPSYNCSAQDTFKLKVKPGKSYLLRLINAALNDEL  234

Query  828   FFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATG  1007
             FFSIANH+LTVVEADAVYVKPF T+++LITPGQT NVLL T ++ PNAT+LI+ARPYAT 
Sbjct  235   FFSIANHTLTVVEADAVYVKPFKTDVILITPGQTMNVLLHTKSNSPNATFLIAARPYATA  294

Query  1008  PAPFDNSTTAGILEYs-tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP  1184
             P  FDN+T  G+LEY  T S      KLPL  P LP FNDTSF+  F  K+RSLAN+ FP
Sbjct  295   PVAFDNTTVTGLLEYEPTKSLLNKNKKLPLHKPVLPRFNDTSFSIKFNGKIRSLANSKFP  354

Query  1185  ANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFN  1364
             A VP +V  RFFFTVGLG++PC +N++CQGP NNT+ +AS+NN++FVQP TALLQ+HFFN
Sbjct  355   AKVPMRVKWRFFFTVGLGLLPCRRNRSCQGP-NNTRLSASINNVTFVQPNTALLQSHFFN  413

Query  1365  QSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESH  1544
             +S GVYT DFPANPP+KFNYTG PP N MV+S TKVV L +NS+VELV+QDTSI+ AESH
Sbjct  414   KSNGVYTTDFPANPPIKFNYTGTPPKNSMVSSGTKVVMLPYNSAVELVLQDTSIVTAESH  473

Query  1545  PLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWF  1724
             PLHLHGFNFFV+GQG GN+DPNKDP KFNLVDPAERNTVGVPSGGWVAIRF+ADNPGAWF
Sbjct  474   PLHLHGFNFFVVGQGIGNFDPNKDPPKFNLVDPAERNTVGVPSGGWVAIRFIADNPGAWF  533

Query  1725  MHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             MHCHLEVHTSWGLKMAWIV DGK   QKL PPP+DLPKC
Sbjct  534   MHCHLEVHTSWGLKMAWIVEDGKLPNQKLPPPPSDLPKC  572



>emb|CAN60069.1| hypothetical protein VITISV_012401 [Vitis vinifera]
Length=573

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/573 (75%), Positives = 492/573 (86%), Gaps = 7/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W+  ++A    AGITRHYKF+IK+QNVTRLC TK+IV+VNG+FPGPRIIAR
Sbjct  4     VLFLVLNSLWLFPELA---SAGITRHYKFNIKLQNVTRLCHTKNIVSVNGQFPGPRIIAR  60

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVV VVNHV  NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNF ITGQRG
Sbjct  61    EGDRVVVNVVNHVPNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFXITGQRG  120

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAH+SWLR+T+YGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  121   TLFWHAHMSWLRSTVYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  180

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  181   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  240

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  241   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  300

Query  1035  AGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AG+L Y     ++ + ++   LP+F PTLP  NDTSFA NFT+KLRSLAN+ FPANVPKK
Sbjct  301   AGLLHYEPPQKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKK  360

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+TKF+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  361   VDKRFFFTVGLGTSPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVY  420

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPA P   FNYTG PP N M ++ TKVV L FN++VELV+QDTSI+G ESHPLHLHG
Sbjct  421   TTDFPATPIFPFNYTGTPPNNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHG  480

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRF+ADNPG WFMHCHLE
Sbjct  481   FNFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLE  540

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAWIV DGK   QKL PPP+DLP+C
Sbjct  541   VHTSWGLKMAWIVKDGKLPNQKLPPPPSDLPQC  573



>ref|XP_006602579.1| PREDICTED: laccase-17-like isoform X2 [Glycine max]
Length=580

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/553 (77%), Positives = 479/553 (87%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG+FPGPRI+AREGDR+++KV +HV+ N++IH
Sbjct  28    GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGDRLLIKVTSHVQNNISIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTLFWHAHISWLR+TLYGPI+
Sbjct  88    WHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLFWHAHISWLRSTLYGPII  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+G  YPF +P+KEVPIIFGEWW  D E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  148   ILPKQGAPYPFTKPYKEVPIIFGEWWNTDPEAVITQALQTGGGPNVSDAYTINGLPGPLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF+T+ +LI
Sbjct  208   NCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFDTDTILI  267

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----nsnktttn  1082
              PGQT+NVLLKT +H+PNAT+ +SARPYATG   FDNST A ILEY        + T+  
Sbjct  268   APGQTSNVLLKTKSHYPNATFFMSARPYATGQGTFDNSTVAAILEYEVPPHFVHSTTSVK  327

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             KL LF P LP  NDTSFATNF  KL SLA+A FPANVP+KVD+ FFFTVGLG  PCPQNQ
Sbjct  328   KLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQNQ  387

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN TKFAASVNN+SF+QPTTALLQAHFF QS GVY+  FP +P V FNYTG PP 
Sbjct  388   TCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPPN  447

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP+
Sbjct  448   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDPA  507

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
               N VDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DG+   
Sbjct  508   NLNPVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELPN  567

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLPKC
Sbjct  568   QKLLPPPADLPKC  580



>ref|XP_009597234.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=552

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/548 (81%), Positives = 487/548 (89%), Gaps = 3/548 (1%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGD-VALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M   F K + +F L  F  V  D +ALAKH GITRHYKF+I+MQN+TRLCQTKSIVTVNG
Sbjct  1     MASYFLKCYNLFFLTIFVLVLADTLALAKHGGITRHYKFNIQMQNMTRLCQTKSIVTVNG  60

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDR+V+KVVNHV+YNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV
Sbjct  61    QFPGPRIIAREGDRLVIKVVNHVQYNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  120

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTLFWHAHISWLR TLYGPIVILPKKGVAYPFPQPFKE+PI+FGEWWKADT
Sbjct  121   YNFTITGQRGTLFWHAHISWLRVTLYGPIVILPKKGVAYPFPQPFKEIPILFGEWWKADT  180

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E IIS+A QTGGAPNISDA+TINGLPG  YNCSAKD+FKLKVK GKTYLLRL+NAALNDE
Sbjct  181   ETIISKALQTGGAPNISDAYTINGLPGLFYNCSAKDTFKLKVKPGKTYLLRLVNAALNDE  240

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+LTVVE DAVYVKPF T+ +LITPGQTTNVLLKT   HPNAT+L++ARPYAT
Sbjct  241   LFFSIANHNLTVVEVDAVYVKPFKTSTILITPGQTTNVLLKTKHFHPNATFLMAARPYAT  300

Query  1005  GPAPFDNSTTAGILEY-stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANF  1181
             GPA FDNSTT GILEY  +++N   ++K PL  P LP+FNDT+FAT+F KK+RSLANA F
Sbjct  301   GPAAFDNSTTTGILEYHQSSNNTNKSSKFPLLNPKLPIFNDTTFATSFAKKIRSLANAKF  360

Query  1182  PANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFF  1361
              ANVPKKVD+RFFFTVGLG+ PCP+NQTCQGP NNTK AASVN+ISFVQP  ALLQ+HFF
Sbjct  361   LANVPKKVDKRFFFTVGLGLNPCPKNQTCQGP-NNTKLAASVNDISFVQPNVALLQSHFF  419

Query  1362  NQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAES  1541
             NQSKGVYT DFP NPP KFNYTGNPPTNI VT+ TKVV L FN+SVELVMQDTSII AES
Sbjct  420   NQSKGVYTTDFPINPPFKFNYTGNPPTNIFVTTGTKVVVLPFNTSVELVMQDTSIISAES  479

Query  1542  HPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAW  1721
             HPLHLHGFNFFV+GQGFGNY+ +KD + FNLVDPAERNTVGVPSGGWV+IRF ADNPG W
Sbjct  480   HPLHLHGFNFFVVGQGFGNYNSSKDTANFNLVDPAERNTVGVPSGGWVSIRFFADNPGVW  539

Query  1722  FMHCHLEV  1745
             FMH  ++V
Sbjct  540   FMHXKIDV  547



>gb|KDO73109.1| hypothetical protein CISIN_1g047497mg [Citrus sinensis]
Length=580

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/570 (76%), Positives = 486/570 (85%), Gaps = 6/570 (1%)
 Frame = +3

Query  147   LAAFCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             L   C       LA+ A G+TRHYKFDIK+QNVTRLC TKSI++VNG+FPGPRI+AREGD
Sbjct  12    LGVICSFVTLCLLAEPALGVTRHYKFDIKLQNVTRLCNTKSIISVNGKFPGPRIVAREGD  71

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             ++++KV+NHV+ N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFTI GQRGTL+
Sbjct  72    QLLIKVMNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTIVGQRGTLW  131

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAH+SWLR+TLYGPI+ILPK+G+ YPF +P+KEVPIIFGEW+KAD E IISQA QTGG 
Sbjct  132   WHAHLSWLRSTLYGPIIILPKRGIPYPFTKPYKEVPIIFGEWFKADPETIISQALQTGGG  191

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV
Sbjct  192   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  251

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             EADA+YVKPF T  +LI PGQTTNVLLKT  H+P+AT+ + ARPY TG   FDNST AGI
Sbjct  252   EADAIYVKPFETETLLIAPGQTTNVLLKTKPHYPSATFFMKARPYVTGQGTFDNSTVAGI  311

Query  1044  LEYst----nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDR  1211
             LEY      + +  +   LPLF P LP  NDTSFAT+FT KLRSLA+  FPANVP+ VDR
Sbjct  312   LEYEKPLNFHLSSNSIKNLPLFKPVLPALNDTSFATSFTNKLRSLASTQFPANVPQNVDR  371

Query  1212  RFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTAD  1391
             RFFFTVGLG  PC  NQTCQGP N T F ASVNNISFV PTTALLQAHF  +S GVY  D
Sbjct  372   RFFFTVGLGTSPCQSNQTCQGP-NGTMFQASVNNISFVMPTTALLQAHFTGKSYGVYNPD  430

Query  1392  FPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNF  1571
             FP +P + FNYTG PP N MV++ TK+V L FNSSVEL+MQDTSI+GAESHPLHLHGFNF
Sbjct  431   FPTSPLIAFNYTGTPPNNTMVSNGTKLVVLPFNSSVELIMQDTSILGAESHPLHLHGFNF  490

Query  1572  FVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHT  1751
             FV+GQGFGN+DPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHT
Sbjct  491   FVVGQGFGNFDPNKDPTKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  550

Query  1752  SWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SWGLKMAWIV+DGK   QKL PPPADLP+C
Sbjct  551   SWGLKMAWIVLDGKHPNQKLPPPPADLPQC  580



>ref|XP_008442529.1| PREDICTED: laccase-17-like [Cucumis melo]
Length=572

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/576 (74%), Positives = 494/576 (86%), Gaps = 6/576 (1%)
 Frame = +3

Query  117   LFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPG  296
             +F  +  IFV    C++        +AGITRHYKF I++QNVTRLCQTK+I+TVNG+FPG
Sbjct  2     VFLSQKAIFVNILLCFILN----IANAGITRHYKFQIQLQNVTRLCQTKTILTVNGQFPG  57

Query  297   PRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT  476
             PRIIAREGDR+++KVVNH++ N+++HWHGV+Q RSGWADGPAY+TQCPIQTGQSYVYNFT
Sbjct  58    PRIIAREGDRLLIKVVNHLQNNISLHWHGVQQRRSGWADGPAYVTQCPIQTGQSYVYNFT  117

Query  477   ITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERII  656
             + GQRGTLFWHAHISWLR+TLYGPIVILPK    YPFPQPFKEVPI+FGEWWKADTE +I
Sbjct  118   VEGQRGTLFWHAHISWLRSTLYGPIVILPKTHQPYPFPQPFKEVPIVFGEWWKADTEDVI  177

Query  657   SQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFS  836
             +QA Q GGAPNISDAFT NGLPGP YNCSA+D+FKLKVK  K YLLRLINAALNDELFFS
Sbjct  178   NQAMQNGGAPNISDAFTFNGLPGPSYNCSAQDTFKLKVKPRKPYLLRLINAALNDELFFS  237

Query  837   IANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAP  1016
             IANH+LTVVEADAVYVKPF +++VLITPGQT NVLL T +  PNAT+LI+ARPYAT PA 
Sbjct  238   IANHTLTVVEADAVYVKPFKSDVVLITPGQTMNVLLHTKSISPNATFLIAARPYATAPAA  297

Query  1017  FDNSTTAGILEYs-tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANV  1193
             FDN+T  G+LEY  T S      KLPL  P LP FNDT+F+  F  K+RSLAN+ FPA V
Sbjct  298   FDNTTVTGLLEYEPTKSLLNKNKKLPLHKPVLPRFNDTNFSIKFNGKIRSLANSKFPAKV  357

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             P +VDRRFFFTVGLG++PC +N++CQGP NNT+F+AS+NN++FVQP TALLQAHFFN+S 
Sbjct  358   PMRVDRRFFFTVGLGLLPCRKNRSCQGP-NNTRFSASINNVTFVQPNTALLQAHFFNKSN  416

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFP NPP+KFNYTG PP N+MV+S TKVV L +N++VELV+QDTSI+ AESHPLH
Sbjct  417   GVYTTDFPVNPPIKFNYTGTPPKNLMVSSGTKVVMLPYNTAVELVLQDTSIVTAESHPLH  476

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQG GN+DPN+DP KFNLVDPAERNTVGVPSGGWVAIRF+ADNPGAWFMHC
Sbjct  477   LHGFNFFVVGQGIGNFDPNRDPPKFNLVDPAERNTVGVPSGGWVAIRFIADNPGAWFMHC  536

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             H EVHTSWGLKMAWIV DGK   QKL PPP+DLPKC
Sbjct  537   HFEVHTSWGLKMAWIVQDGKLPNQKLPPPPSDLPKC  572



>ref|XP_008387787.1| PREDICTED: laccase-17-like [Malus domestica]
Length=578

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/572 (76%), Positives = 497/572 (87%), Gaps = 4/572 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I F + AF  V  + ALAKHA +TRHY F+IK Q+VTRLCQTKS VTVNG+FPGPRIIAR
Sbjct  8     IFFAVCAFICVFSEPALAKHARVTRHYNFNIKSQSVTRLCQTKSXVTVNGQFPGPRIIAR  67

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+V+KVVN+V++NVT+HWHG+RQLR+GWADGPAYITQCPIQTGQSYVYNFT TGQRG
Sbjct  68    EGDRLVIKVVNNVQHNVTLHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNFTXTGQRG  127

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLRAT+YGPIVILPK+ V YPFPQPF+EV IIFGEWWKADTE++I+QA QT
Sbjct  128   TLFWHAHISWLRATVYGPIVILPKRHVPYPFPQPFQEVXIIFGEWWKADTEKVINQALQT  187

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G  PN+SDA+TINGLPGPLYNCS KD +KLKVK G+TYLLRLINAALN+ELFFSIANH+L
Sbjct  188   GLGPNVSDAYTINGLPGPLYNCSTKDIYKLKVKPGRTYLLRLINAALNNELFFSIANHTL  247

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVEADAVYVKPF T  VLITPGQTTNVLL T    PNA ++++ARPY +GPA FDNSTT
Sbjct  248   TVVEADAVYVKPFKTQTVLITPGQTTNVLLMTKPKSPNAKFVMAARPYVSGPAAFDNSTT  307

Query  1035  AGILEYs--tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP-ANVPKKV  1205
              G+LEY   ++S+ +  NK  LFTP LP FNDT F+  + KK+ SLA+  FP ANVPK V
Sbjct  308   TGLLEYEISSSSSNSKNNKKQLFTPVLPKFNDTLFSMKYNKKILSLASPKFPAANVPKTV  367

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             ++RFFFTVGLG++PC + QTCQGP NNT+ AA++NN++FVQP TALLQAHFFNQSKGVYT
Sbjct  368   EKRFFFTVGLGILPCLKKQTCQGP-NNTRLAAAINNVTFVQPNTALLQAHFFNQSKGVYT  426

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFPANP VKFNYTG+PP NI V+S TKVV L FN+SVELV+QDTSIIGAESHPLHLHGF
Sbjct  427   TDFPANPAVKFNYTGSPPNNIAVSSGTKVVVLPFNTSVELVLQDTSIIGAESHPLHLHGF  486

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+G G GN+D   DP K+NLVDPAERNT+GVPSGGWVAIRFLADNPG WFMHCHLEV
Sbjct  487   NFFVLGLGSGNFDKKNDPKKYNLVDPAERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEV  546

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAW+V+DGK R QKL PPP+DLPKC
Sbjct  547   HTSWGLKMAWVVLDGKRRNQKLPPPPSDLPKC  578



>ref|XP_003552160.2| PREDICTED: laccase-17-like isoform X1 [Glycine max]
Length=580

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/553 (77%), Positives = 478/553 (86%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG+FPGP I+AREGDR+++KV NHV+ N++IH
Sbjct  28    GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPHIVAREGDRLLIKVTNHVQNNISIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTLFWHAHISWLR+TLYGPI+
Sbjct  88    WHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLFWHAHISWLRSTLYGPII  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+G  YPF +P+KEVPIIFGEWW  D E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  148   ILPKQGAPYPFTKPYKEVPIIFGEWWNTDPEAVITQALQTGGGPNVSDAYTINGLPGPLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF+T+ +LI
Sbjct  208   NCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFDTDTILI  267

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----nsnktttn  1082
              PGQT+NVLLKT +H+PNAT+ +SARPYATG   FDNST A ILEY        + T+  
Sbjct  268   APGQTSNVLLKTKSHYPNATFFMSARPYATGQGTFDNSTVAAILEYEVPPHFVHSTTSVK  327

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             KL LF P LP  NDTSFATNF  KL SLA+A FPANVP+KVD+ FFFTVGLG  PCPQNQ
Sbjct  328   KLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQNQ  387

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN TKFAASVNN+SF+QPTTALLQAHFF QS GVY+  FP +P V FNYTG PP 
Sbjct  388   TCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPPN  447

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP+
Sbjct  448   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDPA  507

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
               N VDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DG+   
Sbjct  508   NLNPVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELPN  567

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLPKC
Sbjct  568   QKLLPPPADLPKC  580



>ref|XP_002282815.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/573 (76%), Positives = 485/573 (85%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W   +  LA  +GITRHYKF+I++QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  14    VLFLVLNSLWYLPE--LANGSGITRHYKFNIELQNVTRLCHTKSIVSVNGQFPGPPIIAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVVKVVNHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  72    EGDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+I PKK V YPF +P+KEVPIIFGEWW  D E +I+QA Q 
Sbjct  132   TLFWHAHISWLRSTLYGPIIIFPKKNVPYPFAKPYKEVPIIFGEWWNTDPEAVITQALQN  191

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SD +TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  192   GGGPNVSDGYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  251

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  252   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGSGTFDNSTV  311

Query  1035  AGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGIL Y      + +      LPLF PTLP  NDTSFA NFT+KLRSLAN  FPANVP+K
Sbjct  312   AGILHYEPPPKSSPSAPSFENLPLFKPTLPPLNDTSFAANFTRKLRSLANTQFPANVPQK  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTVGLG  PCPQNQTCQGP N+T F+ASVNN+SFV PTTA+LQAHFF QS GVY
Sbjct  372   VDKRFFFTVGLGTNPCPQNQTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVY  431

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFPA P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI+G ESHPLHLHG
Sbjct  432   TTDFPATPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHG  491

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KDPSKFNLVDP ERNTVGVPSGGWVAIRFLADNPG W MHCHLE
Sbjct  492   FNFFVVGQGFGNFDAKKDPSKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHLE  551

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKM WIV DGK   QKL PPP+DLPKC
Sbjct  552   VHTSWGLKMGWIVKDGKMPNQKLPPPPSDLPKC  584



>ref|XP_007022468.1| Laccase 17 [Theobroma cacao]
 gb|EOY13993.1| Laccase 17 [Theobroma cacao]
Length=577

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/550 (78%), Positives = 481/550 (87%), Gaps = 3/550 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHYKFDIK+ NVTRL  TKSIV+VNG+FPGPRI+AREGD++++KVVNHV  N++IHW
Sbjct  29    GITRHYKFDIKLHNVTRLRNTKSIVSVNGQFPGPRIVAREGDQLLIKVVNHVSNNISIHW  88

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAY+TQCP+QTGQSYVYNFTI GQRGTLFWHAHISWLRAT+YGP+VI
Sbjct  89    HGIRQLRSGWADGPAYVTQCPVQTGQSYVYNFTIVGQRGTLFWHAHISWLRATVYGPLVI  148

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPFP+P+KEVPIIFGEW+ AD E +ISQA QTGG PN+SDA+TINGLPGPLYN
Sbjct  149   LPKRGVPYPFPKPYKEVPIIFGEWFNADPEAVISQALQTGGGPNVSDAYTINGLPGPLYN  208

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK G+TYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF T  +LIT
Sbjct  209   CSAKDTFKLKVKPGRTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFETETLLIT  268

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnk--tttnkLP  1091
             PGQTTNVLLKT   +P+AT+ ++ARPY TG   FDNST AGILEY + SN   ++   LP
Sbjct  269   PGQTTNVLLKTKPSYPSATFFMTARPYVTGQGTFDNSTVAGILEYESPSNSFHSSIKMLP  328

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             LF P LP  NDTSFATNF  KLRSLA+A +PANVP+KVD+ FFFTVGLG   C QNQTCQ
Sbjct  329   LFKPILPALNDTSFATNFASKLRSLASAQYPANVPRKVDKHFFFTVGLGTSACQQNQTCQ  388

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N TKFAASVNN+SF  PTTALLQ+HFF QS GVYT DFP NP + FNYTG PP N M
Sbjct  389   GP-NGTKFAASVNNVSFTMPTTALLQSHFFGQSNGVYTPDFPINPIIPFNYTGTPPNNTM  447

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ TKVV L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP+ FN
Sbjct  448   VSNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFN  507

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DGK   QKL
Sbjct  508   LVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPNQKL  567

Query  1812  QPPPADLPKC  1841
              PPPADLPKC
Sbjct  568   LPPPADLPKC  577



>ref|XP_003552179.1| PREDICTED: laccase-17-like [Glycine max]
Length=584

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/571 (76%), Positives = 490/571 (86%), Gaps = 4/571 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +FV+     +  ++  AKHA +TRHYKF+IKMQN TRLCQTK+IVTVNGRFPGPRIIARE
Sbjct  15    MFVVLCALMILPELTHAKHARVTRHYKFNIKMQNFTRLCQTKNIVTVNGRFPGPRIIARE  74

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR++VKVVNHV+YNVT+HWHG+RQL+S WADGPAYITQCPIQTGQS+VYNFT+ GQRGT
Sbjct  75    GDRIMVKVVNHVQYNVTLHWHGIRQLKSAWADGPAYITQCPIQTGQSFVYNFTVIGQRGT  134

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L+WHAHISWLR TLYGPIVILPK+ V YPFPQPF+EVPII GEWWKADTE +I+QA QTG
Sbjct  135   LWWHAHISWLRTTLYGPIVILPKRHVPYPFPQPFREVPIILGEWWKADTEAVINQAMQTG  194

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
              APN+SDA TINGLPGP+ NC+AK++FKLKVK GKTYLLRLINAALNDE+FFSIANH+LT
Sbjct  195   LAPNVSDAHTINGLPGPVSNCAAKETFKLKVKPGKTYLLRLINAALNDEMFFSIANHTLT  254

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             +VEADAVYVKPF+T +VLITPGQT NVLLK  +  PNAT+ IS RPYATGPA FDN+T  
Sbjct  255   MVEADAVYVKPFSTKVVLITPGQTVNVLLKAKSKAPNATFAISTRPYATGPAAFDNTTAT  314

Query  1038  GILEY---stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             G LEY   S  S+K+ T KLPL     P FNDT FA NF  K+RSLA+A FPA VPK VD
Sbjct  315   GFLEYKKPSLASSKSNTKKLPLLRAVFPKFNDTVFAMNFHNKVRSLASARFPAKVPKTVD  374

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             RRFFFTVGLG+  C +NQ CQGP NNT+ AA+VNN++FV P  ALLQAHFFN+SKGVYT 
Sbjct  375   RRFFFTVGLGISQCSKNQQCQGP-NNTRVAAAVNNVTFVTPNIALLQAHFFNKSKGVYTT  433

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFPANPP KFNYTG PP+NI V+S TK V L +N+SVELV+QDTSIIGAESHPLHLHGFN
Sbjct  434   DFPANPPFKFNYTGTPPSNIFVSSGTKAVVLPYNTSVELVLQDTSIIGAESHPLHLHGFN  493

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FF++GQG GN+DP KDP KFNLVDPAERNT GVPSGGWVA+RFLADNPG WFMHCHLEVH
Sbjct  494   FFIVGQGNGNFDPKKDPKKFNLVDPAERNTAGVPSGGWVAVRFLADNPGVWFMHCHLEVH  553

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             TSWGLKMAWIV DGK R QKL PPP+DLPKC
Sbjct  554   TSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  584



>gb|KHN14004.1| Laccase-17 [Glycine soja]
Length=577

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/571 (76%), Positives = 490/571 (86%), Gaps = 4/571 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +FV+     +  ++  AKHA +TRHYKF+IKMQN TRLCQTK+IVTVNGRFPGPRIIARE
Sbjct  8     MFVVLCALMILPELTHAKHARVTRHYKFNIKMQNFTRLCQTKNIVTVNGRFPGPRIIARE  67

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR++VKVVNHV+YNVT+HWHG+RQL+S WADGPAYITQCPIQTGQS+VYNFT+ GQRGT
Sbjct  68    GDRIMVKVVNHVQYNVTLHWHGIRQLKSAWADGPAYITQCPIQTGQSFVYNFTVIGQRGT  127

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L+WHAHISWLR TLYGPIVILPK+ V YPFPQPF+EVPII GEWWKADTE +I+QA QTG
Sbjct  128   LWWHAHISWLRTTLYGPIVILPKRHVPYPFPQPFREVPIILGEWWKADTEAVINQAMQTG  187

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
              APN+SDA TINGLPGP+ NC+AK++FKLKVK GKTYLLRLINAALNDE+FFSIANH+LT
Sbjct  188   LAPNVSDAHTINGLPGPVSNCAAKETFKLKVKPGKTYLLRLINAALNDEMFFSIANHTLT  247

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             +VEADAVYVKPF+T +VLITPGQT NVLLK  +  PNAT+ IS RPYATGPA FDN+T  
Sbjct  248   MVEADAVYVKPFSTKVVLITPGQTVNVLLKAKSKAPNATFAISTRPYATGPAAFDNTTAT  307

Query  1038  GILEY---stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             G LEY   S  S+K+ T KLPL     P FNDT FA NF  K+RSLA+A FPA VPK VD
Sbjct  308   GFLEYKKPSLASSKSNTKKLPLLRAVFPKFNDTVFAMNFHNKVRSLASARFPAKVPKTVD  367

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             RRFFFTVGLG+  C +NQ CQGP NNT+ AA+VNN++FV P  ALLQAHFFN+SKGVYT 
Sbjct  368   RRFFFTVGLGISQCSKNQQCQGP-NNTRVAAAVNNVTFVTPNIALLQAHFFNKSKGVYTT  426

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFPANPP KFNYTG PP+NI V+S TK V L +N+SVELV+QDTSIIGAESHPLHLHGFN
Sbjct  427   DFPANPPFKFNYTGTPPSNIFVSSGTKAVVLPYNTSVELVLQDTSIIGAESHPLHLHGFN  486

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FF++GQG GN+DP KDP KFNLVDPAERNT GVPSGGWVA+RFLADNPG WFMHCHLEVH
Sbjct  487   FFIVGQGNGNFDPKKDPKKFNLVDPAERNTAGVPSGGWVAVRFLADNPGVWFMHCHLEVH  546

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             TSWGLKMAWIV DGK R QKL PPP+DLPKC
Sbjct  547   TSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  577



>gb|AAB17193.1| laccase [Liriodendron tulipifera]
Length=586

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/561 (76%), Positives = 491/561 (88%), Gaps = 6/561 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++A +KHA ITRHYKFDI+M+NVTRLC T++I+TVNG+FPGP+IIAREGDRVVVKVVNHV
Sbjct  27    ELAHSKHARITRHYKFDIQMRNVTRLCHTRNILTVNGQFPGPKIIAREGDRVVVKVVNHV  86

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
               NVT+HWHGVRQLRSGWADGPAY+TQCPIQTGQS+VYNFTI GQRGTLFWHAHISWLR+
Sbjct  87    ANNVTLHWHGVRQLRSGWADGPAYVTQCPIQTGQSFVYNFTIVGQRGTLFWHAHISWLRS  146

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPIVILPK+GV YPF +P+K VPIIFGEW+  D E II+QA QTG  PN+SDAFTIN
Sbjct  147   TLYGPIVILPKRGVPYPFAKPYKSVPIIFGEWFNVDPEAIITQALQTGAGPNVSDAFTIN  206

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+F+L V+ GKTYLLRLINAALNDELFFSIANH+LT+V+ DA+YVKPF
Sbjct  207   GLPGPLYNCSAKDTFRLSVEPGKTYLLRLINAALNDELFFSIANHTLTIVDVDAIYVKPF  266

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnkt  1073
             +T+I+LITPGQTTNVLLKT  H+PNAT+ +SARPYATG   FDN+TT GILEY   ++  
Sbjct  267   DTDILLITPGQTTNVLLKTKPHYPNATFFMSARPYATGRGAFDNTTTIGILEYQKPNSSH  326

Query  1074  ttnk-----LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLG  1238
              +N      LPLF P+LP FNDT+FA N+T++LRSLANA FPANVP+ VDRRFFFTVGLG
Sbjct  327   PSNAIGIKDLPLFRPSLPGFNDTTFAANYTRRLRSLANAKFPANVPQTVDRRFFFTVGLG  386

Query  1239  VIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKF  1418
               PCP NQTCQGP N TKF+AS+NN+S+VQPTTALLQAHFF QS GVY+ +FP  PP  F
Sbjct  387   TQPCPNNQTCQGP-NGTKFSASINNVSYVQPTTALLQAHFFGQSNGVYSTNFPTKPPFPF  445

Query  1419  NYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGN  1598
             NYTG PP N MV++ TKVV L FN++VELV+QDTSI GAESHPLHLHG+NFFVIGQGFGN
Sbjct  446   NYTGTPPNNTMVSNGTKVVVLPFNTTVELVLQDTSIQGAESHPLHLHGYNFFVIGQGFGN  505

Query  1599  YDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWI  1778
             Y+PNKDPS FNL+DP ERNTVGVP+GGWVAIRF ADNPG WFMHCHLEVHTSWGLKMAW+
Sbjct  506   YNPNKDPSNFNLIDPVERNTVGVPAGGWVAIRFQADNPGVWFMHCHLEVHTSWGLKMAWV  565

Query  1779  VMDGKGRKQKLQPPPADLPKC  1841
             V+DGK   QKL PPP+DLP+C
Sbjct  566   VLDGKLPNQKLPPPPSDLPQC  586



>ref|XP_003530894.1| PREDICTED: laccase-17-like [Glycine max]
Length=578

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/583 (74%), Positives = 485/583 (83%), Gaps = 9/583 (2%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M V  F     +  L  FC     +A     G T+HY F+I+ QNVTRLC TKSIVTVNG
Sbjct  1     MGVSHFKIPLFLLSLIIFCMFEHALA-----GTTKHYNFEIRHQNVTRLCHTKSIVTVNG  55

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRI+AREGDR+++KV NHV+ N+TIHWHG+RQL+SGWADGP+Y+TQCPIQTGQ++V
Sbjct  56    QFPGPRIVAREGDRLLIKVTNHVQNNITIHWHGIRQLQSGWADGPSYVTQCPIQTGQTFV  115

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YN+TI GQRGTL+WHAHISWLR+TLYGP++ILPK    YPF +P KEVPIIFGEWW AD 
Sbjct  116   YNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKLNAQYPFAKPHKEVPIIFGEWWNADP  175

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E II+QA QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK GK YLLRLINAALNDE
Sbjct  176   EAIITQALQTGGGPNVSDAYTINGLPGPLYNCSHKDTFKLKVKPGKIYLLRLINAALNDE  235

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+LTVVE DAVYVKPF TN +LITPGQTTNV+LKT +H+PNAT+L++ARPYAT
Sbjct  236   LFFSIANHTLTVVETDAVYVKPFATNTILITPGQTTNVILKTNSHYPNATFLMTARPYAT  295

Query  1005  GPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLAN  1172
             G   FDN+T A ILEY     T+ +  +   LPL  P LP  NDTSFAT FT KLRSLA+
Sbjct  296   GLGTFDNTTVAAILEYKTPSNTHHSAASLKNLPLLKPILPALNDTSFATKFTNKLRSLAS  355

Query  1173  ANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQA  1352
             A FPANVP+KVD+ FFFTVGLG  PCPQNQTCQGPTN+TKF+ASVNN+SF+QPTTALLQ 
Sbjct  356   AQFPANVPQKVDKHFFFTVGLGTTPCPQNQTCQGPTNSTKFSASVNNVSFIQPTTALLQT  415

Query  1353  HFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIG  1532
             HFF QS  VYT DFP  P V FNYTG PP N MV++ TKVV L FN+SVELVMQDTSI+G
Sbjct  416   HFFGQSNRVYTPDFPTKPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILG  475

Query  1533  AESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNP  1712
             AESHPLHLHGFNFFV+GQGFGNYDPNKDP+ FNL DP ERNTVGVPSGGWVAIRFLADNP
Sbjct  476   AESHPLHLHGFNFFVVGQGFGNYDPNKDPANFNLDDPIERNTVGVPSGGWVAIRFLADNP  535

Query  1713  GAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             G WFMHCHLEVHTSWGLKMAW+V+DGK   QKL PPPADLP C
Sbjct  536   GVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLFPPPADLPMC  578



>emb|CDP06593.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/575 (76%), Positives = 492/575 (86%), Gaps = 21/575 (4%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             + ++ VL +F WV  D A AKH GITRHYKFD++MQNVTRLCQTKSIVTVNG+ PGP+I 
Sbjct  7     KHLLVVLISF-WVFADPAFAKHGGITRHYKFDVRMQNVTRLCQTKSIVTVNGQLPGPQIT  65

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRV++KVVNHV+YN+T+HWHGVRQLRSGWADGPAY+TQCPIQTGQSYVYNFT+TGQ
Sbjct  66    AREGDRVIIKVVNHVQYNLTVHWHGVRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVTGQ  125

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR T+YGPIVILPK+GV YPFPQP+KEVPIIFGEWWK DTE +I+QA 
Sbjct  126   RGTLFWHAHISWLRVTVYGPIVILPKRGVPYPFPQPYKEVPIIFGEWWKTDTEILINQAM  185

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTG APN+SDAFTINGLPG LYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH
Sbjct  186   QTGLAPNVSDAFTINGLPGHLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANH  245

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             SLTVVEADAVY KPF T+ VLITPGQTTNVLLKT  H PNAT+L++ARPYATGPA FDN+
Sbjct  246   SLTVVEADAVYTKPFKTDTVLITPGQTTNVLLKTKRHSPNATFLMAARPYATGPAAFDNT  305

Query  1029  TTAGILEYstns----nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             TTAGILEY   S    +      LPL  P+LP+FNDT+FA NF K++RSLA  NFPANVP
Sbjct  306   TTAGILEYHLPSPVPKSNKNKIHLPLLKPSLPIFNDTTFAANFNKRVRSLATPNFPANVP  365

Query  1197  KKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKG  1376
             +K+ RRFFFTVGLG++ CPQ+QTCQGP NNT+ AA+VNN+SFV PTTALLQAHFFNQ+ G
Sbjct  366   QKIGRRFFFTVGLGIMGCPQSQTCQGP-NNTRVAAAVNNVSFVMPTTALLQAHFFNQNNG  424

Query  1377  VYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHL  1556
             VYT DFPANPP  FNYTG PP NIMV+S TKVV L FN+SVELV+QDTSIIGAESHPLHL
Sbjct  425   VYTTDFPANPPFNFNYTGTPPANIMVSSGTKVVVLPFNTSVELVLQDTSIIGAESHPLHL  484

Query  1557  HGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCH  1736
             HGFNFF++GQG GN+DP KDP+KFNLVDPAERNTVGVPSGGW+AIRFLADNPG +    +
Sbjct  485   HGFNFFIVGQGIGNFDPKKDPAKFNLVDPAERNTVGVPSGGWIAIRFLADNPGIYIYITN  544

Query  1737  LEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
                             DGKGRKQKL PPP+DLPKC
Sbjct  545   ---------------YDGKGRKQKLPPPPSDLPKC  564



>ref|XP_003632204.1| PREDICTED: laccase-17 [Vitis vinifera]
 emb|CBI16224.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/573 (76%), Positives = 486/573 (85%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++     FC +  ++ALAK  G+TRHYKF+IK+QNVTRLC TKSIVTVNG FPGPRI+AR
Sbjct  15    LLLSCVTFCLLP-EIALAKDTGLTRHYKFEIKLQNVTRLCHTKSIVTVNGLFPGPRIVAR  73

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+++KVVNHV+ N++IHWHG++QL+SGWADGPAY+TQCPIQTGQSYVYNFTI GQRG
Sbjct  74    EGDRLLIKVVNHVQDNISIHWHGIKQLQSGWADGPAYVTQCPIQTGQSYVYNFTIVGQRG  133

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+ILP++  +YPF +P K VPIIFGEWW AD E +ISQA QT
Sbjct  134   TLFWHAHISWLRSTLYGPIIILPRRNASYPFEKPHKGVPIIFGEWWNADPEAVISQALQT  193

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSAKD+FKLKVK  KTYLLR INAALNDELFFSIANH+L
Sbjct  194   GGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPNKTYLLRFINAALNDELFFSIANHTL  253

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T  +LITPGQTTNVLLKT  + PNAT+L++ARPY TG   FDNST 
Sbjct  254   TVVDVDAIYVKPFETKTLLITPGQTTNVLLKTKPNFPNATFLMTARPYVTGLGTFDNSTV  313

Query  1035  AGILEYstns----nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGILEY   S    +     KLPLF PTLP  NDTSFA NFT KLRSLA+  FPANVP+K
Sbjct  314   AGILEYELPSGSPHSTLFIKKLPLFKPTLPPLNDTSFAANFTSKLRSLASPQFPANVPQK  373

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VDR FFFTVGLG  PC QNQTCQGP N TKF+AS NNISF  PTTALLQAHFF QS GVY
Sbjct  374   VDRHFFFTVGLGSSPCDQNQTCQGP-NGTKFSASFNNISFALPTTALLQAHFFGQSNGVY  432

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
               DFP  P + FNYTG PP N +V++ TKVV L FN+SVELV+QDTSI+GAESHPLHLHG
Sbjct  433   KPDFPITPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVVQDTSILGAESHPLHLHG  492

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGNYDPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  493   FNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  552

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             +HTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  553   IHTSWGLKMAWVVLDGKLPNQKLPPPPADLPKC  585



>ref|XP_010690891.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/577 (73%), Positives = 487/577 (84%), Gaps = 6/577 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCW-VSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             RF+I + +  C+ VS ++A A + GITRHYKF++K+QNVTRLC TKSIVTVNG+FPGPRI
Sbjct  6     RFLIAIFSISCFIVSNNIADATYTGITRHYKFNVKLQNVTRLCHTKSIVTVNGQFPGPRI  65

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             +AREGDR+V+KVVNHV+ N+TIHWHG+RQLRSGWADGPAYI QCPIQTGQ+YVYNFT+ G
Sbjct  66    VAREGDRLVIKVVNHVQNNITIHWHGIRQLRSGWADGPAYIAQCPIQTGQTYVYNFTVVG  125

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTL+WHAHISWLR+TLYGPI+ILPK+GV YPFPQP+KEVPIIFGEWW AD E +I+QA
Sbjct  126   QRGTLWWHAHISWLRSTLYGPIIILPKRGVPYPFPQPYKEVPIIFGEWWNADPEAVIAQA  185

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGG PN+SDA+TINGLPGPLYNCSA+D+F L VK GKTYLLR+INAALNDELFFSIAN
Sbjct  186   LQTGGGPNVSDAYTINGLPGPLYNCSARDTFMLSVKPGKTYLLRIINAALNDELFFSIAN  245

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             H+LT V+ DA+YVKPF T+ ++ITPGQTTNVLLKT  +HP AT+L+ ARPY TG   FDN
Sbjct  246   HTLTTVDVDAIYVKPFETDTIIITPGQTTNVLLKTKPYHPEATFLMMARPYVTGNGTFDN  305

Query  1026  STTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
             ST AGIL+Y       +  KLPLF PTLP   DTSF +NFT KLRSLANA +PANVPK V
Sbjct  306   STVAGILQYQHPKPSISIKKLPLFKPTLPALRDTSFVSNFTNKLRSLANAQYPANVPKNV  365

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF-----FNQS  1370
             D+ FFFTVGLG  PCP+N TCQGPTN T FAASVNN+SFV PT ALLQ HF      +QS
Sbjct  366   DKHFFFTVGLGTNPCPKNHTCQGPTNKTMFAASVNNVSFVTPTKALLQTHFIRSHSLHQS  425

Query  1371  KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPL  1550
             + V+T D P++P + FNYTG PP N MV + TKV+ L FN+SVELVMQDTSI+G E+HPL
Sbjct  426   QQVFTTDLPSSPLIPFNYTGTPPNNTMVMNGTKVMVLPFNTSVELVMQDTSILGVETHPL  485

Query  1551  HLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMH  1730
             HLHG+NFFV+GQGFGN+D  KDP+K+NLVDP ERNTVGVP GGWVAIRFLADNPG WFMH
Sbjct  486   HLHGYNFFVVGQGFGNFDAKKDPAKYNLVDPVERNTVGVPVGGWVAIRFLADNPGVWFMH  545

Query  1731  CHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             CHLEVHTSWGLKMAW+V DGK   QKL PPP+DLPKC
Sbjct  546   CHLEVHTSWGLKMAWVVEDGKLPNQKLPPPPSDLPKC  582



>gb|KHN24984.1| Laccase-17 [Glycine soja]
Length=559

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/553 (77%), Positives = 477/553 (86%), Gaps = 4/553 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG T+HY F+I+ QNVTRLC TKSIVTVNG+FPGPRI+AREGDR+++KV NHV+ N+TIH
Sbjct  7     AGTTKHYNFEIRHQNVTRLCHTKSIVTVNGQFPGPRIVAREGDRLLIKVTNHVQNNITIH  66

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL+SGWADGP+Y+TQCPIQTGQ++VYN+TI GQRGTL+WHAHISWLR+TLYGP++
Sbjct  67    WHGIRQLQSGWADGPSYVTQCPIQTGQTFVYNYTIVGQRGTLWWHAHISWLRSTLYGPLI  126

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK    YPF +P KEVPIIFGEWW AD E II+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  127   ILPKLNAQYPFAKPHKEVPIIFGEWWNADPEAIITQALQTGGGPNVSDAYTINGLPGPLY  186

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS KD+FKLKVK GK YLLRLINAALNDELFFSIANH+LTVVE DAVYVKPF TN +LI
Sbjct  187   NCSHKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVVETDAVYVKPFATNTILI  246

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttn  1082
             TPGQTTNV+LKT +H+PNAT+L++ARPYATG   FDN+T A ILEY     T+ +  +  
Sbjct  247   TPGQTTNVILKTNSHYPNATFLMTARPYATGLGTFDNTTVAAILEYKTPSNTHHSAASLK  306

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
              LPL  P LP  NDTSFAT FT KLRSLA+A FPANVP+KVD+ FFFTVGLG  PCPQNQ
Sbjct  307   NLPLLKPILPALNDTSFATKFTNKLRSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQNQ  366

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN+TKF+ASVNN+SF+QPTTALLQ HFF QS  VYT DFP  P V FNYTG PP 
Sbjct  367   TCQGPTNSTKFSASVNNVSFIQPTTALLQTHFFGQSNRVYTPDFPTKPLVPFNYTGTPPN  426

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNYDPNKDP+
Sbjct  427   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPA  486

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
              FNL DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   
Sbjct  487   NFNLDDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPN  546

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLP C
Sbjct  547   QKLFPPPADLPMC  559



>ref|XP_004492318.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=580

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/584 (74%), Positives = 493/584 (84%), Gaps = 9/584 (2%)
 Frame = +3

Query  105   MMVCLFAKRFI-IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             M V +F+   I +F+L+   +   ++ALA   G T+HY FDI+ QNVTRLC TKS+VTVN
Sbjct  1     MGVSIFSSLKIPMFLLSLINFGIFELALA---GTTKHYHFDIRYQNVTRLCHTKSMVTVN  57

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRI+AREGDR+++KVVN+V+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSY
Sbjct  58    GQFPGPRIVAREGDRLLIKVVNNVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSY  117

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VYN+TI GQRGTLFWHAHISWLR+T+YGP++ILPKK V YPF +P KEVPIIFGEW+ AD
Sbjct  118   VYNYTIKGQRGTLFWHAHISWLRSTVYGPLIILPKKNVQYPFAKPHKEVPIIFGEWFNAD  177

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
             TE +I+QA QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK GKTYLLRLINAALND
Sbjct  178   TEAVIAQALQTGGGPNVSDAYTINGLPGPLYNCSKKDTFKLKVKPGKTYLLRLINAALND  237

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIANH+LTVVEADA+YVKPF TN +LI PGQTTNVLLKT  H+PNAT+L++ARPYA
Sbjct  238   ELFFSIANHTLTVVEADAIYVKPFVTNTILIAPGQTTNVLLKTKPHYPNATFLMTARPYA  297

Query  1002  TGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLA  1169
             TG   FDN+T AGILEY     T+ +  +   LPLF P LP  NDTSFAT FT KLRSLA
Sbjct  298   TGLGTFDNTTVAGILEYEIPSNTHHSAASLETLPLFKPVLPALNDTSFATKFTNKLRSLA  357

Query  1170  NANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQ  1349
             +A FPANVP+K+DR FFFTVGLG  PC  NQTCQGP N T FAAS+NN+SF  PTTALLQ
Sbjct  358   SAQFPANVPQKIDRHFFFTVGLGTNPCKSNQTCQGP-NGTMFAASINNVSFTTPTTALLQ  416

Query  1350  AHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSII  1529
             +HFF QS GVY   FP +P   FNYTG PP N MV++ TKVV L FN+SVELVMQDTSI+
Sbjct  417   SHFFGQSNGVYAPYFPTSPLHPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSIL  476

Query  1530  GAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADN  1709
             GAESHPLHLHGFNFFV+GQGFGN+D NKDP KFNLVDP ERNTVGVPSGGWVAIRF ADN
Sbjct  477   GAESHPLHLHGFNFFVVGQGFGNFDKNKDPKKFNLVDPVERNTVGVPSGGWVAIRFQADN  536

Query  1710  PGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             PGAWFMHCHLEVHTSWGLKMAWIV+DGK   QKL PPPADLPKC
Sbjct  537   PGAWFMHCHLEVHTSWGLKMAWIVLDGKLPNQKLLPPPADLPKC  580



>emb|CDP06592.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/559 (77%), Positives = 478/559 (86%), Gaps = 7/559 (1%)
 Frame = +3

Query  183   LAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvky  359
             L +HA GITRHY+ +I M NVTRLC TKS+V VNG+FPGPRI+AREGDR+++KV NHV  
Sbjct  6     LPQHALGITRHYELNITMLNVTRLCHTKSLVAVNGQFPGPRIVAREGDRLLIKVNNHVSN  65

Query  360   nvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATL  539
             N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLFWHAHISW+RAT+
Sbjct  66    NITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFWHAHISWIRATV  125

Query  540   YGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGL  719
             YGP++ILPK+ V YPF +P +EVP+IFGEW+ ADTE IISQA QTGG PN+SDA+T+NGL
Sbjct  126   YGPLIILPKRHVQYPFAKPHEEVPVIFGEWFNADTEAIISQALQTGGGPNVSDAYTLNGL  185

Query  720   PGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNT  899
             PGPLYNCSAKD+FKLKVKAGKTYLLRLINAALNDELFFSIANH+LTVVEADA+YVKPF T
Sbjct  186   PGPLYNCSAKDTFKLKVKAGKTYLLRLINAALNDELFFSIANHTLTVVEADALYVKPFET  245

Query  900   NIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-----ns  1064
             + +LITPGQTTNVLLKT    P AT+L+ ARPYATG A FDNST AGILEY       +S
Sbjct  246   DTILITPGQTTNVLLKTKPQFPAATFLMLARPYATGAATFDNSTVAGILEYEQSPSPDSS  305

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
                +  KLPLF PTLP  NDT+FA NF  KLRSLAN  +PANVP+ +D  FFFTVGLG  
Sbjct  306   TPVSVMKLPLFRPTLPALNDTAFAANFLNKLRSLANRQYPANVPQNIDEHFFFTVGLGTS  365

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PC Q Q CQGP N TKFAASVNNISF QPTTALLQ+HF  QS GVY+ DFP NP   FNY
Sbjct  366   PCDQTQGCQGP-NGTKFAASVNNISFAQPTTALLQSHFSGQSSGVYSPDFPYNPLRWFNY  424

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TGNPP N MV +ATKV+ L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGNYD
Sbjct  425   TGNPPNNTMVGNATKVMVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNYD  484

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             PNKDP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+
Sbjct  485   PNKDPKNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVL  544

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DGK R QKL PPPADLPKC
Sbjct  545   DGKLRNQKLLPPPADLPKC  563



>ref|XP_006583598.1| PREDICTED: laccase-17-like [Glycine max]
Length=584

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/571 (75%), Positives = 485/571 (85%), Gaps = 4/571 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +F++     +  ++  AKHA +TRHYKF+IKMQN TRLCQTKSIVTVNGRFPGPRIIARE
Sbjct  15    MFIMLCAMMILPELTHAKHARVTRHYKFNIKMQNFTRLCQTKSIVTVNGRFPGPRIIARE  74

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR+VVKVVNHV+YNVT+HWHG+RQL+S WADGPAYITQCPIQTGQS+VYNFT+ GQRGT
Sbjct  75    GDRIVVKVVNHVQYNVTLHWHGIRQLKSAWADGPAYITQCPIQTGQSFVYNFTVIGQRGT  134

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L+WHAHISWLR TLYGPIVILPK+ V YPFPQPF+EVPII GEWWKADTE +I+QA QTG
Sbjct  135   LWWHAHISWLRTTLYGPIVILPKRHVPYPFPQPFREVPIILGEWWKADTEAVINQAMQTG  194

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
              APNISD  TINGLPGP+ NC+AK++F+LKVK GKTYLLRLINAALNDE+FFSIANH+LT
Sbjct  195   LAPNISDVHTINGLPGPVSNCAAKETFQLKVKPGKTYLLRLINAALNDEMFFSIANHTLT  254

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             +VEADAVYVKPF+T IVLITPGQT NVLLK  +  PN T+ IS RPYATGPA FDN+T  
Sbjct  255   MVEADAVYVKPFSTKIVLITPGQTVNVLLKAKSKAPNGTFAISTRPYATGPASFDNTTAT  314

Query  1038  GILEYstnsnktttn---kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             G LEY   S+ +  +   KLPL     P FNDT FA NF  K+RSLANA FPA VPK VD
Sbjct  315   GFLEYKKTSHASNKSNTKKLPLLRAVFPKFNDTVFAMNFHNKVRSLANARFPAKVPKTVD  374

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             R FFFTVGLG+  C +NQ CQGP NNT+ AA+VNN++FV P  ALLQAHFFN+SKGVYT 
Sbjct  375   RHFFFTVGLGISKCSKNQQCQGP-NNTRVAAAVNNVTFVTPNIALLQAHFFNKSKGVYTT  433

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFP+NPP KFNYTG PP+NI V+S TK V L +N+SVELV+QDTSIIGAESHPLHLHGFN
Sbjct  434   DFPSNPPFKFNYTGTPPSNIFVSSGTKTVVLPYNTSVELVLQDTSIIGAESHPLHLHGFN  493

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FF++GQG GN+DP KDP KFNLVDPAERNT GVPSGGWVA+RFLADNPG WFMHCHLEVH
Sbjct  494   FFIVGQGNGNFDPKKDPIKFNLVDPAERNTAGVPSGGWVAVRFLADNPGVWFMHCHLEVH  553

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             TSWGLKMAWIV DGK R QKL PPP+DLPKC
Sbjct  554   TSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  584



>emb|CAN60348.1| hypothetical protein VITISV_005802 [Vitis vinifera]
Length=559

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/559 (77%), Positives = 480/559 (86%), Gaps = 5/559 (1%)
 Frame = +3

Query  177   VALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvk  356
             +ALAK  G+TRHYKF+IK+QNVTRLC TKSIVTVNG FPGPRI+AREGDR+++KVVNHV+
Sbjct  2     IALAKDTGLTRHYKFEIKLQNVTRLCHTKSIVTVNGXFPGPRIVAREGDRLLIKVVNHVQ  61

Query  357   ynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRAT  536
              N++IHWHG++QL+SGWADGPAY+TQCPIQTGQSYVYNFTI GQRGTLFWHAHISWLR+T
Sbjct  62    DNISIHWHGIKQLQSGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLFWHAHISWLRST  121

Query  537   LYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTING  716
             LYGPI+ILP++  +YPF +P K VPIIFGEWW AD E +ISQA QTGG PN+SDA+TING
Sbjct  122   LYGPIIILPRRNASYPFEKPHKGVPIIFGEWWNADPEAVISQALQTGGGPNVSDAYTING  181

Query  717   LPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFN  896
             LPGPLYNCSAKD+FKLKVK  KTYLLR INAALNDELFFSIANH+LTVV+ DA+YVKPF 
Sbjct  182   LPGPLYNCSAKDTFKLKVKPNKTYLLRFINAALNDELFFSIANHTLTVVDVDAIYVKPFE  241

Query  897   TNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstns----  1064
             T  +LITPGQTTNVLLKT  + PNAT+L++ARPY TG   FDNST AGILEY   S    
Sbjct  242   TKTLLITPGQTTNVLLKTKPNFPNATFLMTARPYVTGLGTFDNSTVAGILEYELPSGSPH  301

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
             +     KLPLF PTLP  NDTSFA NFT KLRSLA+  FPANVP+KVDR FFFTVGLG  
Sbjct  302   STLFIKKLPLFKPTLPPLNDTSFAANFTSKLRSLASPQFPANVPQKVDRHFFFTVGLGSS  361

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PC QNQTCQGP N TKF+AS NNISF  PTTALLQAHFF QS GVY  DFP  P + FNY
Sbjct  362   PCDQNQTCQGP-NGTKFSASFNNISFALPTTALLQAHFFGQSNGVYKPDFPITPIIPFNY  420

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG PP N +V++ TKVV L FN+SVELV+QDTSI+GAESHPLHLHGFNFFV+GQGFGNYD
Sbjct  421   TGTPPNNTLVSNGTKVVVLPFNTSVELVVQDTSILGAESHPLHLHGFNFFVVGQGFGNYD  480

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             PNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWGLKMAW+V+
Sbjct  481   PNKDPAKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVL  540

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DGK   QKL PPPADLPKC
Sbjct  541   DGKLPNQKLPPPPADLPKC  559



>ref|XP_002299296.1| laccase family protein [Populus trichocarpa]
 gb|EEE84101.1| laccase family protein [Populus trichocarpa]
Length=581

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/569 (75%), Positives = 483/569 (85%), Gaps = 5/569 (1%)
 Frame = +3

Query  147   LAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDR  326
             L  F +V+  +        TRHYK D+ +QNVTRLC TKS+VTVNG+FPGPRI+AREGDR
Sbjct  14    LLLFSFVTLSLHPKPAVATTRHYKLDVMLQNVTRLCHTKSMVTVNGKFPGPRIVAREGDR  73

Query  327   vvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFW  506
             +++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTL+W
Sbjct  74    LLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIVGQRGTLWW  133

Query  507   HAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAP  686
             HAHISWLR+TLYGP++ILPK G  YPF +P+KEVPIIFGEW+ AD E II+QA QTGG P
Sbjct  134   HAHISWLRSTLYGPLIILPKLGTPYPFVKPYKEVPIIFGEWFNADPEAIINQALQTGGGP  193

Query  687   NISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVE  866
             N+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+ TVVE
Sbjct  194   NVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTFTVVE  253

Query  867   ADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGIL  1046
             ADAVYVKPF+T  +LI PGQTTNVLLKT  HHPNA + ++ARPY TG   FDNST AGIL
Sbjct  254   ADAVYVKPFDTKTLLIAPGQTTNVLLKTKPHHPNAKFFMTARPYVTGQGTFDNSTVAGIL  313

Query  1047  EYstn----snktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             EY  +     +  +T +LPLF P LP  NDTSFAT FT KLRSLANA FPANVP+KVDR+
Sbjct  314   EYEESHKTIQSSHSTKRLPLFKPNLPPLNDTSFATKFTSKLRSLANAQFPANVPQKVDRQ  373

Query  1215  FFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADF  1394
             FFFTVGLG   CPQNQTCQGP N T FAASVNN+SF  PTTALLQAH F QS GVYT DF
Sbjct  374   FFFTVGLGTHSCPQNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHHFGQSNGVYTPDF  432

Query  1395  PANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFF  1574
             P NP   FNYTGNPP N MV++ TK+V L FN++VEL+MQDTSI+GAESHPLHLHGFNFF
Sbjct  433   PINPLTPFNYTGNPPNNTMVSNGTKLVVLPFNTTVELIMQDTSILGAESHPLHLHGFNFF  492

Query  1575  VIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTS  1754
             V+GQGFGN+DPNKDP+ FNL+DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTS
Sbjct  493   VVGQGFGNFDPNKDPANFNLIDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTS  552

Query  1755  WGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WGLKMAW+V+DGK   QKL PPPADLP+C
Sbjct  553   WGLKMAWVVLDGKLPNQKLLPPPADLPRC  581



>ref|XP_011077639.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=578

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/581 (75%), Positives = 488/581 (84%), Gaps = 6/581 (1%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M  LF  + +  V    C       L  HA   TRHY+F+IKMQNVTRLC TKSIVTVNG
Sbjct  1     MAGLFTHQLLFSVGILMC--VALCLLPHHAEAATRHYEFNIKMQNVTRLCHTKSIVTVNG  58

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPR+IAREGDR++V+V NHV  N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYV
Sbjct  59    KFPGPRVIAREGDRLLVRVTNHVPNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYV  118

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFT+ GQRGT FWHAHISWLR+TLYGP++ILPKK V YPF +P++E+PI+FGEW+ ADT
Sbjct  119   YNFTVVGQRGTFFWHAHISWLRSTLYGPLIILPKKNVPYPFQKPYEEIPIVFGEWFNADT  178

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E IISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+FKL+VK GKTYLLR++NAALNDE
Sbjct  179   EAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKPGKTYLLRMVNAALNDE  238

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANHSLT+V+ADA+YVKPF TN +LITPGQTTNVLLKT  + P AT+L++ARPY T
Sbjct  239   LFFSIANHSLTIVDADAIYVKPFETNTILITPGQTTNVLLKTKPNFPGATFLMTARPYVT  298

Query  1005  GPAPFDNSTTAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             G   FDNST AGILEY +    + T   KLPL+ P LP  NDTSFATNF KKLRSLA   
Sbjct  299   GQGTFDNSTVAGILEYESPFLHSVTPLKKLPLYKPILPPLNDTSFATNFAKKLRSLATPQ  358

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPANVP++VD+ FFFTVGLG  PC QN+TCQGP N TKFAASV+NISFVQPTTALLQAHF
Sbjct  359   FPANVPQEVDKHFFFTVGLGTSPCDQNKTCQGP-NGTKFAASVSNISFVQPTTALLQAHF  417

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
               QS GVY+ DFP NP   FNYTGNPP N MV + TK++ L FN+SVELVMQDTSI+GAE
Sbjct  418   TGQSSGVYSPDFPINPLHWFNYTGNPPNNTMVGNGTKLMVLPFNTSVELVMQDTSILGAE  477

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQGFGNYDPN+DP  FNLVDP ERNTVGVP+GGWVAIRFLADNPG 
Sbjct  478   SHPLHLHGFNFFVVGQGFGNYDPNEDPKNFNLVDPIERNTVGVPAGGWVAIRFLADNPGV  537

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  538   WFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  578



>ref|XP_006429125.1| hypothetical protein CICLE_v10011362mg [Citrus clementina]
 ref|XP_006480873.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR42365.1| hypothetical protein CICLE_v10011362mg [Citrus clementina]
Length=578

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/571 (76%), Positives = 485/571 (85%), Gaps = 8/571 (1%)
 Frame = +3

Query  147   LAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             LA  C W      LA  A ITRHYKFDIKMQNVTRLC TKSI+TVNG+FPGPRI+AREGD
Sbjct  10    LAILCVWFLFPAGLAV-ASITRHYKFDIKMQNVTRLCHTKSIITVNGQFPGPRIVAREGD  68

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             R+++KVVNHV  N++IHWHG+RQL SGWADGPAYITQCPIQTGQSYVYNFTI+GQRGTLF
Sbjct  69    RLIIKVVNHVPNNISIHWHGIRQLLSGWADGPAYITQCPIQTGQSYVYNFTISGQRGTLF  128

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAHISWLRAT+YGP+VI PK+GV YPFP+P+KEVPIIFGEW+ ADTE II+Q+ QTG  
Sbjct  129   WHAHISWLRATVYGPLVIFPKRGVPYPFPKPYKEVPIIFGEWFNADTEAIINQSLQTGAG  188

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH++TVV
Sbjct  189   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTVTVV  248

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             + DA+Y+KPF T+I+LITPGQTTN+LLKT   +PNAT+L+SARPYATG   FDNST AGI
Sbjct  249   DVDAIYMKPFQTDILLITPGQTTNILLKTKPSYPNATFLMSARPYATGQGTFDNSTVAGI  308

Query  1044  LEYst-----nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             LEY        S+  +  KLPL  PTLP  NDT+FA N+T +LRSLANA FPANVP+ VD
Sbjct  309   LEYEAPTKHPRSSTVSIKKLPLMKPTLPALNDTAFAFNYTTRLRSLANAQFPANVPQTVD  368

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             +RFFFTVGLG  PCP+NQTCQGP N+TKFAASVNN SF+ P+TALLQAHFF Q+ GVYT 
Sbjct  369   KRFFFTVGLGTNPCPKNQTCQGPNNSTKFAASVNNFSFILPSTALLQAHFFGQN-GVYTT  427

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFP+ P +KFNYTG PP N  V + TK V L FN++VELVMQDTSI+GAESHPLHLHGFN
Sbjct  428   DFPSTPLIKFNYTGTPPNNTSVMNGTKAVVLPFNTTVELVMQDTSILGAESHPLHLHGFN  487

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FFV+GQGFGNYDP KD   FNL+DP ERNTVGVPSGGWVAIRF ADNPG WFMHCH EVH
Sbjct  488   FFVVGQGFGNYDPRKDRKNFNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHFEVH  547

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              SWGLKMAWIV+DG    QKL PPPADLPKC
Sbjct  548   ISWGLKMAWIVLDGNLPNQKLPPPPADLPKC  578



>ref|XP_011002147.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/569 (75%), Positives = 485/569 (85%), Gaps = 5/569 (1%)
 Frame = +3

Query  147   LAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDR  326
             L  F +V+  +       ITRHYK D+ +QNVTRLC TKS+VTVNG+FPGPRI+AREGDR
Sbjct  14    LLLFSFVTFSLHPKSAVAITRHYKLDVMLQNVTRLCHTKSMVTVNGKFPGPRIVAREGDR  73

Query  327   vvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFW  506
             +++KVVNHV+ N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+W
Sbjct  74    LLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWW  133

Query  507   HAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAP  686
             HAHISWLR+TL+GP++ILPK G  YPF +P+KEVP+IFGEW+ AD E IISQA QTGG P
Sbjct  134   HAHISWLRSTLHGPLIILPKLGTPYPFVKPYKEVPVIFGEWFNADPEAIISQALQTGGGP  193

Query  687   NISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVE  866
             N+SDA+TINGLPGPLYNCS KD+FKL+VK GKTYLLRLINAALNDELFFSIANH+ TVVE
Sbjct  194   NVSDAYTINGLPGPLYNCSDKDTFKLRVKPGKTYLLRLINAALNDELFFSIANHTFTVVE  253

Query  867   ADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGIL  1046
             ADAVYVKPF+T  +LI PGQTTNVLLKT  H PNA + ++ARPY TG   FDN+T AGIL
Sbjct  254   ADAVYVKPFDTKTLLIAPGQTTNVLLKTKPHRPNAKFFMTARPYVTGQGTFDNTTIAGIL  313

Query  1047  EYstn----snktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             EY  +     +  +T KLPLF P LP  NDTSFATNFT+KLRSLANA FPANVP+K+DR+
Sbjct  314   EYKESHKTIQSSHSTKKLPLFKPNLPPLNDTSFATNFTRKLRSLANAQFPANVPQKIDRQ  373

Query  1215  FFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADF  1394
             FFFTVGLG   CPQNQTCQGP N T FAASVNN+SF  PTTALLQAH F QSKGVYT DF
Sbjct  374   FFFTVGLGTHSCPQNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHHFGQSKGVYTPDF  432

Query  1395  PANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFF  1574
             P NP   FNYTGNPP N +V++ TK+V L FN++VEL+MQDTSI+GAESHPLHLHGFNFF
Sbjct  433   PINPLTPFNYTGNPPNNTIVSNGTKLVVLPFNTTVELIMQDTSILGAESHPLHLHGFNFF  492

Query  1575  VIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTS  1754
             V+GQGFGN+DPNKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTS
Sbjct  493   VVGQGFGNFDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTS  552

Query  1755  WGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WGLKMAWIV+DGK   QKL PPPADLP+C
Sbjct  553   WGLKMAWIVLDGKLPNQKLLPPPADLPRC  581



>gb|KHN16224.1| Laccase-17 [Glycine soja]
Length=631

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/574 (74%), Positives = 480/574 (84%), Gaps = 25/574 (4%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
              GITRHY FDIK QNV+RLC TKS+VTVNG+FPGP I+AREGDR+++KV NHV+ N++IH
Sbjct  58    GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPHIVAREGDRLLIKVTNHVQNNISIH  117

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTLFWHAHISWLR+TLYGPI+
Sbjct  118   WHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLFWHAHISWLRSTLYGPII  177

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+G  YPF +P+KEVP+IFGEWW  D E +I+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  178   ILPKQGAPYPFTKPYKEVPVIFGEWWNTDPEAVITQALQTGGGPNVSDAYTINGLPGPLY  237

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANH+LTVV+ DA+YVKPF+T+ +LI
Sbjct  238   NCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFDTDTILI  297

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----nsnktttn  1082
              PGQT+N LLKT +H+PNAT+ +SARPYATG   FDNST A ILEY        + T+  
Sbjct  298   APGQTSNGLLKTKSHYPNATFFMSARPYATGQGTFDNSTVAAILEYEVPPHFVHSTTSVK  357

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             KL LF P LP  NDTSFATNF  KL SLA+A FPANVP+KVD+ FFFTVGLG  PCPQNQ
Sbjct  358   KLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQNQ  417

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN TKFAASVNN+SF+QPTTALLQAHFF QS GVY+  FP +P V FNYTG PP 
Sbjct  418   TCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPYFPISPLVPFNYTGTPPN  477

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP---------------------LHLH  1559
             N MV++ TKVV L FN+SVELVMQDTSI+GAESHP                     LHLH
Sbjct  478   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNLHLH  537

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNFFV+GQGFGN+DPNKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHL
Sbjct  538   GFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  597

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             EVHTSWGLKMAWIV+DG+   QKL PPPADLPKC
Sbjct  598   EVHTSWGLKMAWIVLDGELPNQKLLPPPADLPKC  631



>ref|XP_010690924.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/577 (73%), Positives = 483/577 (84%), Gaps = 6/577 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVAL-AKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             R +I + +  C++  + A+ A + GITRHYKF+IK+QNVTRLC TKSIVTVNG+FPGPR+
Sbjct  6     RLLIALFSIICFMLPNNAIDASYTGITRHYKFNIKLQNVTRLCHTKSIVTVNGQFPGPRV  65

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             +AREGDR+V+KVVNHV+ N+TIHWHG+RQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITG
Sbjct  66    VAREGDRLVIKVVNHVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITG  125

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTL+WHAHISWLR+TLYGPI+ILPK+GV YPFPQP+KEVP+IFGEWW AD E +ISQA
Sbjct  126   QRGTLWWHAHISWLRSTLYGPIIILPKRGVPYPFPQPYKEVPLIFGEWWNADPEAVISQA  185

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGG PN+SDA+TINGLPGPLYNCSAKD+F L VK GKTYLLR+INAALNDELFFSIAN
Sbjct  186   LQTGGGPNVSDAYTINGLPGPLYNCSAKDTFMLSVKPGKTYLLRIINAALNDELFFSIAN  245

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             H+LT V+ DAVYVKPF T+ ++ITPGQTTNVLLKT  +HP AT+L+ ARPY TG   FDN
Sbjct  246   HTLTTVDVDAVYVKPFETDTIIITPGQTTNVLLKTKPYHPKATFLMMARPYVTGNGTFDN  305

Query  1026  STTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
             ST AGIL Y       +  KLPLF PTLP   DTSF +NFT KLRSLANA +PANVPK V
Sbjct  306   STVAGILNYQHPKPSISIKKLPLFKPTLPALRDTSFVSNFTNKLRSLANAQYPANVPKNV  365

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF-----FNQS  1370
             D+ FFFTVGLG  PCP+N TCQGP N T FAASVNN+SFV PT ALLQ HF      +Q 
Sbjct  366   DKHFFFTVGLGTNPCPKNHTCQGPNNKTMFAASVNNVSFVMPTKALLQTHFIQSHSLHQL  425

Query  1371  KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPL  1550
             + V+T D P++P + FNYTG PP N MV   TKVV + FN+SVELVMQDTSI+G ESHPL
Sbjct  426   QRVFTTDLPSSPLIPFNYTGMPPNNTMVIDGTKVVAVPFNTSVELVMQDTSILGVESHPL  485

Query  1551  HLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMH  1730
             HLHGFNFFV+GQGFGN+D  KDP+K+NLVDP ERNTVGVPSGGWVAIRF ADNPG WFMH
Sbjct  486   HLHGFNFFVVGQGFGNFDAEKDPAKYNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMH  545

Query  1731  CHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             CHLEVHTSWGLKMAW+V DGK   QKL PPP+DLPKC
Sbjct  546   CHLEVHTSWGLKMAWVVQDGKLPNQKLPPPPSDLPKC  582



>ref|XP_009621093.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=581

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/550 (77%), Positives = 478/550 (87%), Gaps = 2/550 (0%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY+F+I M NVTRLC TKSIVTVNG+FPGPRI+ REGDR+++KV NHV  N++IHW
Sbjct  32    AITRHYEFNITMANVTRLCHTKSIVTVNGKFPGPRIVTREGDRLLIKVNNHVPNNISIHW  91

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  92    HGVRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLII  151

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPKK  +YPF +PFKEVPII GEW+ AD E IISQA QTGG PN+SDA+TINGLPG LYN
Sbjct  152   LPKKNESYPFLKPFKEVPIILGEWFNADPEAIISQALQTGGGPNVSDAYTINGLPGLLYN  211

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYL R+INAALNDELFFSIANH+LTVV+ADAVYVKPF TN +LIT
Sbjct  212   CSAKDTFKLKVKLGKTYLFRMINAALNDELFFSIANHTLTVVDADAVYVKPFETNTILIT  271

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkLP  1091
             PGQTTNVLLKT + +P+AT+L++ARPY TG   FDNST AGILEY +  + +  +  KLP
Sbjct  272   PGQTTNVLLKTKSEYPSATFLMTARPYVTGQGTFDNSTVAGILEYESPISHSTKSMKKLP  331

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             +F PTLP  NDTSFATNF+KKLRSLA + FP  VP+ VD+ FFFTVGLG  PC +NQTCQ
Sbjct  332   MFMPTLPPLNDTSFATNFSKKLRSLATSQFPTKVPQNVDKHFFFTVGLGTTPCDKNQTCQ  391

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GPTN TKFAAS+NNISFVQPTTALLQ+HF  QS GVY+  FP NP   FNYTGNPP N M
Sbjct  392   GPTNTTKFAASINNISFVQPTTALLQSHFIGQSNGVYSPYFPNNPLNWFNYTGNPPNNTM  451

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ TKV+ L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP+ FN
Sbjct  452   VSNGTKVLVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFN  511

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             L+DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QKL
Sbjct  512   LIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  571

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  572   LPPPSDLPKC  581



>ref|XP_009587566.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=581

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/550 (77%), Positives = 476/550 (87%), Gaps = 2/550 (0%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY+F+I MQNVTRLC TKSIVTVNG+FPGPRII REGDR+++KV NHV  N++IHW
Sbjct  32    AITRHYEFNITMQNVTRLCHTKSIVTVNGKFPGPRIITREGDRLLIKVNNHVPNNISIHW  91

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  92    HGVRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLII  151

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPKK  +YPF +PFKE+PII GEW+ AD E IISQA QTGG PN+SDA+TINGLPG LYN
Sbjct  152   LPKKNESYPFVKPFKEIPIILGEWFNADPETIISQALQTGGGPNVSDAYTINGLPGLLYN  211

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV+ADAVYVKPF T  +L+T
Sbjct  212   CSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDADAVYVKPFETETILVT  271

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstns--nktttnkLP  1091
             PGQTTNVLLKT   +P+AT+L++ARPY TG   FDNST AGILEY +    +  +  KLP
Sbjct  272   PGQTTNVLLKTKPEYPSATFLMTARPYVTGQGTFDNSTVAGILEYESPIPHSTKSIKKLP  331

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             LF PTLP  NDTSFATNF+KKLRSLAN+ FPA VP+ VD+ FFFTVGLG  PC +NQTCQ
Sbjct  332   LFKPTLPPLNDTSFATNFSKKLRSLANSQFPAKVPQNVDKHFFFTVGLGTTPCDKNQTCQ  391

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GPTN TKFAAS+NNISFVQPTTALLQ+HF  QS  VY+  FP NP   FNYTGNPP N M
Sbjct  392   GPTNTTKFAASINNISFVQPTTALLQSHFMGQSNSVYSPYFPINPLNWFNYTGNPPNNTM  451

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V + TKV+ L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV GQGFGN+DPNKDP+ FN
Sbjct  452   VYNGTKVLVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVAGQGFGNFDPNKDPANFN  511

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             L+DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QKL
Sbjct  512   LIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  571

Query  1812  QPPPADLPKC  1841
              PPP+DLP+C
Sbjct  572   LPPPSDLPQC  581



>gb|KDO52342.1| hypothetical protein CISIN_1g008085mg [Citrus sinensis]
Length=578

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/571 (75%), Positives = 484/571 (85%), Gaps = 8/571 (1%)
 Frame = +3

Query  147   LAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             LA  C W      LA  A ITRHYKFDIKMQNVTRLC TKSI+TVNG+FPGPRI+AREGD
Sbjct  10    LAILCVWFLFPAGLAV-ASITRHYKFDIKMQNVTRLCHTKSIITVNGQFPGPRIVAREGD  68

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             R+++KVVNHV  N++IHWHG+RQL SGWADGPAYITQCPIQTGQSYVYNFTI+GQRGTLF
Sbjct  69    RLIIKVVNHVPNNISIHWHGIRQLLSGWADGPAYITQCPIQTGQSYVYNFTISGQRGTLF  128

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAHISWLRAT+YGP+VI PK+GV YPFP+P+KEVPIIFGEW+ ADTE II+Q+ QTG  
Sbjct  129   WHAHISWLRATVYGPLVIFPKRGVPYPFPKPYKEVPIIFGEWFNADTEAIINQSLQTGAG  188

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFFSIANHS+TVV
Sbjct  189   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHSVTVV  248

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             + DA+Y+K F T+I+LITPGQTTN+LLK    +PNAT+L+SARPYATG   FDNST AGI
Sbjct  249   DVDAIYIKSFQTDILLITPGQTTNILLKAKPSYPNATFLMSARPYATGQGTFDNSTVAGI  308

Query  1044  LEYst-----nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             LEY        S+  +  KLPL  PTLP  NDT+FA N+T +LRSLANA FPANVP+ V+
Sbjct  309   LEYEAPAKFPRSSTVSIKKLPLMKPTLPALNDTAFAFNYTTRLRSLANAQFPANVPQTVN  368

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             +RFFFTVGLG  PCP+NQTCQGP N+TKFAASVNN SF+ P+TALLQAHFF Q+ GVYT 
Sbjct  369   KRFFFTVGLGTNPCPKNQTCQGPNNSTKFAASVNNFSFILPSTALLQAHFFGQN-GVYTT  427

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFP+ P +KFNYTG PP N  V + TKVV L FN+SVELVMQDTS +GAESHPLHLHGFN
Sbjct  428   DFPSTPLIKFNYTGTPPNNTSVMNGTKVVVLPFNASVELVMQDTSTLGAESHPLHLHGFN  487

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FFVIGQGFGNYDP+KD   FNL+DP ERNTVGVPSGGWVAIRF ADNPG WFMHCH EVH
Sbjct  488   FFVIGQGFGNYDPSKDRKNFNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHFEVH  547

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              SWGLKMAWIV++G    QKL PPPADLPKC
Sbjct  548   ISWGLKMAWIVLNGNLPNQKLPPPPADLPKC  578



>ref|XP_007016607.1| Laccase 17 [Theobroma cacao]
 gb|EOY34226.1| Laccase 17 [Theobroma cacao]
Length=581

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/552 (76%), Positives = 474/552 (86%), Gaps = 5/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHYKF+IK+QNVTRLC TKSIV+VNGRFPGPRI+AREGD++++KVVNHV  N++IHW
Sbjct  31    GITRHYKFNIKLQNVTRLCHTKSIVSVNGRFPGPRIVAREGDQLLIKVVNHVPNNISIHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAY+TQCPIQTG SYVYN+TI+GQRGTLFWHAHISWLRAT+YGP++I
Sbjct  91    HGIRQLRSGWADGPAYVTQCPIQTGHSYVYNYTISGQRGTLFWHAHISWLRATVYGPLII  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPF +P+ EV +IFGEW+ AD E II+QA QTGG PN+SDA+TINGLPGPLYN
Sbjct  151   LPKLGVPYPFAKPYNEVAVIFGEWFNADPEAIINQALQTGGGPNVSDAYTINGLPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVVEADAVYVKPFNT  +LI 
Sbjct  211   CSAKDTFKLKVKLGKTYLLRVINAALNDELFFSIANHTLTVVEADAVYVKPFNTETILIA  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----nsnktttnk  1085
             PGQTTNVLLKT   +PNATY ++ARPY TG A FDNST AGILEY        +  +  +
Sbjct  271   PGQTTNVLLKTKPRYPNATYFMTARPYVTGQATFDNSTVAGILEYELPPNGFHSSISIKE  330

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             L LF   LP  NDTSFATNF  KLRSLA+A FPANVP+KVD++FFFT+GLG  PC  NQT
Sbjct  331   LSLFKSILPALNDTSFATNFASKLRSLASARFPANVPQKVDKQFFFTIGLGTSPCQHNQT  390

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T FAASVNN+SF  PT ALLQAHFF QS GVYT DFP++P + FNYTG P  N
Sbjct  391   CQGP-NGTMFAASVNNVSFAMPTKALLQAHFFGQSNGVYTTDFPSDPTIPFNYTGTPTNN  449

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ TK+V L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP  
Sbjct  450   TMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKN  509

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DGK   Q
Sbjct  510   FNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPNQ  569

Query  1806  KLQPPPADLPKC  1841
             KL PPP DLPKC
Sbjct  570   KLLPPPEDLPKC  581



>ref|XP_009774063.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=581

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/550 (76%), Positives = 476/550 (87%), Gaps = 2/550 (0%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY+F+I M NVTRLC TKSIVTVNG+FPGPRI+ REGDR+++KV NHV  N++IHW
Sbjct  32    AITRHYEFNITMANVTRLCHTKSIVTVNGKFPGPRIVTREGDRLLIKVNNHVPNNISIHW  91

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGPI+I
Sbjct  92    HGVRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPIII  151

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPKK  +YPF +PFKE+PII GEW+  D E IISQA QTGG PN+SDA+TINGLPG LYN
Sbjct  152   LPKKNESYPFVKPFKEIPIILGEWFNTDPEAIISQALQTGGGPNVSDAYTINGLPGLLYN  211

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV+ADAVYVKPF T+ +LIT
Sbjct  212   CSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDADAVYVKPFETDTILIT  271

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkLP  1091
             PGQTTNVLLKT + +P+AT+L++ARPY TG   FDNST AGILEY +    +  +  KLP
Sbjct  272   PGQTTNVLLKTKSEYPSATFLMAARPYVTGQGTFDNSTVAGILEYESPLLHSTKSMKKLP  331

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             +F P LP  NDTSFATNF+KKLRSLAN+ FPA VP+ VD+ FFFTVGLG  PC +NQTCQ
Sbjct  332   MFKPALPPLNDTSFATNFSKKLRSLANSQFPAKVPQNVDKHFFFTVGLGTTPCDKNQTCQ  391

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GPTN TKFAAS+NNISFVQPTTALLQ+HF  QS GVY   FP NP   FNYTGNPP N M
Sbjct  392   GPTNTTKFAASINNISFVQPTTALLQSHFIGQSNGVYNPYFPINPLHWFNYTGNPPNNTM  451

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V + TKV+ L FN++VEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP+ FN
Sbjct  452   VNNGTKVLVLPFNTNVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPTNFN  511

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             L+DP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QKL
Sbjct  512   LIDPVERNTVGVPAGGWVAIRFLADNPGIWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  571

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  572   LPPPSDLPKC  581



>ref|XP_002278275.1| PREDICTED: laccase-17 [Vitis vinifera]
 emb|CBI31652.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/575 (76%), Positives = 490/575 (85%), Gaps = 8/575 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             RF+  VL     V     LA  AGITRHYKF+IK+ +VTRLC TKSIV+VNG+FPGPRII
Sbjct  13    RFLFLVLNTLLVVP---ELAS-AGITRHYKFNIKLHSVTRLCHTKSIVSVNGQFPGPRII  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRVVV VVN+V+ NVTIHWHG+RQL+SGWADGPAY+TQCPIQTGQSYVYNFTITGQ
Sbjct  69    AREGDRVVVTVVNNVQNNVTIHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPIIILPKKNVPYPFAKPYKEVPIIFGEWWNADPEAVITQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             Q GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QNGGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +LTVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNS
Sbjct  249   TLTVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNS  308

Query  1029  TTAGILEYstnsnkttt----nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             T AG+L Y   S  + +      LP+F PTLP  NDTSFA NFT+KLRSLAN+ FPANVP
Sbjct  309   TVAGLLHYEPPSKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSEFPANVP  368

Query  1197  KKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKG  1376
             KKVD+RFFFTVGLG  PCPQNQTCQGP+NNTKF+ASVNN+SFV PTTA+LQAHFF QSKG
Sbjct  369   KKVDKRFFFTVGLGTNPCPQNQTCQGPSNNTKFSASVNNVSFVLPTTAILQAHFFQQSKG  428

Query  1377  VYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHL  1556
             VYT DFP  P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI+G ESHPLHL
Sbjct  429   VYTTDFPTTPTFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHL  488

Query  1557  HGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCH  1736
             HGFNFF++GQGFGN+D  KDP KFNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCH
Sbjct  489   HGFNFFLVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCH  548

Query  1737  LEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LEVHTSWGLKMAWIV DGK   QKL PPP+DLP+C
Sbjct  549   LEVHTSWGLKMAWIVTDGKLPNQKLPPPPSDLPQC  583



>ref|XP_002531824.1| laccase, putative [Ricinus communis]
 gb|EEF30544.1| laccase, putative [Ricinus communis]
Length=576

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/568 (74%), Positives = 485/568 (85%), Gaps = 8/568 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +F+L  FC +          G TRHYKFDIK+QNVTRLC TKSIVTVNG FPGPRI+ARE
Sbjct  17    LFILVTFCLLP-----EPAFGRTRHYKFDIKLQNVTRLCHTKSIVTVNGMFPGPRIVARE  71

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD +++KVVNHV+ N+++HWHG+RQLRSGWADGPAYITQCPIQTGQ Y+YN+T+ GQRGT
Sbjct  72    GDNLLIKVVNHVQNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQHYLYNYTVVGQRGT  131

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L+WHAHISWLR+TLYGPI+I PK+GV YPF +P+KEVPI FGEW+ ADTE II QA QTG
Sbjct  132   LWWHAHISWLRSTLYGPIIIFPKRGVPYPFAKPYKEVPITFGEWFNADTETIIKQALQTG  191

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTY+LRLINAALNDELFFSIANH+LT
Sbjct  192   GGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKTGKTYMLRLINAALNDELFFSIANHTLT  251

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VV+ DAVYVKPF T I+LI PGQTTNVLLKT    PNA + ++ARPY TG   FDNST A
Sbjct  252   VVDVDAVYVKPFETKILLIAPGQTTNVLLKTKPSFPNAAFFMTARPYVTGQGTFDNSTVA  311

Query  1038  GILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRF  1217
             GILEY    +  +  KLPLF P+LP  NDT+FATNFT +LRSLA+A FPANVP+ VD++F
Sbjct  312   GILEY--EPSTLSNKKLPLFKPSLPALNDTAFATNFTNRLRSLASAQFPANVPQVVDKQF  369

Query  1218  FFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFP  1397
             FFTVGLG  PCP+NQTCQGP N TKFAAS+NNISF  PTTALLQAH+  QSKGVY+  FP
Sbjct  370   FFTVGLGTNPCPKNQTCQGP-NGTKFAASINNISFAMPTTALLQAHYSGQSKGVYSPYFP  428

Query  1398  ANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFV  1577
              +P + FNYTGNPP N MV++ TK+V LS+N+SVEL++QDTSI+GAESHPLHLHGFNFFV
Sbjct  429   ISPIIPFNYTGNPPNNTMVSNGTKLVVLSYNTSVELILQDTSILGAESHPLHLHGFNFFV  488

Query  1578  IGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSW  1757
             +GQGFGN+DP KDP+K+NL+DP ERNTVGVPSGGWVAIRF ADNPG WFMHCHLEVHTSW
Sbjct  489   VGQGFGNFDPKKDPAKYNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHLEVHTSW  548

Query  1758  GLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             GLKMAW+V+DGK   QKL+PPPADLPKC
Sbjct  549   GLKMAWVVLDGKLPNQKLRPPPADLPKC  576



>ref|XP_004492322.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=580

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/584 (73%), Positives = 493/584 (84%), Gaps = 9/584 (2%)
 Frame = +3

Query  105   MMVCLFAK-RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             M V LF+   F +F L+   + + ++ALA   GITRHY FDI+ QNVTRLC +K++VTVN
Sbjct  1     MGVSLFSSLTFPLFFLSLINFCTFELALA---GITRHYHFDIRYQNVTRLCHSKTMVTVN  57

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRI+AREGD++++KVVNHV+ N++IHWHG+RQL+SGWADGPAY+TQCPIQTGQSY
Sbjct  58    GQFPGPRIVAREGDQLLIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSY  117

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VYN+TI GQRGTLFWHAHISWLR+T+YGP++ILPKK V YPF +P KEVPIIFGEW+ AD
Sbjct  118   VYNYTIKGQRGTLFWHAHISWLRSTVYGPLIILPKKNVQYPFAKPHKEVPIIFGEWFNAD  177

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
             TE +I+QA QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKV+ GKTYLLR INAALND
Sbjct  178   TEAVIAQALQTGGGPNVSDAYTINGLPGPLYNCSKKDTFKLKVELGKTYLLRFINAALND  237

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIANH+LTVVEADAVYVKPF TN +LI PGQTTNVLLKT  H+PNAT+L++ARPYA
Sbjct  238   ELFFSIANHTLTVVEADAVYVKPFETNTILIAPGQTTNVLLKTKPHYPNATFLMTARPYA  297

Query  1002  TGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLA  1169
             TG   FDN+T AGILEY     T+ +  +  KLPLF P LP  NDTSFAT F+ KL SLA
Sbjct  298   TGLGTFDNTTVAGILEYEIPFNTHHSAASLEKLPLFKPILPALNDTSFATKFSNKLNSLA  357

Query  1170  NANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQ  1349
             +A FPANVP+KVDR FFFTVGLG  PC  N+TCQGP N T FAAS+NN+SF+ PTTALLQ
Sbjct  358   SAQFPANVPQKVDRHFFFTVGLGTNPCKNNKTCQGP-NGTMFAASINNVSFILPTTALLQ  416

Query  1350  AHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSII  1529
             +HFF QS GVY   FP +P   FNYTG PP N MV++ TKVV L FN+SVELVMQDTSI+
Sbjct  417   SHFFGQSNGVYAPYFPNSPLHPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSIL  476

Query  1530  GAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADN  1709
             GAESHPLHLHGFNFFV+GQGFGN+D NKDP  FNLVDP ERNT+GVPSGGWVAIRFLADN
Sbjct  477   GAESHPLHLHGFNFFVVGQGFGNFDSNKDPKNFNLVDPVERNTIGVPSGGWVAIRFLADN  536

Query  1710  PGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             PG WFMHCHLEVHTSWGL+MAWIV+DGK   QKL PPPADLPKC
Sbjct  537   PGVWFMHCHLEVHTSWGLRMAWIVLDGKLPNQKLLPPPADLPKC  580



>ref|XP_011094888.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=578

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/572 (75%), Positives = 484/572 (85%), Gaps = 10/572 (2%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             F+ F+  A C +   V  A     TRHY F+IKMQNVTRLC TKSIVTVNG+FPGPR++A
Sbjct  15    FVAFM--ALCLLPQPVQAA-----TRHYHFNIKMQNVTRLCHTKSIVTVNGQFPGPRVVA  67

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDR+++KV NHV  N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFT+ GQR
Sbjct  68    REGDRLLIKVTNHVSNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVVGQR  127

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GTLFWHAHISWLR+T+YGP++ILPKK V YPF +P+KEVPIIFGEW+ ADTE IISQA Q
Sbjct  128   GTLFWHAHISWLRSTVYGPLIILPKKNVPYPFEKPYKEVPIIFGEWFNADTEAIISQALQ  187

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANHS
Sbjct  188   TGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHS  247

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             LTVV+ADA+YVKPF T+ +LITPGQTTNVLLKT    P AT+L++ARPY TG   FDNST
Sbjct  248   LTVVDADAIYVKPFETDTILITPGQTTNVLLKTKPKFPGATFLMTARPYVTGQGTFDNST  307

Query  1032  TAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
              AGILEY      +  +  KLPL+ P LP  NDT FATNF+KKLRSLA   FPANVP+KV
Sbjct  308   VAGILEYQAPLRHSALSMKKLPLYKPILPALNDTMFATNFSKKLRSLATPQFPANVPQKV  367

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             D++FFFTVGLG  PC +N+TCQGP N TKFAA+V+NISFVQPTTALLQAH+  QS GVY+
Sbjct  368   DKQFFFTVGLGTHPCDKNRTCQGP-NGTKFAAAVSNISFVQPTTALLQAHYTGQSSGVYS  426

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFP +P   FNYTGNPP N MV + TK++ L FN+SVELV+QDTSI+GAESHPLHLHGF
Sbjct  427   PDFPISPFHWFNYTGNPPNNTMVANGTKLMVLPFNTSVELVLQDTSILGAESHPLHLHGF  486

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFF++GQGFGNYDPN D   FNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEV
Sbjct  487   NFFIVGQGFGNYDPNTDLKNFNLVDPIERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEV  546

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  547   HTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  578



>gb|KDP44151.1| hypothetical protein JCGZ_05618 [Jatropha curcas]
Length=576

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/568 (75%), Positives = 488/568 (86%), Gaps = 7/568 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +F +  FC +  D ALA    ITRHYKFDIK+QNVTRLC TKSIVTVNG+FPGPRI+ARE
Sbjct  16    LFSVITFCLLI-DPALA----ITRHYKFDIKLQNVTRLCHTKSIVTVNGKFPGPRIVARE  70

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD++++KVVNHV+ N+++HWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGT
Sbjct  71    GDQLLIKVVNHVQNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIIGQRGT  130

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L+WHAHISWLR+TLYGPI+ILPK GV YPF +P+KE+PIIFGEW+ ADTE II+QA QTG
Sbjct  131   LWWHAHISWLRSTLYGPIIILPKLGVPYPFAKPYKEIPIIFGEWFNADTEAIINQALQTG  190

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTY+LRLINAALNDELFFSIANH+LT
Sbjct  191   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYMLRLINAALNDELFFSIANHTLT  250

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VV+ DAVYVKPF T I+LI PGQT+NVLLKT  + PNA + ++ARPY TG   FDNST A
Sbjct  251   VVDVDAVYVKPFETEILLIAPGQTSNVLLKTKPNFPNAKFFMTARPYVTGLGTFDNSTVA  310

Query  1038  GILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRF  1217
              ILEY   S   +  KLPL+ P LP  NDT+FA NFT+KL SLA+  +PANVP+KVDR+F
Sbjct  311   AILEY-KPSQTASIKKLPLYKPVLPPLNDTAFAINFTQKLFSLASKKYPANVPQKVDRQF  369

Query  1218  FFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFP  1397
             FFTVGLG  PCP NQTCQGP N T FAASVNN+SF  P TALLQ+HFF QSKGVY  +FP
Sbjct  370   FFTVGLGTNPCPHNQTCQGP-NGTMFAASVNNVSFTMPNTALLQSHFFGQSKGVYKPNFP  428

Query  1398  ANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFV  1577
              +P + FNYTGNPP N MV++ TK+V L FN+SVEL++QDTSI+GAESHPLHLHGFNFFV
Sbjct  429   ISPLIPFNYTGNPPNNTMVSNGTKLVVLPFNTSVELILQDTSILGAESHPLHLHGFNFFV  488

Query  1578  IGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSW  1757
             +GQGFGN+DPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSW
Sbjct  489   VGQGFGNFDPNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSW  548

Query  1758  GLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             GLKMAW+V+DGK   QKL PPP DLPKC
Sbjct  549   GLKMAWVVLDGKLPNQKLLPPPVDLPKC  576



>ref|XP_002300066.1| hypothetical protein POPTR_0001s35740g [Populus trichocarpa]
 gb|EEE84871.1| hypothetical protein POPTR_0001s35740g [Populus trichocarpa]
Length=580

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/578 (73%), Positives = 491/578 (85%), Gaps = 12/578 (2%)
 Frame = +3

Query  123   AKRFIIFVLAAFCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGP  299
             A R ++F  + FC       L +HA  +TRHYKFDIK+QNVTRLC +KS+VTVNG+FPGP
Sbjct  10    AFRALLFSFSIFC------LLPEHAFAVTRHYKFDIKLQNVTRLCHSKSMVTVNGQFPGP  63

Query  300   RIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTI  479
             RI+AREGD + +KVVNHV+ N++IHWHG+RQL+SGWADGPAYITQCPIQTGQSYVYN+TI
Sbjct  64    RIVAREGDNLFIKVVNHVQNNISIHWHGIRQLQSGWADGPAYITQCPIQTGQSYVYNYTI  123

Query  480   TGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIIS  659
              GQRGTL+WHAHISWLR+T+YGP++ILPK+GV YPF +P+KEVPIIFGEW+  D E +IS
Sbjct  124   VGQRGTLWWHAHISWLRSTVYGPLIILPKRGVQYPFAKPYKEVPIIFGEWFNVDPEAVIS  183

Query  660   QASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSI  839
             QA QTGG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTY+LRLINAALNDELFFSI
Sbjct  184   QALQTGGGPNVSDAYTINGLPGPLYNCSAEDTFKLKVKPGKTYMLRLINAALNDELFFSI  243

Query  840   ANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPF  1019
             ANHS+T+V+ DAVYVKPF+T  +LITPGQTTNVLLKT  + PNAT+ ++ARPYATG   F
Sbjct  244   ANHSVTIVDVDAVYVKPFDTETLLITPGQTTNVLLKTKPYFPNATFFMTARPYATGQGTF  303

Query  1020  DNSTTAGILEYst----nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPA  1187
             DNST A ILEY +    +S++ +   LPLF PTLP  NDT+FA NFT KLRSLA+A FPA
Sbjct  304   DNSTVAAILEYESPKTIHSSQLSLKNLPLFKPTLPPLNDTAFAANFTSKLRSLASAQFPA  363

Query  1188  NVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQ  1367
              VP+KVD RFFFTVGLG  PCP+NQTCQGP N TKFAASVNN+SF  PTTALLQAHFF +
Sbjct  364   KVPQKVDMRFFFTVGLGTNPCPKNQTCQGP-NGTKFAASVNNVSFSLPTTALLQAHFFGK  422

Query  1368  SKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP  1547
             S GVY  DFP  P   FNYTGNPP N MV++ T++V L FN+SVEL+MQDTSI+G ESHP
Sbjct  423   SNGVYIPDFPITPIFPFNYTGNPPNNTMVSTGTRLVVLPFNTSVELIMQDTSILGVESHP  482

Query  1548  LHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  1727
             LHLHG+NFFV+GQGFGN+DPNKDP+KFNLVDP ERNTVGVPSGGW AIRF ADNPG WFM
Sbjct  483   LHLHGYNFFVVGQGFGNFDPNKDPAKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWFM  542

Query  1728  HCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HCHLEVHTSWGL+MAW+V+DGK   QKL PPPADLPKC
Sbjct  543   HCHLEVHTSWGLEMAWVVLDGKLPNQKLIPPPADLPKC  580



>ref|XP_008385215.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/576 (74%), Positives = 484/576 (84%), Gaps = 10/576 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +  L   C +   V     A ITRHYKFDIK QNVTRLC TKSIVTVNG+FPGP+I+
Sbjct  13    RLFLLSLITLCLIPQHV----FASITRHYKFDIKQQNVTRLCHTKSIVTVNGQFPGPQIV  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRV++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQ+G SYVYNFTITGQ
Sbjct  69    AREGDRVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQSGNSYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK+GV YPF +P+KEVPIIFGEWW AD E +ISQA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEVPIIFGEWWNADPEAVISQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+T NGLPGPLYNCSAKD+FKLKV++GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSDAYTFNGLPGPLYNCSAKDAFKLKVRSGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADA+YVKPF+T+ VLI PGQTTNVLLKT  H P+AT+ ++ARPY TG   FDNS
Sbjct  249   TLKVVEADAIYVKPFDTDTVLIAPGQTTNVLLKTKPHFPSATFFMTARPYVTGLGTFDNS  308

Query  1029  TTAGILEYstnsnktttn----kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             T AGILEY + S    T     KLPLF P LP  NDTSFAT F+ KLRSLANA FPANVP
Sbjct  309   TVAGILEYESTSKALHTTLPMKKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPANVP  368

Query  1197  KKVDRRFFFTVGLGVIPCPQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             +KVDR FFFT+GLG  PC   NQTCQGP N T FAASVNN+SF  PTTALLQAHF  QS 
Sbjct  369   QKVDRHFFFTIGLGTNPCSSNNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFSGQSN  427

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVY+ DFP++P + FNYTG PP + MV + TK++ L +N+SVELVMQDTSI+GAESHPLH
Sbjct  428   GVYSPDFPSSPIIPFNYTGTPPNDTMVGNGTKLMVLPYNTSVELVMQDTSILGAESHPLH  487

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+D NKDP+ FNLVDP ERNTVGVPSGGWVAIRF+ADNPG WFMHC
Sbjct  488   LHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHC  547

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLE+HTSWGLKMAW+V+DGK   Q+L PPPADLP C
Sbjct  548   HLEIHTSWGLKMAWLVLDGKLPNQRLLPPPADLPTC  583



>ref|XP_006370271.1| hypothetical protein POPTR_0001s41170g [Populus trichocarpa]
 gb|ERP66840.1| hypothetical protein POPTR_0001s41170g [Populus trichocarpa]
Length=581

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/552 (76%), Positives = 477/552 (86%), Gaps = 5/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHYKFD+ +QNVTRLC TKSIVTVNG+FPGPRI+AREGDR+++KVVNHV+ N++IHW
Sbjct  31    AITRHYKFDVMLQNVTRLCHTKSIVTVNGKFPGPRIVAREGDRLLIKVVNHVQNNISIHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  91    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLII  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK G  YPF +P KEVPIIFGEW+ AD E II+QA QTGG PN+SDA+TING PGPLYN
Sbjct  151   LPKLGTTYPFAKPHKEVPIIFGEWFNADPEAIINQAMQTGGGPNVSDAYTINGFPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV+ DA+YVKPF+T  +LI 
Sbjct  211   CSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDVDAIYVKPFDTETLLIA  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttn----k  1085
             PGQTTNVLLKT  HHPNA++ +SARPY TG   FDNST AGILEY  ++    ++    K
Sbjct  271   PGQTTNVLLKTKPHHPNASFFMSARPYVTGQGTFDNSTVAGILEYEESNKTIKSSHSPKK  330

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             LP + P LP  NDTSFATNFT KLRSLA+A FPANVP+KVDR+FFF+V LG  PC +N+T
Sbjct  331   LPFYKPNLPPLNDTSFATNFTSKLRSLASAEFPANVPQKVDRQFFFSVSLGTNPCSKNKT  390

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T FAASVNN+SFV PT ALLQAH F QSKGVY+ +FP NP + FNYTG PP N
Sbjct  391   CQGP-NGTMFAASVNNVSFVMPTKALLQAHHFGQSKGVYSPNFPINPLIPFNYTGTPPNN  449

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ TK+V L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+G+GFGN+DP KDP+ 
Sbjct  450   TMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGEGFGNFDPKKDPAN  509

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   Q
Sbjct  510   FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQ  569

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  570   KLLPPPADLPKC  581



>ref|XP_010092993.1| hypothetical protein L484_007174 [Morus notabilis]
 gb|EXB53231.1| hypothetical protein L484_007174 [Morus notabilis]
Length=586

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/577 (74%), Positives = 487/577 (84%), Gaps = 6/577 (1%)
 Frame = +3

Query  126   KRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             + F+   L  F  ++     A  AGITRHYKF+I+++NVTRLC TKSIV+VNG+FPGPRI
Sbjct  11    RAFLGVFLFGFVTMAAIPEHAFAAGITRHYKFNIELKNVTRLCHTKSIVSVNGQFPGPRI  70

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             +AREGDR+++KVVNHVK N++IHWHG+RQL++GWADGPAY+TQCPIQTGQSYVYN++ITG
Sbjct  71    VAREGDRLLIKVVNHVKNNISIHWHGIRQLQTGWADGPAYVTQCPIQTGQSYVYNYSITG  130

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTLFWHAHISW+RAT+YGPIVILPK+GV YPF +P+KEVPIIFGEW+ AD E +ISQA
Sbjct  131   QRGTLFWHAHISWIRATIYGPIVILPKRGVPYPFTKPYKEVPIIFGEWFNADPEAVISQA  190

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKV+ GKTYLLRLINAA+NDELFFSIAN
Sbjct  191   LQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVEPGKTYLLRLINAAMNDELFFSIAN  250

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             H+L VVEADA+YVKPF+T+ +LI PGQTTNVLLKT  H PNAT+ ++ARPYATG   FDN
Sbjct  251   HTLKVVEADAIYVKPFDTDTILIAPGQTTNVLLKTKPHFPNATFFMTARPYATGLGTFDN  310

Query  1026  STTAGILEYstnsnktttnkLP-----LFTPTLPVFNDTSFATNFTKKLRSLANANFPAN  1190
             ST A ILEY   S  +  + LP     LF P LP  NDTSFAT F+ KLRSLA+  FPAN
Sbjct  311   STVAAILEYEFPSKLSPHSTLPMKKLQLFKPILPALNDTSFATKFSNKLRSLASTQFPAN  370

Query  1191  VPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQS  1370
             VP+KVD+RFFFT+GLG  PC  NQTCQGP N T FAASVNNISF  P TALLQAHF  QS
Sbjct  371   VPQKVDKRFFFTIGLGTSPCTHNQTCQGP-NGTMFAASVNNISFALPRTALLQAHFSGQS  429

Query  1371  KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPL  1550
              GVY+  FP +P + FNYTG PP N MVT+ TKV  L FN+SVELV+QDTSI+GAESHPL
Sbjct  430   NGVYSPKFPTSPLIPFNYTGAPPNNTMVTNGTKVAVLPFNTSVELVLQDTSILGAESHPL  489

Query  1551  HLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMH  1730
             HLHGFNFFV+GQGFGN+DPNKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMH
Sbjct  490   HLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMH  549

Query  1731  CHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             CHLEVHTSWGL+MAW+V+DGK   QKL PPPADLPKC
Sbjct  550   CHLEVHTSWGLRMAWVVLDGKLPNQKLLPPPADLPKC  586



>ref|XP_009403441.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=579

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/582 (73%), Positives = 480/582 (82%), Gaps = 11/582 (2%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             +M  LF    ++F          D A A+HAG TRHY FDI+M NV+RLC TKSI+TVNG
Sbjct  6     LMGALFLSSMVVFAFP-------DDARAEHAGTTRHYSFDIRMANVSRLCATKSILTVNG  58

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
              FPGPRI+AREGDRVVVKV NHV +NVTIHWHGVRQLRSGWADGPAY+TQCPIQTG +YV
Sbjct  59    EFPGPRIVAREGDRVVVKVSNHVPHNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGHNYV  118

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFT+ GQRGTLFWHAH+SWLRATLYGPI+ILPK GV YPF +P+KEVPIIFGEWWKADT
Sbjct  119   YNFTVVGQRGTLFWHAHVSWLRATLYGPIIILPKHGVPYPFAKPYKEVPIIFGEWWKADT  178

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E IISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLRLINAA+NDE
Sbjct  179   EAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAAVNDE  238

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANHS+TV+E DAVYVKPF+   ++I+PGQTTNVLL     +P+AT+ + ARPYAT
Sbjct  239   LFFSIANHSVTVIEVDAVYVKPFDAETIVISPGQTTNVLLHAKPTYPSATFFMMARPYAT  298

Query  1005  GPAPFDNSTTAGILEYstnsnkttt---nkLPLFTPTLPVFNDTSFATNFTKKLRSLANA  1175
             G   FDNST A +LEY    + +       LPL+ PTLP FNDTS A NFT KLRSLA A
Sbjct  299   GSGTFDNSTVAAVLEYRKPYSSSAAGFDKNLPLYKPTLPAFNDTSSAANFTGKLRSLATA  358

Query  1176  NFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH  1355
              FPANVP+ VDRRFFFTVGLG  PCP+NQTCQGP N T FAA+VNNISFV PTTALLQAH
Sbjct  359   LFPANVPQTVDRRFFFTVGLGTRPCPKNQTCQGP-NGTMFAAAVNNISFVSPTTALLQAH  417

Query  1356  FFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGA  1535
             F  +S GVYT DFP  P + FNYTG PP N MV++ TK+V L FN+SVELVMQDTSI+GA
Sbjct  418   FTGKSSGVYTPDFPVVPLMPFNYTGAPPNNTMVSNGTKLVVLPFNTSVELVMQDTSILGA  477

Query  1536  ESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             ESHPLHLHG+NFFV+GQGFGNYDP  DP+KFNLVDP ERNT+GV +GGWVAIRFLADNPG
Sbjct  478   ESHPLHLHGYNFFVVGQGFGNYDPVNDPAKFNLVDPVERNTIGVTAGGWVAIRFLADNPG  537

Query  1716  AWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              WFMHCH+E H SWGL+MAW+V++G+   Q L PPP+DLPKC
Sbjct  538   VWFMHCHIEAHMSWGLRMAWLVLNGRLPNQTLPPPPSDLPKC  579



>ref|XP_008222577.1| PREDICTED: laccase-17-like [Prunus mume]
Length=581

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/552 (77%), Positives = 476/552 (86%), Gaps = 4/552 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITRHYKFDI++QNVTRLCQTKSIVTVNG+FPGPRI+AREGD++++KV+NHV+ N++IH
Sbjct  31    ASITRHYKFDIQLQNVTRLCQTKSIVTVNGQFPGPRIVAREGDQLLIKVINHVQNNISIH  90

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLR+GWADGPAY+TQCPIQTG SYVYNFTI GQRGTL+WHAHISWLR+T+YGP++
Sbjct  91    WHGIRQLRTGWADGPAYVTQCPIQTGHSYVYNFTIVGQRGTLWWHAHISWLRSTVYGPLI  150

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK GV YPF +P+K VPIIFGEWW AD E +ISQA QTGG PN+SDA+T+NGLPGPLY
Sbjct  151   ILPKLGVPYPFTKPYKAVPIIFGEWWNADPEAVISQALQTGGGPNVSDAYTLNGLPGPLY  210

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKV+AGKTYLLRLINAALNDELFFSIANH+L VVEADAVYVKPF T+ +LI
Sbjct  211   NCSAKDAFKLKVEAGKTYLLRLINAALNDELFFSIANHTLKVVEADAVYVKPFETHTILI  270

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkL  1088
              PGQTTNVLLKT    PNAT+ ++ARPY TG   FDNST AGILEY    N+      KL
Sbjct  271   APGQTTNVLLKTKPSFPNATFFLTARPYVTGLGTFDNSTVAGILEYEFPPNTKTLKMKKL  330

Query  1089  PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQ-NQT  1265
             PLF P LP  NDTSFAT F  KLRSL NA FPANVPKKVD+RFFFTVGLG  PC Q NQT
Sbjct  331   PLFKPNLPALNDTSFATKFNDKLRSLNNAQFPANVPKKVDKRFFFTVGLGTNPCSQHNQT  390

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T FAAS+NNISF  P TALLQ+HF  QS GVYT DFP NP + FNYTG PP +
Sbjct  391   CQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSNGVYTPDFPTNPIIPFNYTGVPPND  449

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ TK+V L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D NKDP+K
Sbjct  450   TMVSNGTKLVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKDPAK  509

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWGLKMAW+V+DGK   Q
Sbjct  510   FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLPNQ  569

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  570   KLLPPPADLPKC  581



>gb|KHN16225.1| Laccase-17, partial [Glycine soja]
Length=540

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/540 (78%), Positives = 468/540 (87%), Gaps = 4/540 (1%)
 Frame = +3

Query  234   QNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWAD  413
             QNVTRLC TKS+VTVNG+FPGPRI+AREGDR+++KV NHV  N+TIHWHG+RQL+SGWAD
Sbjct  1     QNVTRLCHTKSMVTVNGQFPGPRIVAREGDRLLIKVTNHVSNNITIHWHGIRQLQSGWAD  60

Query  414   GPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQ  593
             GPAY+TQCPIQ GQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++ILPK    YPF +
Sbjct  61    GPAYVTQCPIQRGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKLNAQYPFAK  120

Query  594   PFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVK  773
             P KEVPI+FGEWW AD E +I+QA QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK
Sbjct  121   PHKEVPIVFGEWWNADPEAVITQALQTGGGPNVSDAYTINGLPGPLYNCSDKDTFKLKVK  180

Query  774   AGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTT  953
              GK YLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF TN +LITPGQTTNVLLKT 
Sbjct  181   PGKIYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFATNTILITPGQTTNVLLKTK  240

Query  954   THHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFN  1121
             +H+PNAT+L++ARPYATG   FDN+T AGIL+Y     T+ +  +   LPL  P LP  N
Sbjct  241   SHYPNATFLMTARPYATGLGTFDNTTVAGILQYKTPPNTHHSAASLKNLPLLKPILPALN  300

Query  1122  DTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAA  1301
             DTSFAT F  KLRSLA+A FPANVP+KVD  FFFTVGLG  PCPQNQTCQGPTN TKFAA
Sbjct  301   DTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQNQTCQGPTNATKFAA  360

Query  1302  SVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQL  1481
             SVNN+SF+QPTTALLQ HFF QS GVYTADFPA P + FNYTG PP N MV++ TKVV L
Sbjct  361   SVNNVSFIQPTTALLQTHFFGQSNGVYTADFPAKPLIPFNYTGTPPNNTMVSNGTKVVVL  420

Query  1482  SFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTV  1661
              FN+SVELVMQDTSI+GAESHPLHLHGFNFF +GQGFGN+DPNKDP+ FNL+DP ERNTV
Sbjct  421   PFNTSVELVMQDTSILGAESHPLHLHGFNFFAVGQGFGNFDPNKDPANFNLLDPIERNTV  480

Query  1662  GVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             GVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  481   GVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLFPPPADLPKC  540



>ref|XP_009796361.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=581

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/550 (76%), Positives = 477/550 (87%), Gaps = 2/550 (0%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY+F+I MQNVTRLC TKSIVTVNG+FPGPRI+ REGDR+++KV NHV  N++IHW
Sbjct  32    AITRHYEFNITMQNVTRLCHTKSIVTVNGKFPGPRIVTREGDRLLIKVNNHVPNNISIHW  91

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  92    HGVRQLRSGWADGPAYITQCPIQTGQSYVYNYTIIGQRGTLWWHAHISWLRSTLYGPLII  151

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPKK  +YPF +PFKEVPII GEW+ AD E IISQA QTGG PN+SDA+TINGLPG LYN
Sbjct  152   LPKKNESYPFLKPFKEVPIILGEWFNADPEAIISQALQTGGGPNVSDAYTINGLPGLLYN  211

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CS KD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV+ADAVYVKPF+TN +LIT
Sbjct  212   CSTKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDADAVYVKPFDTNTILIT  271

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkLP  1091
             PGQTTNVLLKT + +P+AT+L++ARPY TG   FDNST AGILEY T  + +  +  KLP
Sbjct  272   PGQTTNVLLKTKSEYPSATFLMTARPYVTGQGTFDNSTVAGILEYETPISHSTKSIKKLP  331

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             LF PTLP  NDTSFATNF+KKL SLAN+ FPA VP+ VD+ FFFTVGLG  PC +NQ CQ
Sbjct  332   LFKPTLPPLNDTSFATNFSKKLHSLANSQFPAKVPQNVDKHFFFTVGLGTTPCDKNQICQ  391

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GPTN TKFAAS+NN+SF+QPTTALLQ+HF  QS GVY+  FP NP   FNYTG PP N  
Sbjct  392   GPTNTTKFAASINNVSFIQPTTALLQSHFIGQSNGVYSPYFPINPLHWFNYTGTPPNNTR  451

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V + TKV+ L FN+SVEL+MQDTSI+GAESHPLHLHGFNF+V+GQGFGN+DPNKDP+ FN
Sbjct  452   VNNGTKVLVLPFNTSVELIMQDTSILGAESHPLHLHGFNFYVVGQGFGNFDPNKDPANFN  511

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             L+DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QKL
Sbjct  512   LIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKL  571

Query  1812  QPPPADLPKC  1841
              PPP+DLP+C
Sbjct  572   LPPPSDLPQC  581



>gb|KEH22816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=580

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/584 (73%), Positives = 489/584 (84%), Gaps = 9/584 (2%)
 Frame = +3

Query  105   MMVCLFAK-RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             M V +F+  +     L+   + + + ALA   G TRHY+FDI  QNVTRLC  K +VTVN
Sbjct  1     MAVTIFSSLKIATLFLSLINFCAFEFALA---GTTRHYQFDIGYQNVTRLCHNKRMVTVN  57

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRI+AREGDR+V+KVVN+V+ N++IHWHG+RQL+SGWADGPAY+TQCPIQTGQSY
Sbjct  58    GQFPGPRIMAREGDRLVIKVVNNVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSY  117

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VYN+TI GQRGTLFWHAHISWLR+TLYGP++ILPKK V YPF +P KEVP+IFGEW+ AD
Sbjct  118   VYNYTIKGQRGTLFWHAHISWLRSTLYGPLIILPKKNVPYPFAKPHKEVPMIFGEWFNAD  177

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
             TE II+QA QTGG PN+S+A+TINGLPGPLYNCS KD+FKLKVK GKTYLLRLINAALND
Sbjct  178   TEAIIAQALQTGGGPNVSEAYTINGLPGPLYNCSKKDTFKLKVKPGKTYLLRLINAALND  237

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFS+ANH+L VVEADA+YVKPF TN +LI PGQTTNVLLKT +H+PNA +L+SARPYA
Sbjct  238   ELFFSVANHTLKVVEADAIYVKPFETNTILIAPGQTTNVLLKTKSHYPNAAFLMSARPYA  297

Query  1002  TGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLA  1169
             TG   FDN+T AGILEY     T+ + ++  K+PLF PTLP  NDTSFAT F+KKLRSLA
Sbjct  298   TGQGTFDNTTVAGILEYEIPSNTHHSASSLKKIPLFKPTLPALNDTSFATKFSKKLRSLA  357

Query  1170  NANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQ  1349
             +  FPANVP+KVD+ FFFTVGLG  PC  NQTCQGP N T FAASVNN+SF  PTTALLQ
Sbjct  358   SPQFPANVPQKVDKHFFFTVGLGTNPCQSNQTCQGP-NGTMFAASVNNVSFTMPTTALLQ  416

Query  1350  AHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSII  1529
             +HF  QS+GVY   FP++P   FNYTG PP N MV++ TKV  L FN+SVELVMQDTSI+
Sbjct  417   SHFTGQSRGVYAPYFPSSPLHPFNYTGTPPNNTMVSNGTKVTVLPFNTSVELVMQDTSIL  476

Query  1530  GAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADN  1709
             GAESHPLHLHGFNFFV+GQGFGNYD NKDP  FNLVDP ERNT+GVPSGGWVAIRFLADN
Sbjct  477   GAESHPLHLHGFNFFVVGQGFGNYDSNKDPKNFNLVDPVERNTIGVPSGGWVAIRFLADN  536

Query  1710  PGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             PG WFMHCHLEVHTSWGLKMAWIV+DGK   QKL PPPADLPKC
Sbjct  537   PGVWFMHCHLEVHTSWGLKMAWIVLDGKLPNQKLLPPPADLPKC  580



>ref|XP_009354528.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=581

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/574 (74%), Positives = 481/574 (84%), Gaps = 8/574 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +F    FC +         AGITR+YKF IK++NVTRLC TK+I+TVNG+FPGPRII
Sbjct  13    RLFLFSFITFCVIPQQAL----AGITRNYKFQIKLRNVTRLCHTKTIITVNGQFPGPRII  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGD++++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTG SYVYNFTITGQ
Sbjct  69    AREGDQLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGNSYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK+GV YPF +P+KEVPIIFGEWW AD E IISQA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFTKPYKEVPIIFGEWWNADPEAIISQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKV+ GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSDAYTINGLPGPLYNCSAKDAFKLKVQPGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADAVYVKPF T+ +LI PGQTTNVLLKT  + PNAT+ ++ARPY TG   FDNS
Sbjct  249   TLKVVEADAVYVKPFETSTILIAPGQTTNVLLKTKPNFPNATFFMTARPYVTGQGTFDNS  308

Query  1029  TTAGILEYs--tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             T AGILEY   + +   TT +LPLF P LP  NDTSFAT F  KLRSL    FPANVP+K
Sbjct  309   TVAGILEYESPSKTKNLTTKRLPLFKPNLPALNDTSFATKFANKLRSLNTQQFPANVPQK  368

Query  1203  VDRRFFFTVGLGVIPCPQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGV  1379
             VD+ FFFT+GLG  PC Q NQTCQGP N T FAAS+NNISF  P TALLQ+HF  QS GV
Sbjct  369   VDKNFFFTIGLGTNPCSQNNQTCQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSSGV  427

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             Y+ DFPANP V FNYTG PP + MV++ TK++ L FNS VELVMQDTSI+GAESHPLHLH
Sbjct  428   YSPDFPANPIVPFNYTGTPPNDTMVSNGTKLMVLPFNSRVELVMQDTSILGAESHPLHLH  487

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNFFV+GQGFGN+DPNKDP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHL
Sbjct  488   GFNFFVVGQGFGNFDPNKDPKMFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  547

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             E+HTSWGLKM W+V+DGK   QKL PPPADLPKC
Sbjct  548   EIHTSWGLKMGWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_010922297.1| PREDICTED: laccase-17-like [Elaeis guineensis]
Length=584

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/584 (73%), Positives = 490/584 (84%), Gaps = 12/584 (2%)
 Frame = +3

Query  99    LRMMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTV  278
             L M   +F+   ++  L          A A+  GI RHY+FDI+M NVTRLC TKSIVTV
Sbjct  10    LLMAALMFSTVTLLLSLGG--------AGAQQTGINRHYRFDIRMANVTRLCHTKSIVTV  61

Query  279   NGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQS  458
             NG+FPGP+I+AREGDRVVVKVVNHV YNVT+HWHGVRQLRSGWADGPAY+TQCPIQTGQS
Sbjct  62    NGQFPGPKIVAREGDRVVVKVVNHVPYNVTLHWHGVRQLRSGWADGPAYVTQCPIQTGQS  121

Query  459   YVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKA  638
             YVYNFTI GQRGTLFWHAHISWLRATLYGPI+ILP +GV YPF +P+KEVPIIFGEWW A
Sbjct  122   YVYNFTIVGQRGTLFWHAHISWLRATLYGPIIILPARGVPYPFSRPYKEVPIIFGEWWNA  181

Query  639   DTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALN  818
             DTE +ISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALN
Sbjct  182   DTEAVISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALN  241

Query  819   DELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPY  998
             DELFFSIANH+LT+V+ DAVYVKPF+T+ ++I PGQTTNVLL+T     ++T+L++ARPY
Sbjct  242   DELFFSIANHTLTIVDVDAVYVKPFDTDTLIIAPGQTTNVLLRTRPSFFHSTFLMAARPY  301

Query  999   ATGPAPFDNSTTAGILEYs---tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLA  1169
             ATG   FDNST AG LEY    T+S  + + KLPLF PTLP  NDT+F  NFT +LRSLA
Sbjct  302   ATGAGAFDNSTVAGFLEYQDPNTSSRASFSKKLPLFRPTLPSLNDTAFVANFTSRLRSLA  361

Query  1170  NANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQ  1349
              A FPANVP+ VDRRFFFTVGLG  PCP+NQTCQGP N TKFAA+V+NISF  PTTALLQ
Sbjct  362   TAQFPANVPQSVDRRFFFTVGLGTSPCPKNQTCQGP-NGTKFAATVSNISFTMPTTALLQ  420

Query  1350  AHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSII  1529
             AHFF QS+GVY+ DFP +P + FNYTG PP N  V++ TK++ L FN++VELVMQDTSI+
Sbjct  421   AHFFGQSRGVYSPDFPYSPLIPFNYTGTPPNNTAVSNGTKLMVLPFNATVELVMQDTSIL  480

Query  1530  GAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADN  1709
             GAESHPLHLHGFNFFV+GQG GNY+P KDP+ FNLVDPAERNTVGVP+GGWVAIRF ADN
Sbjct  481   GAESHPLHLHGFNFFVVGQGSGNYNPAKDPANFNLVDPAERNTVGVPAGGWVAIRFRADN  540

Query  1710  PGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             PG WFMHCHLEVHTSWGLKMAW+V+DG    QKL  PP+DLPKC
Sbjct  541   PGVWFMHCHLEVHTSWGLKMAWLVLDGSLPNQKLPRPPSDLPKC  584



>gb|KEH22917.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=593

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/583 (74%), Positives = 490/583 (84%), Gaps = 14/583 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALA---------KHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             R ++ VL A  WV  ++A A         KH   TRHYKFDIK+QNVTRLCQTKSIVTVN
Sbjct  13    RAMLIVLCAL-WVLPELAHARHVRTTSHAKHVSTTRHYKFDIKLQNVTRLCQTKSIVTVN  71

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRIIAREGDRVVVKVVNHV+YNV+IHWHG+RQ+RS WADGPAYITQCPI+ GQSY
Sbjct  72    GQFPGPRIIAREGDRVVVKVVNHVQYNVSIHWHGIRQVRSAWADGPAYITQCPIKPGQSY  131

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             V+ FTI GQRGTL++HAHISWLR+TL+GPIVILPKK V YPFP PFK++PI+ GEWWKAD
Sbjct  132   VHKFTIIGQRGTLWYHAHISWLRSTLHGPIVILPKKHVPYPFPHPFKQIPIVLGEWWKAD  191

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
             TE +I+QA+QTG APN SDA TINGLPGPL+NCSAKD+FKLKV  GKTYLLR+INAALND
Sbjct  192   TEAVINQATQTGLAPNTSDAHTINGLPGPLHNCSAKDTFKLKVLPGKTYLLRIINAALND  251

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             E+FFSIANH+L VV+ADAVYVKPF TNIVLITPGQTTNVLLKT +  PNA ++I++RPYA
Sbjct  252   EMFFSIANHTLLVVDADAVYVKPFRTNIVLITPGQTTNVLLKTKSKTPNAKFVIASRPYA  311

Query  1002  TGPAPFDNSTTAGILEYstns---nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLAN  1172
             TGPA FDN+T  G LEY  +S    K+    + LF PTLP FNDT FA NF  KLRSL +
Sbjct  312   TGPASFDNTTAIGFLEYKKHSLSNTKSKNKTVKLFRPTLPKFNDTIFAMNFNTKLRSLNS  371

Query  1173  ANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQA  1352
               FPA VPK VD+ FFFTVGLG+  C +NQ CQGP NNT+ AA++NN+SFV P TALLQA
Sbjct  372   KKFPAKVPKTVDKHFFFTVGLGISQCSKNQACQGP-NNTRVAAAINNVSFVMPNTALLQA  430

Query  1353  HFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIG  1532
             HFFN+SKGV+T DFP+NPPVKFNYTG PP NIMV S TKV  L +N+ VELV+QDTSI+G
Sbjct  431   HFFNKSKGVFTTDFPSNPPVKFNYTGTPPKNIMVKSGTKVAVLPYNTKVELVLQDTSILG  490

Query  1533  AESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNP  1712
             AESHPLHLHGFNFF++GQG GN+DP KDP+KFNLVDP ERNT GVP+GGWVA+RFLADNP
Sbjct  491   AESHPLHLHGFNFFIVGQGNGNFDPKKDPAKFNLVDPVERNTAGVPAGGWVALRFLADNP  550

Query  1713  GAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             G WFMHCHLEVHTSWGLKMAWIV DGK R QKL PPP+DLPKC
Sbjct  551   GVWFMHCHLEVHTSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  593



>ref|XP_008223967.1| PREDICTED: laccase-17, partial [Prunus mume]
Length=556

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/554 (77%), Positives = 479/554 (86%), Gaps = 6/554 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITRHYKF+IK QNVTRLC TKSIVTVNG+FPGPRI+AREGDR+++KVVNHV++N++IH
Sbjct  4     ASITRHYKFEIKQQNVTRLCHTKSIVTVNGQFPGPRIVAREGDRLLIKVVNHVQHNISIH  63

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLR+GWADGPAY+TQCPIQTG SYVYNFTI GQRGTL+WHAHISWLR+TL+GPIV
Sbjct  64    WHGIRQLRTGWADGPAYVTQCPIQTGNSYVYNFTIVGQRGTLWWHAHISWLRSTLHGPIV  123

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK GV YPF +P+KEVPIIFGEWW AD E +I QA QTGG PN+SDA+T NGLPGPLY
Sbjct  124   ILPKLGVPYPFTKPYKEVPIIFGEWWNADPEAVIKQALQTGGGPNVSDAYTFNGLPGPLY  183

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK+GKTYLLRLINAALNDELFFSIANH+L VV+ADAVYVKPF T+ +LI
Sbjct  184   NCSAKDAFKLKVKSGKTYLLRLINAALNDELFFSIANHTLKVVDADAVYVKPFETDTILI  243

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttn----  1082
             TPGQTTNVLLKT  H PNAT+ ++ARPY TG   FDNST AGILEY + S    +     
Sbjct  244   TPGQTTNVLLKTKPHFPNATFFMTARPYVTGLGTFDNSTVAGILEYESPSKTLHSTLPMK  303

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC-PQN  1259
             KLPLF P LP  NDTSFAT F+KKLRSLANA FPANVP+KVD+ FFFTVGLG  PC   N
Sbjct  304   KLPLFKPILPALNDTSFATKFSKKLRSLANAQFPANVPQKVDKHFFFTVGLGTNPCNKHN  363

Query  1260  QTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPP  1439
             QTCQGP N T FAASVNN+SFV PTTALLQAHF  QS  VY+++FP++P + FNYTG PP
Sbjct  364   QTCQGP-NGTMFAASVNNVSFVMPTTALLQAHFSGQSNRVYSSNFPSSPVIPFNYTGTPP  422

Query  1440  TNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDP  1619
              N MV++ TK+V L FN+SVEL+MQDTSI+GAESHPLHLHG+NFFV+GQGFGN+D NKDP
Sbjct  423   NNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGYNFFVVGQGFGNFDQNKDP  482

Query  1620  SKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGR  1799
             + FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWGLKMAW+V+DGK  
Sbjct  483   ANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLP  542

Query  1800  KQKLQPPPADLPKC  1841
              QKL PPPADLP C
Sbjct  543   NQKLLPPPADLPTC  556



>gb|KDO73032.1| hypothetical protein CISIN_1g008109mg [Citrus sinensis]
Length=577

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/552 (75%), Positives = 482/552 (87%), Gaps = 5/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHYKF+++++NVTRLC TK++V+VNG+FPGPRI+AREGDR+++KVVNHV++N++IHW
Sbjct  27    AITRHYKFNVELKNVTRLCHTKTLVSVNGQFPGPRIVAREGDRLLIKVVNHVQHNISIHW  86

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSY+YNFTI GQRGTL+WHAHISWLR+TLYGPI+I
Sbjct  87    HGIRQLRSGWADGPAYITQCPIQTGQSYIYNFTIVGQRGTLWWHAHISWLRSTLYGPIII  146

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+G+ YPF +P+KEVPI+FGEW+K+DTE II+QA QTGG PN+SDA+T NGLPGPLYN
Sbjct  147   LPKRGIPYPFAKPYKEVPIVFGEWFKSDTEAIINQALQTGGGPNVSDAYTFNGLPGPLYN  206

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK+GKTYLLRL+N+ALND+LFFSIANH+LTVVE DAVYVKPF T  ++IT
Sbjct  207   CSAKDTFKLKVKSGKTYLLRLVNSALNDDLFFSIANHTLTVVEVDAVYVKPFETETLVIT  266

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----nsnktttnk  1085
             PGQTTNVLL+T  H+P+AT+ ++ARPY TG   FDNST AGILEY        +  +  K
Sbjct  267   PGQTTNVLLETKPHYPSATFFMTARPYVTGLGTFDNSTVAGILEYEKPLNFIHSGNSIKK  326

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             LPLF P LP  NDT+F TNF  KLRSL +A FPANVP+ VD+RFFFTVGLG  PCP+NQT
Sbjct  327   LPLFKPILPPLNDTNFVTNFVNKLRSLGSAQFPANVPQNVDKRFFFTVGLGTSPCPRNQT  386

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T F AS+NNISFV PTTALLQAHF  QS GVY  DFP +P + FNYTGNPP N
Sbjct  387   CQGP-NGTMFEASINNISFVMPTTALLQAHFTGQSNGVYVPDFPTSPLIPFNYTGNPPNN  445

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV+S TK+V L FN+SVEL+MQDTSI+GAE+HPLHLHG+NFFV+GQGFGN+DPNKDP+K
Sbjct  446   TMVSSGTKLVVLPFNTSVELIMQDTSILGAENHPLHLHGYNFFVVGQGFGNFDPNKDPAK  505

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLK AW+V+DGK   Q
Sbjct  506   FNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKTAWLVLDGKLPNQ  565

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  566   KLLPPPADLPKC  577



>ref|XP_006424707.1| hypothetical protein CICLE_v10028090mg [Citrus clementina]
 ref|XP_006488221.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR37947.1| hypothetical protein CICLE_v10028090mg [Citrus clementina]
Length=577

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/552 (75%), Positives = 482/552 (87%), Gaps = 5/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHYKF+++++NVTRLC TK++V+VNG+FPGPRI+AREGDR+++KVVNHV++N++IHW
Sbjct  27    AITRHYKFNVELKNVTRLCHTKTLVSVNGQFPGPRIVAREGDRLLIKVVNHVQHNISIHW  86

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSY+YNFTI GQRGTL+WHAHISWLR+TLYGPI+I
Sbjct  87    HGIRQLRSGWADGPAYITQCPIQTGQSYIYNFTIVGQRGTLWWHAHISWLRSTLYGPIII  146

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+G+ YPF +P+KEVPI+FGEW+K+DTE II+QA QTGG PN+SDA+T NGLPGPLYN
Sbjct  147   LPKRGIPYPFAKPYKEVPIVFGEWFKSDTEAIINQALQTGGGPNVSDAYTFNGLPGPLYN  206

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK+GKTYLLRL+N+ALND+LFFSIANH+LTVVE DAVYVKPF T  ++IT
Sbjct  207   CSAKDAFKLKVKSGKTYLLRLVNSALNDDLFFSIANHTLTVVEVDAVYVKPFETETLVIT  266

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----nsnktttnk  1085
             PGQTTNVLL+T  H+P+AT+ ++ARPY TG   FDNST AGILEY        +  +  K
Sbjct  267   PGQTTNVLLETKPHYPSATFFMTARPYVTGLGTFDNSTVAGILEYEKPLNFIHSGNSIKK  326

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             LPLF P LP  NDT+F TNF  KLRSL +A FPANVP+ VD+RFFFTVGLG  PCP+NQT
Sbjct  327   LPLFKPILPPLNDTNFVTNFVNKLRSLGSAQFPANVPQNVDKRFFFTVGLGTSPCPRNQT  386

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T F AS+NNISFV PTTALLQAHF  QS GVY  DFP +P + FNYTGNPP N
Sbjct  387   CQGP-NGTMFEASINNISFVMPTTALLQAHFTGQSNGVYVPDFPTSPLIPFNYTGNPPNN  445

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV+S TK+V L FN+SVEL+MQDTSI+GAE+HPLHLHG+NFFV+GQGFGN+DPNKDP+K
Sbjct  446   TMVSSGTKLVVLPFNTSVELIMQDTSILGAENHPLHLHGYNFFVVGQGFGNFDPNKDPAK  505

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLK AW+V+DGK   Q
Sbjct  506   FNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKTAWLVLDGKLPNQ  565

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  566   KLLPPPADLPKC  577



>ref|XP_007016584.1| Laccase 17 [Theobroma cacao]
 gb|EOY34203.1| Laccase 17 [Theobroma cacao]
Length=577

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/572 (74%), Positives = 480/572 (84%), Gaps = 8/572 (1%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
              + F   A C + G V      GITRHYKFDIK+ NVTRLC TKSIV+VNG+FPGPRI+A
Sbjct  12    LVFFSFFALCLLPGPVL-----GITRHYKFDIKLHNVTRLCHTKSIVSVNGQFPGPRIVA  66

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGD++++KVVNH+  N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFTI GQR
Sbjct  67    REGDQLLIKVVNHLSNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTIVGQR  126

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GTLFWHAHISWLRAT+YGPIVILPK+GV YPF +P+KEVPI FGEW+ AD E +ISQA +
Sbjct  127   GTLFWHAHISWLRATVYGPIVILPKRGVPYPFAKPYKEVPITFGEWFNADPEAVISQALR  186

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
              GG PN+SDA+TINGLPGPLYNCSAKD+FKLKV+ GKTYLLRLINAALN+ELFFS+ANH+
Sbjct  187   RGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVRPGKTYLLRLINAALNNELFFSVANHT  246

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             LTVV+ DA+YVKPF T  +LITPGQTTNVLLKT   +P+AT+ ++ARPY TG   FDNST
Sbjct  247   LTVVDFDAIYVKPFETETLLITPGQTTNVLLKTKPSYPSATFFMTARPYVTGQGTFDNST  306

Query  1032  TAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
              AGILEY    +S  ++   LPLF P LP  NDTSFATNF  KLRSLA+A +PANVP+KV
Sbjct  307   VAGILEYELPPDSFHSSIKMLPLFKPILPALNDTSFATNFANKLRSLASAQYPANVPQKV  366

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             D+ FFF VGLG  PC QN+TCQGP N TK AASVNN+SF  PTTALLQAHF  QS GVYT
Sbjct  367   DKHFFFAVGLGTSPCQQNRTCQGP-NGTKMAASVNNVSFAMPTTALLQAHFLGQSNGVYT  425

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFP+NP + FNYTG  P N MV++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGF
Sbjct  426   PDFPSNPIIPFNYTGTTPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGF  485

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+GQGFGN+DP KD + FNLVDP ERNTVGVPSGGWVAIRFLADNPG W MHCHLEV
Sbjct  486   NFFVVGQGFGNFDPKKDLANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEV  545

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAWIV+DGK   QKL PPPADLPKC
Sbjct  546   HTSWGLKMAWIVLDGKLPNQKLLPPPADLPKC  577



>ref|XP_010264410.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=583

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/557 (76%), Positives = 477/557 (86%), Gaps = 5/557 (1%)
 Frame = +3

Query  186   AKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynv  365
             A HAGITRHYKF+IK+QNVTRLC TKSI TVNG+FPGPRI+AREGDR+V+KVVNH++ NV
Sbjct  27    ATHAGITRHYKFNIKLQNVTRLCHTKSIPTVNGKFPGPRIVAREGDRLVIKVVNHIQNNV  86

Query  366   TIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYG  545
             ++HWHG+RQLRSGWADGPAY+TQCPIQ GQSYVYNFTITGQRGT FWHAHISWLR+TLYG
Sbjct  87    SLHWHGIRQLRSGWADGPAYVTQCPIQRGQSYVYNFTITGQRGTFFWHAHISWLRSTLYG  146

Query  546   PIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPG  725
             PI+ILPK+ V YPF +P+KEVP+IFGEWW ADTE +I QA Q+G  PN+SDA+TINGLPG
Sbjct  147   PIIILPKRDVPYPFVKPYKEVPLIFGEWWNADTEAVIRQALQSGAGPNVSDAYTINGLPG  206

Query  726   PLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNI  905
             PLYNCSA DSFKLKVK GKTYLLRLINAALNDELFFSIA H+LTVVEAD +YVKPF+T+ 
Sbjct  207   PLYNCSANDSFKLKVKPGKTYLLRLINAALNDELFFSIAKHTLTVVEADGIYVKPFDTDK  266

Query  906   VLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY----stnsnkt  1073
             +LITPGQTT+VLLKT    PNAT+ ++A PY TG   FDNST AGILEY    S +S   
Sbjct  267   LLITPGQTTDVLLKTKPDFPNATFFMAASPYFTGLGTFDNSTIAGILEYDDQPSNSSAIN  326

Query  1074  ttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCP  1253
                +LPLF PTLP  NDT+F  NF+ ++RSLA   FPANVP+ VD+RFFFTVGLG  PCP
Sbjct  327   RKKQLPLFRPTLPPINDTAFVANFSSRIRSLATTQFPANVPQTVDKRFFFTVGLGSSPCP  386

Query  1254  QNQTCQGPTNNT-KFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTG  1430
             +NQ+CQGP N T KFAASVNNISF  PTTA+LQAHFF Q KGVYT+DFP NPP  FNYTG
Sbjct  387   KNQSCQGPNNGTRKFAASVNNISFALPTTAILQAHFFGQEKGVYTSDFPINPPFPFNYTG  446

Query  1431  NPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPN  1610
              PP N +V++ TKVV L FN+SVELVMQ TSI+GAESHPLHLHGFNFFV+GQGFG++DPN
Sbjct  447   TPPNNTLVSNGTKVVVLPFNTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGSFDPN  506

Query  1611  KDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDG  1790
             KDP  FNLVDPAERNTVGVPSGGWVAIRFL+DNPGAWFMHCH EVH SWGL+M WIV+DG
Sbjct  507   KDPPNFNLVDPAERNTVGVPSGGWVAIRFLSDNPGAWFMHCHFEVHLSWGLRMVWIVLDG  566

Query  1791  KGRKQKLQPPPADLPKC  1841
             +   QKL PPP+DLPKC
Sbjct  567   EHPNQKLPPPPSDLPKC  583



>gb|AES79165.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=580

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/584 (73%), Positives = 488/584 (84%), Gaps = 9/584 (2%)
 Frame = +3

Query  105   MMVCLFAK-RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             M V LF+  +F +  L+   + + ++ALA   GITRHY FDI+ QNVTRLC +KS+VTVN
Sbjct  1     MGVSLFSSLKFPLIFLSLINFCTFELALA---GITRHYHFDIRYQNVTRLCHSKSMVTVN  57

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRI+AREGDR+++KVVNHV+ N++IHWHG+RQL+SGWADGPAY+TQCPIQT QSY
Sbjct  58    GQFPGPRIVAREGDRLIIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTDQSY  117

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VYN+TI GQRGTLFWHAHISWLR+TLYGP++ILPKK   YPF +P KEV I+FGEW+ AD
Sbjct  118   VYNYTIKGQRGTLFWHAHISWLRSTLYGPLIILPKKNDQYPFAKPHKEVLILFGEWFNAD  177

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
              E II+QA QTGG PN+SDA+TINGLPGPLYNCSA D+FKLKVK GKTYLLRLINAALND
Sbjct  178   PEAIIAQALQTGGGPNVSDAYTINGLPGPLYNCSANDTFKLKVKPGKTYLLRLINAALND  237

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIANH+L VVEADA+YVKPF TN + I PGQTTNVLL T +H+PNA +L++ARPYA
Sbjct  238   ELFFSIANHTLKVVEADAIYVKPFETNTIYIAPGQTTNVLLNTKSHYPNAAFLMTARPYA  297

Query  1002  TGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLA  1169
              GP PFDN+T A ILEY     T+ + ++  K PLF P LP FNDTSFAT F+ KLRSLA
Sbjct  298   AGPGPFDNTTVAAILEYEIPPNTHHSASSLKKHPLFKPILPAFNDTSFATKFSNKLRSLA  357

Query  1170  NANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQ  1349
             +A FPANVPKK+D+ FFFTVG+G  PC  NQTCQG  N T F AS+NN+SF  PTTALLQ
Sbjct  358   SAQFPANVPKKIDKHFFFTVGIGTNPCQSNQTCQG-LNGTMFVASMNNVSFTMPTTALLQ  416

Query  1350  AHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSII  1529
             +HFF Q+ G+YT DFP+ P   FNYTG PP N MV++ TKVV L FN+SVELVMQDTSI+
Sbjct  417   SHFFGQNNGIYTTDFPSKPLNPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSIL  476

Query  1530  GAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADN  1709
             GAESHPLHLHGFNFFV+GQGFGNYD NKDP KFNLVDP ERNTVGVPSGGWVAIRFLADN
Sbjct  477   GAESHPLHLHGFNFFVVGQGFGNYDSNKDPQKFNLVDPVERNTVGVPSGGWVAIRFLADN  536

Query  1710  PGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             PG WFMHCHLEVHTSWGL MAWIV+DGK   QKL PPPADLPKC
Sbjct  537   PGVWFMHCHLEVHTSWGLSMAWIVLDGKLPNQKLLPPPADLPKC  580



>ref|XP_010920538.1| PREDICTED: laccase-4-like [Elaeis guineensis]
Length=584

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/559 (75%), Positives = 480/559 (86%), Gaps = 4/559 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++  A+  GITRHYKFDI+M NVTRLC TKS+VTVNG++PGPRI+AREGDRV+VKVVNHV
Sbjct  27    ELPCAQQNGITRHYKFDIQMTNVTRLCHTKSMVTVNGQYPGPRIVAREGDRVIVKVVNHV  86

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             + NV+IHWHGVRQLRSGWADGPAY+ QCPIQTG SYVYNFTI  QRGTLFWHAHISWLRA
Sbjct  87    QSNVSIHWHGVRQLRSGWADGPAYVAQCPIQTGHSYVYNFTIVAQRGTLFWHAHISWLRA  146

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPI+ILPK+GV YPF +P+KEVP+IFGEWW ADTE +I+QA QTGG PN+SDA+TIN
Sbjct  147   TLYGPIIILPKRGVPYPFAKPYKEVPMIFGEWWNADTEAVINQALQTGGGPNVSDAYTIN  206

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+FKL+VK G+TYLLR+INAALNDELFFSIANH+LT+VE DAVYVKPF
Sbjct  207   GLPGPLYNCSAKDTFKLRVKPGRTYLLRIINAALNDELFFSIANHTLTIVEVDAVYVKPF  266

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs---tns  1064
             +TN ++ITPGQTTNVLL T    P AT+L+ ARPYATG   FDNSTTAGILEY     +S
Sbjct  267   DTNTLIITPGQTTNVLLHTKPTFPGATFLMLARPYATGQGTFDNSTTAGILEYQHSNASS  326

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
             + + + KLPLF P+LP  NDT F  +FT+KLRSLA   +PA VP+ +DRRFFFTVGLG  
Sbjct  327   SPSFSKKLPLFKPSLPSLNDTKFVADFTRKLRSLATTQYPAKVPQTIDRRFFFTVGLGTS  386

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PCP+NQTCQGP N TKFAA+VNN+SF  PTTALLQAHFF QSKGVYT DFP  P +  NY
Sbjct  387   PCPKNQTCQGP-NGTKFAATVNNVSFSMPTTALLQAHFFGQSKGVYTPDFPIIPLMPLNY  445

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG PP N +V++ T++V L FN+SVELVMQDTSI+G ESHPLHLHGFNFFV+GQGFGN+D
Sbjct  446   TGAPPNNTLVSNGTRLVVLPFNTSVELVMQDTSILGNESHPLHLHGFNFFVVGQGFGNHD  505

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             P KDP+KFNLVDP ERNTV VP GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+
Sbjct  506   PEKDPAKFNLVDPVERNTVSVPPGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVL  565

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DG    QKL PPP+DLPKC
Sbjct  566   DGNLPNQKLPPPPSDLPKC  584



>ref|XP_002271047.2| PREDICTED: laccase-17 [Vitis vinifera]
Length=611

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/560 (74%), Positives = 480/560 (86%), Gaps = 4/560 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++ALAK AGITR YKFDIK+  +TRLC TK ++TVNG+FPGP +  REGD ++V+VVNHV
Sbjct  52    ELALAKDAGITRRYKFDIKLVRMTRLCHTKGVITVNGKFPGPLVTVREGDNLLVEVVNHV  111

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             + N++IHWHG+RQLRSGWADGPAYITQCPI+TGQ Y+YNFT++GQRGTLFWHAHISW+RA
Sbjct  112   QNNISIHWHGIRQLRSGWADGPAYITQCPIRTGQRYMYNFTVSGQRGTLFWHAHISWIRA  171

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             T++GP++ILPK  V YPF  P+KEVPIIFGEWW  D E +ISQA QTG  PN+SDA+TIN
Sbjct  172   TVHGPLIILPKPNVPYPFGNPYKEVPIIFGEWWNVDPEAVISQALQTGAGPNVSDAYTIN  231

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+FKLKVK  KTYLLRLINAA++DELFFSIANH++TVVE DAVYVKPF
Sbjct  232   GLPGPLYNCSAKDTFKLKVKPAKTYLLRLINAAVDDELFFSIANHTITVVEVDAVYVKPF  291

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstns---  1064
             +T+ +LITPGQTTNVLLKT  + P A + + ARPYATG   FDNST AGILEY  ++   
Sbjct  292   DTDTLLITPGQTTNVLLKTKPYFPKANFFMYARPYATGQGTFDNSTVAGILEYELSNFSP  351

Query  1065  -nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGV  1241
              N T+T  LP F P LP FNDTSFA+NF++K+RSLA+A FPA VP+KV+RRFFFTVGLG 
Sbjct  352   FNSTSTKNLPFFKPALPPFNDTSFASNFSRKIRSLASAQFPAKVPQKVERRFFFTVGLGT  411

Query  1242  IPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFN  1421
              PCP+NQTCQGP N TKF+AS+NN+SFV PTTA+LQA+FF QS GVYT DFP NP   FN
Sbjct  412   NPCPRNQTCQGPNNRTKFSASINNVSFVLPTTAILQAYFFGQSNGVYTTDFPNNPITPFN  471

Query  1422  YTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNY  1601
             YTGNPP N MV++ TK V L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNY
Sbjct  472   YTGNPPNNTMVSNGTKAVVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNY  531

Query  1602  DPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIV  1781
             DPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKM WIV
Sbjct  532   DPNKDPAKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWIV  591

Query  1782  MDGKGRKQKLQPPPADLPKC  1841
             ++GK   QKL PPP+DLP C
Sbjct  592   LEGKLPNQKLPPPPSDLPTC  611



>ref|XP_008384938.1| PREDICTED: laccase-2-like [Malus domestica]
Length=585

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/582 (74%), Positives = 484/582 (83%), Gaps = 6/582 (1%)
 Frame = +3

Query  111   VCLFAKRFIIFVLA--AFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             + L A   + F+LA  + C  S + A+A   G+TR YKFDI+++NVTRLC TKSIVTVNG
Sbjct  5     IPLSATFLVAFLLALISLC-ASPEFAIAAAGGVTRQYKFDIELKNVTRLCTTKSIVTVNG  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDRV+VKVVNHV  N+T+HWHG+RQL+SGWADGP+Y+TQCPIQT Q+YV
Sbjct  64    KFPGPRIIAREGDRVLVKVVNHVPNNITLHWHGIRQLQSGWADGPSYVTQCPIQTNQNYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTI GQRGTLFWHAHISWLRAT+YGP++ILPK+   YPFP+P KEVPIIFGEWW  D 
Sbjct  124   YNFTIIGQRGTLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPIIFGEWWNVDX  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +ISQA QTG  PN+SDA+TINGLPGPLYNCS KD+F+LKVK GKTYLLRLI+AALNDE
Sbjct  184   EXVISQALQTGNGPNVSDAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLISAALNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANHS+TVVEADAVYVKPF TNI+LITPGQTTNVLLK   H+PNAT+L+ ARPY T
Sbjct  244   LFFSIANHSITVVEADAVYVKPFKTNILLITPGQTTNVLLKAKPHYPNATFLMLARPYFT  303

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkL---PLFTPTLPVFNDTSFATNFTKKLRSLANA  1175
             G   FDNST AGILEY   SN +++  L   PLF P LP  N TSF  NFT KLRSLAN+
Sbjct  304   GRGTFDNSTVAGILEYKKPSNSSSSTSLKSHPLFRPILPQINATSFVANFTSKLRSLANS  363

Query  1176  NFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH  1355
              FPANVPK V+RRFFFTVGLG  PCP+NQTCQGPTN TKFAAS+NNISF  P+ A+LQ+H
Sbjct  364   RFPANVPKTVERRFFFTVGLGTNPCPKNQTCQGPTNTTKFAASMNNISFALPSXAMLQSH  423

Query  1356  FFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGA  1535
             FF QS  VY+ DFP  PP  FNYTG PP N  V++ TKVV L FN+SVELVMQ TSI+GA
Sbjct  424   FFAQSNSVYSTDFPIIPPKPFNYTGTPPNNTNVSNGTKVVVLKFNTSVELVMQGTSILGA  483

Query  1536  ESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             ESHPLHLHGFNFFV+GQGFGN+DPN DPS FNLVDP ERNTVGVPSGGWVAIRFLADNPG
Sbjct  484   ESHPLHLHGFNFFVVGQGFGNFDPNNDPSNFNLVDPVERNTVGVPSGGWVAIRFLADNPG  543

Query  1716  AWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              W MHCH +VH SWGL+MAW+V DGK   QKL PPP+DLPKC
Sbjct  544   VWLMHCHFDVHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  585



>ref|XP_009354529.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=583

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/576 (74%), Positives = 479/576 (83%), Gaps = 10/576 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +  L   C +   V     A ITRHYKFDIK QNVTRLC TKSIVTVNG+FPGP+I+
Sbjct  13    RLFLLSLITLCLIPQHV----FASITRHYKFDIKQQNVTRLCHTKSIVTVNGQFPGPQIV  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRV++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQ+G SYVYNFTITGQ
Sbjct  69    AREGDRVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQSGNSYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK GV YPF +P+KEVPIIFGEWW AD E +ISQA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPLIILPKHGVPYPFAKPYKEVPIIFGEWWNADPEAVISQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+S+A+T NGLPGPLYNCSAKD+FKLKV++GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSNAYTFNGLPGPLYNCSAKDAFKLKVQSGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADA+YVKPF+T+ VLI PGQTTNVLLKT  H P+AT+ ++ARPY TG   FDNS
Sbjct  249   TLKVVEADAIYVKPFDTDTVLIAPGQTTNVLLKTKPHFPSATFFMTARPYVTGLGTFDNS  308

Query  1029  TTAGILEYstnsnktt----tnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             T AG LEY + S          KLPLF P LP  NDTSFAT F+ KLRSLANA FPANVP
Sbjct  309   TVAGFLEYESTSKALHTKLPMKKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPANVP  368

Query  1197  KKVDRRFFFTVGLGVIPCPQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             +KVDR FFFT+GLG  PC   NQTCQGP N T FAASVNN+SF  PTTALLQAHF  QS 
Sbjct  369   QKVDRHFFFTIGLGTSPCSSNNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFSGQSN  427

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVY+ DFP +P + FNYTG PP + MV   TK++ L +N+SVE+VMQDTSI+GAESHPLH
Sbjct  428   GVYSPDFPISPIIPFNYTGTPPNDTMVGDGTKLMVLPYNTSVEVVMQDTSILGAESHPLH  487

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+D NKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHC
Sbjct  488   LHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  547

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLE+HTSWGLKMAW+V+DGK   QKL PPPADLP C
Sbjct  548   HLEIHTSWGLKMAWLVLDGKLPNQKLLPPPADLPTC  583



>ref|XP_008785574.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=584

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/559 (75%), Positives = 484/559 (87%), Gaps = 4/559 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             D   A+  GITRHY+FDI+M NVTRLC TKSIVTVNG+FPGP+I+AREGDRVVVKVVNHV
Sbjct  27    DGVRAQQTGITRHYRFDIRMANVTRLCHTKSIVTVNGQFPGPKIVAREGDRVVVKVVNHV  86

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             +YNVT+HWHGVRQLRSGWADGPAY+TQCPI+ GQSYVYNFTI  QRGTLFWHAHISWLRA
Sbjct  87    QYNVTLHWHGVRQLRSGWADGPAYVTQCPIRRGQSYVYNFTIVAQRGTLFWHAHISWLRA  146

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPI+ILP +GV YPF +P+KEVPI+FGEWW ADTE +ISQA QTGG PN+SDA+TIN
Sbjct  147   TLYGPIIILPARGVPYPFSKPYKEVPIVFGEWWNADTEAVISQALQTGGGPNVSDAYTIN  206

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LT+V+ DAVYVKPF
Sbjct  207   GLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTIVDVDAVYVKPF  266

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY---stns  1064
             +T+ ++I PGQTTNVLL++    P+AT+L++ARPYATG   FDNST AG LEY    T+S
Sbjct  267   DTDTLIIAPGQTTNVLLRSKPSFPHATFLMAARPYATGSGTFDNSTVAGFLEYQDPKTSS  326

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
               +   KLPLF P+LP  NDT+F  NFT +LRSLA A FPA VP+ V+R+FFFTVGLG  
Sbjct  327   TASFDKKLPLFKPSLPSLNDTAFVANFTSRLRSLATAQFPAKVPRTVERQFFFTVGLGTS  386

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PCP+NQTCQGP N TKFAA+V+NISF  PTTALLQAHFF QSK VY+ DFP +P + FNY
Sbjct  387   PCPKNQTCQGP-NGTKFAATVSNISFAMPTTALLQAHFFGQSKRVYSPDFPYSPLIPFNY  445

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG+PP N +V++ TK++ L +N++VELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNY+
Sbjct  446   TGSPPNNTLVSNGTKLMVLPYNTTVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYN  505

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             P KDP++FNLVDP ERNTVGVP+GGWVAIRF ADNPG WFMHCHLEVHTSWGLKMAW+V+
Sbjct  506   PAKDPARFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWLVL  565

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DG    QKL PPP+DLP+C
Sbjct  566   DGSLPNQKLPPPPSDLPRC  584



>ref|XP_007207546.1| hypothetical protein PRUPE_ppa017421mg [Prunus persica]
 gb|EMJ08745.1| hypothetical protein PRUPE_ppa017421mg [Prunus persica]
Length=581

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/552 (76%), Positives = 476/552 (86%), Gaps = 4/552 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITRHYKFDIK+QNVTRLCQTKSIVTVNG+FPGPRI+AREGD++++KV+NHV+ N+++H
Sbjct  31    ASITRHYKFDIKLQNVTRLCQTKSIVTVNGQFPGPRIVAREGDQLLIKVINHVQNNISVH  90

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLR+GWADGPAY+TQCPIQTG SYVYNFTI GQRGTL+WHAHISWLR+T+YGP++
Sbjct  91    WHGIRQLRTGWADGPAYVTQCPIQTGHSYVYNFTIVGQRGTLWWHAHISWLRSTVYGPLI  150

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK GV YPF +P+K VPIIFGEWW AD E +ISQA QTGG PN+SDA+T+NGLPGPLY
Sbjct  151   ILPKLGVPYPFTKPYKAVPIIFGEWWNADPEAVISQALQTGGGPNVSDAYTLNGLPGPLY  210

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKV+AGKTYLLRLINAALNDELFFSIANH+L VVEADAVYVKPF T+ +LI
Sbjct  211   NCSAKDAFKLKVEAGKTYLLRLINAALNDELFFSIANHTLKVVEADAVYVKPFETHTILI  270

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGIL--EYstnsnktttnkL  1088
              PGQTTNVLLKT    PNAT+ ++ARPY TG   FDNST AGIL  E+  N+      KL
Sbjct  271   APGQTTNVLLKTKPSFPNATFFLTARPYVTGLGTFDNSTVAGILVYEFPPNTKTLKMKKL  330

Query  1089  PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQ-NQT  1265
             PLF P LP  NDTSFAT F  KLRSL NA FPANVP+KVD+ FFFTVGLG  PC Q N+T
Sbjct  331   PLFKPNLPALNDTSFATKFNDKLRSLNNARFPANVPQKVDKHFFFTVGLGTNPCSQHNRT  390

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T FAAS+NNISF  P TALLQ+HF +QS GVYT DFP NP + FNYTG PP +
Sbjct  391   CQGP-NGTMFAASINNISFAMPNTALLQSHFSSQSNGVYTPDFPTNPIIPFNYTGAPPND  449

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ TK+V L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D NKDP+K
Sbjct  450   TMVSNGTKLVVLQFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKDPAK  509

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWGLKMAW+V+DGK   Q
Sbjct  510   FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLPNQ  569

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  570   KLLPPPADLPKC  581



>ref|XP_004302730.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=591

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/577 (76%), Positives = 503/577 (87%), Gaps = 9/577 (2%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             + F + AF  V  ++A+ KHAG+TRHYKF+I  Q+VTRLC+TKSI+TVNG+FPGPRI+AR
Sbjct  16    VFFSVCAFFCVLPELAVGKHAGVTRHYKFNIMSQSVTRLCKTKSIITVNGQFPGPRIVAR  75

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+V+KVVNHV+ NVT+HWHG+RQLRSGWADGP+YITQCPIQTGQSYVYNFTITGQRG
Sbjct  76    EGDRLVIKVVNHVQNNVTLHWHGIRQLRSGWADGPSYITQCPIQTGQSYVYNFTITGQRG  135

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TL+WHAHISWLRATLYGPIVILPKK V YPFPQPFKEVPIIFGEWWKADTE +I+QA QT
Sbjct  136   TLWWHAHISWLRATLYGPIVILPKKHVPYPFPQPFKEVPIIFGEWWKADTETVINQAIQT  195

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G  PN+SDA+TINGLPGPLYNCSAKD++KLKVK GKTYLLRLINAALN+ELFFSIANH+ 
Sbjct  196   GSGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNNELFFSIANHTF  255

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVEADAVYVKPF+T +VLITPGQTTNV+L+T    PNAT++++ARPY +GPA FDN+TT
Sbjct  256   TVVEADAVYVKPFSTKVVLITPGQTTNVILRTKPKSPNATFVMAARPYVSGPAAFDNTTT  315

Query  1035  AGILEYstnsnk-------tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP-AN  1190
             +G+LEY T+ +            KL L TP LP  NDT F+ N+ KK+RSLAN  FP AN
Sbjct  316   SGLLEYETSVSSNHNKNKNKRKKKLLLLTPVLPKLNDTMFSMNYNKKIRSLANPKFPSAN  375

Query  1191  VPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQS  1370
             VPK VD+ FFFTVGLG+ PC +NQ C GP NNT+ AA++NN+SFVQP+TALLQAHFFN++
Sbjct  376   VPKTVDKNFFFTVGLGLSPCSKNQNCPGP-NNTRVAAAINNVSFVQPSTALLQAHFFNKT  434

Query  1371  KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPL  1550
             KGVYT DFPANP VKFNYTG PP+NI V++ TKVV L FN+ VELV+QDTSIIGAESHPL
Sbjct  435   KGVYTTDFPANPLVKFNYTGTPPSNIAVSTGTKVVVLPFNTRVELVLQDTSIIGAESHPL  494

Query  1551  HLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMH  1730
             HLHGFNFFV+G GFGN+DP  DP K+NLVDPAERNT+GVPSGGWVA+RFLADNPG WFMH
Sbjct  495   HLHGFNFFVVGFGFGNFDPKNDPKKYNLVDPAERNTIGVPSGGWVALRFLADNPGVWFMH  554

Query  1731  CHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             CHLEVHTSWGLKMAW+VMDGKGR QKL PPP+DLPKC
Sbjct  555   CHLEVHTSWGLKMAWVVMDGKGRHQKLPPPPSDLPKC  591



>ref|XP_008463808.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Cucumis melo]
Length=578

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/572 (73%), Positives = 476/572 (83%), Gaps = 4/572 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             +IF    F   S  +      G TRHY F+IKMQNVTRLC TKSIVTVNG+FPGPRI+AR
Sbjct  8     LIFFFFCFVLYSCVIPKLVFGGTTRHYNFEIKMQNVTRLCHTKSIVTVNGKFPGPRIVAR  67

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+++KVVNHV  N++IHWHG+RQLRSGWADGPAYITQCPIQ+GQSYVYN+TI GQRG
Sbjct  68    EGDRLLIKVVNHVPNNISIHWHGIRQLRSGWADGPAYITQCPIQSGQSYVYNYTIIGQRG  127

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+ILPK GV YPFP+P KE+PIIFGEWW  DTE +ISQA QT
Sbjct  128   TLFWHAHISWLRSTLYGPIIILPKLGVPYPFPKPHKEMPIIFGEWWNVDTEAVISQALQT  187

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+T+NGLPGP YNCSAKD+ KLKVK GKTYLLRLINAALNDELFFSIANHSL
Sbjct  188   GGGPNVSDAYTMNGLPGPFYNCSAKDTLKLKVKPGKTYLLRLINAALNDELFFSIANHSL  247

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             T+V+ DAVY+KP  TN ++I PGQT+NVLL+T ++ PNA + + ARPY TG   FDNST 
Sbjct  248   TIVDVDAVYIKPLKTNTLIIAPGQTSNVLLQTKSNFPNAKFYMLARPYVTGQGTFDNSTV  307

Query  1035  AGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             AGILEY  +  K     LP++ P LP  NDTSF TNFTKKLRSLAN+ FPANVP+K+D++
Sbjct  308   AGILEYDGHQQKNPKKTLPIYKPNLPSLNDTSFVTNFTKKLRSLANSQFPANVPQKIDKK  367

Query  1215  FFFTVGLGVIPC---PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             FFFTVGLG  PC    +NQTCQGP N T FAAS+NN+SFV P  ALLQ+H+  QS GVY+
Sbjct  368   FFFTVGLGTNPCNNNKKNQTCQGP-NGTMFAASINNVSFVMPNVALLQSHYKGQSNGVYS  426

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
               FP +P + FNYTGNPP N MV + TKVV L FN+SVEL+MQDTSI+GAESHPLHLHGF
Sbjct  427   PFFPNSPLIPFNYTGNPPNNTMVGNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGF  486

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+GQGFGN+DPNKDP  FNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEV
Sbjct  487   NFFVVGQGFGNFDPNKDPQNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEV  546

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  547   HTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  578



>emb|CBI30527.3| unnamed protein product [Vitis vinifera]
Length=586

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/560 (74%), Positives = 480/560 (86%), Gaps = 4/560 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++ALAK AGITR YKFDIK+  +TRLC TK ++TVNG+FPGP +  REGD ++V+VVNHV
Sbjct  27    ELALAKDAGITRRYKFDIKLVRMTRLCHTKGVITVNGKFPGPLVTVREGDNLLVEVVNHV  86

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             + N++IHWHG+RQLRSGWADGPAYITQCPI+TGQ Y+YNFT++GQRGTLFWHAHISW+RA
Sbjct  87    QNNISIHWHGIRQLRSGWADGPAYITQCPIRTGQRYMYNFTVSGQRGTLFWHAHISWIRA  146

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             T++GP++ILPK  V YPF  P+KEVPIIFGEWW  D E +ISQA QTG  PN+SDA+TIN
Sbjct  147   TVHGPLIILPKPNVPYPFGNPYKEVPIIFGEWWNVDPEAVISQALQTGAGPNVSDAYTIN  206

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+FKLKVK  KTYLLRLINAA++DELFFSIANH++TVVE DAVYVKPF
Sbjct  207   GLPGPLYNCSAKDTFKLKVKPAKTYLLRLINAAVDDELFFSIANHTITVVEVDAVYVKPF  266

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstns---  1064
             +T+ +LITPGQTTNVLLKT  + P A + + ARPYATG   FDNST AGILEY  ++   
Sbjct  267   DTDTLLITPGQTTNVLLKTKPYFPKANFFMYARPYATGQGTFDNSTVAGILEYELSNFSP  326

Query  1065  -nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGV  1241
              N T+T  LP F P LP FNDTSFA+NF++K+RSLA+A FPA VP+KV+RRFFFTVGLG 
Sbjct  327   FNSTSTKNLPFFKPALPPFNDTSFASNFSRKIRSLASAQFPAKVPQKVERRFFFTVGLGT  386

Query  1242  IPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFN  1421
              PCP+NQTCQGP N TKF+AS+NN+SFV PTTA+LQA+FF QS GVYT DFP NP   FN
Sbjct  387   NPCPRNQTCQGPNNRTKFSASINNVSFVLPTTAILQAYFFGQSNGVYTTDFPNNPITPFN  446

Query  1422  YTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNY  1601
             YTGNPP N MV++ TK V L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNY
Sbjct  447   YTGNPPNNTMVSNGTKAVVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNY  506

Query  1602  DPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIV  1781
             DPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKM WIV
Sbjct  507   DPNKDPAKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWIV  566

Query  1782  MDGKGRKQKLQPPPADLPKC  1841
             ++GK   QKL PPP+DLP C
Sbjct  567   LEGKLPNQKLPPPPSDLPTC  586



>emb|CAN72263.1| hypothetical protein VITISV_037366 [Vitis vinifera]
Length=574

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/573 (76%), Positives = 482/573 (84%), Gaps = 16/573 (3%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             + F++    W+  +  LA  AGITRHYKF+IK+QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  14    VXFIVLNTLWLFPE--LASSAGITRHYKFNIKLQNVTRLCHTKSIVSVNGQFPGPHIIAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVVKVVNHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  72    EGDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+ILPKK V YPF +P+KEVPIIFGEWW AD E +I+QA Q 
Sbjct  132   TLFWHAHISWLRSTLYGPIIILPKKNVPYPFFKPYKEVPIIFGEWWNADPEAVITQALQN  191

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  192   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  251

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++A PYATG   FDNST 
Sbjct  252   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAAXPYATGRGTFDNSTV  311

Query  1035  AGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGIL Y     ++ + ++   LPLF PTLP  NDTSFA NFT KLRSLAN  FPANVP+K
Sbjct  312   AGILHYEPPPKSSXSASSFKNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQK  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFT          NQTCQGPTN T F+ASVNN+SFV PTTA+LQAHFF QSKGVY
Sbjct  372   VDQRFFFT----------NQTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVY  421

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             T DFP  P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI+G ESHPLHLHG
Sbjct  422   TTDFPTTPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHG  481

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+D  KD  KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE
Sbjct  482   FNFFVVGQGFGNFDSKKDSPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  541

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGLKMAWIVMDGK   QKL PPP+DLPKC
Sbjct  542   VHTSWGLKMAWIVMDGKLPNQKLPPPPSDLPKC  574



>ref|XP_009416147.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/578 (73%), Positives = 481/578 (83%), Gaps = 6/578 (1%)
 Frame = +3

Query  117   LFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPG  296
             L  K F++  +A       D A+A   GITRHYKFDI+M N TRLC TKSIVTVNG+FPG
Sbjct  8     LLVKAFLLSCIALLAL--SDAAVAPPTGITRHYKFDIQMANATRLCHTKSIVTVNGQFPG  65

Query  297   PRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT  476
             P+I+AREGDRVVVKVVNHV++NVT+HWHG+RQLRSGWADGPAY+TQCPIQTG SYVYNFT
Sbjct  66    PKIVAREGDRVVVKVVNHVEHNVTLHWHGIRQLRSGWADGPAYVTQCPIQTGHSYVYNFT  125

Query  477   ITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERII  656
             I GQRGT FWHAHISWLRATLYGPIV+LP+ GV YPF +P+KEVP+I GEWWKAD E +I
Sbjct  126   IVGQRGTFFWHAHISWLRATLYGPIVVLPQLGVPYPFAKPYKEVPVILGEWWKADAEAVI  185

Query  657   SQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFS  836
             SQA +TGG PN+SDA+TINGLPGP YNCSAKD+FKLKVK G TYLLRLINAALNDELFF 
Sbjct  186   SQALETGGGPNVSDAYTINGLPGPFYNCSAKDTFKLKVKPGTTYLLRLINAALNDELFFG  245

Query  837   IANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAP  1016
             IANH+LTVV+ DAVYVKPF ++ +LI+PGQTT+VLL+    +PNA + +SA PY TG   
Sbjct  246   IANHTLTVVDVDAVYVKPFESDALLISPGQTTDVLLRAKPDYPNAMFFMSASPYVTGSGT  305

Query  1017  FDNSTTAGILEYs---tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPA  1187
             FDNST AG+LEY    ++S  +  +KLPL+ PTLP  NDTSF  NFT KLRSLA A FPA
Sbjct  306   FDNSTVAGVLEYRNPNSSSRASFNSKLPLYKPTLPSLNDTSFFANFTGKLRSLATARFPA  365

Query  1188  NVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQ  1367
             NVP+ VDRR FFTVGLG  PCP+NQ CQGP N TKF+A+VNN+SF  PTTALLQAHF  Q
Sbjct  366   NVPQAVDRRVFFTVGLGSSPCPENQMCQGP-NGTKFSATVNNVSFALPTTALLQAHFLGQ  424

Query  1368  SKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP  1547
             S+GVY  DFP  P + FNYTG PP N +V + TK++ L FN+SVELVMQDTSI+GAESHP
Sbjct  425   SRGVYMPDFPVTPLMPFNYTGTPPNNTLVGNGTKLMVLPFNTSVELVMQDTSILGAESHP  484

Query  1548  LHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  1727
             LHLHGFNFFV+GQGFGNYDP KDP+KFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFM
Sbjct  485   LHLHGFNFFVVGQGFGNYDPAKDPTKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFM  544

Query  1728  HCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HCHLEVHTSWGLKMAW+V+DG    QKL PPP+DLPKC
Sbjct  545   HCHLEVHTSWGLKMAWLVLDGSLPHQKLPPPPSDLPKC  582



>ref|XP_008778964.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=584

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/559 (75%), Positives = 483/559 (86%), Gaps = 4/559 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             D   A+  GITRHY+FDI+M NVTRLC TKSIVTVNG+FPGP+I+AREGDRVVVKVVNHV
Sbjct  27    DGVRAQQTGITRHYRFDIRMANVTRLCHTKSIVTVNGQFPGPKIVAREGDRVVVKVVNHV  86

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             +YNVT+HWHGVRQLRSGWADGPAY+TQCPI+ GQSYVYNFTI  QRGTLFWHAHISWLRA
Sbjct  87    QYNVTLHWHGVRQLRSGWADGPAYVTQCPIRRGQSYVYNFTIVAQRGTLFWHAHISWLRA  146

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPI+ILP +GV YPF +P+KEVPI+FGEWW ADTE +ISQA QTGG PN+SDA+TIN
Sbjct  147   TLYGPIIILPARGVPYPFSKPYKEVPIVFGEWWNADTEAVISQALQTGGGPNVSDAYTIN  206

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LT+V+ DAVYVKPF
Sbjct  207   GLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTIVDVDAVYVKPF  266

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY---stns  1064
             +T+ ++I PGQTTNVLL++    P+AT+L++ARPYATG   FDNST AG LEY    T+S
Sbjct  267   DTDTLIIAPGQTTNVLLRSKPSFPHATFLMAARPYATGSGTFDNSTVAGFLEYQDPKTSS  326

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
               +   KLPLF P+LP  NDT+F  NFT +LRSLA A FPA VP+ V+R+FFFTVGLG  
Sbjct  327   TASFDKKLPLFKPSLPSLNDTAFVANFTSRLRSLATAQFPAKVPRTVERQFFFTVGLGTS  386

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PCP+NQTCQGP N TKFAA+V+NISF  PTTALLQAHFF QSK VY+ DFP +P + FNY
Sbjct  387   PCPKNQTCQGP-NGTKFAATVSNISFAMPTTALLQAHFFGQSKRVYSPDFPYSPLIPFNY  445

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG+PP N +V++ TK++ L +N++VELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNY+
Sbjct  446   TGSPPNNTLVSNGTKLMVLPYNTTVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYN  505

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             P KDP++FNLVDP ERNTVGVP+GGWVAIRF ADNPG WFMHCHLEVHTSWGLKMAW+V+
Sbjct  506   PAKDPARFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHTSWGLKMAWLVL  565

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DG    QKL PPP+DLP C
Sbjct  566   DGSLPNQKLPPPPSDLPNC  584



>gb|KHN07178.1| Laccase-17, partial [Glycine soja]
Length=541

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/542 (78%), Positives = 468/542 (86%), Gaps = 4/542 (1%)
 Frame = +3

Query  225   IKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSG  404
             +++QNVTRLCQTKSIVT+NGRFPGPR+IAREGDR+V+KV N+V YNVTIHWHGVRQLRS 
Sbjct  1     VQLQNVTRLCQTKSIVTINGRFPGPRVIAREGDRLVIKVTNNVPYNVTIHWHGVRQLRSA  60

Query  405   WADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYP  584
             WADGPAY+TQCPIQTGQ++VYNFT+TGQRGTL+WHAHISWLR TLYGPIVILPKK V YP
Sbjct  61    WADGPAYVTQCPIQTGQTFVYNFTVTGQRGTLWWHAHISWLRTTLYGPIVILPKKHVPYP  120

Query  585   FPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKL  764
             FPQ FKEVPIIFGEWWKADTE +I+QA QTG APN+SDA+TING PG LYN + KD+FKL
Sbjct  121   FPQTFKEVPIIFGEWWKADTETVINQAMQTGLAPNLSDAYTINGFPGFLYNGTTKDTFKL  180

Query  765   KVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLL  944
             KVKAGKTYLLRLINAALN+ELFF IANH+LTVVEADAVYVKPF TN VLITPGQT NVLL
Sbjct  181   KVKAGKTYLLRLINAALNNELFFGIANHTLTVVEADAVYVKPFRTNYVLITPGQTINVLL  240

Query  945   KTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttn---kLPLFTPTLPV  1115
             KT +  PNA ++I+ARPYATGPA FDN+T  G+LEY  +S   T     KL L  P LP 
Sbjct  241   KTKSKAPNAAFVIAARPYATGPAAFDNTTATGLLEYKKSSVSNTKTKNKKLRLLRPVLPK  300

Query  1116  FNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKF  1295
             FNDT FA  F KK+RSLANA FPA VPK VD+ FFFTVGLG+  CP+NQ CQGP NNT+ 
Sbjct  301   FNDTVFAMKFNKKVRSLANARFPAKVPKTVDKHFFFTVGLGISSCPKNQACQGP-NNTRV  359

Query  1296  AASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVV  1475
              A+VNN+SFV P  ALLQAHFFN+SKGVYT DFPANPP +FNYTG PP NIM++S TK V
Sbjct  360   TAAVNNVSFVMPNIALLQAHFFNKSKGVYTTDFPANPPFRFNYTGTPPNNIMISSGTKAV  419

Query  1476  QLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERN  1655
              L FN+SVEL++QDTSIIGAESHPLHLHGFNFFV+GQG GN+DP KDPSKFNLVDPAERN
Sbjct  420   VLPFNASVELILQDTSIIGAESHPLHLHGFNFFVVGQGNGNFDPKKDPSKFNLVDPAERN  479

Query  1656  TVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLP  1835
             T+GVPSGGWVA+RF ADNPG WFMHCHLEVHTSWGLKMAWIV DGK   QKL PPP+DLP
Sbjct  480   TIGVPSGGWVAVRFFADNPGVWFMHCHLEVHTSWGLKMAWIVQDGKLHHQKLPPPPSDLP  539

Query  1836  KC  1841
             KC
Sbjct  540   KC  541



>ref|XP_008358049.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/576 (73%), Positives = 478/576 (83%), Gaps = 10/576 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +F L   C +         A ITRHYKFDIK QNVTRLC TKSIVTVNG+FPGPRI+
Sbjct  13    RLFLFSLITLCLIPQHAL----ASITRHYKFDIKHQNVTRLCHTKSIVTVNGQFPGPRIV  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGD V++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQ G +YVYNFTITGQ
Sbjct  69    AREGDHVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQKGNNYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK+GV YPF +P+KEVPIIFGEWW  DTE IISQA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEVPIIFGEWWNVDTEAIISQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+S+A+TINGLPGPLYNCS KD+FKLKV++GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSNAYTINGLPGPLYNCSVKDTFKLKVQSGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADA+YVKPF TN +LI PGQTTNVLLKT  + PNAT+ ++ARPYATG   FDNS
Sbjct  249   TLKVVEADAIYVKPFETNTILIAPGQTTNVLLKTKANFPNATFFMTARPYATGLGTFDNS  308

Query  1029  TTAGILEYstnsnktttn----kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             T A ILEY + S    +     KLPLF P +P  NDTSFAT F+ KLRSLANA FPANVP
Sbjct  309   TVAAILEYESPSKTLHSTLPMKKLPLFKPFMPALNDTSFATKFSNKLRSLANAQFPANVP  368

Query  1197  KKVDRRFFFTVGLGVIPCP-QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             +KVD+ FFFT+GLG  PC   NQTCQGP N T FAASVNN+SF  PTTALLQAHF  QS 
Sbjct  369   QKVDKHFFFTIGLGTNPCSNSNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFTGQSN  427

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVY+  FP++P + FNYTG PP N MV + TK++ L FN+SVELV QDTSI+G ESHPLH
Sbjct  428   GVYSPYFPSSPLIPFNYTGTPPNNTMVGNGTKLMVLPFNTSVELVXQDTSILGVESHPLH  487

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+D NKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHC
Sbjct  488   LHGFNFFVVGQGFGNFDRNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHC  547

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLE+HTSWGLKMAW+V+DGK   QKL PPPADLP C
Sbjct  548   HLEIHTSWGLKMAWLVLDGKLPNQKLLPPPADLPTC  583



>ref|XP_004148786.1| PREDICTED: laccase-17-like [Cucumis sativus]
 ref|XP_004165834.1| PREDICTED: laccase-17-like [Cucumis sativus]
 gb|KGN64741.1| hypothetical protein Csa_1G085370 [Cucumis sativus]
Length=579

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/568 (73%), Positives = 475/568 (84%), Gaps = 7/568 (1%)
 Frame = +3

Query  156   FCWVSGDVALAK---HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDR  326
             FC+V     + K       TRHY F+IKMQNVTRLC TKSIVTVNG+FPGPRI+AREGDR
Sbjct  13    FCFVLYSCVVPKLVFGGTTTRHYNFEIKMQNVTRLCHTKSIVTVNGKFPGPRIVAREGDR  72

Query  327   vvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFW  506
             +++KVVN+V  N++IHWHG+RQLRSGWADGPAYITQCPIQ+GQSYVYN+TI GQRGTLFW
Sbjct  73    LLIKVVNNVPNNISIHWHGIRQLRSGWADGPAYITQCPIQSGQSYVYNYTIIGQRGTLFW  132

Query  507   HAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAP  686
             HAHISWLR+TLYGPI+ILPK GV YPFP+P KE+PIIFGEWW  DTE +ISQA QTGG P
Sbjct  133   HAHISWLRSTLYGPIIILPKLGVPYPFPKPHKEMPIIFGEWWNVDTEAVISQALQTGGGP  192

Query  687   NISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVE  866
             N+SDA+T+NGLPGP YNCS KD+ KLKVK GKTYLLRLINAALNDELFFSIANHSLT+V+
Sbjct  193   NVSDAYTMNGLPGPFYNCSTKDTLKLKVKPGKTYLLRLINAALNDELFFSIANHSLTIVD  252

Query  867   ADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGIL  1046
              DAVY+KPF TN ++I PGQT+NVLL+T ++ PNA + + ARPY TG   FDNST AGIL
Sbjct  253   VDAVYIKPFKTNTLIIAPGQTSNVLLQTKSNFPNAKFYMLARPYVTGQGTFDNSTVAGIL  312

Query  1047  EYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFT  1226
             EY  +  K     LP++ P LP  NDTSF TNFTKKLRSLAN+ FPANVP+K+D++FFFT
Sbjct  313   EYDDHQQKNPKKTLPIYKPNLPSLNDTSFVTNFTKKLRSLANSQFPANVPQKIDKKFFFT  372

Query  1227  VGLGVIPCP---QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFP  1397
             VGLG  PC    +NQTCQGP N T FAAS+NN+SF+ P  ALLQ+H+  QS GVY+  FP
Sbjct  373   VGLGTNPCSNNKKNQTCQGP-NGTMFAASINNVSFIMPNVALLQSHYKGQSNGVYSPFFP  431

Query  1398  ANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFV  1577
              +P + FNYTGNPP N MV + TKVV L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV
Sbjct  432   NSPLIPFNYTGNPPNNTMVGNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFV  491

Query  1578  IGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSW  1757
             +GQGFGN+DPNKDP  FNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHTSW
Sbjct  492   VGQGFGNFDPNKDPQNFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSW  551

Query  1758  GLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             GLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  552   GLKMAWLVLDGKLPNQKLLPPPADLPKC  579



>ref|XP_010920540.1| PREDICTED: laccase-10-like [Elaeis guineensis]
Length=575

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/549 (75%), Positives = 470/549 (86%), Gaps = 1/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITRHYKFDI+ +NVTRLC T+SIVTVNG+FPGP+I+AREGDRV+VKV+NH+K NVTIH
Sbjct  28    ASITRHYKFDIQRKNVTRLCHTRSIVTVNGKFPGPKIVAREGDRVIVKVINHIKNNVTIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQ+++GWADGPAYITQCPIQ GQ+YVYNFTI GQRGTL WHAHISW+R TLYG I+
Sbjct  88    WHGVRQIQTGWADGPAYITQCPIQRGQTYVYNFTIVGQRGTLLWHAHISWMRVTLYGAII  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+GV YPFP+P+KE+P+IFGEW+ AD E +I+QA QTG  PN+SDA+TINGLPGPLY
Sbjct  148   ILPKRGVPYPFPKPYKEIPVIFGEWFNADPEAVIAQALQTGAGPNVSDAYTINGLPGPLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS  D+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVVE DA+Y KPFN++ +LI
Sbjct  208   NCSKVDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVEVDAIYTKPFNSDTILI  267

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             TPGQTTNVLL+T    P AT+L++ARPYATG   FDN+TTAG+LEY    +  +   LPL
Sbjct  268   TPGQTTNVLLRTKPSFPGATFLMAARPYATGLGTFDNTTTAGLLEYKYTPSTPSNKNLPL  327

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               PTLP  NDT+FA NFT KLRSLANA FPANVP+ VD+RF+FTVGLG  PCP+NQTCQG
Sbjct  328   SKPTLPSLNDTAFAANFTGKLRSLANAQFPANVPQTVDKRFYFTVGLGTSPCPKNQTCQG  387

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P N TKFAASVNNISF  P+TALLQAHF  QSKGVYT DFP+NPP  FNYTG PP N  V
Sbjct  388   P-NGTKFAASVNNISFALPSTALLQAHFLGQSKGVYTTDFPSNPPFPFNYTGTPPNNTFV  446

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
             T+ TK V L FN+SVELVMQDTSI G ESHPLHLHGFNFFV+GQGFGNYDP+KDP+KFNL
Sbjct  447   TNGTKAVVLPFNASVELVMQDTSIQGNESHPLHLHGFNFFVVGQGFGNYDPSKDPAKFNL  506

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
              DP ERNT GVP+GGWVAIRF ADNPG WFMHCHL+VHTSWGL+MAW+V DG    QKL 
Sbjct  507   ADPIERNTFGVPAGGWVAIRFQADNPGVWFMHCHLDVHTSWGLRMAWVVNDGPLPNQKLL  566

Query  1815  PPPADLPKC  1841
             PPP+DLPKC
Sbjct  567   PPPSDLPKC  575



>ref|XP_010264408.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=591

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/588 (71%), Positives = 485/588 (82%), Gaps = 16/588 (3%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGR  287
             +V   A R + F  +  C   G +  A     TRHY+F IK+QNVTRLC TKSI+T NGR
Sbjct  10    LVSTDALRLLSF--SCLCLWPGLLVFAS----TRHYEFHIKLQNVTRLCHTKSIITANGR  63

Query  288   FPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVY  467
             FPGPRI+AREGDRV++KVV+HV+ NV++HWHG+RQL+SGWADGPAY+TQCPIQTGQSYVY
Sbjct  64    FPGPRIVAREGDRVLIKVVSHVQNNVSLHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVY  123

Query  468   NFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTE  647
             NF+ITGQRGTLFWHAH+SWLR+TLYGP +ILPKK V+YPFP+P+KEVPI+FGEWW ADTE
Sbjct  124   NFSITGQRGTLFWHAHVSWLRSTLYGPFIILPKKNVSYPFPKPYKEVPIVFGEWWNADTE  183

Query  648   RIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDEL  827
              +++QA Q+GG PN+SDA+TINGLPGPLYNCS KD+FKLKV+ G+TYLLR+INA +++EL
Sbjct  184   AVVTQALQSGGGPNVSDAYTINGLPGPLYNCSTKDTFKLKVRPGRTYLLRMINALVDEEL  243

Query  828   FFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATG  1007
             FFSIANH+LTVVEADAVYVKPF+T+ +LI PGQTTNVLLK     PNAT+LI+ARPY TG
Sbjct  244   FFSIANHTLTVVEADAVYVKPFHTDRLLIAPGQTTNVLLKAKPFFPNATFLIAARPYFTG  303

Query  1008  PAPFDNSTTAGILEY----------stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKL  1157
                FDNST AGILEY          S  + K    KLPLF PTLP  NDTSF  NF+ + 
Sbjct  304   LGTFDNSTVAGILEYDDEQPSNSTVSAINRKKKKQKLPLFRPTLPPINDTSFVANFSSRF  363

Query  1158  RSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTT  1337
             RSLA   FPANVP+ VD+RFFFTVGLG  PCP+NQTCQGP N+TKF+AS+NN SF  P+T
Sbjct  364   RSLATTQFPANVPQTVDKRFFFTVGLGTSPCPKNQTCQGPNNSTKFSASINNNSFALPST  423

Query  1338  ALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQD  1517
             A+LQAH+F Q KGVYT DFPANPP  FNYTG PP N +V++ TKVV L FN+SVELV+Q 
Sbjct  424   AILQAHYFGQEKGVYTTDFPANPPFPFNYTGTPPNNTVVSNGTKVVVLPFNTSVELVLQG  483

Query  1518  TSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRF  1697
             TSI+GAESHPLHLHGFNFFV+GQG GNYDPNKDP  FNLVDP ERNT+GVPSGGWVAIRF
Sbjct  484   TSILGAESHPLHLHGFNFFVVGQGSGNYDPNKDPPNFNLVDPVERNTIGVPSGGWVAIRF  543

Query  1698  LADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LADNPGAWFMHCH E+H SWGLKM WIV+DG+   QKL PPP+DLPKC
Sbjct  544   LADNPGAWFMHCHFEIHLSWGLKMVWIVLDGELPNQKLPPPPSDLPKC  591



>ref|XP_008385213.1| PREDICTED: laccase-17-like [Malus domestica]
Length=581

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/574 (74%), Positives = 474/574 (83%), Gaps = 8/574 (1%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +F     C +         AGITRHYKF+IK+QNVTRLC TKSI+TVNG+FPGPRII
Sbjct  13    RLFLFSFITLCLIPQHAL----AGITRHYKFEIKLQNVTRLCHTKSIITVNGQFPGPRII  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGD++++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTG SYVYNFT TGQ
Sbjct  69    AREGDQLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGNSYVYNFTXTGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK+GV YPF +P+KEVPIIFGEWW AD E II QA 
Sbjct  129   RGTLFWHAHISWLRSTIYGPLIILPKRGVPYPFTKPYKEVPIIFGEWWNADPEVIIRQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKV+ GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSDAYTINGLPGPLYNCSTKDAFKLKVRPGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADAVYVKPF T  +LI PGQTTNVLLKT  + PNAT+ ++ARPY TG   FDNS
Sbjct  249   TLKVVEADAVYVKPFETRTILIAPGQTTNVLLKTKPNFPNATFFMTARPYVTGQGTFDNS  308

Query  1029  TTAGILEYs--tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             T AGILEY   + +   TT + PLF P LP  NDTSFAT F  KLRSL    FPANVP+K
Sbjct  309   TVAGILEYESPSKTKTLTTKRHPLFKPNLPALNDTSFATKFANKLRSLNTQQFPANVPQK  368

Query  1203  VDRRFFFTVGLGVIPCPQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGV  1379
             VD+ FFFT+GLG  PC Q NQTCQGP N T FAAS+NNISF  P TALLQ+HF  QS GV
Sbjct  369   VDKHFFFTIGLGTNPCSQNNQTCQGP-NGTMFAASINNISFAMPNTALLQSHFSGQSSGV  427

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             Y+ DFPANP V FNYTG PP + MV++ TK+V L FNS VELVMQDTSI+GAESHPLHLH
Sbjct  428   YSPDFPANPIVPFNYTGTPPNDTMVSNGTKLVVLPFNSRVELVMQDTSILGAESHPLHLH  487

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNFFV+GQGFGN+D NKDP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHL
Sbjct  488   GFNFFVVGQGFGNFDRNKDPKMFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  547

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             E+HTSWGLKM W+V+DG    QKL PPPADLPKC
Sbjct  548   EIHTSWGLKMGWVVLDGXLPNQKLLPPPADLPKC  581



>ref|XP_008356891.1| PREDICTED: laccase-2 [Malus domestica]
Length=584

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/578 (74%), Positives = 482/578 (83%), Gaps = 4/578 (1%)
 Frame = +3

Query  120   FAKRFII-FVLAAFCWVS-GDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFP  293
             F+  F++ F+LA    ++  + A+A    +TR YKFDIK++NVTRLC TKSIVTVNG+FP
Sbjct  7     FSPTFLVAFLLALISLLAFPEFAIAAAGSVTRLYKFDIKLKNVTRLCTTKSIVTVNGKFP  66

Query  294   GPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNF  473
             GPRIIAREGDRV+VKVVNHV  N+TIHWHG+RQL+SGWADGP+Y+TQCPIQT QSYVYNF
Sbjct  67    GPRIIAREGDRVLVKVVNHVPNNMTIHWHGIRQLQSGWADGPSYVTQCPIQTNQSYVYNF  126

Query  474   TITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERI  653
             TI GQRGTLFWHAHISWLRAT+YGP++ILPK+   YPFP+P KEVPIIFGEWW  DTE +
Sbjct  127   TIIGQRGTLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPIIFGEWWNVDTEAV  186

Query  654   ISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFF  833
             ISQA QTGG PN+S+A+TINGLPGPLYNCS KD+F LKVK GKTYLLRLINAA+NDELFF
Sbjct  187   ISQALQTGGGPNVSNAYTINGLPGPLYNCSKKDTFSLKVKPGKTYLLRLINAAVNDELFF  246

Query  834   SIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPA  1013
             SIANHSLTVVEADAVYVKPF TNI+LITPGQTTNVLLK   H+PNAT+L+ ARPY TG  
Sbjct  247   SIANHSLTVVEADAVYVKPFKTNILLITPGQTTNVLLKAKPHYPNATFLMLARPYFTGMG  306

Query  1014  PFDNSTTAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPA  1187
              FDNST AGILEY    NS+ +T+ K PLF P LP  N TSF  NFT K RSLAN+ FPA
Sbjct  307   TFDNSTVAGILEYKEHSNSSSSTSLKSPLFRPILPQINATSFVANFTSKFRSLANSKFPA  366

Query  1188  NVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQ  1367
             NVP+ V++RFFFTVGLG  PCP+NQTCQGPTN TKFAAS+NN SFV P+ ALLQ+HFF Q
Sbjct  367   NVPRTVEKRFFFTVGLGTNPCPKNQTCQGPTNTTKFAASINNNSFVLPSVALLQSHFFAQ  426

Query  1368  SKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP  1547
             S  +YT DFP  PP  FNYTG PP N  V++ TKVV L FN+SVELV+Q TSI+GAESHP
Sbjct  427   SNSIYTTDFPTIPPKLFNYTGTPPNNTNVSNGTKVVVLKFNTSVELVLQGTSILGAESHP  486

Query  1548  LHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  1727
             LHLHGFNFFV+GQGFGN+DPNKDP  FNLVDP ERNT GVPS GWVAIRFLADNPG W M
Sbjct  487   LHLHGFNFFVVGQGFGNFDPNKDPPNFNLVDPVERNTFGVPSRGWVAIRFLADNPGVWLM  546

Query  1728  HCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HCH ++H SWGL+MAW+V DGK   QKL PPP+DLPKC
Sbjct  547   HCHFDIHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  584



>ref|XP_002520231.1| laccase, putative [Ricinus communis]
 gb|EEF42143.1| laccase, putative [Ricinus communis]
Length=580

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/551 (75%), Positives = 475/551 (86%), Gaps = 4/551 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              +TR Y+F+I +QNVTRLC +KS+VTVNG+FPGPRI+AREGDR+++KVVN+V+ N++IHW
Sbjct  31    AVTRDYEFNIMLQNVTRLCHSKSMVTVNGQFPGPRIMAREGDRLLIKVVNNVQNNISIHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYI QCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  91    HGIRQLRSGWADGPAYIAQCPIQTGQSYVYNYTIIGQRGTLWWHAHISWLRSTLYGPLII  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPF +P+KEV I+FGEW+ ADTE +I QA QTGG PN+SDA+TINGLPGPLYN
Sbjct  151   LPKHGVPYPFAKPYKEVSIVFGEWFNADTEAVIKQALQTGGGPNVSDAYTINGLPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+LKVK GKTYLLR+INAALNDELFFSIANH++ VVE DAVYVKPF+T  +LI+
Sbjct  211   CSAKDTFRLKVKLGKTYLLRIINAALNDELFFSIANHTMKVVEVDAVYVKPFDTKTILIS  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs---tnsnktttnkL  1088
             PGQTTNVLLKT  H+PNAT+L++ARPY TG   FDNST AGILEY       +  + NKL
Sbjct  271   PGQTTNVLLKTKLHYPNATFLMTARPYVTGQGTFDNSTVAGILEYEPSQKTHHSLSINKL  330

Query  1089  PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTC  1268
               F P LPV NDTSFAT F+ +LRSL +A FPANVP+KVD++FFFTVGLG  PCP+NQTC
Sbjct  331   QFFKPKLPVLNDTSFATKFSSQLRSLDSAEFPANVPQKVDKQFFFTVGLGTSPCPKNQTC  390

Query  1269  QGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNI  1448
             QGP N T FAASVNN+SF  P  ALLQAHF  QS GVY  +FP++P   FNYTGNPP N 
Sbjct  391   QGP-NGTMFAASVNNVSFDMPDIALLQAHFSGQSNGVYNPNFPSSPLFPFNYTGNPPNNT  449

Query  1449  MVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKF  1628
             MV+S TKVV L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D NKDP+KF
Sbjct  450   MVSSGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKDPTKF  509

Query  1629  NLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             NLVDP ERNTVGVPSGGWVA+RFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QK
Sbjct  510   NLVDPVERNTVGVPSGGWVAVRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQK  569

Query  1809  LQPPPADLPKC  1841
             L PPPADLPKC
Sbjct  570   LLPPPADLPKC  580



>ref|XP_003623041.1| Laccase [Medicago truncatula]
 ref|XP_003636576.1| Laccase [Medicago truncatula]
 gb|AES79259.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=581

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/585 (73%), Positives = 485/585 (83%), Gaps = 10/585 (2%)
 Frame = +3

Query  105   MMVCLFAK-RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             M   LF+  +  +F+ +   +   +VALA     TRHY FDI+ +NVTRLC  KS+VTVN
Sbjct  1     MGFSLFSSLKIQVFIFSLINFGFFEVALAS---TTRHYHFDIRYENVTRLCHKKSMVTVN  57

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRI+AREGDR+++KVVNHV+ N++IHWHG+RQL+SGWADGPAY+TQCPIQTGQSY
Sbjct  58    GQFPGPRIVAREGDRLIIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSY  117

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VYN+TI GQRGTLFWHAHISWLR+TLYGP++ILPKK V YPF +P KEVPIIFGEW+  D
Sbjct  118   VYNYTIKGQRGTLFWHAHISWLRSTLYGPLIILPKKNVQYPFAKPHKEVPIIFGEWFNTD  177

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
              E II+QA QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKVK  KTYLLRLINAALND
Sbjct  178   PEAIIAQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPRKTYLLRLINAALND  237

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIANH+LTVVEADAVY KPF TN +LI PGQTTNVLLKT  H+PNAT+L+ ARPYA
Sbjct  238   ELFFSIANHTLTVVEADAVYAKPFVTNTILIAPGQTTNVLLKTKPHYPNATFLMLARPYA  297

Query  1002  TGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLA  1169
             TG   FDNST AGI+EY     T+ + ++  KLPL  P LP  NDTSFATNFT KL SLA
Sbjct  298   TGQGTFDNSTVAGIIEYEIPFNTHHSNSSLKKLPLLKPILPQLNDTSFATNFTNKLHSLA  357

Query  1170  NANFPANVPKKVDRRFFFTVGLGVIPCP-QNQTCQGPTNNTKFAASVNNISFVQPTTALL  1346
             NA FPANVP+KVD+ FFFTVGLG  PC  +NQTCQGP N T FAASVNN+SF+ PTTALL
Sbjct  358   NAQFPANVPQKVDKHFFFTVGLGTNPCQNKNQTCQGP-NGTMFAASVNNVSFIMPTTALL  416

Query  1347  QAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSI  1526
             Q HFF Q+ G+YT DFP+ P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI
Sbjct  417   QTHFFGQNNGIYTTDFPSKPMNPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSI  476

Query  1527  IGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLAD  1706
             +G ESHPLHLHGFNFFV+GQGFGN+D N DP  FNLVDP ERNTVGVPSGGWVAIRFLAD
Sbjct  477   LGVESHPLHLHGFNFFVVGQGFGNFDSNSDPQNFNLVDPVERNTVGVPSGGWVAIRFLAD  536

Query  1707  NPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             NPG WFMHCHLE+HTSWGLKMAWIV+DGK   QK+ PPP DLPKC
Sbjct  537   NPGVWFMHCHLEIHTSWGLKMAWIVLDGKLPNQKVLPPPVDLPKC  581



>ref|XP_011094887.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=583

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/573 (73%), Positives = 489/573 (85%), Gaps = 6/573 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F+L AFC +  ++ALA+  GITRHYKF+I+M  VTRLC TKS+VTVNG+FPGPRI+AR
Sbjct  13    VLFLLLAFC-IFCEIALAQDGGITRHYKFNIQMAKVTRLCHTKSMVTVNGKFPGPRIVAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR++++VVN+V  N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFT+ GQRG
Sbjct  72    EGDRLLIEVVNNVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVVGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+T+YGP++ILPKKGV YPF +P+KEVPIIFGEW+  D E II+QA QT
Sbjct  132   TLFWHAHISWLRSTVYGPLIILPKKGVPYPFAKPYKEVPIIFGEWYNGDPEAIINQAMQT  191

Query  675   GGAPNISDAFTINGLPGPLYNC-SAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             GG PN+SDA+TINGLPGPLYNC SAKD+FKLKVK GKTYLLRLINAALN++LFFSIANHS
Sbjct  192   GGGPNVSDAYTINGLPGPLYNCSSAKDTFKLKVKPGKTYLLRLINAALNEDLFFSIANHS  251

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             LTVVEADA+YVKPF ++IVL+TPGQTTN+LL+T +  P+A +L++  PY TG A FDNST
Sbjct  252   LTVVEADAIYVKPFQSDIVLLTPGQTTNLLLETKSQSPSANFLMAVSPYVTGLATFDNST  311

Query  1032  TAGILEYst-nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
              AGILEY   + +     +LPLF PTLP  NDTSFATNFT K+RSLA+  +PANVP+ VD
Sbjct  312   AAGILEYEIPSKSHHGNKRLPLFKPTLPAVNDTSFATNFTSKIRSLASPQYPANVPQNVD  371

Query  1209  RRFFFTVGLGVIPCP-QNQ-TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             + FFFTVGLG  PC  QN+ +CQGP N T+F+ASVNN+SFVQP TALLQAH   QS GVY
Sbjct  372   KHFFFTVGLGTSPCDHQNKSSCQGP-NGTRFSASVNNVSFVQPNTALLQAHHSGQSNGVY  430

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             + DFP +P   FNYTG PP N MV++ TKVV L FN+SVE++MQDTSI+GAESHPLHLHG
Sbjct  431   SPDFPISPLHWFNYTGTPPNNTMVSNGTKVVVLPFNTSVEVIMQDTSILGAESHPLHLHG  490

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN+DP +DP  FNLVDP ERNTVGVP GGWVAIRFLADNPG WFMHCHLE
Sbjct  491   FNFFVVGQGFGNFDPKQDPKNFNLVDPIERNTVGVPPGGWVAIRFLADNPGVWFMHCHLE  550

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             +HTSWGLKMAW+V+DGK   QKL PPP DLPKC
Sbjct  551   IHTSWGLKMAWLVLDGKLPNQKLLPPPKDLPKC  583



>ref|XP_009358279.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=583

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/576 (73%), Positives = 478/576 (83%), Gaps = 10/576 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +F L   C +         A ITRHYKFDIK QNVTRLC TKSIVTVNG+FPGPRI+
Sbjct  13    RLFLFSLITLCLIPQHAL----ASITRHYKFDIKHQNVTRLCHTKSIVTVNGQFPGPRIV  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGD V++KVVNHV+ N++IHWHG+RQL+SGWADGPAY+TQCPIQTG +YVYNFTITGQ
Sbjct  69    AREGDHVLIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGNNYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK+GV YPF +P+KE+PIIFGEWW  D E +ISQA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEIPIIFGEWWNVDPEAVISQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKV++GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVQSGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADA+YVKPF T+ +LI PGQTTNVLLKT  + P+AT+ ++ARPYATG   FDN+
Sbjct  249   TLKVVEADAIYVKPFETDTILIAPGQTTNVLLKTKANFPSATFFMTARPYATGLGTFDNT  308

Query  1029  TTAGILEYstnsnktttn----kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             T A ILEY + S    +     KLPLF P LP  NDTSFAT F  KLRSLANA FPANVP
Sbjct  309   TVAAILEYESPSKTLHSTLPVKKLPLFKPVLPALNDTSFATKFGNKLRSLANAQFPANVP  368

Query  1197  KKVDRRFFFTVGLGVIPCP-QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             +KVD+ FFFT+GLG  PC   NQTCQGP N T FAASVNN+SF  PTTALLQAHF  QS 
Sbjct  369   QKVDKHFFFTIGLGTNPCSNSNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFTGQSN  427

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
              VY+  FP++P + FNYTG PP N MV + TK++ L FN+SVELVMQDTSI+G ESHPLH
Sbjct  428   AVYSPYFPSSPLIPFNYTGTPPNNTMVGNGTKLMVLPFNTSVELVMQDTSILGVESHPLH  487

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+D NKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHC
Sbjct  488   LHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  547

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLE+HTSWGLKMAW+V+DGK   QKL PPPADLP C
Sbjct  548   HLEIHTSWGLKMAWLVLDGKLPNQKLLPPPADLPTC  583



>ref|XP_010043648.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
Length=585

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/583 (72%), Positives = 486/583 (83%), Gaps = 7/583 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             +  C  A  F++ + A+ C+   D AL    G+TRHYKF++ + NVTRLC TKS+VTVNG
Sbjct  6     LQSCPLAGFFLVALFAS-CFFP-DPALVAGEGMTRHYKFNVVLHNVTRLCHTKSMVTVNG  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             ++PGPR++AREGDR++++VVNHV  N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYV
Sbjct  64    KWPGPRVVAREGDRLLIEVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YN+TI GQRGTL+WHAHISWLR+TLYGP++ILPK   +YPF +P KE+PIIFGEW+ +DT
Sbjct  124   YNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKHNGSYPFIKPHKEIPIIFGEWFNSDT  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E II+QA +TGG PN+SDA+TING PGPLYNCSAKD+++LKVK GKTYLLRLINAALNDE
Sbjct  184   EAIINQALKTGGGPNVSDAYTINGFPGPLYNCSAKDTYRLKVKPGKTYLLRLINAALNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+LTVVEADA+Y+KPF T  +LITPGQTTNVLLKT  H+P AT+L++ARPY T
Sbjct  244   LFFSIANHTLTVVEADAIYLKPFETETLLITPGQTTNVLLKTKPHYPKATFLMTARPYVT  303

Query  1005  GPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLAN  1172
             G   FDNST AGILEY           +  +LPLF PTLP  NDT+FATNFT KLRSLA 
Sbjct  304   GLGTFDNSTVAGILEYEPPLKEPHQSFSIKQLPLFKPTLPPLNDTAFATNFTNKLRSLAT  363

Query  1173  ANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQA  1352
             A FPANVP+KVD+RFFFTVGLG  PC  NQTCQGP N T F A+VNN+SF  PTTALLQA
Sbjct  364   AQFPANVPQKVDQRFFFTVGLGTNPCQGNQTCQGP-NGTMFTAAVNNVSFTLPTTALLQA  422

Query  1353  HFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIG  1532
             H+  QS GVY+ DFP  P   FN+TG PP N  V + TK+V L FN+SVEL+MQDTSI+G
Sbjct  423   HYTGQSNGVYSPDFPNYPKTIFNFTGTPPNNTNVGNGTKLVVLPFNASVELIMQDTSILG  482

Query  1533  AESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNP  1712
             AESHPLHLHGFNFFV+GQGFGN+DPNKDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNP
Sbjct  483   AESHPLHLHGFNFFVVGQGFGNFDPNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLADNP  542

Query  1713  GAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             G WFMHCHLEVHTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  543   GVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_004246869.2| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=568

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/570 (73%), Positives = 475/570 (83%), Gaps = 8/570 (1%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             F++ ++ A C +S   A       TRHYKF+IKMQNVTRLC TKSIVTVNG+FPGP+I+A
Sbjct  7     FLLSLMIASCLLSSVSA------ATRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPKIVA  60

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDR+ ++VVNHV  N++IHWHG+RQ+RSGWADGPAY+TQCPIQ GQ YVYNFTI GQR
Sbjct  61    REGDRLEIEVVNHVHNNISIHWHGIRQVRSGWADGPAYVTQCPIQNGQKYVYNFTIIGQR  120

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GT +WHAHISWLR+TLYGPI+ILP K   YPF +P+KE+PIIFGEW+ ADTE IISQA Q
Sbjct  121   GTFWWHAHISWLRSTLYGPIIILPNKNTPYPFAKPYKEIPIIFGEWFNADTEAIISQALQ  180

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYN SAKD+FKLKVK  KTYLLRLINAALNDELFFSIANH+
Sbjct  181   TGGGPNVSDAYTINGLPGPLYNFSAKDTFKLKVKPEKTYLLRLINAALNDELFFSIANHT  240

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             L +++AD VYVKPF TN ++ITPGQT NVLLKT +H PNAT+ ++ARPY TGP  FDNST
Sbjct  241   LQIIDADGVYVKPFETNTLIITPGQTHNVLLKTKSHFPNATFYMTARPYVTGPGTFDNST  300

Query  1032  TAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDR  1211
              AGILEY  +  K     LPLF P LP  NDT+F TNFT +LRSLA+  +PANVP+ VDR
Sbjct  301   VAGILEY-ESKTKLHLKNLPLFKPLLPALNDTNFVTNFTNRLRSLASPQYPANVPQNVDR  359

Query  1212  RFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTAD  1391
             R FFTVGLG  PC +N+TCQGP N TKF+AS+NN+SFV PTTALLQ+HFF QSKGVY  D
Sbjct  360   RLFFTVGLGTSPCDKNKTCQGP-NGTKFSASINNVSFVLPTTALLQSHFFGQSKGVYKPD  418

Query  1392  FPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNF  1571
             FP +P   FNYTGNPP N +V + TK++ L FN+SVELVMQDTSI+G ESHPLHLHGFNF
Sbjct  419   FPYSPLNWFNYTGNPPNNTLVANDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNF  478

Query  1572  FVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHT  1751
             FV+GQGFGN+DP KDPS FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHT
Sbjct  479   FVVGQGFGNFDPKKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  538

Query  1752  SWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SWGLKMAW+V DGK   QKL PPP DLPKC
Sbjct  539   SWGLKMAWLVQDGKLPNQKLPPPPMDLPKC  568



>ref|XP_007208016.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica]
 gb|EMJ09215.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica]
Length=587

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/573 (73%), Positives = 482/573 (84%), Gaps = 6/573 (1%)
 Frame = +3

Query  141   FVLAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             F+LA  C W   + + A  +G+TRHYKFDIK++NVTRLCQTKSIV VNG+FPGPRIIARE
Sbjct  15    FLLALSCFWSLPEFSAAAASGVTRHYKFDIKLKNVTRLCQTKSIVAVNGKFPGPRIIARE  74

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR+VVKVVNHV+ N+++HWHG+RQL+SGWADGP+YITQCPIQT QSYVYNFTITGQRGT
Sbjct  75    GDRIVVKVVNHVQNNISLHWHGIRQLQSGWADGPSYITQCPIQTNQSYVYNFTITGQRGT  134

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             LFWHAHISWLRAT+YGP++ILPK   +YPFP+P KEVPIIFGEWWKAD E +I QA QTG
Sbjct  135   LFWHAHISWLRATVYGPLIILPKHNASYPFPKPHKEVPIIFGEWWKADPEAVIRQALQTG  194

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
               PN+S+A+TINGLPGPLYNCS KD+F+LKVK GKTYLLRLINAA+NDELFFSIANHSLT
Sbjct  195   AGPNVSEAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLINAAVNDELFFSIANHSLT  254

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADA+YVKPF T+I+LITPGQTTNVLL+T   +PNAT+L+ ARPY TG   FDNST A
Sbjct  255   VVEADALYVKPFKTDILLITPGQTTNVLLRTKPSYPNATFLMLARPYFTGMGTFDNSTVA  314

Query  1038  GILEYstnsnktttnk---LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             GILEY   SN + +      PL  PTLP  N TSF  NF+ K RSLAN+ FPANVPK V 
Sbjct  315   GILEYKNPSNPSASTSPRNPPLLRPTLPQINATSFVANFSAKFRSLANSKFPANVPKTVR  374

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             +RFFFTVGLG  PCP+NQTCQGP N++KFAAS+NNISF+ PTTALLQ+HFF +S GV+T 
Sbjct  375   KRFFFTVGLGTNPCPKNQTCQGPNNSSKFAASINNISFILPTTALLQSHFFGKSNGVFTT  434

Query  1389  DFPANPPVKFNYTGNPP--TNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             DFP NP   FNYTG P   TNI V++ TK V L FN+SVE+V+Q T I+GAESHPLHLHG
Sbjct  435   DFPTNPLQPFNYTGTPSNNTNINVSNGTKAVVLKFNTSVEVVLQGTGILGAESHPLHLHG  494

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN++PNKDP+ FNLVDP ERNT+GVPSGGWVAIRFLADNPG W +HCH +
Sbjct  495   FNFFVVGQGFGNFNPNKDPASFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWLLHCHFD  554

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VH SWGL+MAW+V DGK   QKL PPP+DLPKC
Sbjct  555   VHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  587



>ref|XP_003622947.1| Laccase [Medicago truncatula]
Length=560

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/580 (72%), Positives = 478/580 (82%), Gaps = 21/580 (4%)
 Frame = +3

Query  105   MMVCLFAK-RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             M V LF+  +F +  L+   + + ++ALA   GITRHY FDI+ QNVTRLC +KS+VTVN
Sbjct  1     MGVSLFSSLKFPLIFLSLINFCTFELALA---GITRHYHFDIRYQNVTRLCHSKSMVTVN  57

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGPRI+AREGDR+++KVVNHV+ N++IHWHG+RQL+SGWADGPAY+TQCPIQT QSY
Sbjct  58    GQFPGPRIVAREGDRLIIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTDQSY  117

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VYN+TI GQRGTLFWHAHISWLR+TLYGP++ILPKK   YPF +P KEV I+FGEW+ AD
Sbjct  118   VYNYTIKGQRGTLFWHAHISWLRSTLYGPLIILPKKNDQYPFAKPHKEVLILFGEWFNAD  177

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
              E II+QA QTGG PN+SDA+TINGLPGPLYNCSA D+FKLKVK GKTYLLRLINAALND
Sbjct  178   PEAIIAQALQTGGGPNVSDAYTINGLPGPLYNCSANDTFKLKVKPGKTYLLRLINAALND  237

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIANH+L VVEADA+YVKPF TN + I PGQTTNVLL T +H+PNA +L++ARPYA
Sbjct  238   ELFFSIANHTLKVVEADAIYVKPFETNTIYIAPGQTTNVLLNTKSHYPNAAFLMTARPYA  297

Query  1002  TGPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANF  1181
              GP PFDN+T A                 PLF P LP FNDTSFAT F+ KLRSLA+A F
Sbjct  298   AGPGPFDNTTVAH----------------PLFKPILPAFNDTSFATKFSNKLRSLASAQF  341

Query  1182  PANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFF  1361
             PANVPKK+D+ FFFTVG+G  PC  NQTCQG  N T F AS+NN+SF  PTTALLQ+HFF
Sbjct  342   PANVPKKIDKHFFFTVGIGTNPCQSNQTCQG-LNGTMFVASMNNVSFTMPTTALLQSHFF  400

Query  1362  NQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAES  1541
              Q+ G+YT DFP+ P   FNYTG PP N MV++ TKVV L FN+SVELVMQDTSI+GAES
Sbjct  401   GQNNGIYTTDFPSKPLNPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAES  460

Query  1542  HPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAW  1721
             HPLHLHGFNFFV+GQGFGNYD NKDP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG W
Sbjct  461   HPLHLHGFNFFVVGQGFGNYDSNKDPQKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVW  520

Query  1722  FMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             FMHCHLEVHTSWGL MAWIV+DGK   QKL PPPADLPKC
Sbjct  521   FMHCHLEVHTSWGLSMAWIVLDGKLPNQKLLPPPADLPKC  560



>emb|CDP01507.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/562 (75%), Positives = 473/562 (84%), Gaps = 7/562 (1%)
 Frame = +3

Query  174   DVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnh  350
              + L +HA GITRHY+ +I M NVTRLC TKS+V VNG+FPGPRI+A EGDR+++KV NH
Sbjct  24    SLLLPQHALGITRHYELNITMLNVTRLCHTKSLVAVNGQFPGPRIVAGEGDRLLIKVNNH  83

Query  351   vkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLR  530
             V  N+TIHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLFWHAHISWLR
Sbjct  84    VSNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFWHAHISWLR  143

Query  531   ATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTI  710
             AT YGP++ILPK  V YPF +P++EVPIIFGEW+ ADTE IISQA +TGG PN+SDA+TI
Sbjct  144   ATAYGPLIILPKHHVPYPFAKPYEEVPIIFGEWFNADTEAIISQALRTGGGPNVSDAYTI  203

Query  711   NGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKP  890
             NGLPGPLYNCSAKD+F+LKVKAGKTYLLRLINAALNDELFFSIANH+LTVVEADA YVKP
Sbjct  204   NGLPGPLYNCSAKDTFRLKVKAGKTYLLRLINAALNDELFFSIANHTLTVVEADANYVKP  263

Query  891   FNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnk  1070
             F T+ +LI PGQTTNVLLKT    P AT+L+ A PY TG   FDNST AGI+EY  +++ 
Sbjct  264   FETDTILIAPGQTTNVLLKTKPQFPAATFLMLATPYFTGAGTFDNSTVAGIVEYEQSTSL  323

Query  1071  tttnk-----LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGL  1235
              +T       LPLF PTLP  NDTSFA NF+ KLRSLA+  +PANVP  +D++ FFTVGL
Sbjct  324   NSTTAISVKKLPLFRPTLPALNDTSFAANFSNKLRSLASPQYPANVPWNIDKQVFFTVGL  383

Query  1236  GVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVK  1415
             G  PC Q Q CQGP N TKFAASVNNISFVQPTTALLQ+HF  QS GVY+ DFP NP   
Sbjct  384   GTSPCDQPQGCQGP-NGTKFAASVNNISFVQPTTALLQSHFSGQSSGVYSPDFPFNPLHW  442

Query  1416  FNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFG  1595
              NYTGNPP N MV +ATKV+ + FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFG
Sbjct  443   LNYTGNPPNNTMVGNATKVLVVPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFG  502

Query  1596  NYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAW  1775
             NYDPNKDP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW
Sbjct  503   NYDPNKDPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGMWFMHCHLEVHTSWGLKMAW  562

Query  1776  IVMDGKGRKQKLQPPPADLPKC  1841
             +V+DGK   QKL PPPADLPKC
Sbjct  563   LVLDGKLPNQKLLPPPADLPKC  584



>ref|XP_009597231.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=568

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/549 (75%), Positives = 469/549 (85%), Gaps = 2/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             +  TRHYKF+IKMQNVTRLC TKS+VTVNG+FPGP+++AREGDR+ ++V+NHV+ N++IH
Sbjct  22    SATTRHYKFEIKMQNVTRLCHTKSMVTVNGQFPGPKVVAREGDRLEIEVLNHVQNNISIH  81

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFTI GQRGT +WHAHISWLR+T+YGPI+
Sbjct  82    WHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTIIGQRGTFWWHAHISWLRSTVYGPII  141

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPKK   YPF +P+KEVPIIFGEW+ ADTE II+QA QTGG PN+SDA+TINGLPGPLY
Sbjct  142   ILPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIIAQALQTGGGPNVSDAYTINGLPGPLY  201

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLK+K GKTYLLRLINAALNDELFFSIANH+L V++AD VYVKPF T+ ++I
Sbjct  202   NCSAKDTFKLKMKPGKTYLLRLINAALNDELFFSIANHTLRVIDADGVYVKPFETDTLII  261

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             TPGQT NVLLKT  H PNAT+ ++ARPY TGP  FDNST AGILEY  + +K     LPL
Sbjct  262   TPGQTHNVLLKTKPHFPNATFYMTARPYVTGPGTFDNSTVAGILEY-ESKSKPHLKNLPL  320

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
             F P LP  NDT+F TNFT +LRSLA   FPANVP  VD+  FFTVGLG  PC QN+TCQG
Sbjct  321   FKPLLPALNDTTFVTNFTSRLRSLATPQFPANVPLNVDKHLFFTVGLGTSPCDQNKTCQG  380

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P N TKF+ASVNNISFVQPTTALLQ+HF  +SKGVY  DFP +P   FNYTGNPP N +V
Sbjct  381   P-NGTKFSASVNNISFVQPTTALLQSHFLGKSKGVYKPDFPYSPLNWFNYTGNPPNNTLV  439

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
              + TK++ L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D NKDP+ FNL
Sbjct  440   KNDTKLMVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDGNKDPANFNL  499

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
              DP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   QKL 
Sbjct  500   ADPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLP  559

Query  1815  PPPADLPKC  1841
              PP DLPKC
Sbjct  560   LPPRDLPKC  568



>ref|XP_009375916.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri]
Length=585

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/582 (73%), Positives = 483/582 (83%), Gaps = 6/582 (1%)
 Frame = +3

Query  111   VCLFAKRFIIFVLA--AFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             + L A   + F+LA  + C  S + A+A   G+TR YKFDIK++NVTRLC TKSIVTVNG
Sbjct  5     IPLSATFLVAFLLALISLC-ASPEFAIAAAGGVTRQYKFDIKLKNVTRLCTTKSIVTVNG  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRIIAREGDRV+VKVVNHV  N+T+HWHG+RQL+SGWADGP+Y+TQCPIQT QSYV
Sbjct  64    KFPGPRIIAREGDRVLVKVVNHVPNNITLHWHGIRQLQSGWADGPSYVTQCPIQTNQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTI GQRGTLFWHAHISWLRAT+YGP++ILPK+   YPFP+P KEVP+IFGEWW  D 
Sbjct  124   YNFTIIGQRGTLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPVIFGEWWNVDP  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +ISQA QTG  PN+S+A+TINGLPGPLYNCS KD+F+LKVK GKTYLLRLINAALNDE
Sbjct  184   EAVISQALQTGNGPNVSNAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLINAALNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANHS+TVVEADAVYVK F TNI+LITPGQTTNVLLK   H+PNAT+L+ ARPY T
Sbjct  244   LFFSIANHSITVVEADAVYVKRFKTNILLITPGQTTNVLLKAKPHYPNATFLMLARPYFT  303

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkL---PLFTPTLPVFNDTSFATNFTKKLRSLANA  1175
             G   FDNST AGILEY   SN +++  L   PLF P LP  N TSF  NFT KLRSLAN+
Sbjct  304   GRGTFDNSTVAGILEYKKPSNSSSSTSLKSHPLFRPILPQINATSFVANFTSKLRSLANS  363

Query  1176  NFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH  1355
              FPANVPK V+RRFFFT+GLG  PCP+NQTCQGPTN TKFAAS+NNISF  P+ A+LQ+H
Sbjct  364   RFPANVPKTVERRFFFTIGLGTNPCPKNQTCQGPTNTTKFAASMNNISFALPSVAMLQSH  423

Query  1356  FFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGA  1535
             FF QS  VY+ DFP  PP  FNYTG PP N  V + TKVV L FN+SVELVMQ TSI+GA
Sbjct  424   FFAQSNSVYSTDFPIIPPKPFNYTGTPPNNTNVNNGTKVVVLKFNTSVELVMQGTSILGA  483

Query  1536  ESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             ESHPLHLHGFNFFV+GQGFGN+DPNKDPS FNLVDP ERN+VGVPSGGWVAIRFLADNPG
Sbjct  484   ESHPLHLHGFNFFVVGQGFGNFDPNKDPSNFNLVDPVERNSVGVPSGGWVAIRFLADNPG  543

Query  1716  AWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              W MHCH +VH SWGL+MAW+V DGK   QKL PPP+DLPKC
Sbjct  544   VWLMHCHFDVHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  585



>gb|EYU26609.1| hypothetical protein MIMGU_mgv1a003496mg [Erythranthe guttata]
Length=581

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/550 (75%), Positives = 471/550 (86%), Gaps = 3/550 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY+F+IKMQ VTRLC TKSIVTVNG+FPGPR++AREGDR+V+KV N+V  N+TIHW
Sbjct  33    AITRHYEFNIKMQKVTRLCHTKSIVTVNGKFPGPRVVAREGDRLVIKVKNNVSNNITIHW  92

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+ GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  93    HGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGTLWWHAHISWLRSTLYGPLII  152

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK  V YPF +P+KEVPIIFGEW+ ADTE IISQA QTGG PN+SDA+TINGLPGPLYN
Sbjct  153   LPKANVPYPFQKPYKEVPIIFGEWFNADTEAIISQALQTGGGPNVSDAYTINGLPGPLYN  212

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKL+VK GKTYLLRLINAALNDELFFSIANHSLTVV+ADAVYVKPF T+ +L+T
Sbjct  213   CSAKDTFKLRVKPGKTYLLRLINAALNDELFFSIANHSLTVVDADAVYVKPFETDTILLT  272

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkLP  1091
             PGQT+NVLLKT  ++P AT+L++ARPY TG   FDNST A ILEY +    +  +  KLP
Sbjct  273   PGQTSNVLLKTKPNYPGATFLMTARPYVTGQGTFDNSTVAAILEYESPFLHSVASMKKLP  332

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             L+   LP  NDTSF T F KKLRSL +  +PANVP+KVD++F FTVGLG  PC QN TCQ
Sbjct  333   LYRSILPPLNDTSFVTKFAKKLRSLDSREYPANVPQKVDKQFLFTVGLGTSPCGQNNTCQ  392

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N ++FAASV+NISFVQ TTALLQAH+  QS GVY+ DFP +P   FNYTGNPP N +
Sbjct  393   GP-NGSRFAASVSNISFVQSTTALLQAHYTGQSSGVYSPDFPFSPKNWFNYTGNPPNNTI  451

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V + TK++ L +NSSVELVMQDTSI+GAESHPLHLHGFNFFV+G GFGNY+PN DP KFN
Sbjct  452   VANGTKLMVLPYNSSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYNPNTDPQKFN  511

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DG    QKL
Sbjct  512   LVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGNLPNQKL  571

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  572   LPPPSDLPKC  581



>ref|XP_006341009.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=568

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/570 (73%), Positives = 474/570 (83%), Gaps = 8/570 (1%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             F++ ++ A C       L   +  TRHYKF+IKMQNVTRLC TKSIVTVNG+FPGPRI+A
Sbjct  7     FLVSLMIASC------LLPSVSAATRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPRIVA  60

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDR+ ++VVNHV  N++IHWHG+RQ+RSGWADGPAY+TQCPIQTGQ Y+YNFTI GQR
Sbjct  61    REGDRLEIEVVNHVHNNISIHWHGIRQVRSGWADGPAYVTQCPIQTGQKYLYNFTIIGQR  120

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GT +WHAHISWLR+TLYGPI+ILPKK   YPF +P+KEVPIIFGEW+ ADTE IISQA Q
Sbjct  121   GTFWWHAHISWLRSTLYGPIIILPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIISQALQ  180

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK GKTYLLRLINAALNDELFFSIANH+
Sbjct  181   TGGGPNVSDAYTINGLPGPLYNCSTKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHT  240

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             L +++AD VYVKPF TN ++ITPGQT NVLLKT  H PNAT+ ++ARPY TG   FDNST
Sbjct  241   LQIIDADGVYVKPFETNTLIITPGQTHNVLLKTKPHFPNATFYMTARPYVTGLGTFDNST  300

Query  1032  TAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDR  1211
              AGILEY  +  +     LPLF P LP  NDT+F TNFT +LRSLA+  F ANVP+ VD+
Sbjct  301   VAGILEY-ESKTELHLKNLPLFKPLLPALNDTNFVTNFTSRLRSLASPQFLANVPQNVDK  359

Query  1212  RFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTAD  1391
             R FFTVGLG  PC Q +TCQGP N TKF+AS+NN+SF+ PTTALLQ+HFF QSKGVY  D
Sbjct  360   RLFFTVGLGTSPCDQIKTCQGP-NGTKFSASINNVSFILPTTALLQSHFFGQSKGVYKPD  418

Query  1392  FPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNF  1571
             FP +P   FNYTGNPP N +V + TK++ L FN+SVELVMQDTSI+G ESHPLHLHGFNF
Sbjct  419   FPYSPLNWFNYTGNPPNNTLVHNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNF  478

Query  1572  FVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHT  1751
             FV+GQGFGN+DPNKDPS FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHT
Sbjct  479   FVVGQGFGNFDPNKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  538

Query  1752  SWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SWGL+MAW+V +GK   QKL PPP DLPKC
Sbjct  539   SWGLEMAWLVQNGKLPNQKLPPPPMDLPKC  568



>ref|XP_011042451.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/552 (76%), Positives = 476/552 (86%), Gaps = 5/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHYKFD+ +QNVTRLC TKSIVTVNG+FPGPRI+AREGDR+++KVVNHV+ N++IHW
Sbjct  31    AITRHYKFDVMLQNVTRLCHTKSIVTVNGKFPGPRIVAREGDRLIIKVVNHVQNNISIHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+T  GQRGTL+WHAHISWLR+TL+GP++I
Sbjct  91    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTTVGQRGTLWWHAHISWLRSTLHGPLII  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK G  YPF +P KEVPIIFGEW+ AD E II+QA QTGG PN+SDA+TING PGPLYN
Sbjct  151   LPKLGTTYPFAKPHKEVPIIFGEWFNADPEAIITQAMQTGGGPNVSDAYTINGFPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVV+ DA+YVKPF+T  +LI 
Sbjct  211   CSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDVDAIYVKPFDTETLLIA  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttn----k  1085
             PGQTTNVLLKT  HHPNA++ +SARPY TG   FDNST AGILEY  ++    ++    K
Sbjct  271   PGQTTNVLLKTKPHHPNASFFMSARPYVTGQGTFDNSTVAGILEYEESNKTIKSSHSPKK  330

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             LPL+ P LP   DTSFATNFT KLRSLA+A FPANVP+KVDR+FFF+VGLG  PC +NQT
Sbjct  331   LPLYKPNLPPLTDTSFATNFTSKLRSLASAEFPANVPRKVDRQFFFSVGLGTNPCSKNQT  390

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T FAASVNN+SFV PT ALLQAH F QSKGVY+ +FP NPP+ FNYTG PP N
Sbjct  391   CQGP-NGTMFAASVNNVSFVMPTKALLQAHHFGQSKGVYSPNFPINPPIPFNYTGTPPNN  449

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV + TK+V L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D  KDP+ 
Sbjct  450   TMVNNGTKLVVLPFNASVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKKDPAN  509

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DGK   Q
Sbjct  510   FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQ  569

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  570   KLLPPPADLPKC  581



>gb|EYU26602.1| hypothetical protein MIMGU_mgv1a003840mg [Erythranthe guttata]
Length=560

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/550 (75%), Positives = 470/550 (85%), Gaps = 3/550 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY+F+IKMQ VTRLC TKSIVTVNG+FPGPR++AREGDR+V+KV N+V  N+TIHW
Sbjct  12    AITRHYEFNIKMQKVTRLCHTKSIVTVNGKFPGPRVVAREGDRLVIKVKNNVSNNITIHW  71

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+ GQRGTL+WHAHISWLR+TLYGP+VI
Sbjct  72    HGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGTLWWHAHISWLRSTLYGPLVI  131

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK  V YPF +P+KEVPIIFGEW+ ADTE IISQA QTGG PN+SDA+TINGLPGPLYN
Sbjct  132   LPKANVPYPFLKPYKEVPIIFGEWFNADTEAIISQALQTGGGPNVSDAYTINGLPGPLYN  191

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKL+VK GKTYLLRLINAALNDELFFSIANHSLTVV+ADAVYVKPF T+ +L+T
Sbjct  192   CSAKDTFKLRVKPGKTYLLRLINAALNDELFFSIANHSLTVVDADAVYVKPFETDTILLT  251

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkLP  1091
             PGQT+NVLLKT  ++P AT+L++ARPY TG   FDNST A ILEY +    +  +  KLP
Sbjct  252   PGQTSNVLLKTKPNYPGATFLMTARPYVTGQGTFDNSTVAAILEYESPFLHSVASMKKLP  311

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             L+   LP  NDTSF T F KKLRSL +  +PANVP+KVD++F FTVGLG  PC  N TCQ
Sbjct  312   LYRSILPPLNDTSFVTKFAKKLRSLDSREYPANVPQKVDKQFLFTVGLGTSPCGHNNTCQ  371

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N ++FAASV+NISFVQ TTALLQAH+  QS GVY+ DFP +P   FNYTGNPP N +
Sbjct  372   GP-NGSRFAASVSNISFVQSTTALLQAHYTGQSSGVYSPDFPFSPKNWFNYTGNPPNNTI  430

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V + TK++ L +NSSVELVMQDTSI+GAESHPLHLHGFNFFV+G GFGNY+PN DP KFN
Sbjct  431   VANGTKLMVLPYNSSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYNPNTDPQKFN  490

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DG    QKL
Sbjct  491   LVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGNLPNQKL  550

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  551   LPPPSDLPKC  560



>ref|XP_010106521.1| hypothetical protein L484_025281 [Morus notabilis]
 gb|EXC10697.1| hypothetical protein L484_025281 [Morus notabilis]
Length=577

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/551 (74%), Positives = 471/551 (85%), Gaps = 2/551 (0%)
 Frame = +3

Query  192   HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTI  371
             HAG+TRHYKFDI ++NVTRLC +KSIVTVNGRFPGPRI+AREGDRV++KVVNHV  N+TI
Sbjct  28    HAGVTRHYKFDITLKNVTRLCHSKSIVTVNGRFPGPRIVAREGDRVLIKVVNHVPNNITI  87

Query  372   HWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPI  551
             HWHG+RQL+SGWADGP+YITQCPIQTGQSYVYNFTI GQRGTL+WHAHISWLRAT+YGP 
Sbjct  88    HWHGIRQLQSGWADGPSYITQCPIQTGQSYVYNFTIIGQRGTLWWHAHISWLRATVYGPF  147

Query  552   VILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPL  731
             VILP++  +YPF +P KEVPIIFGEWW ADTE +I QA QTG  PN+SDA+TINGLPGPL
Sbjct  148   VILPRRNESYPFLKPHKEVPIIFGEWWNADTEAVIKQALQTGAGPNVSDAYTINGLPGPL  207

Query  732   YNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVL  911
             YNCS K++FKLKVK GKTYLLRLINAALND+LFFSIANH+LTVVEADAVYVKPF +NIVL
Sbjct  208   YNCSQKETFKLKVKPGKTYLLRLINAALNDDLFFSIANHTLTVVEADAVYVKPFQSNIVL  267

Query  912   ITPGQTTNVLLKTTTHHPNATYLISARPYATGPA-PFDNSTTAGILEYstnsnktttnkL  1088
             I PGQTTNV+LKT  H PNA++ + ARPY+T  +  F N+T AG+LEY  N    ++  L
Sbjct  268   INPGQTTNVVLKTKKHSPNASFFMLARPYSTAASGTFANTTVAGVLEY-ENPAIKSSKNL  326

Query  1089  PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTC  1268
             P+   +LP  NDTSFA+NF+ K RSLA A FPANVP+ V + FFFTVGLG  PCP+NQTC
Sbjct  327   PILRLSLPQINDTSFASNFSNKFRSLATAKFPANVPQTVQKHFFFTVGLGTNPCPKNQTC  386

Query  1269  QGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNI  1448
             QGPTN++KFAASVNN+SF+ P+ ALLQ HFF +S GV+T DFP+ P V+FNYTG PP N 
Sbjct  387   QGPTNSSKFAASVNNVSFIMPSVALLQTHFFKKSNGVFTTDFPSFPLVQFNYTGTPPNNT  446

Query  1449  MVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKF  1628
              V++ TKVV L +N+SVELV QDT I+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP+KF
Sbjct  447   NVSNGTKVVVLKYNTSVELVFQDTGILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPAKF  506

Query  1629  NLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             NLVDP ERNT+GVPSGGW AIRFLADNPG WFMHCH +VH SWGL+MAWIV DGK   QK
Sbjct  507   NLVDPVERNTIGVPSGGWAAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVQDGKLPNQK  566

Query  1809  LQPPPADLPKC  1841
             L PPP+DLPKC
Sbjct  567   LPPPPSDLPKC  577



>ref|XP_006363101.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=569

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/572 (73%), Positives = 470/572 (82%), Gaps = 9/572 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +  + A C       L   +  TRHYKF+IK+QNVTRLC TKS+VTVNG+FPGPRI+
Sbjct  6     RLFLVSIIALC------LLHNVSAATRHYKFEIKLQNVTRLCHTKSMVTVNGKFPGPRIV  59

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDR+ ++V+N+V+ N++IHWHG+RQ+RSGWADGPAY+TQCPIQ GQ YVYNFTI GQ
Sbjct  60    AREGDRLEIEVINNVQNNISIHWHGIRQIRSGWADGPAYVTQCPIQIGQKYVYNFTIIGQ  119

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGT +WHAHISWLR+TLYGPI+ILPKK   YPF +P+KEVPIIFGEW+  DTE IISQA 
Sbjct  120   RGTFWWHAHISWLRSTLYGPIIILPKKNNPYPFTKPYKEVPIIFGEWFNGDTEAIISQAL  179

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK GKTYLLRLINAALNDELFFSIANH
Sbjct  180   QTGGGPNVSDAYTINGLPGPLYNCSTKDTFKLKVKPGKTYLLRLINAALNDELFFSIANH  239

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L V++AD VYVKPF TN ++ITPGQT NVLLKT  H PNA + + ARPY TGP  FDNS
Sbjct  240   TLQVIDADGVYVKPFETNTIIITPGQTHNVLLKTKPHFPNAKFYMLARPYVTGPGTFDNS  299

Query  1029  TTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             T AGILEY  + +K     LP+F P+LP  NDT F TNFT KLRSLA   FPANVP  VD
Sbjct  300   TVAGILEY-ESKSKHHLKNLPIFKPSLPSLNDTIFVTNFTSKLRSLATPQFPANVPLNVD  358

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTT-ALLQAHFFNQSKGVYT  1385
             R  FFT+GLG  PC QN+TCQGP N TKF+AS+NN+SF+ PTT ALLQ+HFF QSKGVY 
Sbjct  359   RHLFFTIGLGTSPCDQNKTCQGP-NGTKFSASINNVSFILPTTNALLQSHFFGQSKGVYK  417

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFP +P   FNYTGNPP N +V + TK++ L FN+SVELVMQDTSI+G ESHPLHLHGF
Sbjct  418   PDFPYSPLHWFNYTGNPPNNTLVNNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGF  477

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEV  1745
             NFFV+GQGFGNYDPNKDPS FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEV
Sbjct  478   NFFVVGQGFGNYDPNKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEV  537

Query  1746  HTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HTSWGLKMAW+V DGK   QKL PPP DLPKC
Sbjct  538   HTSWGLKMAWLVQDGKLPNQKLPPPPMDLPKC  569



>ref|XP_003622953.1| Laccase [Medicago truncatula]
Length=604

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/553 (75%), Positives = 472/553 (85%), Gaps = 9/553 (2%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG TRHY+FDI  QNVTRLC  K +VTVNG+FPGPRI+AREGDR+V+KVVN+V+ N++IH
Sbjct  57    AGTTRHYQFDIGYQNVTRLCHNKRMVTVNGQFPGPRIMAREGDRLVIKVVNNVQNNISIH  116

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL+SGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTLFWHAHISWLR+TLYGP++
Sbjct  117   WHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNYTIKGQRGTLFWHAHISWLRSTLYGPLI  176

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPKK V YPF +P KEVP+IFGEW+ ADTE II+QA QTGG PN+S+A+TINGLPGPLY
Sbjct  177   ILPKKNVPYPFAKPHKEVPMIFGEWFNADTEAIIAQALQTGGGPNVSEAYTINGLPGPLY  236

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             N +    FKLKVK GKTYLLRLINAALNDELFFS+ANH+L VVEADA+YVKPF TN +LI
Sbjct  237   NYT----FKLKVKPGKTYLLRLINAALNDELFFSVANHTLKVVEADAIYVKPFETNTILI  292

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttn  1082
              PGQTTNVLLKT +H+PNA +L+SARPYATG   FDN+T AGILEY     T+ + ++  
Sbjct  293   APGQTTNVLLKTKSHYPNAAFLMSARPYATGQGTFDNTTVAGILEYEIPSNTHHSASSLK  352

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
             K+PLF PTLP  NDTSFAT F+KKLRSLA+  FPANVP+KVD+ FFFTVGLG  PC  NQ
Sbjct  353   KIPLFKPTLPALNDTSFATKFSKKLRSLASPQFPANVPQKVDKHFFFTVGLGTNPCQSNQ  412

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGP N T FAASVNN+SF  PTTALLQ+HF  QS+GVY   FP++P   FNYTG PP 
Sbjct  413   TCQGP-NGTMFAASVNNVSFTMPTTALLQSHFTGQSRGVYAPYFPSSPLHPFNYTGTPPN  471

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TKV  L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNYD NKDP 
Sbjct  472   NTMVSNGTKVTVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDSNKDPK  531

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
              FNLVDP ERNT+GVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAWIV+DGK   
Sbjct  532   NFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPN  591

Query  1803  QKLQPPPADLPKC  1841
             QKL PPPADLPKC
Sbjct  592   QKLLPPPADLPKC  604



>ref|XP_006400889.1| hypothetical protein EUTSA_v10013109mg [Eutrema salsugineum]
 gb|ESQ42342.1| hypothetical protein EUTSA_v10013109mg [Eutrema salsugineum]
Length=572

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/566 (73%), Positives = 479/566 (85%), Gaps = 4/566 (1%)
 Frame = +3

Query  156   FCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvv  332
             F  VS  + L + A GITRHY  DIKMQNVTRLC TKSIV+VNG+FPGP++IAREGD+++
Sbjct  7     FAVVSCVLLLPEPAFGITRHYTLDIKMQNVTRLCHTKSIVSVNGQFPGPKLIAREGDQLL  66

Query  333   vkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHA  512
             +KVVNHV  N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLF+HA
Sbjct  67    IKVVNHVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFYHA  126

Query  513   HISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNI  692
             HISWLRAT+YGPI+ILPK+GV YPF +P+KEVP+IFGEW+ AD E II QA+QTGG PN+
Sbjct  127   HISWLRATVYGPIIILPKRGVPYPFAKPYKEVPMIFGEWFNADPEAIIRQATQTGGGPNV  186

Query  693   SDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEAD  872
             SDA+TINGLPGPLYNCSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEAD
Sbjct  187   SDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEAD  246

Query  873   AVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY  1052
             A+YVKPF T+ +LI PGQTTNVLLKT   +P+A++ ++ARPY TG   FDNST AGIL+Y
Sbjct  247   AIYVKPFETDTILIAPGQTTNVLLKTKPSYPSASFFMTARPYVTGQGTFDNSTVAGILDY  306

Query  1053  s-tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTV  1229
                   +T+   LPLFTP LP  NDT+FAT F+ KLRSL +  FPA VP KVDR+FFFTV
Sbjct  307   EPPKHARTSIKDLPLFTPVLPALNDTNFATKFSNKLRSLNSKKFPAKVPLKVDRKFFFTV  366

Query  1230  GLGVIPC--PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPAN  1403
             GLG  PC    NQTCQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+ ++P +
Sbjct  367   GLGTKPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPNYPWD  426

Query  1404  PPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIG  1583
             P VKFNYTG PP N MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+G
Sbjct  427   PIVKFNYTGTPPNNTMVSNGTNLMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVG  486

Query  1584  QGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  1763
             QGFGN+DPNKDP  FNLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL
Sbjct  487   QGFGNFDPNKDPKNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGL  546

Query  1764  KMAWIVMDGKGRKQKLQPPPADLPKC  1841
             +MAW+V+DG    QKL PPPADLPKC
Sbjct  547   RMAWLVLDGDKPNQKLLPPPADLPKC  572



>ref|XP_008359106.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/560 (74%), Positives = 473/560 (84%), Gaps = 10/560 (2%)
 Frame = +3

Query  129   RFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             R  +  L   C +   V     A ITRHYKFDIK QNVTRLC TKSIVTVNG+FPGP+I+
Sbjct  13    RLFLLSLITLCLIPQHV----FASITRHYKFDIKQQNVTRLCHTKSIVTVNGQFPGPQIV  68

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDRV++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQ+G SYVYNFTITGQ
Sbjct  69    AREGDRVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQSGNSYVYNFTITGQ  128

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTLFWHAHISWLR+T+YGP++ILPK+GV YPF +P+KEVPIIFGEWW AD E +ISQA 
Sbjct  129   RGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEVPIIFGEWWNADPEAVISQAL  188

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             QTGG PN+SDA+T NGLPGPLYNCSAKD+FKLKV++GKTYLLRLINAALNDELFFSIANH
Sbjct  189   QTGGGPNVSDAYTFNGLPGPLYNCSAKDAFKLKVRSGKTYLLRLINAALNDELFFSIANH  248

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             +L VVEADA+YVKPF+T+ VLI PGQTTNVLLKT  H P+AT+ ++ARPY TG   FDNS
Sbjct  249   TLKVVEADAIYVKPFDTDTVLIAPGQTTNVLLKTKPHFPSATFFMTARPYVTGLGTFDNS  308

Query  1029  TTAGILEYstnsnktttn----kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             T AGILEY + S    T     KLPLF P LP  NDTSFAT F+ KLRSLANA FPANVP
Sbjct  309   TVAGILEYESTSKALHTTLPMKKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPANVP  368

Query  1197  KKVDRRFFFTVGLGVIPCPQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             +KVDR FFFT+GLG  PC   NQTCQGP N T FAASVNN+SF  PTTALLQAHF  QS 
Sbjct  369   QKVDRHFFFTIGLGTNPCSSNNQTCQGP-NGTMFAASVNNVSFAMPTTALLQAHFSGQSN  427

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVY+ DFP++P + FNYTG PP + MV + TK++ L +N+SVELVMQDTSI+GAESHPLH
Sbjct  428   GVYSPDFPSSPIIPFNYTGTPPNDTMVGNGTKLMVLPYNTSVELVMQDTSILGAESHPLH  487

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+D NKDP+ FNLVDP ERNTVGVPSGGWVAIRF+ADNPG WFMHC
Sbjct  488   LHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHC  547

Query  1734  HLEVHTSWGLKMAWIVMDGK  1793
             HLE+HTSWGLKMAW+V+DGK
Sbjct  548   HLEIHTSWGLKMAWLVLDGK  567



>ref|XP_009120521.1| PREDICTED: laccase-17-like [Brassica rapa]
Length=573

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/551 (74%), Positives = 468/551 (85%), Gaps = 3/551 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  DIKM NVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVNHV  N++IHW
Sbjct  23    GITRHYTLDIKMHNVTRLCHTKSLVSVNGQFPGPKLIAREGDQLLIKVVNHVPNNISIHW  82

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLF+HAHISWLRAT+YGPI+I
Sbjct  83    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIAGQRGTLFYHAHISWLRATVYGPIII  142

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPFP+P KEVP+IFGEW+ AD E II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  143   LPKRGVPYPFPKPHKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  202

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  203   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  262

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLPL  1094
             PGQTTN+LLKT   +PNA++L++ARPY TG   FDNST AG+LEY      KT+   LPL
Sbjct  263   PGQTTNLLLKTKPSYPNASFLMTARPYVTGQGTFDNSTVAGVLEYEQPKHAKTSIKNLPL  322

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQTC  1268
             F P LP  NDT+FA  F+ KLRSL +  FPANVP KVDR+FFFTVGLG  PC    NQTC
Sbjct  323   FAPVLPALNDTNFAAKFSNKLRSLNSKRFPANVPLKVDRKFFFTVGLGTTPCNHKNNQTC  382

Query  1269  QGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNI  1448
             QGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+ +FP NP V FNYTG PP N 
Sbjct  383   QGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWNPVVPFNYTGTPPNNT  442

Query  1449  MVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKF  1628
             MV + T V+ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP  F
Sbjct  443   MVRTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDPKNF  502

Query  1629  NLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             NLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    QK
Sbjct  503   NLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQK  562

Query  1809  LQPPPADLPKC  1841
             L PPP DLPKC
Sbjct  563   LLPPPVDLPKC  573



>ref|XP_008778578.1| PREDICTED: laccase-10-like [Phoenix dactylifera]
Length=577

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/552 (75%), Positives = 471/552 (85%), Gaps = 5/552 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITRHYKFDI+ +NVTRLC T+SIVTVNG FPGP+I+AREGDRV+V+VVNHVK NVTIH
Sbjct  28    ASITRHYKFDIQRKNVTRLCHTRSIVTVNGEFPGPKIVAREGDRVIVRVVNHVKNNVTIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQ+++GWADGPAY+TQCPIQTGQSYVYNFTI GQRGTLFWHAHISW+R TLYGPI+
Sbjct  88    WHGVRQIQTGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLFWHAHISWMRVTLYGPII  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+GV YPF +P+KE+PI+FGEW+  D E +I+QA QTG  PN+SDA+TINGLPGPLY
Sbjct  148   ILPKRGVPYPFAKPYKEIPIMFGEWFNTDPEAVIAQALQTGAGPNVSDAYTINGLPGPLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS KD+FKLKVK GKTYLLR++NAALNDELFFSIANH+LTVV+ DA+Y KPF T+I+LI
Sbjct  208   NCS-KDTFKLKVKPGKTYLLRMVNAALNDELFFSIANHTLTVVDVDAIYTKPFKTDIILI  266

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs---tnsnktttnk  1085
             TPGQTTNVLL+T    P A++L++ARPYATG   FDN+TTAG+LEY     +S  T +  
Sbjct  267   TPGQTTNVLLQTKPSLPCASFLMAARPYATGLGAFDNTTTAGLLEYLPPGVSSPSTPSKN  326

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             L L  PTLP  NDT+FA NFT KLRSLANA FPANVP+ VDRRF+FTVGLG  PCP NQT
Sbjct  327   LTLSRPTLPSLNDTAFAANFTGKLRSLANAQFPANVPQTVDRRFYFTVGLGTSPCPTNQT  386

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N TKFAASVNNISF  P+TALLQAHFF QSKGVY  DFP+NPP  FNYTG PP N
Sbjct  387   CQGP-NGTKFAASVNNISFALPSTALLQAHFFGQSKGVYRTDFPSNPPFPFNYTGTPPNN  445

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
               VT+ TK+V L FN+SVELVMQDTSI G ESHPLHLHGFNFFV+GQGFGNYDP KDP+K
Sbjct  446   SFVTNGTKLVVLPFNASVELVMQDTSIQGIESHPLHLHGFNFFVVGQGFGNYDPAKDPAK  505

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNL DP ERNTVGVP+GGWVAIRF ADNPG WFMHCHL+VHT WGL+MAW+V DG    Q
Sbjct  506   FNLADPIERNTVGVPAGGWVAIRFRADNPGVWFMHCHLDVHTVWGLRMAWVVNDGPLPSQ  565

Query  1806  KLQPPPADLPKC  1841
             KL PPP+DLPKC
Sbjct  566   KLLPPPSDLPKC  577



>ref|XP_009364426.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri]
Length=584

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/558 (75%), Positives = 467/558 (84%), Gaps = 2/558 (0%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             + A+A    +TRHYKFDIK++NVTRLC TKSIVTVNG+FPGPRIIAREGDRV+V VVNHV
Sbjct  27    EFAIAAAGSVTRHYKFDIKLKNVTRLCTTKSIVTVNGKFPGPRIIAREGDRVLVNVVNHV  86

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
               N+TIHWHG+RQL++GWADGP+YITQCPIQT QSYVYNFTI GQRGTLFWHAHISWLRA
Sbjct  87    PNNMTIHWHGIRQLQNGWADGPSYITQCPIQTNQSYVYNFTIIGQRGTLFWHAHISWLRA  146

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             T+YGP++ILPK+   YPFP+P KEVPIIFGEWW  DTE +ISQA QTG  PN+S+A+TIN
Sbjct  147   TVYGPLIILPKRHAPYPFPKPHKEVPIIFGEWWNVDTEAVISQALQTGNGPNVSNAYTIN  206

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCS KD+F LKVK GKTYLLRLINAA+NDELFFSIANHSLTVVEADAVYVKPF
Sbjct  207   GLPGPLYNCSKKDTFSLKVKPGKTYLLRLINAAVNDELFFSIANHSLTVVEADAVYVKPF  266

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsn  1067
              TNI+ ITPGQTTNVLLK    +PNAT+L+ ARPY TG   FDNST AGILEY    NS+
Sbjct  267   TTNILFITPGQTTNVLLKAKPQYPNATFLMLARPYFTGRGTFDNSTVAGILEYKEHSNSS  326

Query  1068  ktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIP  1247
              +T+ K PLF P LP  N TSF  NFT K RSLA++ FPANVP+ V++RFFFTVGLG  P
Sbjct  327   SSTSLKSPLFRPILPQINATSFVANFTSKFRSLASSKFPANVPRTVEKRFFFTVGLGTNP  386

Query  1248  CPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYT  1427
             CP+NQTCQGPTN TKFAAS+NN SF  P+ ALLQ+HFF QS  VYT DFP  PP  FNYT
Sbjct  387   CPKNQTCQGPTNTTKFAASINNNSFALPSVALLQSHFFAQSNSVYTTDFPTIPPKPFNYT  446

Query  1428  GNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDP  1607
             G PP N  V++ TKVV L FN+SVELV+Q TSI+GAESHPLHLHGFNFFV+GQGFGN+DP
Sbjct  447   GTPPNNTNVSNGTKVVVLKFNTSVELVLQGTSILGAESHPLHLHGFNFFVVGQGFGNFDP  506

Query  1608  NKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMD  1787
             NKDP KFNLVDP ERNT GVP+ GW AIRFLADNPG W MHCH +VH SWGL+MAW+V D
Sbjct  507   NKDPPKFNLVDPVERNTYGVPARGWAAIRFLADNPGVWLMHCHFDVHLSWGLRMAWVVQD  566

Query  1788  GKGRKQKLQPPPADLPKC  1841
             GK   QKL PPP+DLPKC
Sbjct  567   GKLPNQKLPPPPSDLPKC  584



>gb|KDO37152.1| hypothetical protein CISIN_1g040938mg, partial [Citrus sinensis]
Length=487

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/488 (83%), Positives = 438/488 (90%), Gaps = 1/488 (0%)
 Frame = +3

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFT+TGQRGTLFWHAHISWLRATLYGPIVI
Sbjct  1     HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRGTLFWHAHISWLRATLYGPIVI  60

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+  +YPFPQPFKEVP+IFGEWWKADTE+II+QA QTG APNISDAFTINGLPGPLYN
Sbjct  61    LPKRHASYPFPQPFKEVPMIFGEWWKADTEKIINQALQTGAAPNISDAFTINGLPGPLYN  120

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH+LTVVE DAVYVKP  T +VLIT
Sbjct  121   CSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVETDAVYVKPIKTKVVLIT  180

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPLF  1097
             PGQTTNVLLK     PNA++LI+ARPYATGPA FDN+TTAG+LEY   +N     KLPL 
Sbjct  181   PGQTTNVLLKAKHKSPNASFLIAARPYATGPASFDNTTTAGVLEYEQPNNANKNKKLPLL  240

Query  1098  TPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGP  1277
              P LP FNDT+FA  F+KK+RSLA A FPA VP+KVDR FFFTVGLG+ PCPQNQTCQGP
Sbjct  241   KPALPKFNDTNFAMQFSKKIRSLATAKFPAKVPRKVDRLFFFTVGLGLSPCPQNQTCQGP  300

Query  1278  TNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVT  1457
              NNT  AAS+NN+SF QP  ALLQAHFFN+SKGVYT DFPANPP KFNYTG PP+NIMV+
Sbjct  301   -NNTMLAASINNVSFAQPNIALLQAHFFNKSKGVYTTDFPANPPFKFNYTGTPPSNIMVS  359

Query  1458  SATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLV  1637
             S T+ V L FN+SVE+VMQDTSIIGAESHPLHLHGFNFFV+GQGFGN+DP+KDP+KFNLV
Sbjct  360   SGTRAVALPFNASVEVVMQDTSIIGAESHPLHLHGFNFFVVGQGFGNFDPSKDPAKFNLV  419

Query  1638  DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQP  1817
             DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIV DGKG KQKL P
Sbjct  420   DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVNDGKGPKQKLPP  479

Query  1818  PPADLPKC  1841
             PP+DLPKC
Sbjct  480   PPSDLPKC  487



>ref|XP_002317505.2| hypothetical protein POPTR_0011s12100g [Populus trichocarpa]
 gb|EEE98117.2| hypothetical protein POPTR_0011s12100g [Populus trichocarpa]
Length=581

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/566 (75%), Positives = 488/566 (86%), Gaps = 5/566 (1%)
 Frame = +3

Query  156   FCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvv  335
             F +V+  V       ITRHYKFD+ +QNVTRLC T+S+VTVNG+FPGPRI+AREGDR+V+
Sbjct  17    FSFVTLSVNPEPALAITRHYKFDVMLQNVTRLCHTRSMVTVNGKFPGPRIVAREGDRLVI  76

Query  336   kvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAH  515
             ++VNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTL+WHAH
Sbjct  77    RMVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIVGQRGTLWWHAH  136

Query  516   ISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNIS  695
             ISWLR+TL+GPI++LPK G  YPF +P+KEVPIIFGEW+ AD E IISQA QTGG PN+S
Sbjct  137   ISWLRSTLHGPIILLPKLGTPYPFAKPYKEVPIIFGEWFNADPEAIISQAMQTGGGPNVS  196

Query  696   DAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADA  875
             DA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH++TVV+ DA
Sbjct  197   DAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTVTVVDVDA  256

Query  876   VYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs  1055
             VYVKPF+   +LITPGQTTNVLLKT   +PNA + +SARPYATG   FDNST AGILEY 
Sbjct  257   VYVKPFDAETLLITPGQTTNVLLKTKPDYPNAQFFMSARPYATGQGTFDNSTVAGILEYE  316

Query  1056  ----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFF  1223
                 T+ +  +T KLPL+ P LP  NDTSFATNF+ KLRSLA+A+FPANVP+KVDR+FFF
Sbjct  317   VPNKTSQSNHSTKKLPLYKPNLPPLNDTSFATNFSSKLRSLASADFPANVPQKVDRQFFF  376

Query  1224  TVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPAN  1403
             TVGLG  PC +NQTCQGP N T+FAASVNN+SFV PTTALLQAH F QS+GVY+  FP +
Sbjct  377   TVGLGTNPCSKNQTCQGP-NGTRFAASVNNVSFVMPTTALLQAHHFGQSRGVYSPYFPIS  435

Query  1404  PPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIG  1583
             P + FNYTG PP N MV++ TK+V L FN+SVEL+MQ TSI+GAESHPLHLHGFNFFV+G
Sbjct  436   PLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQGTSILGAESHPLHLHGFNFFVVG  495

Query  1584  QGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  1763
             QGFGN+DP+KDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGL
Sbjct  496   QGFGNFDPSKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGL  555

Query  1764  KMAWIVMDGKGRKQKLQPPPADLPKC  1841
             KMAW+V+DGK   QKL PPPADLPKC
Sbjct  556   KMAWVVLDGKLPNQKLLPPPADLPKC  581



>emb|CDY09232.1| BnaA02g06580D [Brassica napus]
Length=572

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/551 (74%), Positives = 473/551 (86%), Gaps = 3/551 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  DIKM NVTRLC TKS+V+VNG+FPGP+IIAREGD++++KVVNHV  N+++HW
Sbjct  22    GITRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKIIAREGDQLLIKVVNHVPNNISLHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL++HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP+P KEVP++FGEW+ ADTE II QA+ TGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKHGVPYPFPKPHKEVPMVFGEWFNADTEAIIRQATLTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VKAGKTYLLR+INAALNDELFFSIANH++TVVEADAVYVKPF TN +LI 
Sbjct  202   CSAKDTFRLRVKAGKTYLLRIINAALNDELFFSIANHTVTVVEADAVYVKPFETNTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLPL  1094
             PGQTTNVLLKT   +P+A++ ++ARPYATG   FDN+T AGILEY      KT    LPL
Sbjct  262   PGQTTNVLLKTKPSYPSASFFMTARPYATGQGTFDNTTVAGILEYEQPKHAKTNIKNLPL  321

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQTC  1268
             FTP LP  NDT+FAT F+ KLRSL +  FPANVP++VDR+FFFTVGLG  PC    NQTC
Sbjct  322   FTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPQEVDRKFFFTVGLGTNPCNHKNNQTC  381

Query  1269  QGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNI  1448
             QGPTN T FAAS++NISF  PT ALLQ+H+  +S GVY+ +FP +P V FNYTG PP N 
Sbjct  382   QGPTNTTMFAASISNISFTLPTKALLQSHYSGRSNGVYSPNFPWSPIVPFNYTGTPPNNT  441

Query  1449  MVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKF  1628
             MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP KF
Sbjct  442   MVSTGTNLMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKKF  501

Query  1629  NLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             NLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    QK
Sbjct  502   NLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQK  561

Query  1809  LQPPPADLPKC  1841
             L PPPADLPKC
Sbjct  562   LIPPPADLPKC  572



>emb|CDY31581.1| BnaA10g12900D [Brassica napus]
Length=573

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/551 (74%), Positives = 467/551 (85%), Gaps = 3/551 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  DIKM NVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVNHV  N++IHW
Sbjct  23    GITRHYTLDIKMHNVTRLCHTKSLVSVNGQFPGPKLIAREGDQLLIKVVNHVPNNISIHW  82

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLF+HAHISWLRAT+YGPI+I
Sbjct  83    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIAGQRGTLFYHAHISWLRATVYGPIII  142

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP+P KEVP+IFGEW+ AD E II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  143   LPKLGVPYPFPKPHKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  202

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADAVYVKPF T+ +LI 
Sbjct  203   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAVYVKPFETDTILIA  262

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLPL  1094
             PGQTTN+LLKT   +PNA++L++ARPY TG   FDNST AG+LEY      KT+   LPL
Sbjct  263   PGQTTNLLLKTKPSYPNASFLMTARPYVTGQGTFDNSTVAGVLEYEQPKHAKTSIKNLPL  322

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQTC  1268
             F P LP  NDT+FA  F+ KLRSL +  FPANVP KVDR+FFFTVGLG  PC    NQTC
Sbjct  323   FAPVLPALNDTNFAAKFSNKLRSLNSKRFPANVPLKVDRKFFFTVGLGTTPCNHKNNQTC  382

Query  1269  QGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNI  1448
             QGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+ +FP NP V FNYTG PP N 
Sbjct  383   QGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWNPVVPFNYTGTPPNNT  442

Query  1449  MVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKF  1628
             MV + T V+ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP  F
Sbjct  443   MVRTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDPKNF  502

Query  1629  NLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             NLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    QK
Sbjct  503   NLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQK  562

Query  1809  LQPPPADLPKC  1841
             L PPP DLPKC
Sbjct  563   LLPPPVDLPKC  573



>ref|XP_008358843.1| PREDICTED: laccase-17-like [Malus domestica]
Length=580

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/552 (75%), Positives = 465/552 (84%), Gaps = 4/552 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AGIT HYKF+IK Q VTRLC TKSIVTVNG+FPGP+IIAREGD++++KVVNHV+ N++IH
Sbjct  30    AGITXHYKFEIKQQKVTRLCHTKSIVTVNGQFPGPKIIAREGDQLLIKVVNHVQNNISIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL+SGWADGPAY+TQCPIQTG SYVYNFTITGQRGTLFWHAHISWLR+T+YGP++
Sbjct  90    WHGIRQLQSGWADGPAYVTQCPIQTGNSYVYNFTITGQRGTLFWHAHISWLRSTVYGPLI  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK  V YPF +P+KEVPIIFGEWW A+ E IISQA QTGG PN+SDA+TING PGPLY
Sbjct  150   ILPKXSVPYPFTKPYKEVPIIFGEWWNABPEAIISQALQTGGGPNVSDAYTINGFPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKV+ GKTYLLRLINAALNDELFFSIANH+L VVEADA+YVKPF T  +LI
Sbjct  210   NCSAKDAFKLKVQPGKTYLLRLINAALNDELFFSIANHTLKVVEADAIYVKPFETRTILI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs--tnsnktttnkL  1088
              PGQTTNVLLKT  + PNAT+ ++ARP+ TG   FDN+T AGILEY   + +    T +L
Sbjct  270   APGQTTNVLLKTKPNFPNATFFMTARPFVTGQGTFDNTTVAGILEYDSPSKTKTLNTKRL  329

Query  1089  PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQ-NQT  1265
             PL  P LP  NDTSFAT F  KLRSL    FPANVP+KVD+ FFFT+GLG  PC Q NQ 
Sbjct  330   PLLKPNLPALNDTSFATKFANKLRSLNTPQFPANVPQKVDKHFFFTIGLGTNPCSQNNQR  389

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T FAASVNNISF  P TALLQ+HF  QS GVYT DFP NP   FNYTG PP +
Sbjct  390   CQGP-NGTMFAASVNNISFAMPNTALLQSHFSGQSSGVYTPDFPTNPITPFNYTGPPPND  448

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ TK++ L FNS VELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNKDP K
Sbjct  449   TMVSNGTKLMVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKK  508

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWGLKM W+V+DGK   Q
Sbjct  509   FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGKLPNQ  568

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  569   KLLPPPADLPKC  580



>ref|XP_010031544.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW50887.1| hypothetical protein EUGRSUZ_J00532 [Eucalyptus grandis]
Length=585

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/581 (71%), Positives = 483/581 (83%), Gaps = 9/581 (2%)
 Frame = +3

Query  114   CLFAKRFII-FVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRF  290
             C  A  F++ F+++ FC    + AL    G+TRHYKF++ +QNVTRLC TKS++T+NG++
Sbjct  9     CPLAGFFLVAFLVSCFC---PEPALVAGEGMTRHYKFNVVLQNVTRLCHTKSVITINGKW  65

Query  291   PGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYN  470
             PGP++IAREGDR++++VVNHV  N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSY+YN
Sbjct  66    PGPQVIAREGDRLLIEVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYMYN  125

Query  471   FTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTER  650
             +TI GQRGTL+WHAHISWLR+TLYGP++ILPK   +YPF +P KE+PI+FGEW+  DTE 
Sbjct  126   YTIVGQRGTLWWHAHISWLRSTLYGPLIILPKHNASYPFVKPHKEIPIVFGEWFNLDTEA  185

Query  651   IISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELF  830
             II+QA QTGG PN+S+A+TINGLPGPLYNCSAKD+++LKVK GKTYLLRLINAALNDELF
Sbjct  186   IINQALQTGGGPNVSNAYTINGLPGPLYNCSAKDTYRLKVKPGKTYLLRLINAALNDELF  245

Query  831   FSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGP  1010
             FSIANH+LTVVEADAVYVKPF T  +LI PGQTTNVLLKT  H+P A +L++ARPY TG 
Sbjct  246   FSIANHTLTVVEADAVYVKPFETETLLIAPGQTTNVLLKTKPHYPKAIFLMTARPYVTGL  305

Query  1011  APFDNSTTAGILEYstnsn----ktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
               FDNST AGILEY    +     ++  +LPLF PTLP  NDT FATNFT KLRSLA   
Sbjct  306   GTFDNSTVAGILEYKPPLDKPHWSSSIKQLPLFKPTLPPLNDTGFATNFTNKLRSLATPQ  365

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPANVP+KVD+RFFFTVGLG +PC  NQTCQGP N T F A++NN+SF  PTTALLQAH+
Sbjct  366   FPANVPQKVDQRFFFTVGLGTMPCQGNQTCQGP-NGTMFNAAINNVSFTMPTTALLQAHY  424

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
               QS  VY+ DFP+ P   FN+TG  P N  V + TK+V L FNSSVEL+MQDTSI+GAE
Sbjct  425   TGQSNRVYSPDFPSYPKSIFNFTGTSPNNTNVGNGTKLVVLPFNSSVELIMQDTSILGAE  484

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQGFGN+DPN DP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG 
Sbjct  485   SHPLHLHGFNFFVVGQGFGNFDPNNDPGKFNLVDPVERNTVGVPSGGWVAIRFLADNPGV  544

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCHLEVHTSWGLKMAW+V+DGK   QKL PPPADLPKC
Sbjct  545   WFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLPPPPADLPKC  585



>ref|XP_010443793.1| PREDICTED: laccase-17 [Camelina sativa]
Length=611

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/556 (73%), Positives = 468/556 (84%), Gaps = 8/556 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  +IKMQNVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVN V  N++IHW
Sbjct  56    GITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREGDQLLIKVVNQVPNNISIHW  115

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLF+HAHISWLRAT+YGP++I
Sbjct  116   HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFYHAHISWLRATVYGPLII  175

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPF +P KEVP+IFGEW+ AD E II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  176   LPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  235

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  236   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  295

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnk----  1085
             PGQTTNVLLKT   +P+A++ +SARPY TG   FDNST AGILEY  +      +     
Sbjct  296   PGQTTNVLLKTKPSYPSASFFMSARPYVTGQGTFDNSTVAGILEYEPSKQTKDAHSRTKI  355

Query  1086  --LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--P  1253
               LPLF PTLP  NDT+FAT F+ KLRSL + NFPANVP  VDR+FFFTVGLG  PC   
Sbjct  356   KNLPLFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  415

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
              NQTCQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+  FP +P V FNYTG 
Sbjct  416   NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  475

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNK
Sbjct  476   PPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  535

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP  FNLVDP ERNT+GVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG 
Sbjct  536   DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  595

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPPADLPKC
Sbjct  596   KPDQKLLPPPADLPKC  611



>ref|XP_011029469.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/566 (74%), Positives = 487/566 (86%), Gaps = 5/566 (1%)
 Frame = +3

Query  156   FCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvv  335
             F +V+  V       +++HYKFD+ +QNVTRLC TKS+VTVNG+FPGPRI+AREGDR+V+
Sbjct  17    FSFVTLSVNPEPALAVSKHYKFDVMLQNVTRLCHTKSMVTVNGKFPGPRIVAREGDRLVI  76

Query  336   kvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAH  515
             +VVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTL+WHAH
Sbjct  77    RVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIVGQRGTLWWHAH  136

Query  516   ISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNIS  695
             ISWLR+TLYGPI++LPK G  YPF +P+KEVPIIFGEW+ AD E II+QA QTGG PN+S
Sbjct  137   ISWLRSTLYGPIILLPKLGTTYPFAKPYKEVPIIFGEWFNADPEAIINQAMQTGGGPNVS  196

Query  696   DAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADA  875
             DA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH++TVV+ DA
Sbjct  197   DAYTINGLPGPLYNCSAKDTFKLKVKLGKTYLLRMINAALNDELFFSIANHTVTVVDVDA  256

Query  876   VYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs  1055
             VYVKPF+   +LITPGQTTNVLLKT   +PNA + +SARPYATG   FDNST AGILEY 
Sbjct  257   VYVKPFDAETLLITPGQTTNVLLKTKHDYPNAQFFMSARPYATGQGTFDNSTVAGILEYE  316

Query  1056  ----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFF  1223
                 T+ +  +T KLPL+ P LP  NDTSFATNF+ KLRSLA+A++PANVP+KVDR+F F
Sbjct  317   VPNKTSQSNHSTKKLPLYKPNLPPLNDTSFATNFSSKLRSLASADYPANVPQKVDRQFVF  376

Query  1224  TVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPAN  1403
             TVGLG  PC +NQTCQGP N T+FAASVNN+SFV PTTALLQAH F QSKGVY+  FP +
Sbjct  377   TVGLGTNPCSKNQTCQGP-NGTRFAASVNNVSFVMPTTALLQAHHFGQSKGVYSPYFPVS  435

Query  1404  PPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIG  1583
             P + FNYTG PP N MV++ TK+V L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+G
Sbjct  436   PLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVG  495

Query  1584  QGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  1763
             Q FGN+DP+KDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGL
Sbjct  496   QSFGNFDPSKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGL  555

Query  1764  KMAWIVMDGKGRKQKLQPPPADLPKC  1841
             KMAW+V+DGK   QKL PPPADLPKC
Sbjct  556   KMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_006856866.1| hypothetical protein AMTR_s00055p00190270 [Amborella trichopoda]
 gb|ERN18333.1| hypothetical protein AMTR_s00055p00190270 [Amborella trichopoda]
Length=583

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/582 (72%), Positives = 492/582 (85%), Gaps = 5/582 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             +M  +     +I VL+A   +   +A AKHAGITRHYKF+I  +N+ RLC TK +VTVNG
Sbjct  4     LMRAMAVMSVMICVLSAMGSLP-QLAEAKHAGITRHYKFNIVAENIRRLCHTKPVVTVNG  62

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             + PGP ++AREGDRV+VKVVNH +YN+TIHWHGVRQL+SGWADGPAY+TQCPIQTG++YV
Sbjct  63    QVPGPTLVAREGDRVLVKVVNHAQYNITIHWHGVRQLQSGWADGPAYVTQCPIQTGKTYV  122

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTL WHAH SWLR+T+YG IVILPK+ V +PFP+P K++PIIFGEWW  D 
Sbjct  123   YNFTITGQRGTLLWHAHASWLRSTVYGAIVILPKRHVPFPFPKPHKDIPIIFGEWWNVDP  182

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +ISQA QTGGAPN+SDA+TING PGPLYNCSAKD+F+L V+ GKTYLLRLINAALNDE
Sbjct  183   EAVISQALQTGGAPNVSDAYTINGHPGPLYNCSAKDTFRLMVEPGKTYLLRLINAALNDE  242

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANHSLTVVEADA+YVKPF+TN+V++ PGQTTNVLL T +   NAT+L+SARPYAT
Sbjct  243   LFFSIANHSLTVVEADAIYVKPFSTNVVVLAPGQTTNVLLTTKSQPANATFLMSARPYAT  302

Query  1005  GPAPFDNSTTAGILEYstnsn---ktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANA  1175
             GPA FDNSTTAGIL+Y   +     ++T+K  L +PTLP  NDT+F T+FT+KL+SLAN 
Sbjct  303   GPATFDNSTTAGILQYHQTNLTSPSSSTSKFRLLSPTLPTINDTNFVTSFTQKLKSLANN  362

Query  1176  NFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH  1355
              FPANVP+KVD++FFFTVGLG  PCP+NQTCQGP N TK  AS+NN+SFV P+ A+LQAH
Sbjct  363   QFPANVPQKVDKQFFFTVGLGTSPCPKNQTCQGP-NGTKLTASINNVSFVLPSIAMLQAH  421

Query  1356  FFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGA  1535
             F  +  GVYT DFP NPP  FNYTG+PP N MV S TK V L FN+SVE+V+QDT I+GA
Sbjct  422   FSAKLAGVYTTDFPNNPPFPFNYTGSPPNNTMVISGTKTVVLKFNTSVEVVLQDTGILGA  481

Query  1536  ESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             ESHPLHLHGFNFFV+GQGFGNYDP+KDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG
Sbjct  482   ESHPLHLHGFNFFVMGQGFGNYDPSKDPAKFNLVDPMERNTVGVPSGGWVAIRFLADNPG  541

Query  1716  AWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              WFMHCHLEVHTSWGLKMAW+VMDGK   QKL PPP+DLP+C
Sbjct  542   VWFMHCHLEVHTSWGLKMAWVVMDGKLPNQKLLPPPSDLPQC  583



>ref|XP_009354571.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=545

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/544 (76%), Positives = 462/544 (85%), Gaps = 4/544 (1%)
 Frame = +3

Query  219   FDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLR  398
               IK++NVTRLC TKSI+TVNG+FPGPRIIAREGD++++KV NHV+ N++IHWHG+RQLR
Sbjct  3     LQIKLRNVTRLCHTKSIITVNGQFPGPRIIAREGDQLLIKVANHVQNNISIHWHGIRQLR  62

Query  399   SGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVA  578
             SGWADGPAY+TQCPIQTG SYVYNFTITGQRGTLFWHAHISWLR+T+YGP++ILPK+GV 
Sbjct  63    SGWADGPAYVTQCPIQTGNSYVYNFTITGQRGTLFWHAHISWLRSTVYGPLIILPKRGVP  122

Query  579   YPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSF  758
             YPF +P+KEVPIIFGEWW AD E IISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+F
Sbjct  123   YPFTKPYKEVPIIFGEWWNADPEAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDAF  182

Query  759   KLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNV  938
             KLKV  GKTYLLRLINAALNDELFFSIANH+L VVEADAVYVKPF T  +LI PGQTTNV
Sbjct  183   KLKVHPGKTYLLRLINAALNDELFFSIANHTLKVVEADAVYVKPFETRTILIAPGQTTNV  242

Query  939   LLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs--tnsnktttnkLPLFTPTLP  1112
             LLKT  + PNAT+ ++ARPY TG   FDNST AGILEY   + +   TT +LPLF P LP
Sbjct  243   LLKTKPNFPNATFFMTARPYVTGQGTFDNSTVAGILEYESPSKTKNLTTKRLPLFKPKLP  302

Query  1113  VFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC-PQNQTCQGPTNNT  1289
               NDTSFAT F  KLRSL    FPANVP+KVD+ FFFT+GLG  PC P NQTCQGP N T
Sbjct  303   ALNDTSFATKFGNKLRSLNTQQFPANVPQKVDKNFFFTIGLGTNPCSPNNQTCQGP-NGT  361

Query  1290  KFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATK  1469
              FAAS+NNISF  P TALLQ+HF  QS GVY+ DFPANP V FNYTG PP + MV++ TK
Sbjct  362   MFAASINNISFAMPNTALLQSHFSGQSSGVYSPDFPANPIVPFNYTGTPPNDTMVSNGTK  421

Query  1470  VVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAE  1649
             +V L FNS VELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D NKDP  FNLVDP E
Sbjct  422   LVVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKDPKMFNLVDPVE  481

Query  1650  RNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPAD  1829
             RNTVGVPSGGWVAIRFLADNPG WFMHCHLE+HTSWGLKM W+V+DGK   QKL PPPAD
Sbjct  482   RNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGKLPNQKLLPPPAD  541

Query  1830  LPKC  1841
             LPKC
Sbjct  542   LPKC  545



>ref|XP_002317504.2| hypothetical protein POPTR_0011s12090g [Populus trichocarpa]
 gb|EEE98116.2| hypothetical protein POPTR_0011s12090g [Populus trichocarpa]
Length=581

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/566 (75%), Positives = 486/566 (86%), Gaps = 5/566 (1%)
 Frame = +3

Query  156   FCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvv  335
             F +V+  V       ITRHYKFD+ +QNVTRLC TKS+VTVNG+FPGPRI+AREGDR+V+
Sbjct  17    FSFVTLSVNPEPALAITRHYKFDVMLQNVTRLCHTKSMVTVNGKFPGPRIVAREGDRLVI  76

Query  336   kvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAH  515
              VVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTL+WHAH
Sbjct  77    TVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIVGQRGTLWWHAH  136

Query  516   ISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNIS  695
             ISWLR+TLYGPI++LPK G  YPF +P+KEVPIIFGEW+ AD E II+QA QTGG PN+S
Sbjct  137   ISWLRSTLYGPIILLPKLGTPYPFAKPYKEVPIIFGEWFNADPEAIINQAMQTGGGPNVS  196

Query  696   DAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADA  875
             DA+TINGLPGPLYNCSAKD+FKLKVK GKTYLLR+INAALNDELFFSIANH++TVV+ DA
Sbjct  197   DAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTVTVVDVDA  256

Query  876   VYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs  1055
             VYVKPF+   +LITPGQTTNVLLKT   +PNA + +SARPYATG   FDNST AGILEY 
Sbjct  257   VYVKPFDAETLLITPGQTTNVLLKTKPDYPNAQFFMSARPYATGQGTFDNSTVAGILEYE  316

Query  1056  ----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFF  1223
                 T+ +  +T KLPL+ P LP  NDTSFATNF+ KLRSLA+A+FPANVP+KVDR+F F
Sbjct  317   VPNKTSQSNHSTKKLPLYKPNLPPLNDTSFATNFSSKLRSLASADFPANVPQKVDRQFVF  376

Query  1224  TVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPAN  1403
             TVGLG  PC +NQTCQGP N T+FAASVNN+SFV P+TALLQAH F QS+GVY+  F  +
Sbjct  377   TVGLGTNPCSKNQTCQGP-NGTRFAASVNNVSFVMPSTALLQAHHFGQSRGVYSPYFAIS  435

Query  1404  PPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIG  1583
             P + FNYTG PP N MV++ TK+V L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+G
Sbjct  436   PLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVG  495

Query  1584  QGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGL  1763
             QGFGN+DP+KDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGL
Sbjct  496   QGFGNFDPSKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGL  555

Query  1764  KMAWIVMDGKGRKQKLQPPPADLPKC  1841
             KMAW+V+DGK   QKL PPPADLPKC
Sbjct  556   KMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_006341211.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=568

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/570 (72%), Positives = 470/570 (82%), Gaps = 8/570 (1%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             F++ +  A C       L   +  TRHYKF+IKMQNVTRLC TKSIVTVNG+FPGPRI+A
Sbjct  7     FLVSLTIASC------LLPSVSAATRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPRIVA  60

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDR+ ++VVNHV  N++IHWHG+RQ+RSGWADGPAY+TQCP      Y+YNFTI GQR
Sbjct  61    REGDRLEIEVVNHVHNNISIHWHGIRQVRSGWADGPAYVTQCPNSNWPKYLYNFTIIGQR  120

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GT +WHAHISWLR+TLYGPI+ILPKK   YPF +P+KEVPIIFGEW+ ADTE IISQA Q
Sbjct  121   GTFWWHAHISWLRSTLYGPIIILPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIISQALQ  180

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYNCS KD+FKLKVK GKTYLLRLINAALNDELFFSIANH+
Sbjct  181   TGGGPNVSDAYTINGLPGPLYNCSTKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHT  240

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             L +++AD VYVKPF TN ++ITPGQT NVLLKT  H PNAT+ ++ARPY TG   FDNST
Sbjct  241   LQIIDADGVYVKPFETNTLIITPGQTHNVLLKTKPHFPNATFYMTARPYVTGLGTFDNST  300

Query  1032  TAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDR  1211
              AGILEY  +  K     LPLF P LP  NDT+F TNFT +LRSLA+  FPANVP+ +D+
Sbjct  301   VAGILEY-ESKTKLHLKNLPLFKPLLPALNDTNFVTNFTSRLRSLASPQFPANVPQNIDK  359

Query  1212  RFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTAD  1391
             R FFTVGLG  PC QN+TCQGP N TKF+AS+NN+SF+ PTTALLQ+HFF QSKGVY  D
Sbjct  360   RLFFTVGLGTSPCDQNKTCQGP-NGTKFSASINNVSFILPTTALLQSHFFGQSKGVYKPD  418

Query  1392  FPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNF  1571
             FP +P   FNYTGNPP N +V + TK+V L FN+SVELVMQDTSI+G ESHPLHLHGFNF
Sbjct  419   FPYSPLNWFNYTGNPPNNTLVHNDTKLVVLPFNTSVELVMQDTSILGLESHPLHLHGFNF  478

Query  1572  FVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHT  1751
             FV+GQGFGN+DPNKDPS FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHT
Sbjct  479   FVVGQGFGNFDPNKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  538

Query  1752  SWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             SWGLKMAW+V +GK   QKL PPP DLPKC
Sbjct  539   SWGLKMAWLVQNGKLPNQKLPPPPMDLPKC  568



>ref|XP_011089492.1| PREDICTED: laccase-17 [Sesamum indicum]
Length=578

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/571 (73%), Positives = 477/571 (84%), Gaps = 4/571 (1%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             F++  LA F +       A+ +G TRHYKF+I++ NVTRLC+TKSI+TVNG+FPGPRI+A
Sbjct  11    FLVLFLAVFLFFG--TGTAQQSGTTRHYKFNIQLHNVTRLCKTKSIITVNGKFPGPRIVA  68

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDRVV+KVVN+V  NV+IHWHG+RQL+SGWADGPAY+TQCPIQ+GQSYVYNFTI GQR
Sbjct  69    REGDRVVIKVVNNVSNNVSIHWHGIRQLQSGWADGPAYVTQCPIQSGQSYVYNFTIIGQR  128

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GTLFWHAHISWLRATLYGPIVILPKK  +YPFP+P KEVP+IFGEWW ADTE +ISQA Q
Sbjct  129   GTLFWHAHISWLRATLYGPIVILPKKNASYPFPKPHKEVPVIFGEWWNADTEAVISQALQ  188

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYNCSA ++FKLKVK GKTYLLRLINAALNDELFFSI+NH+
Sbjct  189   TGGGPNVSDAYTINGLPGPLYNCSANETFKLKVKPGKTYLLRLINAALNDELFFSISNHT  248

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             LTVVEADA+Y+KPF T+I++I PGQTTNVLL+T  +  N+T+L++ARPY TG   FDN+T
Sbjct  249   LTVVEADAIYIKPFETDILVIAPGQTTNVLLRTKPNPTNSTFLMAARPYFTGQGTFDNTT  308

Query  1032  TAGILEYstnsnktttnkL-PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
              AGILEY   S K     +  L  PTLP  N TSF  NF+ K RSLANA FPANVP+ VD
Sbjct  309   VAGILEYKLPSQKALDAPINSLQIPTLPPINATSFVANFSSKFRSLANARFPANVPQTVD  368

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             ++FFFTVGLG  PCP+NQTCQGP N TKFAASVNNISF  PTTALLQA+F  +S GVY  
Sbjct  369   KKFFFTVGLGSSPCPKNQTCQGP-NGTKFAASVNNISFTNPTTALLQAYFSRRSNGVYNT  427

Query  1389  DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFN  1568
             DFP+ P + FNYTG PP N  V + TK+V L FNS+VE+V+QDTSI+GAESHPLHLHG+N
Sbjct  428   DFPSFPLMPFNYTGTPPNNTGVANGTKLVVLPFNSTVEVVLQDTSILGAESHPLHLHGYN  487

Query  1569  FFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVH  1748
             FFV+GQGFGN+DP KDP  FNLVDP ERNT+GVPSGGW AIRF ADNPG WFMHCH EVH
Sbjct  488   FFVVGQGFGNFDPQKDPPNFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  547

Query  1749  TSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              SWGLKMAWIV+DGK   QKL PPP+DLPKC
Sbjct  548   LSWGLKMAWIVLDGKLPNQKLPPPPSDLPKC  578



>ref|XP_008222248.1| PREDICTED: laccase-2 [Prunus mume]
Length=587

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/573 (72%), Positives = 480/573 (84%), Gaps = 6/573 (1%)
 Frame = +3

Query  141   FVLAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             F+LA  C W   + + A  +G+TRHYKFDIK++NVTRLCQTKSIV VNG+FPGPRIIARE
Sbjct  15    FLLALSCFWSLPEFSAAAASGVTRHYKFDIKLKNVTRLCQTKSIVAVNGKFPGPRIIARE  74

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR++VKVVNHV+ N+++HWHG+RQL+SGWADGP+YITQCPIQT QSYVYNFTITGQRGT
Sbjct  75    GDRILVKVVNHVQNNISLHWHGIRQLQSGWADGPSYITQCPIQTNQSYVYNFTITGQRGT  134

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             LFWHAHISWLRAT+YGP++ILPK   +YPFP+P KEVPIIFGEWWKAD E +I QA QTG
Sbjct  135   LFWHAHISWLRATVYGPLIILPKHNASYPFPKPHKEVPIIFGEWWKADPEAVIRQALQTG  194

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
               PN+S+A+TINGLPGPLYNCS KD+F+LKVK GKTYLLRLINAA+NDELFFSIANHSLT
Sbjct  195   AGPNVSEAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLINAAVNDELFFSIANHSLT  254

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADA+YVKPF T+I+LITPGQTTNVLL+T   +PNAT+L+ ARPY TG   FDNST A
Sbjct  255   VVEADALYVKPFKTDILLITPGQTTNVLLRTKPSYPNATFLMLARPYFTGMGTFDNSTVA  314

Query  1038  GILEYstnsnktttnkL---PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVD  1208
             GILEY   SN + +  L   PL  PTLP  N TSF  NF+ K RSLAN+ FPANVPK V 
Sbjct  315   GILEYKNPSNPSASTSLKNPPLLKPTLPQINATSFVANFSAKFRSLANSKFPANVPKTVQ  374

Query  1209  RRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTA  1388
             +RFFFTVGLG  PCP+NQTCQGP N++KFAAS NNISF+ PTTALLQ+HFF +S GV+T 
Sbjct  375   KRFFFTVGLGTNPCPKNQTCQGPNNSSKFAASFNNISFILPTTALLQSHFFGKSNGVFTT  434

Query  1389  DFPANPPVKFNYTGNP--PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             DFP NP   FNYTG P   TN  V++ TK V L FN+SVE+V+Q T I+GAESHP+HLHG
Sbjct  435   DFPTNPLQPFNYTGTPSNNTNTNVSNGTKAVVLKFNTSVEVVLQGTGILGAESHPVHLHG  494

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             FNFFV+GQGFGN++PNKDP+ FNLVDP ERNT+GVPSGGW AIRFLADNPG W +HCH +
Sbjct  495   FNFFVVGQGFGNFNPNKDPASFNLVDPVERNTIGVPSGGWAAIRFLADNPGVWLLHCHFD  554

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VH SWGL+MAW+V DGK   QKL PPP+DLPKC
Sbjct  555   VHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  587



>ref|XP_010535559.1| PREDICTED: laccase-17 [Tarenaya hassleriana]
Length=580

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/555 (73%), Positives = 473/555 (85%), Gaps = 8/555 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHYK +IKMQNVTRLC T+SIV+VNG+FPGPR++AREGDR+++KV+NHV  N+++HW
Sbjct  27    GITRHYKLEIKMQNVTRLCHTRSIVSVNGQFPGPRLVAREGDRLLIKVMNHVPNNISMHW  86

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL++HAHISWLR+TLYGPI+I
Sbjct  87    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGTLWYHAHISWLRSTLYGPIII  146

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPF +P+KEVP+IFGEW+ AD E II+QA QTGG PN+SDA+TINGLPGPLYN
Sbjct  147   LPKYGVPYPFEKPYKEVPMIFGEWFNADPEAIINQALQTGGGPNVSDAYTINGLPGPLYN  206

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKL+V+ GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  207   CSAKDTFKLRVRPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  266

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs------tnsnkttt  1079
             PGQTTNVLLKT   +P+AT+L++ARPY TG   FDNST AGILEY          +KT+ 
Sbjct  267   PGQTTNVLLKTKPKYPSATFLMTARPYVTGQGTFDNSTVAGILEYEQPRNAKAIHSKTSI  326

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCP-Q  1256
               LPLF P LP  NDT+FAT F  +LRSL +  +PANVPK+VD++FFFTVGLG  PC  +
Sbjct  327   KNLPLFKPVLPALNDTNFATKFVNQLRSLDSKKYPANVPKEVDQKFFFTVGLGTNPCSTK  386

Query  1257  NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNP  1436
             NQTCQGP N T FAAS+NNISF  PT ALLQ+H+F +S GVY  DFP +P   FNYTGNP
Sbjct  387   NQTCQGP-NGTMFAASINNISFTMPTAALLQSHYFGRSNGVYRTDFPFDPLFPFNYTGNP  445

Query  1437  PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKD  1616
             P N MV++ TK++ L FN+SVELVMQDTSI+G ESHPLHLHGFNFFV+GQGFGN++P KD
Sbjct  446   PNNTMVSNGTKLLVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNFNPKKD  505

Query  1617  PSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKG  1796
             P  FN+VDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DG  
Sbjct  506   PKNFNVVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDK  565

Query  1797  RKQKLQPPPADLPKC  1841
               QKL PPPADLPKC
Sbjct  566   SNQKLLPPPADLPKC  580



>ref|XP_010256880.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=583

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/559 (75%), Positives = 474/559 (85%), Gaps = 6/559 (1%)
 Frame = +3

Query  180   ALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvky  359
             AL   A ITRHYKFDI++QNVTRLCQTKSI TVNG+FPGPRI+AREGDRVVVKV+NHV++
Sbjct  26    ALLVQASITRHYKFDIRLQNVTRLCQTKSIATVNGQFPGPRIVAREGDRVVVKVINHVQH  85

Query  360   nvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATL  539
             NVT+HWHG+RQL+SGWADGPAY+TQCPIQTGQ+YVYNFTI+GQ GTLFWHAHISWLRATL
Sbjct  86    NVTLHWHGIRQLQSGWADGPAYVTQCPIQTGQAYVYNFTISGQTGTLFWHAHISWLRATL  145

Query  540   YGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGL  719
             YGPI+ILPK   +YPFP+P+KEV +IFGEWW AD E +I+QA QTGG PN+SDA+TINGL
Sbjct  146   YGPIIILPKPNASYPFPKPYKEVTMIFGEWWNADPEAVITQALQTGGGPNVSDAYTINGL  205

Query  720   PGPLYNCSAKDSFKLKVK-AGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFN  896
             PGP YNCSA+D+FKLKVK  GK YLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF+
Sbjct  206   PGPFYNCSARDTFKLKVKPGGKIYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFD  265

Query  897   TNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst----ns  1064
             T+ ++ITPGQTTNVL+KT  H P+AT+L++ARPY +G   FDNSTTAGILEY      +S
Sbjct  266   TDNLVITPGQTTNVLVKTKPHFPSATFLMAARPYFSGLGTFDNSTTAGILEYQKPSYNSS  325

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
                   +LPLF PTLP   DTS  +NFT + RSLA A FPANVP+ VD+RFFFTVG+G I
Sbjct  326   VSINNKQLPLFQPTLPAITDTSVVSNFTNRFRSLATAQFPANVPQSVDKRFFFTVGIGSI  385

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PCPQNQTCQGP N  K A  VNNISFV PTTA+L+AHF  QSKGVYT DFP NPP  FNY
Sbjct  386   PCPQNQTCQGP-NGIKLAGYVNNISFVLPTTAILEAHFLGQSKGVYTTDFPTNPPFPFNY  444

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG PP N MVT+ TK   L FN+SVELVMQ TS +G E+HPLHLHGFNFFV+GQGFGN+D
Sbjct  445   TGTPPNNTMVTTGTKAAVLPFNTSVELVMQGTSTLGTENHPLHLHGFNFFVVGQGFGNFD  504

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             PNKDP  FNLVDP ERNTVGVP+GGW+AIRFLADNPGAWFMHCH E HTSWGL+M WIV+
Sbjct  505   PNKDPPNFNLVDPIERNTVGVPAGGWIAIRFLADNPGAWFMHCHFEAHTSWGLRMVWIVL  564

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DGK   +KL PPP+DLPKC
Sbjct  565   DGKLPNKKLPPPPSDLPKC  583



>ref|XP_006370270.1| hypothetical protein POPTR_0001s41160g [Populus trichocarpa]
 gb|ERP66839.1| hypothetical protein POPTR_0001s41160g [Populus trichocarpa]
Length=581

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/552 (74%), Positives = 469/552 (85%), Gaps = 5/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHYKFD+ +QNVTRLC TKS+VTVNG+FPGP I+AREGDR+++KVVNHV+ N++IHW
Sbjct  31    AITRHYKFDVMLQNVTRLCHTKSMVTVNGKFPGPCIVAREGDRLLIKVVNHVQNNISIHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAY+TQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR+TLYGP++I
Sbjct  91    HGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLII  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK G  YPF +P KEVPIIFGEW+ AD E II+QA QTGG PN+SDA+TINGLPGPLYN
Sbjct  151   LPKLGTPYPFAKPDKEVPIIFGEWFNADPEAIINQAMQTGGGPNVSDAYTINGLPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAK++FKLKVK GKTYLLRLINAALN+ELFFSIANH+LTVV  DA+YVKPF+T  +LI 
Sbjct  211   CSAKNTFKLKVKPGKTYLLRLINAALNEELFFSIANHTLTVVGVDAIYVKPFDTETLLIA  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstn----snktttnk  1085
              GQTT+VLLKT  HHP+A + +SARPY TG   FDNST AGILEY        +  T+ +
Sbjct  271   SGQTTDVLLKTKPHHPDAKFFMSARPYVTGQGTFDNSTVAGILEYEVARKTIQSSHTSKR  330

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             LPL+ P LP  NDTSFATNFT KLRSLA+A FPANVP+KVDR FFFTVGLG  PC +NQT
Sbjct  331   LPLYKPNLPPLNDTSFATNFTSKLRSLASAEFPANVPQKVDRHFFFTVGLGTNPCSKNQT  390

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N T+FAASVNN+SFV PT ALL+AH F QSKGVY+ +FP +P + F+YTG P  N
Sbjct  391   CQGP-NGTRFAASVNNVSFVMPTKALLEAHHFGQSKGVYSPNFPISPLIPFDYTGTPQNN  449

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV+  TK+V L FN+SVEL+MQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP+ 
Sbjct  450   TMVSHGTKLVMLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDPAN  509

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGWVAIRFLADNPG WF+HCH+E+H SWGL MAW+V+DGK    
Sbjct  510   FNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFLHCHVELHMSWGLMMAWVVLDGKLPNH  569

Query  1806  KLQPPPADLPKC  1841
             +L PPP DLPKC
Sbjct  570   RLLPPPVDLPKC  581



>ref|XP_011019845.1| PREDICTED: laccase-2-like [Populus euphratica]
Length=580

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/565 (72%), Positives = 467/565 (83%), Gaps = 0/565 (0%)
 Frame = +3

Query  147   LAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDR  326
             L  FC+    +     A ITR Y F+I  +N TRLC T+S+VTVNG+FPGPR++AREGD+
Sbjct  16    LQLFCFFIFSLVPDFAAAITRQYTFNITYKNFTRLCHTRSLVTVNGKFPGPRLVAREGDQ  75

Query  327   vvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFW  506
             V+VKVVNHV  N+TIHWHGVRQL SGWADGPAYITQCPIQTGQ+Y YNFTITGQRGTL W
Sbjct  76    VLVKVVNHVAENITIHWHGVRQLTSGWADGPAYITQCPIQTGQAYTYNFTITGQRGTLLW  135

Query  507   HAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAP  686
             HAHISWLR++LYGPI+ILPK   +YPF +P+KE+PI+FGEW+  D E +I+QA QTG  P
Sbjct  136   HAHISWLRSSLYGPIIILPKLNESYPFKKPYKEIPILFGEWFNVDPEAVIAQALQTGAGP  195

Query  687   NISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVE  866
             N+SDA+TINGLPGPLYNCSAKD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVE
Sbjct  196   NVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVE  255

Query  867   ADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGIL  1046
             ADAVYVKPF  + +LITPGQTTNVLLKT  H PNAT+ + A PY +G   FDNSTTAG L
Sbjct  256   ADAVYVKPFEADTLLITPGQTTNVLLKTKPHLPNATFYMFAGPYFSGMGSFDNSTTAGFL  315

Query  1047  EYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFT  1226
              Y   S      KLP   PTLP  N T F  NFTKK RSLANA FPANVP+ VDR+FFFT
Sbjct  316   VYKHPSGNNHLKKLPSLKPTLPPTNATGFVANFTKKFRSLANAKFPANVPQTVDRKFFFT  375

Query  1227  VGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANP  1406
             VGLG  PCP+N TCQGP NNTKFAAS+NN+SFV P+ ALLQ++FF QS GV+T+DFP NP
Sbjct  376   VGLGTHPCPKNTTCQGPNNNTKFAASINNVSFVLPSVALLQSYFFGQSNGVFTSDFPQNP  435

Query  1407  PVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQ  1586
              + FNYTG PP N MV++ TK V L+FN+SVELVMQ TSI+GAESHPLHLHG+NFFV+GQ
Sbjct  436   TIPFNYTGTPPNNTMVSNGTKTVVLAFNTSVELVMQGTSILGAESHPLHLHGYNFFVVGQ  495

Query  1587  GFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLK  1766
             GFGNYDPNKDPS FNLVDP ERNT GVP+GGWVAIRFLADNPG WFMHCHL+VHTSWGL+
Sbjct  496   GFGNYDPNKDPSNFNLVDPVERNTAGVPAGGWVAIRFLADNPGLWFMHCHLDVHTSWGLR  555

Query  1767  MAWIVMDGKGRKQKLQPPPADLPKC  1841
             MAWIV+DG    QK+ PPP+DLPKC
Sbjct  556   MAWIVLDGPQPNQKIPPPPSDLPKC  580



>ref|XP_004294637.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=584

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/580 (72%), Positives = 479/580 (83%), Gaps = 12/580 (2%)
 Frame = +3

Query  120   FAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGP  299
             F + F++ VL   C +S ++A A    IT+HYKF+IK+QNVTRLC TKSIVTVNG+FPGP
Sbjct  11    FFRLFLLSVLT-LC-LSSELAAAS---ITKHYKFEIKLQNVTRLCHTKSIVTVNGQFPGP  65

Query  300   RIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTI  479
             RI+AREGD +++KVVNHV  N++IHWHG+RQLRSGWADGPAY+TQCPIQTG SYVYN+TI
Sbjct  66    RIVAREGDNLLIKVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGNSYVYNYTI  125

Query  480   TGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIIS  659
              GQRGTL+WHAH+SWLR+T+YGP++ILPK+G  YPF +P+KEVPIIFGEWW AD E +I+
Sbjct  126   VGQRGTLWWHAHLSWLRSTVYGPLIILPKRGAPYPFIKPYKEVPIIFGEWWNADPEAVIN  185

Query  660   QASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSI  839
             QA QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKV+AGKTYLLRLIN ALNDELFFSI
Sbjct  186   QALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVQAGKTYLLRLINGALNDELFFSI  245

Query  840   ANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPF  1019
             ANH+L VVE DAVYVKPF TN +LITPGQTTNVLLKT  + PNAT+L++ARPY TG   F
Sbjct  246   ANHTLKVVETDAVYVKPFKTNTILITPGQTTNVLLKTKPNFPNATFLMTARPYVTGLGTF  305

Query  1020  DNSTTAGILEYstnsnktt--tnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANV  1193
             DNST AGILEY   +  +T    KLPL  P LP  NDTSF T F  KLRSL    FPANV
Sbjct  306   DNSTVAGILEYEATTLHSTLPMKKLPLHKPILPALNDTSFVTKFVSKLRSLNTPQFPANV  365

Query  1194  PKKVDRRFFFTVGLGVIPCPQ----NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFF  1361
             P+KVD+  FFTVGLG  PC Q    NQTCQGP N T FAAS+NN+SF  PTTALLQ+HF 
Sbjct  366   PQKVDKHLFFTVGLGSNPCSQQQNSNQTCQGP-NGTMFAASINNVSFTMPTTALLQSHFS  424

Query  1362  NQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAES  1541
              QSKGVY++DFP +P   FNYTG P  N  V + TK++ L FN+SVELV+Q TSI+GAES
Sbjct  425   GQSKGVYSSDFPISPLTPFNYTGPPLNNTNVGNGTKLMVLPFNTSVELVLQGTSILGAES  484

Query  1542  HPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAW  1721
             HPLHLHGFNFFV+GQGFGN+D NKDP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG W
Sbjct  485   HPLHLHGFNFFVVGQGFGNFDQNKDPKKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVW  544

Query  1722  FMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             FMHCHLEVHTSWGLKMAW+V+DGK   QKL PPP+DLP C
Sbjct  545   FMHCHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPSDLPTC  584



>emb|CAN73336.1| hypothetical protein VITISV_033042 [Vitis vinifera]
Length=547

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/569 (73%), Positives = 465/569 (82%), Gaps = 35/569 (6%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             ++F++    W   +  LA  +GITRHYKF+I++QNVTRLC TKSIV+VNG+FPGP IIAR
Sbjct  14    VLFLVLNSLWFLPE--LANGSGITRHYKFNIELQNVTRLCHTKSIVSVNGQFPGPPIIAR  71

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDRVVVKVVNHV+ NVTIHWHGVRQLRSGWADGPAY+TQCPIQTGQ+YVYNFTITGQRG
Sbjct  72    EGDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  131

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLR+TLYGPI+I PKK V YPF +P+KEVPIIFGEWW  D E +I+QA Q 
Sbjct  132   TLFWHAHISWLRSTLYGPIIIFPKKNVPYPFAKPYKEVPIIFGEWWNTDPEAVITQALQN  191

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSA+D+FKLKVK GKTYLLRLINAALNDELFFSIANH+L
Sbjct  192   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  251

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVV+ DA+YVKPF T+ +LITPGQTTN+LLK   H PNAT+L++ARPYATG   FDNST 
Sbjct  252   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  311

Query  1035  AGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             A                                  NFT+KLRSLAN  FPANVP+KVD+R
Sbjct  312   AA---------------------------------NFTRKLRSLANTQFPANVPQKVDKR  338

Query  1215  FFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADF  1394
             FFFTVGLG  PCPQNQTCQGP N+T F+ASVNN+SFV PTTA+LQAHFF QS GVYT DF
Sbjct  339   FFFTVGLGTNPCPQNQTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDF  398

Query  1395  PANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFF  1574
             PA P   FNYTG PP N MV++ TKVV L FN+SVELV+QDTSI+G ESHPLHLHGFNFF
Sbjct  399   PATPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFF  458

Query  1575  VIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTS  1754
             V+GQGFGN+D  KDPSKFNLVDP ERNTVGVPSGGWVAIRFLADNPG W MHCHLEVHTS
Sbjct  459   VVGQGFGNFDAKKDPSKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEVHTS  518

Query  1755  WGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WGLKM  IV DGK   QKL PPP+DLPKC
Sbjct  519   WGLKMGXIVKDGKMPNQKLPPPPSDLPKC  547



>ref|XP_002308164.1| hypothetical protein POPTR_0006s08740g [Populus trichocarpa]
 gb|EEE91687.1| hypothetical protein POPTR_0006s08740g [Populus trichocarpa]
Length=580

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/549 (73%), Positives = 463/549 (84%), Gaps = 0/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITR Y F+I  +N TRLC T+S+VTVNG+FPGPR++AREGD+V+VKVVNHV  N+TIH
Sbjct  32    AAITRQYTFNITHKNFTRLCHTRSLVTVNGQFPGPRLVAREGDQVLVKVVNHVAENITIH  91

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQL +GWADGPAY+TQCPIQTGQ+Y YNFTITGQRGTL WHAHISWLR++LYGPI+
Sbjct  92    WHGVRQLTTGWADGPAYVTQCPIQTGQAYTYNFTITGQRGTLLWHAHISWLRSSLYGPII  151

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK   +YPF +P+KE+PI+FGEW+  D E +I+QA QTG  PN+SDA+TINGLPGPLY
Sbjct  152   ILPKLNESYPFKKPYKEIPILFGEWFNVDPEAVIAQALQTGAGPNVSDAYTINGLPGPLY  211

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF  + +LI
Sbjct  212   NCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFEADTLLI  271

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             +PGQTTNVLLKT  H PNAT+ + A PY +G   FDNSTTAG+L Y   S+     KLP 
Sbjct  272   SPGQTTNVLLKTKPHLPNATFYMFAGPYFSGMGSFDNSTTAGVLVYKHPSSNNHLKKLPT  331

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               PTLP  N T F  NFTKK RSLANA FPANVP+ VDR+FFFTVGLG  PCP+N TCQG
Sbjct  332   LKPTLPPINATGFVANFTKKFRSLANAKFPANVPQTVDRKFFFTVGLGTNPCPKNTTCQG  391

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P NNTKFAAS+NN+SFV P+ ALLQ++FF QS GV+T+DFP NP + FNYTG PP N MV
Sbjct  392   PNNNTKFAASINNVSFVLPSVALLQSYFFGQSNGVFTSDFPQNPTIPFNYTGTPPNNTMV  451

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
             ++ TK V L+FN+SVELVMQ TSI+ AESHPLHLHGFNFFV+GQGFGNYDPNKDPS FNL
Sbjct  452   SNGTKAVVLTFNTSVELVMQGTSIVAAESHPLHLHGFNFFVVGQGFGNYDPNKDPSNFNL  511

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
             VDP ERNT GVP+GGW+AIRFLADNPG WFMHCHL+VHTSWGL+MAWIV+DG    QK+ 
Sbjct  512   VDPMERNTAGVPAGGWIAIRFLADNPGVWFMHCHLDVHTSWGLRMAWIVLDGPQPNQKIP  571

Query  1815  PPPADLPKC  1841
             PPP+DLPKC
Sbjct  572   PPPSDLPKC  580



>ref|XP_009419259.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=581

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/553 (75%), Positives = 472/553 (85%), Gaps = 4/553 (1%)
 Frame = +3

Query  192   HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTI  371
              +GITRHYKFD++M NVTRLC TKSIVTVNG+FPGPRI+AREGDRV VKV+NHV YNVTI
Sbjct  30    QSGITRHYKFDVQMANVTRLCSTKSIVTVNGQFPGPRIVAREGDRVAVKVINHVPYNVTI  89

Query  372   HWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPI  551
             HWHGVRQLRSGWADGPAY+TQCPI TG+SYVYNFTI GQRGTLFWHAHISWLRATLYGPI
Sbjct  90    HWHGVRQLRSGWADGPAYVTQCPIPTGRSYVYNFTIVGQRGTLFWHAHISWLRATLYGPI  149

Query  552   VILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPL  731
             +ILP+ GV YPF +P++EVP+IFGEWWKADTE II QA QTGG PN+SDA+TINGLPGPL
Sbjct  150   IILPELGVPYPFTKPYREVPVIFGEWWKADTEAIIHQALQTGGGPNVSDAYTINGLPGPL  209

Query  732   YNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVL  911
             YNCSAKD+FKLKVK GKTYLLRLINAALN+ELFFSIANH++TVV+ D VYVKPF+   +L
Sbjct  210   YNCSAKDTFKLKVKPGKTYLLRLINAALNNELFFSIANHTVTVVDVDGVYVKPFDAETLL  269

Query  912   ITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY---stnsnktttn  1082
             I+PGQTT+VLL    ++P+A + ++AR YATG   FDNST A +LEY   S +S    T 
Sbjct  270   ISPGQTTDVLLHAKPYYPDAMFFMTARSYATGSGTFDNSTVAAVLEYQNPSRSSPAVFTK  329

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
              LPL  PTLP FNDTSFA NFT +LRSLA   FPANVP+ VDRRF FTVGLG  PCP+NQ
Sbjct  330   NLPLHKPTLPAFNDTSFAANFTGRLRSLATTRFPANVPQTVDRRFLFTVGLGTSPCPKNQ  389

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGP N TKF+A+VNNISF  PTTALLQAHFF QS+ VY+ DFP  P + FNYTG PP 
Sbjct  390   TCQGP-NGTKFSATVNNISFASPTTALLQAHFFGQSRNVYSPDFPVVPLMPFNYTGTPPN  448

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N MV++ TK+V L FN+SVELVMQDTSI+G ESHPLHLHG+NFFV+GQGFGNYDP  DP+
Sbjct  449   NTMVSNGTKLVVLPFNTSVELVMQDTSILGTESHPLHLHGYNFFVVGQGFGNYDPANDPA  508

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
             KFNLVDPAERNTVGVP+GGWVAIRFLADNPG WFMHCH+E H SWGLKMAW+V+DG+   
Sbjct  509   KFNLVDPAERNTVGVPAGGWVAIRFLADNPGVWFMHCHIEAHMSWGLKMAWLVLDGELPN  568

Query  1803  QKLQPPPADLPKC  1841
             QKL PPP+DLPKC
Sbjct  569   QKLPPPPSDLPKC  581



>ref|XP_010541373.1| PREDICTED: laccase-17 [Tarenaya hassleriana]
Length=649

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/578 (70%), Positives = 483/578 (84%), Gaps = 9/578 (2%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRII  308
             F ++ L  +  V   + L + A GITRHYK +IKMQNVTRLC T+SIV+VNG+FPGPR++
Sbjct  73    FTVYQLLFYVLVCILIVLPRPAFGITRHYKLEIKMQNVTRLCHTRSIVSVNGQFPGPRLV  132

Query  309   AREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQ  488
             AREGDR+++KVVNHV  N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQ
Sbjct  133   AREGDRLLIKVVNHVSNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIIGQ  192

Query  489   RGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQAS  668
             RGTL++HAH+SWLR+T+YGP++ILPK+GV YPF +P+KE+P+IFGEW+ AD E II+QA 
Sbjct  193   RGTLWYHAHVSWLRSTIYGPLIILPKRGVPYPFAKPYKEIPMIFGEWFNADPEAIINQAL  252

Query  669   QTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANH  848
             +TGG PN+SDA+TINGLPGPLYNCSAKD+F+L+V+ GKTYLLRL+NAALNDELFFSIANH
Sbjct  253   KTGGGPNVSDAYTINGLPGPLYNCSAKDTFRLRVRPGKTYLLRLMNAALNDELFFSIANH  312

Query  849   SLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNS  1028
             ++TVVEADA+YVKPF T+ +LI PGQTTNVLLKT + +P A++ ++ARPY TG   FDNS
Sbjct  313   TVTVVEADAIYVKPFETDTILIAPGQTTNVLLKTKSQYPKASFFMTARPYVTGQGTFDNS  372

Query  1029  TTAGILEYs------tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPAN  1190
             T AGILEY          +KT+   L L  P LP  NDT+FAT F  KLRSL +  FPA 
Sbjct  373   TVAGILEYEPPKSTKAIHSKTSIKNLQLLKPVLPALNDTNFATAFINKLRSLNSKRFPAT  432

Query  1191  VPKKVDRRFFFTVGLGVIPCPQ-NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQ  1367
             VPK+VD++FFFTVGLG  PC Q NQ+CQGP N T FAASVNNISF+ PTTALLQ+H+  Q
Sbjct  433   VPKEVDQKFFFTVGLGTNPCSQKNQSCQGP-NGTMFAASVNNISFIMPTTALLQSHYSGQ  491

Query  1368  SKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP  1547
             S GVY+  FP +P + FNYTGNPP N MV++ TK++ L FN+SVELVMQDTSI+GAESHP
Sbjct  492   SHGVYSPYFPHDPLIPFNYTGNPPNNTMVSNGTKLLVLPFNTSVELVMQDTSILGAESHP  551

Query  1548  LHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  1727
             LHLHGFNFFV+GQGFGN+DP KDP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFM
Sbjct  552   LHLHGFNFFVVGQGFGNFDPKKDPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFM  611

Query  1728  HCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HCHLEVHTSWGLKMAW+V+DG    QKL PPPADLP+C
Sbjct  612   HCHLEVHTSWGLKMAWLVLDGDTPDQKLLPPPADLPRC  649



>ref|XP_010483648.1| PREDICTED: laccase-17-like [Camelina sativa]
Length=611

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/576 (71%), Positives = 476/576 (83%), Gaps = 12/576 (2%)
 Frame = +3

Query  141   FVLAAFCWVSGDVALAKHA-GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
              +LA F +V   + L + A GITRHY  +IKMQNVTRLC TKS+V+VNG+FPGP++IARE
Sbjct  39    LLLAIFSFV---LLLPQPAFGITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  95

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD++++KVVN V  N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGT
Sbjct  96    GDQLLIKVVNQVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  155

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             LF+HAHISWLRAT+YGP++ILPK+GV YPF +P KEVP+IFGEW+ AD E II QA+QTG
Sbjct  156   LFYHAHISWLRATVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTG  215

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDA+TINGLPGPLYNCSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++T
Sbjct  216   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  275

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADA+YVKPF T+ +LI PGQTTNVLLKT   +P+A++ +SARPY TG   FDNST A
Sbjct  276   VVEADAIYVKPFETDTILIAPGQTTNVLLKTKPSYPSASFFMSARPYVTGQGTFDNSTVA  335

Query  1038  GILEYstnsnktttnkL------PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPK  1199
             GILEY  +      +         +F PTLP  NDT+FAT F+ KLRSL + NFPANVP 
Sbjct  336   GILEYEPSKQTKDAHSRTNIKNHQVFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVPL  395

Query  1200  KVDRRFFFTVGLGVIPC--PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
              VDR+FFFTVGLG  PC    NQTCQGPTN T FAAS++NISF  PT ALLQ+H+  QS 
Sbjct  396   NVDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSH  455

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVY+  FP +P V FNYTG PP N MV++ T ++ L +N+SVELVMQDTSI+GAESHPLH
Sbjct  456   GVYSPKFPWSPIVPFNYTGTPPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLH  515

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGN+DPNKDP  FNLVDP ERNT+GVPSGGW AIRFLADNPG WFMHC
Sbjct  516   LHGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHC  575

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HLEVHTSWGL+MAW+V+DG    QKL PPPADLPKC
Sbjct  576   HLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  611



>ref|XP_009414328.1| PREDICTED: laccase-17-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/550 (75%), Positives = 469/550 (85%), Gaps = 5/550 (1%)
 Frame = +3

Query  204   TRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHG  383
             TR YKFDI++QNVTRLC+T+SIVTVNG+FPGP+I+AREGDRVVVKVVNHV  NVTIHWHG
Sbjct  34    TRRYKFDIRLQNVTRLCRTRSIVTVNGKFPGPKIMAREGDRVVVKVVNHVTNNVTIHWHG  93

Query  384   VRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILP  563
             VRQLR+GW DGPAY+TQCPI+TGQS+VYNFTI GQRGTLFWHAHISW+RATLYGPIVILP
Sbjct  94    VRQLRTGWYDGPAYVTQCPIRTGQSFVYNFTIVGQRGTLFWHAHISWMRATLYGPIVILP  153

Query  564   KKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCS  743
             K+GV YPFP+P+KE+P+IFGEW+  D E II+QA +TG  PNISDA+TINGLPGPLYNCS
Sbjct  154   KRGVPYPFPKPYKEIPVIFGEWFNVDPEAIIAQALRTGAGPNISDAYTINGLPGPLYNCS  213

Query  744   AKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPG  923
              KD+F+LKVK GKTYLLR+INAALNDELFFSIANH+LTVV+ DAVYVKPF  +IV I PG
Sbjct  214   KKDTFELKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDVDAVYVKPFEADIVHIAPG  273

Query  924   QTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs---tnsnktttnkLPL  1094
             QTTNVLL T    P+AT+L++ARPYATG   FDN+TTAG+L Y     +S+ +    L L
Sbjct  274   QTTNVLLHTKPSPPDATFLMAARPYATGSGTFDNTTTAGLLVYLPPNASSSSSHVKNLAL  333

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
             F PTLP  NDT++ TN+T KLRSLA+A FPANVPK V+RRF+FTVGLG  PC +NQTCQG
Sbjct  334   FRPTLPALNDTAYTTNYTGKLRSLASAQFPANVPKTVERRFYFTVGLGTSPCAKNQTCQG  393

Query  1275  PTNNTKFAASVNNISFVQPTT-ALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             P N TKFAASVNNISF  PT+ ALLQAH+F Q+KGVY  DFP  PP  FNYTG PP +  
Sbjct  394   P-NGTKFAASVNNISFALPTSAALLQAHYFGQTKGVYDTDFPDTPPFPFNYTGTPPNDTF  452

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             VT+ATKVV L FN+SVELVMQDTSI GAESHPLHLHGFNFFV+G GFGNYDP+KDP +FN
Sbjct  453   VTNATKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGFNFFVVGTGFGNYDPSKDPRRFN  512

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             L DP ERNTVGVP GGWVAIRFLADNPG WFMHCHLEVHTSWGL+MAW+V DG    QKL
Sbjct  513   LADPIERNTVGVPVGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWVVNDGWLPNQKL  572

Query  1812  QPPPADLPKC  1841
              PPP+DLP+C
Sbjct  573   VPPPSDLPRC  582



>ref|XP_010455850.1| PREDICTED: laccase-17-like [Camelina sativa]
Length=577

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/556 (72%), Positives = 466/556 (84%), Gaps = 8/556 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              ITRHY  +IKMQNVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVN V  N++IHW
Sbjct  22    AITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREGDQLLIKVVNQVPNNISIHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLR+GWADGPAYITQCPIQTGQSYVYN+TI GQRGTLF+HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRTGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPF +P KEVP+IFGEW+ AD E II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnk------ttt  1079
             PGQTTNVLLKT   +P+A++ +SARPY TG   FDNST AGILEY  +         T  
Sbjct  262   PGQTTNVLLKTKPSYPSASFFMSARPYVTGQGTFDNSTVAGILEYEPSKQTKDDHSRTKI  321

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--P  1253
               LPLF PTLP  NDT+FAT F+ KLRSL + NFPANVP  VDR+FFFTVGLG  PC   
Sbjct  322   KNLPLFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  381

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
              NQTCQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+  FP +P V FNYTG 
Sbjct  382   NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D NK
Sbjct  442   PPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDANK  501

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP  FNLVDP ERNT+GVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG 
Sbjct  502   DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPPADLPKC
Sbjct  562   KPDQKLLPPPADLPKC  577



>ref|NP_200810.1| laccase 17 [Arabidopsis thaliana]
 sp|Q9FJD5.1|LAC17_ARATH RecName: Full=Laccase-17; AltName: Full=Benzenediol:oxygen oxidoreductase 
17; AltName: Full=Diphenol oxidase 17; AltName: 
Full=Urishiol oxidase 17; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08370.1| laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AAU05482.1| At5g60020 [Arabidopsis thaliana]
 gb|AAU95426.1| At5g60020 [Arabidopsis thaliana]
 gb|AED97267.1| laccase 17 [Arabidopsis thaliana]
Length=577

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/556 (72%), Positives = 469/556 (84%), Gaps = 8/556 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  +IKMQNVTRLC TKS+V+VNG+FPGP++IAREGD+V++KVVN V  N+++HW
Sbjct  22    GITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREGDQVLIKVVNQVPNNISLHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL++HAHISWLR+T+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRSTVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPF +P KEVP+IFGEW+ ADTE II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKRGVPYPFAKPHKEVPMIFGEWFNADTEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T  +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETETILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs------tnsnkttt  1079
             PGQTTNVLLKT + +P+A++ ++ARPY TG   FDNST AGILEY          ++T+ 
Sbjct  262   PGQTTNVLLKTKSSYPSASFFMTARPYVTGQGTFDNSTVAGILEYEPPKQTKGAHSRTSI  321

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--P  1253
               L LF P LP  NDT+FAT F+ KLRSL + NFPANVP  VDR+FFFTVGLG  PC   
Sbjct  322   KNLQLFKPILPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  381

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
              NQTCQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+  FP +P V FNYTG 
Sbjct  382   NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNK
Sbjct  442   PPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  501

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP  FNLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG 
Sbjct  502   DPRNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPPADLPKC
Sbjct  562   KPDQKLLPPPADLPKC  577



>ref|XP_007016364.1| Laccase 2 [Theobroma cacao]
 gb|EOY33983.1| Laccase 2 [Theobroma cacao]
Length=585

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/559 (73%), Positives = 475/559 (85%), Gaps = 4/559 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             +V  AKHAGITRHY FDIK++++TRLC+TKSIV VNG+FPGPR+IAREGDR+VV+VVNHV
Sbjct  28    EVVTAKHAGITRHYHFDIKLKSITRLCRTKSIVAVNGKFPGPRLIAREGDRLVVEVVNHV  87

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
               N++IHWHGVRQLRSGWADGP+YITQCPIQTGQSYVYNFTI+GQRGTLFWHAHISWLRA
Sbjct  88    PNNISIHWHGVRQLRSGWADGPSYITQCPIQTGQSYVYNFTISGQRGTLFWHAHISWLRA  147

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             T+YGP++ILPK+  +YPF +P+KEVPI+FGEW+ AD E +I+Q+ QTG  PN+SDA+T+N
Sbjct  148   TVYGPLIILPKRNESYPFVKPYKEVPILFGEWFNADPEAVINQSLQTGAGPNVSDAYTLN  207

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPGPLYNCS+KD++KLKVK GKTYLLRLINAALNDELFFSIANHS TVVEADAVYVKPF
Sbjct  208   GLPGPLYNCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHSFTVVEADAVYVKPF  267

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnkt  1073
              TN ++I PGQTTNVLLKT    PNAT+ + ARPY TG   FDN+T AGILEY T S+ +
Sbjct  268   VTNTLVIAPGQTTNVLLKTKPQAPNATFFMLARPYFTGMGAFDNTTVAGILEYETPSSSS  327

Query  1074  ttnkL---PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
             ++      PL  P LP  N T+F   F+ K RSLA   FPANVP+KVD++FFFTVGLG  
Sbjct  328   SSISSKNHPLLKPGLPAINATNFVAKFSSKFRSLATTKFPANVPQKVDKKFFFTVGLGSS  387

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PCP+NQTCQGP N TKFAAS+NNISF  P TALLQ++FF QS   YT DFPA P   FNY
Sbjct  388   PCPKNQTCQGP-NGTKFAASMNNISFALPRTALLQSYFFAQSNRGYTTDFPAFPLHPFNY  446

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG PP N +VT+ TKVV + FN+SVE+V+QDTSI+GAESHPLHLHG+NF+V+GQGFGN+D
Sbjct  447   TGTPPNNTLVTNGTKVVVIPFNTSVEVVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFD  506

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             PNKDP+KFN+VDPAERNTVGVPSGGWVAIRF ADNPG W MHCHL+VH SWGL+MAWIV+
Sbjct  507   PNKDPAKFNVVDPAERNTVGVPSGGWVAIRFQADNPGVWLMHCHLDVHLSWGLRMAWIVL  566

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DG+   QKL PPP+DLPKC
Sbjct  567   DGELPNQKLPPPPSDLPKC  585



>ref|XP_004246356.1| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=569

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/546 (74%), Positives = 460/546 (84%), Gaps = 3/546 (1%)
 Frame = +3

Query  207   RHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGV  386
             RHYKF+IK+QNVTRLC TK+IVTVNG+FPGP I+AREGDR+ ++V+N+V+ N++IHWHG+
Sbjct  26    RHYKFEIKLQNVTRLCHTKNIVTVNGKFPGPPIVAREGDRLEIEVINNVQNNISIHWHGI  85

Query  387   RQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPK  566
             RQ+RSGWADGPAY+TQCPIQ GQ YVYNFTI GQRGT +WHAHISWLR+TLYGPI+ILPK
Sbjct  86    RQIRSGWADGPAYVTQCPIQIGQKYVYNFTIIGQRGTFWWHAHISWLRSTLYGPIIILPK  145

Query  567   KGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCSA  746
             K   YPF +P+KEVPIIFGEW+  DTE IISQA QTGG PN+SDA+TINGLPGPLYNCS 
Sbjct  146   KNNPYPFTKPYKEVPIIFGEWFNGDTETIISQALQTGGGPNVSDAYTINGLPGPLYNCSK  205

Query  747   KDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQ  926
             KD+FKLKVK GKTYLLRLINAALNDELFFSIANH+L V++AD VYVKPF TN ++ITPGQ
Sbjct  206   KDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLQVIDADGVYVKPFETNTIIITPGQ  265

Query  927   TTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPLFTPT  1106
             T NVLLKT  H PNA + + ARPY TGP  FDNST AGILEY  + +K     L +F P+
Sbjct  266   THNVLLKTKPHFPNAKFYMLARPYVTGPGTFDNSTVAGILEY-ESKSKPHLKNLSIFKPS  324

Query  1107  LPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNN  1286
             LP  NDT F T+FT KLRSLA   FPANVP  VDR  FFT+GLG  PC QN+TCQGP N 
Sbjct  325   LPSLNDTIFVTDFTSKLRSLATPQFPANVPLYVDRHLFFTIGLGTSPCDQNKTCQGP-NG  383

Query  1287  TKFAASVNNISFVQPTT-ALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSA  1463
             TKF+AS+NN+SF+ PTT +LLQ+HFF QSKGVY  DFP +P   FNYTGNPP N +V + 
Sbjct  384   TKFSASINNVSFILPTTNSLLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNPPNNTLVNND  443

Query  1464  TKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDP  1643
             TK++ L FN+SVELVMQDTSI+G ESHPLHLHGFNFFV+GQGFGNYDPNKDPS FNLVDP
Sbjct  444   TKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNYDPNKDPSNFNLVDP  503

Query  1644  AERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPP  1823
              ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V DGK   QKL PPP
Sbjct  504   IERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQDGKLPNQKLPPPP  563

Query  1824  ADLPKC  1841
              DLPKC
Sbjct  564   MDLPKC  569



>ref|XP_010046415.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW85638.1| hypothetical protein EUGRSUZ_B02428 [Eucalyptus grandis]
Length=585

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/583 (70%), Positives = 476/583 (82%), Gaps = 7/583 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             +  C  A  F++ + A+ C+   D AL    G+TRHYKF + +QNVTRLC TKS+VT+NG
Sbjct  6     LQSCPLAGFFLVPLFAS-CFFP-DPALVASEGVTRHYKFKVVLQNVTRLCYTKSMVTING  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPR+IAREGDR++++VVNHV  N++IHWHGVRQ +SGWADGPAY+TQCPIQT QSYV
Sbjct  64    KFPGPRVIAREGDRLLIEVVNHVPNNISIHWHGVRQHQSGWADGPAYVTQCPIQTDQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YN+TI GQRGTL+WHAHISWLR+TLYG ++ILPK   +YPF +P KE+PIIFGEW+ +DT
Sbjct  124   YNYTIVGQRGTLWWHAHISWLRSTLYGSLIILPKHNDSYPFAKPHKEIPIIFGEWFNSDT  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E IISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+++LKVK GKTYLLRLINA LNDE
Sbjct  184   EAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTYRLKVKPGKTYLLRLINAVLNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+LTVVEADA Y+KPF T  +LI PGQTTNVL+KT  ++P AT+L++ARPY T
Sbjct  244   LFFSIANHTLTVVEADATYLKPFETETLLIAPGQTTNVLIKTKPYYPKATFLMTARPYVT  303

Query  1005  GPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLAN  1172
             G   FDNST AGILEY           +  +LPLF PTLP  NDT+FATNFT KLRSLA 
Sbjct  304   GLGTFDNSTVAGILEYEPPLNEPHQSPSIKQLPLFKPTLPPLNDTAFATNFTTKLRSLAT  363

Query  1173  ANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQA  1352
               FPANVP KVDRRFFFTV LG IPC  NQTCQGP   T   A+VNN+SF  PTTALLQA
Sbjct  364   PQFPANVPLKVDRRFFFTVSLGTIPCQGNQTCQGPY-GTMLTAAVNNVSFTMPTTALLQA  422

Query  1353  HFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIG  1532
             H+  QS GVY+ DFP++P   FN+TG PP N  V + TK+V L FN+SVEL+MQDTSI+G
Sbjct  423   HYTGQSNGVYSPDFPSHPKSIFNFTGTPPNNTNVGNGTKLVVLPFNTSVELIMQDTSILG  482

Query  1533  AESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNP  1712
             AE HPLHLHGFNFFV+GQGFGN+DPNKDP+ FNLVDP ERNTVGVPSGGWVA RFLADNP
Sbjct  483   AERHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVATRFLADNP  542

Query  1713  GAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             G WFMHCHLEVH+SWG+KMAW+V+DGK   QKL PPPADLPKC
Sbjct  543   GVWFMHCHLEVHSSWGMKMAWLVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_009796024.1| PREDICTED: laccase-2-like [Nicotiana sylvestris]
Length=583

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/587 (70%), Positives = 487/587 (83%), Gaps = 12/587 (2%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKH--AGITRHYKFDIKMQNVTRLCQTKSIVTV  278
             M   +F+ R I+  L  FC+        +   AG+TRHYKFDI+++NVTRLCQTK+IVTV
Sbjct  1     MSASIFSPRSIL--LTIFCFTCSIFLFPEFVTAGVTRHYKFDIRLKNVTRLCQTKTIVTV  58

Query  279   NGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQS  458
             NG+FPGPR++AREGDRVVVKV+NHV  NV+ HWHG+RQ++SGWADGPAYITQCPIQTGQS
Sbjct  59    NGKFPGPRVVAREGDRVVVKVINHVSNNVSFHWHGIRQIQSGWADGPAYITQCPIQTGQS  118

Query  459   YVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKA  638
             YVYNFTITGQRGTL+WHAHISW+RATLYGP++I PK   +YPF +P KEVPIIFGEWW A
Sbjct  119   YVYNFTITGQRGTLWWHAHISWMRATLYGPLIIYPKHNTSYPFAKPHKEVPIIFGEWWNA  178

Query  639   DTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALN  818
             +TE +I+Q+  TG  PN+SD++TINGLPGPLYNCSAKD+FKLKVK GKTY+LR+INAALN
Sbjct  179   NTEAVINQSLVTGAGPNVSDSYTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRIINAALN  238

Query  819   DELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPY  998
             D+LFFSIANHS+TVVEADAVYVKPF T+I+LI PGQTTNVLLKT  +    T+L++ARPY
Sbjct  239   DDLFFSIANHSMTVVEADAVYVKPFETDIILIAPGQTTNVLLKTHPNPQQTTFLMAARPY  298

Query  999   ATGPAPFDNSTTAGILEY------stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLR  1160
              TG   FDNST AGIL Y       ++S+ T+   LP+  PTLP  N TSF  NF+ K R
Sbjct  299   FTGQGTFDNSTIAGILMYDNLSASISSSSNTSIKNLPI--PTLPPINSTSFVANFSNKFR  356

Query  1161  SLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTA  1340
             SLAN  FPANVP+KVD++FFFTVGLG  PCP+NQTCQGP N++KF+ASVNN+S + PTTA
Sbjct  357   SLANTQFPANVPQKVDKQFFFTVGLGSNPCPKNQTCQGPNNSSKFSASVNNVSMILPTTA  416

Query  1341  LLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDT  1520
             LLQ++FF +S GVYT++FP+ P V FNYTG PP N  V++ TKVV L FN+SVELVMQDT
Sbjct  417   LLQSYFFKKSNGVYTSNFPSVPLVPFNYTGTPPNNTHVSNGTKVVVLPFNTSVELVMQDT  476

Query  1521  SIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFL  1700
             SI+GAESHPLHLHG+NF+V+GQGFGN+DP KDP+ +NLVDP ERNT+GVPSGGWVAI FL
Sbjct  477   SILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWVAIHFL  536

Query  1701  ADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             ADNPG WFMHCH EVH SWGL+MAW+V+DG+   QKL PPPADLPKC
Sbjct  537   ADNPGVWFMHCHFEVHLSWGLRMAWLVLDGELPNQKLPPPPADLPKC  583



>ref|XP_006280235.1| hypothetical protein CARUB_v10026150mg [Capsella rubella]
 gb|EOA13133.1| hypothetical protein CARUB_v10026150mg [Capsella rubella]
Length=577

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/556 (72%), Positives = 466/556 (84%), Gaps = 8/556 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  +IKMQNVTRLC TKS+V+VNG+FPGP++IAREGD++++KV+N V  N++IHW
Sbjct  22    GITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREGDQLLIKVINQVPNNISIHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTLF+HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPF +P KEVP+IFGEW+ AD E II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs------tnsnkttt  1079
             PGQTTNVLLKT   +P+A++ + ARPY TG   FDNST AGILEY          ++ + 
Sbjct  262   PGQTTNVLLKTKPSYPSASFFMFARPYVTGQGTFDNSTVAGILEYEPSKHIKDAHSRASI  321

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--P  1253
               L LF PTLP  NDT+FAT F+ KLRSL + NFPANVP  VDR+FFFTVGLG  PC   
Sbjct  322   KNLQLFRPTLPALNDTNFATKFSNKLRSLNSKNFPANVPLNVDRKFFFTVGLGTNPCNHK  381

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
              NQTCQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+  FP +P V FNYTG 
Sbjct  382   NNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N  V++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNK
Sbjct  442   PPNNTNVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  501

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP  FNLVDP ERNT+GVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG 
Sbjct  502   DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPPADLPKC
Sbjct  562   KPDQKLLPPPADLPKC  577



>ref|XP_002864664.1| hypothetical protein ARALYDRAFT_496140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40923.1| hypothetical protein ARALYDRAFT_496140 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/556 (72%), Positives = 469/556 (84%), Gaps = 8/556 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  +IKMQNVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVN V  N++IHW
Sbjct  22    GITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREGDQLLIKVVNQVSNNISIHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL++HAHISWLR+T+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRSTVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPF +P KEVP+IFGEW+ AD E II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF  + +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFEMDTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs------tnsnkttt  1079
             PGQTTNVLLKT + +P+A++ ++ARPY TG   FDNST AGILEY          ++T+ 
Sbjct  262   PGQTTNVLLKTKSSYPSASFFMTARPYVTGQGTFDNSTVAGILEYEPPKQTKDAHSRTSI  321

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--P  1253
               L LF P LP  NDT+FAT F+ KLRSL + NFPANVP  +DR+FFFTVGLG  PC   
Sbjct  322   KNLQLFKPILPALNDTNFATKFSNKLRSLNSKNFPANVPLNIDRKFFFTVGLGTNPCNHK  381

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
              NQTCQGPTN T FAAS++NISF+ PT ALLQ+H+  QS GVY+  FP +P V FNYTG 
Sbjct  382   NNQTCQGPTNTTMFAASISNISFIMPTKALLQSHYSGQSHGVYSPKFPWSPIVPFNYTGT  441

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N M+++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPNK
Sbjct  442   PPNNTMISNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNK  501

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP  FNLVDP ERNT+GVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG 
Sbjct  502   DPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGD  561

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPPADLPKC
Sbjct  562   KPDQKLLPPPADLPKC  577



>emb|CDX71061.1| BnaC03g11450D [Brassica napus]
Length=573

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/552 (73%), Positives = 466/552 (84%), Gaps = 4/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             G TRHY  DIKM NVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVNHV  N+++HW
Sbjct  22    GKTRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKLIAREGDQLLIKVVNHVPNNLSLHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL++HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGTLWYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPF +P KEVP++FGEW+ ADTE II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKHGVPYPFHKPHKEVPMVFGEWFNADTEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktt--tnkLP  1091
             PGQTTN+LLKT   +P A++L++ARPYATG   FDNST AGILEY    +  T     L 
Sbjct  262   PGQTTNLLLKTKQSYPKASFLMTARPYATGQGTFDNSTVAGILEYEQPKHTKTFIKKNLQ  321

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQT  1265
             LFTP LP  NDT+FAT F+ KLRSL +  +PANVP KVDR+FFFTVGLG  PC    NQT
Sbjct  322   LFTPVLPALNDTNFATKFSNKLRSLNSKRYPANVPLKVDRKFFFTVGLGTNPCNHKNNQT  381

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+ +FP N  V FNYTG PP N
Sbjct  382   CQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWNTIVPFNYTGTPPNN  441

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ T V+ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D  +DP K
Sbjct  442   TMVSTGTNVMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKEDPKK  501

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    Q
Sbjct  502   FNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKSDQ  561

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  562   KLLPPPADLPKC  573



>ref|XP_009126628.1| PREDICTED: laccase-17-like [Brassica rapa]
Length=572

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/551 (73%), Positives = 468/551 (85%), Gaps = 3/551 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY  DIKM NVTRLC TKS+V+VNG+FPGP+IIAREGD++++KVVNHV  N+++HW
Sbjct  22    GITRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKIIAREGDQLLIKVVNHVPNNISLHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL++HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP+P KEVP++FGEW+ A TE II QA+ TGG PN+SDA+TINGLPGPLY 
Sbjct  142   LPKHGVPYPFPKPHKEVPMVFGEWFSAVTEAIIRQATLTGGGPNVSDAYTINGLPGPLYT  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VKAGKTYLLR+INAALNDELFFSIANH++TVVEADAVYVKPF TN +LI 
Sbjct  202   CSAKDTFRLRVKAGKTYLLRIINAALNDELFFSIANHTVTVVEADAVYVKPFETNTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLPL  1094
             PGQTTNVLLKT   +P+A++ ++ARPYATG   FDN+T AGILEY     +KT    LPL
Sbjct  262   PGQTTNVLLKTKPSYPSASFFMTARPYATGQGTFDNTTVAGILEYEQPKHSKTNIKNLPL  321

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQTC  1268
             FTP LP  NDT+FAT F+ KLRSL +  FPANVP++VDR+FFFT GLG  PC    NQTC
Sbjct  322   FTPVLPALNDTNFATKFSNKLRSLNSQKFPANVPQEVDRKFFFTGGLGNTPCNHKNNQTC  381

Query  1269  QGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNI  1448
              GPTN T FAAS++NISF  PT ALLQ+H+  +S GVY+ +FP +P V FNYTG PP N 
Sbjct  382   LGPTNTTMFAASISNISFTLPTKALLQSHYSGRSNGVYSPNFPWSPIVPFNYTGTPPNNT  441

Query  1449  MVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKF  1628
             MV++ T V+ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DP  DP KF
Sbjct  442   MVSTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKNDPKKF  501

Query  1629  NLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             NLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    QK
Sbjct  502   NLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQK  561

Query  1809  LQPPPADLPKC  1841
             L PPPADLPKC
Sbjct  562   LLPPPADLPKC  572



>ref|XP_002520232.1| laccase, putative [Ricinus communis]
 gb|EEF42144.1| laccase, putative [Ricinus communis]
Length=578

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/550 (72%), Positives = 463/550 (84%), Gaps = 2/550 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
               ITRHYKFDI  QNVTRLC TK++VTVNG+FPGPRI+A+EGDR++++V NHVK+N++IH
Sbjct  30    VAITRHYKFDIMEQNVTRLCHTKTMVTVNGQFPGPRIVAKEGDRLLIQVTNHVKHNISIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLR T+YGPI+
Sbjct  90    WHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRTTVYGPII  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             I  K  + +PF +P KEVPIIFGEW+ AD + +I +A +TGG PN+SDA+TING PGPL 
Sbjct  150   IHSKSSIHHPFVKPNKEVPIIFGEWFNADPDAVIKEALKTGGGPNVSDAYTINGFPGPLS  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS KD+++L VK GKTY+LRLINAALNDELFFSIANH+LTVVE DAVYVKPF+T I++I
Sbjct  210   NCSTKDTYRLHVKPGKTYMLRLINAALNDELFFSIANHTLTVVEVDAVYVKPFHTKILVI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnk-tttnkLP  1091
              PGQTTNVLL+T  H+P AT+ ++ARPYATG   FDNS+ A IL+Y   S    +  K+P
Sbjct  270   APGQTTNVLLQTKPHYPEATFFMTARPYATGQGTFDNSSVAAILQYKATSKSNRSNKKIP  329

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             LF P+LP  ND+SF   +T KLRSLA+  FPANVP+++DRRFFFT+GLG  PCP+N+TCQ
Sbjct  330   LFKPSLPALNDSSFVMKYTNKLRSLASEEFPANVPQRIDRRFFFTIGLGTKPCPRNETCQ  389

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N  KFAAS NN+SF  PT ALLQ+HF  Q+KGVYT DFP     +FNYTGNPP N M
Sbjct  390   GP-NGAKFAASANNVSFTMPTKALLQSHFLGQAKGVYTLDFPRTVLFRFNYTGNPPNNTM  448

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ TKVV+L FN+S+EL+MQDTSI+G ESHPLHLHGFNFFV+GQGFGN+DP KDPSKFN
Sbjct  449   VSTGTKVVKLHFNTSIELIMQDTSILGVESHPLHLHGFNFFVVGQGFGNFDPKKDPSKFN  508

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V DGK   QKL
Sbjct  509   LVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVNDGKHPNQKL  568

Query  1812  QPPPADLPKC  1841
              PPPADLP C
Sbjct  569   LPPPADLPNC  578



>gb|KFK27539.1| hypothetical protein AALP_AA8G396300 [Arabis alpina]
Length=575

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/575 (70%), Positives = 473/575 (82%), Gaps = 6/575 (1%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             + F L    +  G + L    GITRHY  DIKM NVTRLC TKS+V+VNG+FPGP++IAR
Sbjct  1     MAFQLLFAVFSCGLLFLQPAFGITRHYTLDIKMHNVTRLCHTKSLVSVNGQFPGPKLIAR  60

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGD+V++KV+N+V  N++IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRG
Sbjct  61    EGDQVLIKVINNVSNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRG  120

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TL++HAHISWLR+T+YGP++ILPK+GV YPF +P KEVP+ FGEW+ AD E II QA+QT
Sbjct  121   TLWYHAHISWLRSTVYGPLIILPKRGVPYPFAKPHKEVPMTFGEWFNADPEAIIRQATQT  180

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+SDA+TINGLPGPLYNCSAKD+FKL+VK GKTYLLRLINAALNDELFFSIANH++
Sbjct  181   GGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKPGKTYLLRLINAALNDELFFSIANHTV  240

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVEADA+YVKPF T+ +LI PGQTTN+LLKT + +P+A++ ++ARPYATG   FDN+T 
Sbjct  241   TVVEADAIYVKPFETDTILIAPGQTTNILLKTKSSYPSASFFMTARPYATGQGTFDNTTV  300

Query  1035  AGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             AGILEY     T         L LF P LP  NDT+FAT F+ KLRSL +  FPANVP  
Sbjct  301   AGILEYEPPKHTKDAHLKIKNLQLFKPVLPALNDTNFATKFSNKLRSLNSKTFPANVPLN  360

Query  1203  VDRRFFFTVGLGVIPC--PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKG  1376
             VDR+FFFTVGLG  PC    NQTCQGPTN T FAAS++NISF+ PT ALLQ+H+  QS+G
Sbjct  361   VDRQFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFIMPTKALLQSHYSGQSRG  420

Query  1377  VYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHL  1556
             VY+  FP NP V FNYTG PP N  V++ T ++ L +N+SVELVMQDTSI+GAESHPLHL
Sbjct  421   VYSPQFPWNPIVPFNYTGTPPNNTNVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHL  480

Query  1557  HGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCH  1736
             HGFNFFV+GQGFGN+DPNKDP  FNLVDP ERNT+GVPSGGW AIRFLADNPG WFMHCH
Sbjct  481   HGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCH  540

Query  1737  LEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LEVHTSWGL+MAW+V+DG    QKL PPPADLPKC
Sbjct  541   LEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  575



>ref|XP_010039666.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW45808.1| hypothetical protein EUGRSUZ_L00359 [Eucalyptus grandis]
Length=585

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/583 (70%), Positives = 474/583 (81%), Gaps = 7/583 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             +  C  A  F++ + A+ C+   D AL    G+TRHYKF + +QNVTRLC TKS+VT+NG
Sbjct  6     LQSCPLAGFFLVALFAS-CFFP-DPALVASEGVTRHYKFKVVLQNVTRLCYTKSMVTING  63

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPR+I REGDR++++VVNHV  N++IHWHGVRQ +SGWADGPAY+TQCPIQT QSYV
Sbjct  64    KFPGPRVIVREGDRLLIEVVNHVPNNISIHWHGVRQHQSGWADGPAYVTQCPIQTDQSYV  123

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YN+TI GQRGTL+WHAHISWLR+TLYG ++ILPK   +YPF +P KE+PIIFGEW+ ++T
Sbjct  124   YNYTIVGQRGTLWWHAHISWLRSTLYGSLIILPKHNDSYPFAKPHKEIPIIFGEWFNSNT  183

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E IISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+++LKVK GKTYLLRLINA LNDE
Sbjct  184   EAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTYRLKVKPGKTYLLRLINAVLNDE  243

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+LTVVEADA Y+KPF T  +LI PGQTTNVL+KT  ++P AT+L++ARPY T
Sbjct  244   LFFSIANHTLTVVEADATYLKPFETETLLIAPGQTTNVLIKTKPYYPKATFLMTARPYVT  303

Query  1005  GPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLAN  1172
             G   FDNST AGILEY           +  +LPLF PTLP  ND +FATNFT KLRSLA 
Sbjct  304   GLGTFDNSTVAGILEYEPPLNEPHQSPSIKQLPLFKPTLPPLNDRAFATNFTTKLRSLAT  363

Query  1173  ANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQA  1352
               FPANVP KVDRRFFFTV LG IPC  NQTCQGP   T   A+VNN+SF  PTTALLQA
Sbjct  364   PQFPANVPLKVDRRFFFTVSLGTIPCQGNQTCQGPY-GTMLTAAVNNVSFTMPTTALLQA  422

Query  1353  HFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIG  1532
             H+  QS GVY+ DFP++P   FN+TG PP N  V + TKVV L FN+SVEL+MQDTSI+G
Sbjct  423   HYTGQSNGVYSPDFPSHPKSIFNFTGTPPNNTNVGNGTKVVVLPFNTSVELIMQDTSILG  482

Query  1533  AESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNP  1712
             AE HPLHLHGFNFFV+GQGFGN+DPNKDP+ FNLVDP ERNTVGVPSGGWVA RFLADNP
Sbjct  483   AERHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVATRFLADNP  542

Query  1713  GAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             G WFMHCHLEVH+SWG+KMAW+V+DGK   QKL PPPADLPKC
Sbjct  543   GVWFMHCHLEVHSSWGMKMAWLVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_002531565.1| laccase, putative [Ricinus communis]
 gb|EEF30831.1| laccase, putative [Ricinus communis]
Length=577

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/548 (71%), Positives = 462/548 (84%), Gaps = 2/548 (0%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
              +TRHY F+I  Q +TRLC T+S++TVNG+FPGPR++AREGDRV++KVVNHV  NVTIHW
Sbjct  32    AVTRHYTFNIVNQTITRLCHTRSVLTVNGKFPGPRLVAREGDRVIIKVVNHVSSNVTIHW  91

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQL +GWADGPAYITQCPIQTGQSY YNFTITGQRGTL WHAHISWLR++LYGPI+I
Sbjct  92    HGIRQLTTGWADGPAYITQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSSLYGPIII  151

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
              P++  +YPF +P+KE+PI+ GEW+  D E +I+QA Q G  PN+SDA+TINGLPGPLYN
Sbjct  152   FPRRNESYPFQKPYKEIPILLGEWFNVDPEAVIAQALQIGAGPNVSDAYTINGLPGPLYN  211

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CS+KD+FKLKVK GKTYLLR+INAALNDELFFSIA+H+LTVVEADA+Y KPF T+ +LIT
Sbjct  212   CSSKDTFKLKVKPGKTYLLRIINAALNDELFFSIASHTLTVVEADAIYTKPFETDTLLIT  271

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPLF  1097
             PGQTTNVLLKT    PNATYL++ARPY TG   FDNST A ILEY        + +LPLF
Sbjct  272   PGQTTNVLLKTKPSLPNATYLMAARPYFTGQGTFDNSTAAAILEY--KHPSNISRQLPLF  329

Query  1098  TPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGP  1277
              PTLP  N T F  N T++ RSLANA FPANVP+ VDR+FFFTVGLG  PCP N TCQGP
Sbjct  330   KPTLPPINATGFVANITRRFRSLANAKFPANVPQNVDRKFFFTVGLGTNPCPANTTCQGP  389

Query  1278  TNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVT  1457
             TN TKF+AS+NN+SF+ P+ +LLQ+++F +S G++TADFP NPP  FNYTG PP N  V+
Sbjct  390   TNTTKFSASINNVSFLMPSVSLLQSYYFGKSNGIFTADFPQNPPTPFNYTGTPPNNTNVS  449

Query  1458  SATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLV  1637
             + T+ + L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGNY+ NKDP+ FNLV
Sbjct  450   NGTRALMLRFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYNSNKDPANFNLV  509

Query  1638  DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQP  1817
             DP ERNTVGVP+GGWVAIRFLADNPG WFMHCHL+VHTSWGL+MAW+V++G    QKLQP
Sbjct  510   DPMERNTVGVPAGGWVAIRFLADNPGVWFMHCHLDVHTSWGLRMAWLVLNGPQPNQKLQP  569

Query  1818  PPADLPKC  1841
             PP+DLPKC
Sbjct  570   PPSDLPKC  577



>emb|CDX88735.1| BnaA03g09140D [Brassica napus]
Length=573

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/552 (72%), Positives = 466/552 (84%), Gaps = 4/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             G TRHY  DIKM NVTRLC TKS+V+VNG+FPGP++IAREGD++++KVVNHV  N+++HW
Sbjct  22    GKTRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKLIAREGDQLLIKVVNHVPNNISLHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL++HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGTLWYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPF +P KEVP++FGEW+ ADTE II QA+QTGG PN+SDA+TINGLPGPLYN
Sbjct  142   LPKHGVPYPFHKPHKEVPMVFGEWFNADTEAIIRQATQTGGGPNVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs--tnsnktttnkLP  1091
             PGQTTN+LLKT   +P A++L++ARPY TG   FDNST AGILEY    ++  +    L 
Sbjct  262   PGQTTNLLLKTKQSYPKASFLMTARPYVTGQGTFDNSTVAGILEYEQPKHTKTSIKKNLQ  321

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQT  1265
             LFTP LP  NDT+FAT F+ KLRSL +  FPANVP KVDR+FFFTVGLG  PC    NQT
Sbjct  322   LFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPLKVDRKFFFTVGLGTNPCNHKNNQT  381

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+ +FP +P V FNYTG PP N
Sbjct  382   CQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWSPIVPFNYTGTPPNN  441

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D  +DP  
Sbjct  442   TMVSTGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKEDPKN  501

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    Q
Sbjct  502   FNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQ  561

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  562   KLLPPPADLPKC  573



>ref|XP_010541371.1| PREDICTED: laccase-17-like [Tarenaya hassleriana]
Length=582

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/555 (73%), Positives = 468/555 (84%), Gaps = 12/555 (2%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHYK +IKMQNVTRLC T+SIV+VNG+FPGPR++AREGDR+++KVVN+V        
Sbjct  33    GITRHYKLEIKMQNVTRLCHTRSIVSVNGKFPGPRLVAREGDRLLIKVVNYVSN----RM  88

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+TI GQRGTL++HAHISWLR+T+YGP++I
Sbjct  89    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIIGQRGTLWYHAHISWLRSTIYGPLII  148

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK+GV YPF +P++EVP+IFGEW+ AD E II+QA +TGG PN+SDA+TINGLPGPLYN
Sbjct  149   LPKRGVPYPFAKPYREVPMIFGEWFNADPEAIINQALKTGGGPNVSDAYTINGLPGPLYN  208

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  209   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  268

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs------tnsnkttt  1079
             PGQTTNVLLKT + +P A++ ++ARPY TG   FDNST AGILEY          +KT+ 
Sbjct  269   PGQTTNVLLKTKSQYPKASFFMTARPYVTGQGTFDNSTVAGILEYEPPKSTKAIHSKTSI  328

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQ-  1256
               L L  P LP  NDT+FAT FT KLRSL +  FPANVP +VD++FFFTVGLG  PC Q 
Sbjct  329   KNLQLLKPVLPALNDTNFATTFTNKLRSLNSKRFPANVPTEVDQKFFFTVGLGTKPCNQK  388

Query  1257  NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNP  1436
             NQTCQGP N T FAASVNNISF+ PTTALLQ+H+  QS GVY+  FP +P + FNYTGNP
Sbjct  389   NQTCQGP-NGTMFAASVNNISFIMPTTALLQSHYSGQSHGVYSPYFPHDPLIPFNYTGNP  447

Query  1437  PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKD  1616
             P N MV + TK++ L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+DPN+D
Sbjct  448   PNNTMVGNGTKLLVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNED  507

Query  1617  PSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKG  1796
             P  FNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V+DG  
Sbjct  508   PKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDK  567

Query  1797  RKQKLQPPPADLPKC  1841
               QKL PPPADLPKC
Sbjct  568   PDQKLLPPPADLPKC  582



>ref|XP_004294638.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=581

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/585 (71%), Positives = 482/585 (82%), Gaps = 10/585 (2%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M V LF+   ++ +    C   G +     A ITRHY FD+++QNV RLC TKSIVT+NG
Sbjct  1     MGVALFS---LVRLFVLCCITLGLIPQLALASITRHYTFDVQLQNVKRLCHTKSIVTING  57

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             +FPGPRI+AREGDR+++KVVNHV+ N++IHWHG+RQL++GWADGPAYITQCPIQTG SYV
Sbjct  58    QFPGPRIVAREGDRLLIKVVNHVQSNISIHWHGIRQLQTGWADGPAYITQCPIQTGNSYV  117

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTI GQRGTL+WHAHISWLR+T+YGP++I+PK+GV YPF +P+KEVPIIFGEWW ADT
Sbjct  118   YNFTIVGQRGTLWWHAHISWLRSTIYGPLIIIPKRGVPYPFTKPYKEVPIIFGEWWNADT  177

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I QA QTGG PN+SDA+TINGLPGPLYNCSAKD+FKLKV+AGKTY+LR+INAALNDE
Sbjct  178   EAVIKQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVQAGKTYMLRIINAALNDE  237

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+L VVEADAVYVKPF+TN +LI PGQT NVLLKT   HPNAT+ ++ARPY T
Sbjct  238   LFFSIANHTLKVVEADAVYVKPFDTNTILIAPGQTINVLLKTKPSHPNATFFMTARPYVT  297

Query  1005  GPAPFDNSTTAGILEYstnsnktt--tnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             G   FDNST AGILEY + +  +T    KLPL  P LPV NDTSFAT F+ KLRSL    
Sbjct  298   GLGTFDNSTVAGILEYESTALHSTLPMKKLPLHKPILPVLNDTSFATKFSNKLRSLNTPQ  357

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQ----NQTCQGPTNNTKFAASVNNISFVQPTTALL  1346
             FPANVP+KVD+R FFT+GLG  PC Q    NQTCQGP N T FAAS+NNISF  P TALL
Sbjct  358   FPANVPQKVDKRLFFTIGLGTNPCSQQKHNNQTCQGP-NVTMFAASINNISFTMPNTALL  416

Query  1347  QAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSI  1526
             Q+HFF QS GVY+  FP +P + FNYTG    N  V++ TK++ L FN+SVELV+QDTSI
Sbjct  417   QSHFFGQSNGVYSPYFPISPLIPFNYTGAQLNNTNVSNGTKLMVLPFNTSVELVLQDTSI  476

Query  1527  IGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLAD  1706
             +GAESHPLHLHGFNFFV+GQGFGNYD NKDP KFNL+DP ERNTVGVPSGGWVAIRFLAD
Sbjct  477   LGAESHPLHLHGFNFFVVGQGFGNYDQNKDPKKFNLIDPVERNTVGVPSGGWVAIRFLAD  536

Query  1707  NPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             NPG WFMHCHLE+HTSWGL+MAW+V+DGK   QKL PPP DLPKC
Sbjct  537   NPGVWFMHCHLEIHTSWGLRMAWLVLDGKLPNQKLLPPPLDLPKC  581



>ref|XP_009760365.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=580

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/548 (73%), Positives = 462/548 (84%), Gaps = 3/548 (1%)
 Frame = +3

Query  204   TRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHG  383
             TRHY F+I   NVTRLC TKSIV+VNGRFPGPR++AREGDRV+VKVVNHV  N++IHWHG
Sbjct  34    TRHYTFNIVQHNVTRLCTTKSIVSVNGRFPGPRLVAREGDRVIVKVVNHVSKNISIHWHG  93

Query  384   VRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILP  563
             +RQL SGWADGPAY+TQCPIQT QSY YNFTI GQRGTLFWHAHISWLRAT+YGPI+ILP
Sbjct  94    IRQLTSGWADGPAYVTQCPIQTNQSYTYNFTIIGQRGTLFWHAHISWLRATVYGPIIILP  153

Query  564   KKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCS  743
             +K  +YPF +P+KE+PIIFGEWW  D E +I+QA QTGG PN+SDA+TING PGPLYNCS
Sbjct  154   RKNESYPFKKPYKEIPIIFGEWWNVDPEAVINQALQTGGGPNVSDAYTINGFPGPLYNCS  213

Query  744   AKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPG  923
             +KD+FK +VK GKTY+LRLINAALNDE+FFSIANH+LT+VEADAVY KPF+TN+V ITPG
Sbjct  214   SKDTFKFRVKPGKTYMLRLINAALNDEMFFSIANHTLTIVEADAVYTKPFDTNVVFITPG  273

Query  924   QTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs--tnsnktttnkLPLF  1097
             QTTNVLL+T   HPNAT+L++A+PY TG   FDNST AG LEY    N + T  NKL LF
Sbjct  274   QTTNVLLRTKPFHPNATFLMAAQPYFTGQGTFDNSTVAGFLEYKPPLNGSPTNKNKLKLF  333

Query  1098  TPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGP  1277
              PTLP    T F  NFTKK RSLA+A FPANVP+ VD+RF FTVGLG  PCP+N TCQGP
Sbjct  334   KPTLPNITATGFVANFTKKFRSLASAQFPANVPQTVDKRFLFTVGLGSSPCPKNTTCQGP  393

Query  1278  TNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVT  1457
              N TKFAASVNN+SF  PTTALLQ+HFF QS GVYT DFP NP   FNYTG PP N +VT
Sbjct  394   -NGTKFAASVNNVSFALPTTALLQSHFFGQSNGVYTTDFPTNPLNPFNYTGTPPNNTLVT  452

Query  1458  SATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLV  1637
             +ATK V L FNSSVE+V+QDT+I+GAE+HPLHLHG+NFFV+G+GFGN+DPNKDP+ FNL 
Sbjct  453   NATKTVVLPFNSSVEVVLQDTNILGAENHPLHLHGYNFFVVGEGFGNFDPNKDPANFNLK  512

Query  1638  DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQP  1817
             DP ERNTVGVP+GGW+A RF ADNPG WFMHCH +VHTSWGL+MAWIV+DG  + QKL P
Sbjct  513   DPIERNTVGVPAGGWIAFRFFADNPGVWFMHCHFDVHTSWGLRMAWIVLDGPLQSQKLPP  572

Query  1818  PPADLPKC  1841
             PP+DLPKC
Sbjct  573   PPSDLPKC  580



>ref|XP_008803092.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=577

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/552 (76%), Positives = 470/552 (85%), Gaps = 5/552 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITRHYKFDIKMQNVTRLC T+SI TVNGRFPGP+I+AREGDRV+V+VVNHVK NVTIH
Sbjct  28    ASITRHYKFDIKMQNVTRLCHTRSIATVNGRFPGPKIVAREGDRVIVRVVNHVKNNVTIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQLR+GWADGPAY+TQCPIQTGQSYVYNFTI GQRGTLFWHAHISW+R TLYGPIV
Sbjct  88    WHGVRQLRTGWADGPAYMTQCPIQTGQSYVYNFTILGQRGTLFWHAHISWMRVTLYGPIV  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+GV YPF +P+KE+PIIFGEW+  D E +I+QA +TG  PN+SDA+TINGLPGPLY
Sbjct  148   ILPKRGVPYPFAKPYKEIPIIFGEWFNVDAEAVIAQALRTGAGPNVSDAYTINGLPGPLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS KD+FKLKVK GKTYLLR+INAALNDELFFSIA+H+LTVVE DA+Y KPFNT+IVLI
Sbjct  208   NCS-KDTFKLKVKPGKTYLLRMINAALNDELFFSIADHNLTVVEVDAIYTKPFNTDIVLI  266

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY---stnsnktttnk  1085
             TPGQTTNVLL+T    P+AT+L++ARPYATG   FDN+TTAG+LEY   + +   T    
Sbjct  267   TPGQTTNVLLQTKPSLPSATFLMAARPYATGLGTFDNTTTAGLLEYLPPTFSLPSTLAEN  326

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             L L  PTLP  NDT+FA +F+ K+RSLANA FPANVP+ VDRRF+FTVGLG  PCP+NQT
Sbjct  327   LALLKPTLPSLNDTAFAASFSSKVRSLANAQFPANVPQTVDRRFYFTVGLGTSPCPRNQT  386

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N TKFAASVNNISF  P+T LL++HF  QSKGVYT DFP NPP  FNYTG PP N
Sbjct  387   CQGP-NGTKFAASVNNISFALPSTPLLESHFLGQSKGVYTTDFPNNPPFPFNYTGTPPNN  445

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
               VT+ TKVV L FN+SVELVMQDTSI GAESHPLHLHG+NFFV+G+G GNYD +KDP+K
Sbjct  446   TFVTNGTKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGYNFFVVGRGSGNYDASKDPAK  505

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNL DP E NTVGVP+GGWVAIRF ADNPG WFMHCHL+VHTSWGL MAW V DG    Q
Sbjct  506   FNLADPIEMNTVGVPAGGWVAIRFRADNPGVWFMHCHLDVHTSWGLGMAWAVNDGMLPSQ  565

Query  1806  KLQPPPADLPKC  1841
             KL PPP+DLPKC
Sbjct  566   KLLPPPSDLPKC  577



>emb|CAA74105.1| laccase [Populus trichocarpa]
Length=580

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/549 (72%), Positives = 459/549 (84%), Gaps = 0/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             A ITR Y F+I  +N TRLC T+S+VTVNG+FPGPR++AREGD+V+VKVVNHV  N+TIH
Sbjct  32    AAITRQYTFNITHKNFTRLCHTRSLVTVNGQFPGPRLVAREGDQVLVKVVNHVAENITIH  91

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQL +GWADGPAY+TQCPIQTGQ+Y YNFTITGQRGTL WHAHISWLR++LYGPI+
Sbjct  92    WHGVRQLTTGWADGPAYVTQCPIQTGQAYTYNFTITGQRGTLLWHAHISWLRSSLYGPII  151

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK   +YPF +P+KE+PI+FGEW+  D E +I+QA QTG  PN+SDA+TINGLPGPLY
Sbjct  152   ILPKLNESYPFKKPYKEIPILFGEWFNVDPEAVIAQALQTGAGPNVSDAYTINGLPGPLY  211

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF  + +LI
Sbjct  212   NCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFEADTLLI  271

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             +PGQTTNVLLKT  H PNAT+ + A PY +G   FDNSTTAG+L Y   S+     KLP 
Sbjct  272   SPGQTTNVLLKTKPHLPNATFYMFAGPYFSGMGSFDNSTTAGVLVYKHPSSNNHLKKLPT  331

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               PTLP  N T F  NFTKK RSLANA FPANVP+ VDR+FFFTVGLG  PCP+N TCQG
Sbjct  332   LKPTLPPINATGFVANFTKKFRSLANAKFPANVPQTVDRKFFFTVGLGTNPCPKNTTCQG  391

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
               NNTKFAAS+NN+SFV P+ ALLQ++F     GV+T+DFP NP + FNYTG PP N MV
Sbjct  392   TNNNTKFAASINNVSFVLPSVALLQSYFLWTVNGVFTSDFPQNPTIPFNYTGTPPNNTMV  451

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
             ++ TK V L+FN+SVELVMQ TSI+ AESHPLHLHGFNFFV+GQGFGNYDPNKDPS FNL
Sbjct  452   SNGTKAVVLTFNTSVELVMQGTSIVAAESHPLHLHGFNFFVVGQGFGNYDPNKDPSNFNL  511

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
             VDP ERNT GVP+GGW+AIRFLADNPG WFMHCHL+VHTSWGL+MAWIV+DG    QK+ 
Sbjct  512   VDPMERNTAGVPAGGWIAIRFLADNPGVWFMHCHLDVHTSWGLRMAWIVLDGPQPNQKIP  571

Query  1815  PPPADLPKC  1841
             PPP+DLPKC
Sbjct  572   PPPSDLPKC  580



>ref|XP_004241217.1| PREDICTED: laccase-2-like [Solanum lycopersicum]
Length=576

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/549 (72%), Positives = 472/549 (86%), Gaps = 2/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG+TRHYKFDI+++NVTRLC+TK+IVTVNG+FPGPR++AREGDR+V+KVVNHV  NV+IH
Sbjct  30    AGVTRHYKFDIRLKNVTRLCKTKTIVTVNGKFPGPRVVAREGDRLVIKVVNHVSNNVSIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL+SGWADGPAY+TQCPIQ GQSYVYNFTITGQRGTL+WHAHISW+RATLYGP++
Sbjct  90    WHGIRQLQSGWADGPAYVTQCPIQKGQSYVYNFTITGQRGTLWWHAHISWMRATLYGPLI  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             I PK  V+YPF +P KE+PI+FGEWW A+TE +I+Q+  TG  PN+SD++TINGLPGPLY
Sbjct  150   IYPKHNVSYPFAKPHKEIPIMFGEWWNANTEAVINQSLVTGAGPNVSDSYTINGLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKLKVK+GKTY+LR+INAALND+LFF IANH++TVVEADA YVKPF T+I++I
Sbjct  210   NCSAKDTFKLKVKSGKTYMLRIINAALNDDLFFRIANHTMTVVEADAFYVKPFETDIIVI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             TPGQTTNVLLKT  +    T++++ARPY TG   FDNST AGIL Y ++SN  + N LP+
Sbjct  270   TPGQTTNVLLKTHHNPQQTTFVMAARPYFTGLGTFDNSTIAGILMYESSSNNISINNLPI  329

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               PTLP  N TSF +NFT K R+LA+  FP NVP+ VD+ FFFTVGLG  PCP+NQTCQG
Sbjct  330   --PTLPPINSTSFVSNFTNKFRALASVKFPVNVPRNVDKHFFFTVGLGSNPCPKNQTCQG  387

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P N++KFAASVNNIS + P TALLQ++FF +S GVYT+DFP+ P V FNY+G PP N  V
Sbjct  388   PNNSSKFAASVNNISMILPNTALLQSYFFKKSNGVYTSDFPSVPLVSFNYSGTPPNNTNV  447

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
             ++ TKVV L FN+SVE+VMQDTSI+GAESHPLHLHG+NF+V+GQGFGN+DP  DP+K+NL
Sbjct  448   SNGTKVVVLPFNTSVEVVMQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKNDPAKYNL  507

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
             VDP ERNTVGVPSGGWVAIRFLADNPG W MHCH +VH SWGL+MAWIV+DGK   QKL 
Sbjct  508   VDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDVHLSWGLRMAWIVLDGKLPNQKLL  567

Query  1815  PPPADLPKC  1841
             PPPADLP C
Sbjct  568   PPPADLPMC  576



>ref|XP_009630096.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=601

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/548 (73%), Positives = 462/548 (84%), Gaps = 3/548 (1%)
 Frame = +3

Query  204   TRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHG  383
             TRHY F+I   NVTRLC TKSIV+VNGRFPGPR++AREGDRV+VKVVNHV  N++IHWHG
Sbjct  55    TRHYTFNIVQHNVTRLCTTKSIVSVNGRFPGPRLVAREGDRVIVKVVNHVSNNISIHWHG  114

Query  384   VRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILP  563
             +RQL SGWADGPAY+TQCPIQT QSY YNFTI GQRGTLFWHAHISWLRAT+YGPI+ILP
Sbjct  115   IRQLTSGWADGPAYVTQCPIQTNQSYTYNFTIIGQRGTLFWHAHISWLRATVYGPIIILP  174

Query  564   KKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCS  743
             +   +YPF +P+KE+PI+FGEWW  D E +I+QA QTGG PN+SDA+TING PGPLYNCS
Sbjct  175   QHNESYPFKKPYKEIPILFGEWWNVDPEAVINQALQTGGGPNVSDAYTINGFPGPLYNCS  234

Query  744   AKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPG  923
             +KD+FKLKVK GKTY+LRLINAALNDE+FFSIANH+LT+VEADAVY KPFNTN+V ITPG
Sbjct  235   SKDTFKLKVKPGKTYMLRLINAALNDEMFFSIANHTLTIVEADAVYSKPFNTNVVFITPG  294

Query  924   QTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs--tnsnktttnkLPLF  1097
             QTTNVLL+T  ++PNAT+L++A+PY TG   FDNST AGILEY    N + T  NK+ LF
Sbjct  295   QTTNVLLRTKPYYPNATFLMAAQPYFTGQGTFDNSTAAGILEYKPPLNGSPTNKNKIKLF  354

Query  1098  TPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGP  1277
              PTLP    T F  NFTKK RSLA+A FPANVPK VD+RF FTVGLG  PCP+N TCQGP
Sbjct  355   KPTLPNITATGFVANFTKKFRSLASARFPANVPKTVDKRFLFTVGLGSSPCPKNTTCQGP  414

Query  1278  TNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVT  1457
              N TKFAASVNN+SF  PTTALLQ+HFF QS GVYT DFP NP   FNYTG  P N +VT
Sbjct  415   -NGTKFAASVNNVSFALPTTALLQSHFFGQSNGVYTTDFPTNPLNPFNYTGTSPNNTLVT  473

Query  1458  SATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLV  1637
             +ATK V L FNSSVE+V+QDT+I+GAE+HPLHLHG+NFFV+G+GFGN+DPNKDP+ FNL 
Sbjct  474   NATKTVVLPFNSSVEVVLQDTNILGAENHPLHLHGYNFFVVGEGFGNFDPNKDPANFNLK  533

Query  1638  DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQP  1817
             DP ERNTVGVP+GGW+A RF ADNPG WFMHCH +VHTSWGL+MAWIV+DG    QKL P
Sbjct  534   DPIERNTVGVPAGGWIAFRFFADNPGVWFMHCHFDVHTSWGLRMAWIVLDGPLPSQKLPP  593

Query  1818  PPADLPKC  1841
             PP+DLPKC
Sbjct  594   PPSDLPKC  601



>ref|XP_006488364.1| PREDICTED: laccase-17-like [Citrus sinensis]
Length=583

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/573 (69%), Positives = 471/573 (82%), Gaps = 4/573 (1%)
 Frame = +3

Query  132   FIIFVLAAFC-WVSGDVALA--KHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPR  302
              + F++   C WV   VA+A  KH G+TRHYKF+I+++NVTRLC TKS+VTVNG+FPGPR
Sbjct  12    LVAFLIVTSCIWVFPQVAVATSKHTGVTRHYKFNIRLKNVTRLCHTKSMVTVNGKFPGPR  71

Query  303   IIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTIT  482
             ++AREGDR++VKVVNH   N++IHWHG+RQL+SGWADGPAYITQCPIQTGQSYVYNFT+ 
Sbjct  72    VVAREGDRIIVKVVNHAPNNISIHWHGIRQLQSGWADGPAYITQCPIQTGQSYVYNFTVV  131

Query  483   GQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQ  662
             GQRGTL WHAH  WLRAT+YGP++ILP+   +YPF +P+KEV I+ GEW+ AD E II+Q
Sbjct  132   GQRGTLLWHAHFQWLRATVYGPLIILPRHNASYPFAKPYKEVTIMLGEWFNADPEAIINQ  191

Query  663   ASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIA  842
             + QTG  PN+S+A+T NGLPGP YNCSAKD++KLKVK GK Y+LRLIN ALNDELFFSIA
Sbjct  192   SLQTGNGPNVSEAYTFNGLPGPTYNCSAKDTYKLKVKPGKAYMLRLINTALNDELFFSIA  251

Query  843   NHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFD  1022
             NH+LTVVEADA YVKPF TNI++I PGQTTNVLLKT  + PNA++ + ARPY TG   FD
Sbjct  252   NHTLTVVEADATYVKPFETNILVIAPGQTTNVLLKTNPNPPNASFFMLARPYFTGMGTFD  311

Query  1023  NSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             NST A ILEY T S   +     LF P+LP  NDT+F  NF+ K RSLANA FPANVP+ 
Sbjct  312   NSTVAAILEYETPSQDNSFRNRTLFKPSLPAINDTNFVANFSSKFRSLANAQFPANVPQT  371

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVY  1382
             VD+RFFFTV LG  PCP+NQTCQGP N TKFAA+VNN+SF  P+TALLQ++FF +SKGVY
Sbjct  372   VDKRFFFTVSLGANPCPKNQTCQGP-NGTKFAAAVNNVSFALPSTALLQSYFFAKSKGVY  430

Query  1383  TADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
             TADFP  P   FNYTG PP N  V++ TK + + FN+SVELV+QDTSI+GAESHPLHLHG
Sbjct  431   TADFPQFPLHPFNYTGTPPNNTFVSNGTKALVIPFNTSVELVLQDTSILGAESHPLHLHG  490

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
             +N +V+GQGFGN+DP  DP+KFNL+DP ERNTVGVPSGGWVAIRFLADNPG WFMHCH +
Sbjct  491   YNVYVVGQGFGNFDPKNDPAKFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFD  550

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VH SWGL+MAWIV+DG+   QKL PPP+DLPKC
Sbjct  551   VHLSWGLRMAWIVLDGELPNQKLPPPPSDLPKC  583



>ref|XP_006429120.1| hypothetical protein CICLE_v10011363mg [Citrus clementina]
 gb|ESR42360.1| hypothetical protein CICLE_v10011363mg [Citrus clementina]
Length=578

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/550 (73%), Positives = 466/550 (85%), Gaps = 2/550 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AGITRHY F+IK  NVTRLC T++I++VNG+FPGP ++AREGDRV++KV NHV  NVTIH
Sbjct  30    AGITRHYTFNIKYHNVTRLCHTRNIISVNGQFPGPSLVAREGDRVLIKVTNHVSNNVTIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQ+ SGWADGPAY+TQCPIQTGQSY YNFTITGQRGTL WHAHISWLR+TLYGPI+
Sbjct  90    WHGVRQVTSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSTLYGPII  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+  +YPF +P KE+PI+FGEW+  D E IISQA QTG  PN+SDA+TINGLPGPLY
Sbjct  150   ILPKRNESYPFQKPHKEIPILFGEWFNVDPEAIISQALQTGAGPNVSDAYTINGLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS+KD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF+T+ +LI
Sbjct  210   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFDTDKLLI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLP  1091
             TPGQT NVLL+T  + PNAT+ + ARPY +G    DNSTTAGILEY   +++  ++ KL 
Sbjct  270   TPGQTANVLLRTKPYFPNATFFMQARPYFSGMGTIDNSTTAGILEYKHPSNHSISSKKLQ  329

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             L+ PTLP  NDTSFA NFT+K RSLA+  +PANVP+ VDR+FFFTVGLG  PCP+N TCQ
Sbjct  330   LYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKNTTCQ  389

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N TKF+ASVNN+SFV P+TA+LQ++FF Q+ GVYT DFP  PP+ FNYTG PP N  
Sbjct  390   GP-NGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPPNNTN  448

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ T+ V L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+G GFGNYDP+KD   FN
Sbjct  449   VSNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDLMNFN  508

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNT+GVP+GGWVAIRF ADNPG WFMHCHL+VHTSWGL+MAWIV +G    Q L
Sbjct  509   LVDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQPNQTL  568

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  569   PPPPSDLPKC  578



>gb|KDO51175.1| hypothetical protein CISIN_1g008090mg [Citrus sinensis]
Length=578

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/550 (73%), Positives = 466/550 (85%), Gaps = 2/550 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AGITRHY F+IK  NVTRLC T++I++VNG+FPGP ++AREGDRV++KV NHV  NVTIH
Sbjct  30    AGITRHYTFNIKYHNVTRLCHTRNIISVNGQFPGPSLVAREGDRVLIKVTNHVSNNVTIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQ+ SGWADGPAY+TQCPIQTGQSY YNFTITGQRGTL WHAHISWLR+TLYGPI+
Sbjct  90    WHGVRQVTSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSTLYGPII  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+  +YPF +P KE+PI+FGEW+  D E IISQA QTG  PN+SDA+TINGLPGPLY
Sbjct  150   ILPKRNESYPFQKPHKEIPILFGEWFNVDPEAIISQALQTGAGPNVSDAYTINGLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS+KD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF+T+ +LI
Sbjct  210   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFDTDKLLI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLP  1091
             TPGQT NVLL+T  + PNAT+ + ARPY +G    DNSTTAGILEY   +++  ++ KL 
Sbjct  270   TPGQTANVLLRTKPYFPNATFFMQARPYFSGMGTIDNSTTAGILEYKHPSNHSISSKKLQ  329

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             L+ PTLP  NDTSFA NFT+K RSLA+  +PANVP+ VDR+FFFTVGLG  PCP+N TCQ
Sbjct  330   LYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKNTTCQ  389

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N TKF+ASVNN+SFV P+TA+LQ++FF Q+ GVYT DFP  PP+ FNYTG PP N  
Sbjct  390   GP-NGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPPNNTN  448

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ T+ V L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+G GFGNYDP+KD   FN
Sbjct  449   VSNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDLMNFN  508

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNT+GVP+GGWVAIRF ADNPG WFMHCHL+VHTSWGL+MAWIV +G    Q L
Sbjct  509   LVDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQPNQTL  568

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  569   PPPPSDLPKC  578



>ref|XP_011095204.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=579

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/550 (73%), Positives = 464/550 (84%), Gaps = 4/550 (1%)
 Frame = +3

Query  201   ITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWH  380
             +TRHY F+I   NVTRLC TKSI++VNG+FPGPR+IAREGD+V+VKVVN+V  NVTIHWH
Sbjct  31    MTRHYTFNIVQHNVTRLCTTKSIISVNGKFPGPRLIAREGDQVLVKVVNNVMNNVTIHWH  90

Query  381   GVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVIL  560
             GVRQLRSGWADGPAY+TQCPIQTGQSY YNFTITGQRGTLFWHAHISWLRATLYGPI+IL
Sbjct  91    GVRQLRSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLFWHAHISWLRATLYGPIIIL  150

Query  561   PKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNC  740
             P++  +YPF +P+KEVPIIFGEWW  D E +I+QA QTGG PN+SDA+TINGLPGPLYNC
Sbjct  151   PRQNESYPFRKPYKEVPIIFGEWWNVDPEAVINQALQTGGGPNVSDAYTINGLPGPLYNC  210

Query  741   SAK---DSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVL  911
             S+K   ++FKLKVK GKTY+LRLINAA+NDELFFSIANH++T+VEADAVYVKPF T++V 
Sbjct  211   SSKGNINTFKLKVKPGKTYMLRLINAAMNDELFFSIANHNVTIVEADAVYVKPFVTSVVF  270

Query  912   ITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLP  1091
             ITPGQTTNVLLKT  ++PNAT+L++ARPY TG   FDNST AG LEY    + +      
Sbjct  271   ITPGQTTNVLLKTKPYYPNATFLMAARPYFTGQGTFDNSTVAGFLEYEHPLHISFDKNKT  330

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             +F P+LP  N T    NFTK  RSL +  + ANVP+ VD++FFFTVGLG  PCPQN TCQ
Sbjct  331   IFKPSLPPINATGVVANFTKMFRSLNSPKYTANVPQTVDKQFFFTVGLGSSPCPQNATCQ  390

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N TKFAASVNN+SF  PTTALLQA+F   S G+YT DFP+NPP  FNYTG+PP N  
Sbjct  391   GP-NGTKFAASVNNVSFALPTTALLQAYFSKNSYGIYTTDFPSNPPNPFNYTGSPPNNTQ  449

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ T+VV L FN+SVELV+QDTSI+GAESHPLHLHGFNFFV+G+GFGNYDP KDP+ FN
Sbjct  450   VSNGTRVVVLPFNTSVELVLQDTSILGAESHPLHLHGFNFFVVGEGFGNYDPYKDPANFN  509

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNT+GVPSGGWVAIRFLADNPG WFMHCH +VHTSWGL+MAWIV+DG+   QKL
Sbjct  510   LVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHFDVHTSWGLRMAWIVLDGQLPSQKL  569

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  570   PPPPSDLPKC  579



>ref|XP_006846061.1| hypothetical protein AMTR_s00012p00061860 [Amborella trichopoda]
 gb|ERN07736.1| hypothetical protein AMTR_s00012p00061860 [Amborella trichopoda]
Length=579

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/566 (71%), Positives = 478/566 (84%), Gaps = 4/566 (1%)
 Frame = +3

Query  120   FAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGP  299
             F   F + +L +   +  +++ +KHAGITRHYKF+I+++N+TRLC TK ++TVNG  PGP
Sbjct  4     FLSAFAMALLLSTILLKSELSESKHAGITRHYKFNIRLENMTRLCHTKQVITVNGLVPGP  63

Query  300   RIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTI  479
             RI+AREGDR++VKVVNHV  NVT+HWHGVRQL+SGWADGPAY+TQCPIQTGQSYVYNFTI
Sbjct  64    RIVAREGDRLLVKVVNHVPNNVTLHWHGVRQLQSGWADGPAYVTQCPIQTGQSYVYNFTI  123

Query  480   TGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIIS  659
              GQRGTLFWHAH+SWLR+TLYGP+VILPK+ + YPF +P +EVPIIFGEWW  D+E +IS
Sbjct  124   IGQRGTLFWHAHVSWLRSTLYGPLVILPKRAIPYPFAKPHEEVPIIFGEWWNVDSEAVIS  183

Query  660   QASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSI  839
             QA QTGG PNISDA+TING PGPLYNCSAKD+F+L+V+ GKTYLLRLINAALNDELFFSI
Sbjct  184   QALQTGGGPNISDAYTINGHPGPLYNCSAKDTFRLEVEPGKTYLLRLINAALNDELFFSI  243

Query  840   ANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPF  1019
             ANHS+TVVE DA+YVKPF T +VLITPGQTTNVLL   +     T++++ARPY TG   F
Sbjct  244   ANHSVTVVETDAIYVKPFTTEVVLITPGQTTNVLLTAKSQPFGTTFVMAARPYVTGLGTF  303

Query  1020  DNSTTAGILEY---stnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPAN  1190
             DNSTT G+L Y   S  ++  +  KLPL  PTLP  NDT+FATNF+++LRSLA   FPAN
Sbjct  304   DNSTTVGLLHYNIPSFVNSSASRPKLPLLLPTLPPLNDTAFATNFSRRLRSLATNQFPAN  363

Query  1191  VPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQS  1370
             VP++VD+RF FTVGLG  PCP+NQTCQGP N TKFAASVNN+SFV PTTALLQ++FF QS
Sbjct  364   VPQRVDKRFLFTVGLGTSPCPKNQTCQGP-NGTKFAASVNNVSFVLPTTALLQSYFFGQS  422

Query  1371  KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPL  1550
              G+YT DFP NPP+ FNYTG+PP N + +  TK+  L FN+SVELV+QDT I+GAESHPL
Sbjct  423   VGIYTTDFPDNPPIPFNYTGSPPNNTLASFGTKLEVLKFNTSVELVLQDTGILGAESHPL  482

Query  1551  HLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMH  1730
             HLHGFNFFV+GQGFGNYDP+KDP+KFNLVDP ERNT+GVPSGGWVA+RFLADNPG WFMH
Sbjct  483   HLHGFNFFVVGQGFGNYDPSKDPAKFNLVDPVERNTIGVPSGGWVALRFLADNPGVWFMH  542

Query  1731  CHLEVHTSWGLKMAWIVMDGKGRKQK  1808
             CHLEVHTSWGLKMAW+V+DGK   QK
Sbjct  543   CHLEVHTSWGLKMAWLVLDGKLPSQK  568



>ref|XP_009131958.1| PREDICTED: laccase-17 [Brassica rapa]
Length=573

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/552 (72%), Positives = 464/552 (84%), Gaps = 4/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             G TRHY  DIKM NVTRLC TKS+V+VNG FPGP++IAREGD++++KVVNHV  N+++HW
Sbjct  22    GKTRHYTLDIKMHNVTRLCHTKSLVSVNGEFPGPKLIAREGDQLLIKVVNHVPNNISLHW  81

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLRSGWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL++HAHISWLRAT+YGP++I
Sbjct  82    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGTLWYHAHISWLRATVYGPLII  141

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPF +P KEVP++FGEW+ ADTE II QA+ TGG P++SDA+TINGLPGPLYN
Sbjct  142   LPKHGVPYPFHKPHKEVPMVFGEWFNADTEAIIRQATLTGGGPSVSDAYTINGLPGPLYN  201

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+F+L+VK GKTYLLRLINAALNDELFFSIANH++TVVEADA+YVKPF T+ +LI 
Sbjct  202   CSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIA  261

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst--nsnktttnkLP  1091
             PGQTTN+LLKT   +P A++L++ARPY TG   FDNST AGILEY    ++  +    L 
Sbjct  262   PGQTTNLLLKTKQSYPKASFLMTARPYVTGQGTFDNSTVAGILEYEQPKHTKTSIKKNLQ  321

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC--PQNQT  1265
             LFTP LP  NDT+FAT F+ KLRSL +  FPANVP KVDR+FFFTVGLG  PC    NQT
Sbjct  322   LFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPLKVDRKFFFTVGLGTNPCNHKNNQT  381

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGPTN T FAAS++NISF  PT ALLQ+H+  QS GVY+ +FP +P V FNYTG PP N
Sbjct  382   CQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSPNFPWSPIVPFNYTGTPPNN  441

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ T ++ L +N+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQGFGN+D  +DP  
Sbjct  442   TMVSTGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDAKEDPKN  501

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNTVGVPSGGW AIRFLADNPG WFMHCHLEVHTSWGL+MAW+V+DG    Q
Sbjct  502   FNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQ  561

Query  1806  KLQPPPADLPKC  1841
             KL PPPADLPKC
Sbjct  562   KLLPPPADLPKC  573



>ref|XP_006480879.1| PREDICTED: laccase-17-like [Citrus sinensis]
Length=567

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/550 (72%), Positives = 465/550 (85%), Gaps = 2/550 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AGITRHY F+IK  NVTRLC T++I++VNG+FPGP ++ REGDRV++KV NHV  NVTIH
Sbjct  19    AGITRHYTFNIKYHNVTRLCHTRNIISVNGQFPGPSLLVREGDRVLIKVTNHVSNNVTIH  78

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQ+ SGWADGPAY+TQCPIQTGQSY YNFTITGQRGTL WHAHISWLR+TLYGPI+
Sbjct  79    WHGVRQVTSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSTLYGPII  138

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+  +YPF +P KE+PI+FGEW+  D E IISQA QTG  PN+SDA+TINGLPGPLY
Sbjct  139   ILPKRNESYPFQKPHKEIPILFGEWFNVDPEAIISQALQTGAGPNVSDAYTINGLPGPLY  198

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS+KD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVEADAVYVKPF+T+ +LI
Sbjct  199   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFDTDKLLI  258

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYst-nsnktttnkLP  1091
             TPGQT NVLL+T  + PNAT+ + ARPY +G    DNSTTAGILEY   +++  ++ KL 
Sbjct  259   TPGQTANVLLRTKPYFPNATFFMQARPYFSGMGTIDNSTTAGILEYKHPSNHSISSKKLQ  318

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             L+ PTLP  NDTSFA NFT+K RSLA+  +PANVP+ VDR+FFFTVGLG  PCP+N TCQ
Sbjct  319   LYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKNTTCQ  378

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP N TKF+ASVNN+SFV P+TA+LQ++FF Q+ GVYT DFP  PP+ FNYTG PP N  
Sbjct  379   GP-NGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPPNNTN  437

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             V++ T+ V L FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+G GFGNYDP+KD   FN
Sbjct  438   VSNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDLMNFN  497

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDP ERNT+GVP+GGWVAIRF ADNPG WFMHCHL+VHTSWGL+MAWIV +G    Q L
Sbjct  498   LVDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQPNQTL  557

Query  1812  QPPPADLPKC  1841
              PPP+DLPKC
Sbjct  558   PPPPSDLPKC  567



>ref|XP_006856865.1| hypothetical protein AMTR_s00055p00189700 [Amborella trichopoda]
 gb|ERN18332.1| hypothetical protein AMTR_s00055p00189700 [Amborella trichopoda]
Length=582

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/581 (71%), Positives = 481/581 (83%), Gaps = 4/581 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             +M  +     +I  L+A   +   +A AKHAGITR Y F+I  +N+ RLC  K + TVNG
Sbjct  4     LMRAMVVMSVVICALSAMGSLP-QLAEAKHAGITRRYTFNIVAKNIRRLCHAKPVATVNG  62

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             + PGP +IAREGDRV+VKVVN+ +YN+TIHWHGVRQL+SGWADGPAY+TQCPIQTGQ+YV
Sbjct  63    QVPGPTLIAREGDRVLVKVVNNAQYNITIHWHGVRQLQSGWADGPAYVTQCPIQTGQTYV  122

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFTITGQRGTL WHAH SWLR+T+YG IVILP++ V +PFP P +++PIIFGEWW  D 
Sbjct  123   YNFTITGQRGTLLWHAHASWLRSTVYGAIVILPRRHVPFPFPTPHQDIPIIFGEWWNVDP  182

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +ISQA QTGGAPN+SD++TING PGPLYNCSAKD+F L V  GKTYLLRLINAALNDE
Sbjct  183   EAVISQALQTGGAPNVSDSYTINGHPGPLYNCSAKDTFSLMVAPGKTYLLRLINAALNDE  242

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANHSLTVVEADA+YVKPF+TN+V++ PGQTTNVLL T    PNA++L+SARPYAT
Sbjct  243   LFFSIANHSLTVVEADAIYVKPFSTNVVVLAPGQTTNVLLTTKIQPPNASFLMSARPYAT  302

Query  1005  GPAPFDNSTTAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANAN  1178
             GPA FDNSTTAGIL+Y T   S+ ++ +K  L +P+LP  NDT+F T+FT+KL+SLAN  
Sbjct  303   GPATFDNSTTAGILQYQTNLTSSSSSRSKFRLLSPSLPTINDTNFVTSFTQKLKSLANNQ  362

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPANVP+KVD++FFFTVGLG  PCP+NQTCQGP N TK  AS+NN+SFV P+ A+LQ HF
Sbjct  363   FPANVPQKVDKQFFFTVGLGTSPCPKNQTCQGP-NGTKLTASINNVSFVLPSIAMLQTHF  421

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
               +  GVYT DFP NPP  FNY G PP N MVTS TK V L FN+SVE+V+QDT I+GAE
Sbjct  422   SGKLAGVYTTDFPNNPPFPFNYIGPPPNNTMVTSGTKAVVLKFNTSVEVVLQDTGILGAE  481

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQGFGNYDP+KDP+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG 
Sbjct  482   SHPLHLHGFNFFVMGQGFGNYDPSKDPAKFNLVDPMERNTVGVPSGGWVAIRFLADNPGV  541

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             W MHCHLEVHTSWGLKMAW+VMDG    QKL PPP+DLPKC
Sbjct  542   WLMHCHLEVHTSWGLKMAWVVMDGTLPNQKLPPPPSDLPKC  582



>ref|XP_010654259.1| PREDICTED: laccase-2-like [Vitis vinifera]
 emb|CBI30535.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/552 (73%), Positives = 463/552 (84%), Gaps = 5/552 (1%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG+TRHY F+I + NVTRLCQTKSI++VNGRFPGP ++AREGDRVVVKVVN V  NVTIH
Sbjct  30    AGVTRHYTFNITLHNVTRLCQTKSIISVNGRFPGPPVVAREGDRVVVKVVNKVSNNVTIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHGVRQLRS WADGP Y+TQCPIQTGQ+Y YNFTITGQRGTL WHAHISWLRATLYGPI+
Sbjct  90    WHGVRQLRSAWADGPTYVTQCPIQTGQTYTYNFTITGQRGTLLWHAHISWLRATLYGPII  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILP++  +YPFP+P KEV IIFGEWW AD E +ISQA Q+GG PN+SDA+TINGLPGPLY
Sbjct  150   ILPRRNESYPFPKPHKEVTIIFGEWWNADPEAVISQALQSGGGPNVSDAYTINGLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS+KD++KLKVK GKTYLLRLINAALNDELFFSIANH+LTVVE DA YVKPF+TN+++I
Sbjct  210   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEGDATYVKPFDTNVLVI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             TPGQTTNVLLKT  + PN+T+L++ARPY TG   FDNSTTAGILEY   S  T++     
Sbjct  270   TPGQTTNVLLKTKPYFPNSTFLMAARPYFTGQGTFDNSTTAGILEYVNPSKPTSSQNKLP  329

Query  1095  FTPTLPVF---NDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
                        N T F TNFT+K RSLA A FPANVP+ VD+RFFFT+GLG  PCP++ T
Sbjct  330   LLKPTLPPVNPNATGFVTNFTRKFRSLATAKFPANVPQTVDKRFFFTIGLGSNPCPKDMT  389

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGP N TKF+ASVNNISF+ P+ +++QA+FF Q+ GVYT DFP  PPV FNYTG PP N
Sbjct  390   CQGP-NGTKFSASVNNISFILPSVSIMQAYFFGQN-GVYTTDFPTYPPVPFNYTGTPPNN  447

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
              MV++ T+VV L FN+SVELVMQDTSI+GAESHP HLHG+NF+V+GQG GNYDPN DP+ 
Sbjct  448   TMVSNGTRVVVLPFNTSVELVMQDTSILGAESHPFHLHGYNFYVVGQGIGNYDPNTDPAN  507

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             FNLVDP ERNT GVP+GGWVAIRF ADNPG WFMHCHL+VHTSWGL+MAWIV+DG+   Q
Sbjct  508   FNLVDPVERNTFGVPAGGWVAIRFQADNPGVWFMHCHLDVHTSWGLRMAWIVLDGQQPNQ  567

Query  1806  KLQPPPADLPKC  1841
             KL PPP+DLPKC
Sbjct  568   KLPPPPSDLPKC  579



>ref|XP_008359730.1| PREDICTED: laccase-17-like [Malus domestica]
Length=586

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/574 (71%), Positives = 463/574 (81%), Gaps = 10/574 (2%)
 Frame = +3

Query  144   VLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             +L  FC V+  +      GITRHY F++K  NVTRLC T+SIV+VNG+FPGPR++AREGD
Sbjct  15    LLFGFCIVA-SLMPEFAVGITRHYTFNVKYHNVTRLCNTRSIVSVNGQFPGPRLVAREGD  73

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             +V++KVVNH+  NVTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY YNFTI GQRGTL 
Sbjct  74    QVLIKVVNHISNNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYTYNFTIQGQRGTLL  133

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAHISWLR+TLYGPI+ILPK   +YPF +P+KEVPI+ GEW+  D E +I+QA QTGG 
Sbjct  134   WHAHISWLRSTLYGPIIILPKLNESYPFMKPYKEVPILLGEWFNVDPEAVINQALQTGGG  193

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGPLYNCS+KD FKLKVK  KTYLLRLINAALNDELFFSIANH+LTVV
Sbjct  194   PNVSDAYTINGLPGPLYNCSSKDVFKLKVKPXKTYLLRLINAALNDELFFSIANHTLTVV  253

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             EADAVY KPF T+ +LITPGQTTNVLLKT  + PNAT+LI ARPY TG    DN+TTAGI
Sbjct  254   EADAVYTKPFETDTLLITPGQTTNVLLKTKPNSPNATFLILARPYFTGAGTLDNTTTAGI  313

Query  1044  LEYs--tnsnktttnkLPLFTPTLPVFNDTSFAT------NFTKKLRSLANANFPANVPK  1199
             LEY     ++  +   LPLF P+LP  N T F        N   K RSLA+  FPANVP+
Sbjct  314   LEYEHPVTTHHASIKTLPLFKPSLPPINATKFVNVTQFVLNLANKFRSLASKKFPANVPQ  373

Query  1200  KVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGV  1379
              VDR FFFTVGLG  PCPQN TCQGP N  KFAAS+NN SF  P+TA+LQAHF  QS G+
Sbjct  374   TVDRNFFFTVGLGTSPCPQNSTCQGP-NGLKFAASINNFSFALPSTAMLQAHFSGQSNGI  432

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             YT DFPANP VKFNYTG PP    V +ATK + L FN+SVELV+QDTSI+GAESHPLHLH
Sbjct  433   YTTDFPANPLVKFNYTGTPPNVTNVANATKALVLPFNTSVELVLQDTSILGAESHPLHLH  492

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNF+++GQG GNYDPNK+P+KFNLVDP ERNT GVP+GGW+A+RF ADNPG WFMHCHL
Sbjct  493   GFNFYIVGQGIGNYDPNKBPAKFNLVDPXERNTAGVPAGGWIAVRFXADNPGVWFMHCHL  552

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             ++HTSWGLKMAWIV DG    QKL PPP+DLPKC
Sbjct  553   DIHTSWGLKMAWIVQDGPQANQKLPPPPSDLPKC  586



>ref|XP_004514389.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=579

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/568 (69%), Positives = 473/568 (83%), Gaps = 5/568 (1%)
 Frame = +3

Query  144   VLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             +L  FC ++    L     ITRHY F+I+  NVTRLC T++I++VNG+FPGPR++AREGD
Sbjct  15    LLFGFCVITLFPELV--VSITRHYTFNIEYLNVTRLCHTRNILSVNGKFPGPRLVAREGD  72

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
             RV+VKVVNH+  NVTIHWHG+RQ  +GW+DGPAY+TQCPIQT Q+Y YNFTITGQRGTLF
Sbjct  73    RVLVKVVNHISNNVTIHWHGIRQKTTGWSDGPAYVTQCPIQTNQTYTYNFTITGQRGTLF  132

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAHISWLRATLYGPI+ILPKK  +YPF +P++E+PI+FGEW+  D E +I+QA QTGG 
Sbjct  133   WHAHISWLRATLYGPIIILPKKNESYPFEKPYREIPILFGEWFNVDPEAVINQALQTGGG  192

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGP YNCS+KD+FKLKVK  KTYLLR+INAALN+ELFFSIANH+LTVV
Sbjct  193   PNVSDAYTINGLPGPFYNCSSKDTFKLKVKPNKTYLLRIINAALNEELFFSIANHTLTVV  252

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             EADA Y+KPFNT+I++ITPGQTTNV+LKT  + PN+T+L+ ARPY TG   FDNST AGI
Sbjct  253   EADARYIKPFNTDIIVITPGQTTNVILKTKPYFPNSTFLMIARPYVTGLGTFDNSTPAGI  312

Query  1044  LEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFF  1223
             L+Y    +K+ T  LP   PTLP  NDT+F +NFT+K +SLAN+ FP NVPKKVD++ FF
Sbjct  313   LQY-KQQHKSPTKNLPFLKPTLPFINDTNFVSNFTRKFKSLANSKFPINVPKKVDKKLFF  371

Query  1224  TVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH--FFNQSKGVYTADFP  1397
             TVGLG  PCP+N TCQGPTNNTKFAASVNN SFV P+ ++++++  F N + GVY  DFP
Sbjct  372   TVGLGTSPCPENTTCQGPTNNTKFAASVNNYSFVLPSVSIMESYYNFGNSNNGVYKTDFP  431

Query  1398  ANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFV  1577
              NP   FNYTG PP N MV + TK+V L FN+SVEL++QDTSI+GAESHPLHLHG++FFV
Sbjct  432   DNPLNPFNYTGTPPNNTMVNNDTKLVVLKFNTSVELILQDTSILGAESHPLHLHGYDFFV  491

Query  1578  IGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSW  1757
             +GQGFGNYD NKDPS FNL DP ERNTVGVP+GGWVAIRF ADNPG WFMHCHL++HTSW
Sbjct  492   VGQGFGNYDSNKDPSNFNLFDPVERNTVGVPAGGWVAIRFFADNPGVWFMHCHLDIHTSW  551

Query  1758  GLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             GL+MAWIV+DG    QKLQPPP+DLPKC
Sbjct  552   GLRMAWIVLDGPESNQKLQPPPSDLPKC  579



>ref|XP_004246425.1| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=571

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/573 (70%), Positives = 471/573 (82%), Gaps = 9/573 (2%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             +++F  A  C +           ITRHY F+I   NVTRLC TKSIV+VNGRFPGPRIIA
Sbjct  5     YLLFGFAILCLLPQSTFC-----ITRHYTFNIVKHNVTRLCTTKSIVSVNGRFPGPRIIA  59

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDRV+VKV+N V  N++IHWHG+RQL +GWADGPAY+TQCPIQ  +SY YNFTI GQR
Sbjct  60    REGDRVIVKVINQVSNNISIHWHGIRQLANGWADGPAYVTQCPIQFNKSYTYNFTIIGQR  119

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GTLFWHAHISWLRAT+YGPI+ILP++  +YPF +P+K++PI+FGEWW  DTE +I+QA Q
Sbjct  120   GTLFWHAHISWLRATVYGPIIILPRRNESYPFKKPYKQIPIMFGEWWNVDTEAVINQALQ  179

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYNCS+KD+FKLKVK GKTY+LRLINAALNDE+FFSIANH+
Sbjct  180   TGGGPNVSDAYTINGLPGPLYNCSSKDTFKLKVKPGKTYMLRLINAALNDEMFFSIANHT  239

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             LT+V+ADA+Y KPFNTN+V ITPGQTTNVLLKT  H+PNAT+L++A+PY +G   FDNST
Sbjct  240   LTIVDADAIYTKPFNTNVVFITPGQTTNVLLKTKPHYPNATFLMAAQPYFSGLGTFDNST  299

Query  1032  TAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
              AGILEY +  +++ T  +K+ LF PTLP    TSF  NFTK  RSLAN  FPANVP  V
Sbjct  300   VAGILEYESPLHNSPTNKSKIKLFKPTLPNITSTSFVANFTKNFRSLANTPFPANVPLNV  359

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             D+RF FT+GLG  PCP+N TCQGP N TKFAASVNNISF+ PTTALLQ+H+F QS G+YT
Sbjct  360   DKRFLFTIGLGSNPCPKNMTCQGP-NGTKFAASVNNISFILPTTALLQSHYFGQSNGIYT  418

Query  1386  ADFPANPPVKFNYTGNP-PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
              DFP  P   FNYTG+P P N  VT+ATKVV L FNSSVE+V+QDTSI+GAE+HPLHLHG
Sbjct  419   TDFPVTPLNPFNYTGSPQPNNTFVTNATKVVVLPFNSSVEVVLQDTSILGAENHPLHLHG  478

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
              NFFV+G+GFGN+DPN DPS FNL DP +RNTVGVP+GGW+A RF ADNPG WFMHCH E
Sbjct  479   HNFFVVGEGFGNFDPNNDPSNFNLKDPIQRNTVGVPAGGWIAFRFFADNPGVWFMHCHFE  538

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGL+MAWIV+DG    QKL PPP+DLPKC
Sbjct  539   VHTSWGLRMAWIVLDGSLPSQKLPPPPSDLPKC  571



>ref|XP_004970542.1| PREDICTED: laccase-4-like [Setaria italica]
Length=582

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/559 (71%), Positives = 460/559 (82%), Gaps = 5/559 (1%)
 Frame = +3

Query  180   ALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvky  359
             ++ +  GITR+Y F++ M NVTRLC +KSIVTVNG+FPGP ++AREGDRVVV+V NH ++
Sbjct  24    SIVEVQGITRYYDFNVTMANVTRLCSSKSIVTVNGQFPGPELVAREGDRVVVRVTNHAQH  83

Query  360   nvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATL  539
             NV++HWHG+RQLR+GWADGPAYITQCPIQTGQSYVYNFT+ GQRGTL+WHAHISWLRAT+
Sbjct  84    NVSLHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNFTVVGQRGTLWWHAHISWLRATV  143

Query  540   YGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGL  719
             YGPIVILPK GV YPFP P+KEVP+IFGEWW+ADTE +I QA QTGG PN+SDA TINGL
Sbjct  144   YGPIVILPKLGVPYPFPAPYKEVPVIFGEWWQADTEVVIKQALQTGGGPNVSDAHTINGL  203

Query  720   PGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNT  899
             PGPLYNCSAKD++KLKVK GKTY+LRLINAALNDELFFSIANHSLTVVE DAVYVKPF  
Sbjct  204   PGPLYNCSAKDTYKLKVKPGKTYMLRLINAALNDELFFSIANHSLTVVEVDAVYVKPFTV  263

Query  900   NIVLITPGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYst----ns  1064
             + +LI PGQTTNVLL     +P A Y +SA PY+T  P  FDN+T AGILEY      +S
Sbjct  264   DTLLIAPGQTTNVLLTAKPFYPGANYYMSAAPYSTTRPGTFDNTTVAGILEYEYPDAPSS  323

Query  1065  nktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVI  1244
               +    LPL+ PTLP FNDT F  NFT KLRSLA A +PA VPK VD++FFFTVGLG  
Sbjct  324   APSFNKALPLYKPTLPGFNDTDFVGNFTAKLRSLATAQYPAAVPKTVDKKFFFTVGLGTH  383

Query  1245  PCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNY  1424
             PCP N TCQGPTN T+FAASVNN+SF  PT ALL +HF   S GVY++DFP  P   FNY
Sbjct  384   PCPANTTCQGPTNTTQFAASVNNVSFALPTRALLHSHFTGLSSGVYSSDFPVAPLTPFNY  443

Query  1425  TGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYD  1604
             TG PP N  V + TK++ + + ++VELVMQ TSI+G ESHPLHLHGFNFFV+GQG+GNYD
Sbjct  444   TGTPPNNTNVANGTKLMVIPYGTNVELVMQGTSILGIESHPLHLHGFNFFVVGQGYGNYD  503

Query  1605  PNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVM  1784
             P  DP+KFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHT+WGL+MAW+V+
Sbjct  504   PVNDPAKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVL  563

Query  1785  DGKGRKQKLQPPPADLPKC  1841
             DG    QKL PPP+DLPKC
Sbjct  564   DGSLPHQKLLPPPSDLPKC  582



>gb|EYU41744.1| hypothetical protein MIMGU_mgv1a025875mg [Erythranthe guttata]
Length=554

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/543 (76%), Positives = 460/543 (85%), Gaps = 28/543 (5%)
 Frame = +3

Query  189   KHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvT  368
             KH+G+TRHYKF+I+MQNVTRLCQ+KSIVTVNG+FPGP I AREGDRVVVKVVNHV+YNV+
Sbjct  24    KHSGVTRHYKFNIEMQNVTRLCQSKSIVTVNGQFPGPTITAREGDRVVVKVVNHVQYNVS  83

Query  369   IHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGP  548
             IHWHG+RQLRSGWADGPAYITQCPIQTGQSYVYNFT+T QRGTLFWHAHISWLR TLYGP
Sbjct  84    IHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTAQRGTLFWHAHISWLRVTLYGP  143

Query  549   IVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGP  728
             I++LPKKGV YPFPQP+KE+PIIFGEWWKADTE +I+QA QTGGAPNISDAFTINGL GP
Sbjct  144   IIVLPKKGVPYPFPQPYKEIPIIFGEWWKADTETVINQALQTGGAPNISDAFTINGLTGP  203

Query  729   LYN-CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNI  905
              YN CSAKD                       ELFFSIANH++TVV+ADAVYVKPF TNI
Sbjct  204   FYNNCSAKD-----------------------ELFFSIANHTMTVVDADAVYVKPFKTNI  240

Query  906   VLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEY--stnsnkttt  1079
             VLITPGQTTNVLLKT  H PN  +L+ ARPYATGPA FDNSTTAGILEY  S+N+     
Sbjct  241   VLITPGQTTNVLLKTKKHRPNTAFLMEARPYATGPASFDNSTTAGILEYHLSSNNATNNN  300

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQ-  1256
              K+ L  P+LP FNDT FAT F+KKLRSLA++ FPA VP+KVDRRFFFTVGLG+ PC   
Sbjct  301   TKIALLKPSLPKFNDTVFATKFSKKLRSLASSKFPALVPQKVDRRFFFTVGLGLNPCSSP  360

Query  1257  NQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNP  1436
             N+TCQGP NNT   AS+NN+SFV P TALLQAH+ NQSKGVYTADFPANPP KFNYTGNP
Sbjct  361   NKTCQGP-NNTMLTASINNVSFVMPNTALLQAHYSNQSKGVYTADFPANPPFKFNYTGNP  419

Query  1437  PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKD  1616
             P+N    + T+V  L FN+SVE+V+QDTSI+GAESHPLHLHG+NFFV+GQGF N+DPNKD
Sbjct  420   PSNPAAAAGTRVAVLPFNASVEVVLQDTSIVGAESHPLHLHGYNFFVLGQGFENFDPNKD  479

Query  1617  PSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKG  1796
             P+KFNLVDP ERNTVGVPSGGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+VMDG  
Sbjct  480   PAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVMDGIR  539

Query  1797  RKQ  1805
             R Q
Sbjct  540   RNQ  542



>ref|XP_007026983.1| Laccase 17 isoform 1 [Theobroma cacao]
 ref|XP_007026984.1| Laccase 17 isoform 1 [Theobroma cacao]
 gb|EOY07485.1| Laccase 17 isoform 1 [Theobroma cacao]
 gb|EOY07486.1| Laccase 17 isoform 1 [Theobroma cacao]
Length=577

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/549 (72%), Positives = 459/549 (84%), Gaps = 1/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG TRHY F+I   NVTRLC T++I+TVN +FPGPR++AREGDRV+VKVVNH+  NV+IH
Sbjct  30    AGETRHYTFNIDYHNVTRLCHTRTILTVNRQFPGPRLVAREGDRVIVKVVNHISNNVSIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL +GWADGP+Y+TQCPIQT QSY+YNFTITGQRGTL WHAHISWLRAT+YGPI+
Sbjct  90    WHGIRQLTTGWADGPSYVTQCPIQTNQSYIYNFTITGQRGTLLWHAHISWLRATIYGPII  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+  +YPF +P KEV I+FGEW+  D E IISQA QTG APN+SDA+TIN LPGPLY
Sbjct  150   ILPKRNESYPFVKPHKEVTILFGEWFNTDPEAIISQALQTGAAPNVSDAYTINSLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS+KD++KLKVK GKTYLLRLINAALNDELFFSIANH++TVVE DA+Y KPF T+ +LI
Sbjct  210   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTVTVVEGDAIYTKPFETDKLLI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             TPGQTTNVLLKT    PNA++L++ARPY TG    DNSTT GILEY    +  ++  L L
Sbjct  270   TPGQTTNVLLKTKPEFPNASFLMAARPYFTGQGTIDNSTTVGILEYEHPKHHKSSKNLTL  329

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               PTLP  N T+F  NFT K RSLANA FPANVPK VD++FFFTVGLG  PCPQN TCQG
Sbjct  330   LQPTLPPINATAFVANFTGKFRSLANAKFPANVPKTVDKKFFFTVGLGTSPCPQNTTCQG  389

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P N++KFAASVNN+SF  P+ A+LQA++F Q+ GVYT DFP  P + FNYTG PP N  V
Sbjct  390   PNNSSKFAASVNNMSFALPSVAILQAYYFGQN-GVYTTDFPTQPLIPFNYTGTPPNNTNV  448

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
              + T+ V L FN+SVELVMQDTSI+GAESHPLHLHG+NFFV+GQGFGN+DPNKDP+KFNL
Sbjct  449   MNGTRTVVLPFNTSVELVMQDTSILGAESHPLHLHGYNFFVVGQGFGNFDPNKDPAKFNL  508

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
             VDP ERNT GVP+GGW+AIRF ADNPG WFMHCHL+VHTSWGLKMAWIV+DG    QKLQ
Sbjct  509   VDPMERNTAGVPAGGWLAIRFFADNPGVWFMHCHLDVHTSWGLKMAWIVLDGPQPNQKLQ  568

Query  1815  PPPADLPKC  1841
             PPP+DLP+C
Sbjct  569   PPPSDLPQC  577



>ref|XP_010906603.1| PREDICTED: laccase-17-like [Elaeis guineensis]
Length=576

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/549 (73%), Positives = 460/549 (84%), Gaps = 2/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AGITRH+KFDIK+QNVTRLC T+S+VTVNGRFPGP+I+ REGDRVVVKVVNHV+ N+TIH
Sbjct  30    AGITRHFKFDIKLQNVTRLCHTRSMVTVNGRFPGPKIVVREGDRVVVKVVNHVQNNITIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQ R+GWADGPAY+TQCPIQTGQSYVY+FTI GQRGTL+WHAH SWLRAT+YGP+V
Sbjct  90    WHGIRQFRNGWADGPAYVTQCPIQTGQSYVYDFTIVGQRGTLWWHAHHSWLRATVYGPLV  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+G+ YPFP+P+KEVPI+ GEW+  D E +I+QA QTG  PN+S+A+TINGLPGPLY
Sbjct  150   ILPKRGIPYPFPKPYKEVPILLGEWFNEDPEAVIAQALQTGAGPNVSEAYTINGLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCSAKD+FKL VK GK YLLRLINAALND+LFFSIANHS+TVVE DA YVKP   + +LI
Sbjct  210   NCSAKDTFKLNVKPGKRYLLRLINAALNDDLFFSIANHSMTVVETDASYVKPLQMDTILI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
              PG+TTN+LL T    PNAT+ + ARPY TG    DN+T AG+L+Y++ SNK     + L
Sbjct  270   GPGETTNILLHTKPASPNATFFMLARPYNTGLGTIDNTTVAGLLDYASTSNKNLFPVV-L  328

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               PTLP  NDT+ A NF+ KLRSLA+A FPANVP+ VDRRF+FTVGLG  PCP+NQTCQG
Sbjct  329   LKPTLPAINDTAAAANFSTKLRSLASAQFPANVPQTVDRRFYFTVGLGTSPCPKNQTCQG  388

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P N TKFAASVNN+SF  P+ ALLQAH+  QSKGVYT DFP NPP +FNYTG PP N  V
Sbjct  389   P-NGTKFAASVNNVSFAFPSMALLQAHYMEQSKGVYTTDFPNNPPFQFNYTGTPPNNTFV  447

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
             T+ATKVV L FN+SVELVMQDTSI GAESHPLHLHG NF+V+GQGFGNYDP KDP+KFNL
Sbjct  448   TNATKVVALPFNTSVELVMQDTSIQGAESHPLHLHGNNFYVVGQGFGNYDPMKDPAKFNL  507

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
             VDP ERNT GVPSGGW AIRF ADNPG W MHCH +VH SWGL+MAW+V DG    QKL 
Sbjct  508   VDPVERNTAGVPSGGWAAIRFRADNPGVWLMHCHFDVHLSWGLRMAWVVNDGPLPSQKLL  567

Query  1815  PPPADLPKC  1841
             PPP+DLPKC
Sbjct  568   PPPSDLPKC  576



>gb|KHG14663.1| Laccase-4 [Gossypium arboreum]
Length=500

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/490 (79%), Positives = 433/490 (88%), Gaps = 3/490 (1%)
 Frame = +3

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQ+RSGWADGPAY+TQCPIQT QSYVYNFT+TGQRGTLFWHAHISWLRATLYGPIVI
Sbjct  12    HGIRQIRSGWADGPAYVTQCPIQTRQSYVYNFTLTGQRGTLFWHAHISWLRATLYGPIVI  71

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPKK  +YPFP P+KEVP++FGEWWKADTE II+QA  TGGAPNISDAFTINGLPGP +N
Sbjct  72    LPKKHASYPFPHPYKEVPVVFGEWWKADTETIINQAMATGGAPNISDAFTINGLPGPSHN  131

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVKAGKTYLLRL+NAALNDELFF +ANH+LTVVEADAVYVKPF T+IVLIT
Sbjct  132   CSAKDTFKLKVKAGKTYLLRLVNAALNDELFFRVANHTLTVVEADAVYVKPFKTDIVLIT  191

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnkttt--nkLP  1091
             PGQTTNVLL+  +  P+A + +SARPYATGPA FDN+TT GILEY  +++ + +     P
Sbjct  192   PGQTTNVLLRAKSKTPSAKFAMSARPYATGPATFDNTTTIGILEYEKSASASKSNHKNSP  251

Query  1092  LFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQ  1271
             L    LP FND+S+A  F +K RSLA A FPA VPK VDRRFFFTVGLG++PC +NQTCQ
Sbjct  252   LLKAKLPQFNDSSYAMKFQRKFRSLATAKFPAKVPKNVDRRFFFTVGLGILPCSKNQTCQ  311

Query  1272  GPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIM  1451
             GP NNT+ AA+VNN+SFVQP  ALLQAHFFN+SKGVYT +FP NPP KFNYTG PP NIM
Sbjct  312   GP-NNTRPAAAVNNVSFVQPNIALLQAHFFNKSKGVYTTNFPTNPPFKFNYTGTPPKNIM  370

Query  1452  VTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFN  1631
             ++S TKVV L+FN+SVELVMQDTSI+GAESHPLHLHGFNFFV+GQG GN+DP KDP+KFN
Sbjct  371   LSSGTKVVALAFNTSVELVMQDTSILGAESHPLHLHGFNFFVLGQGVGNFDPKKDPAKFN  430

Query  1632  LVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKL  1811
             LVDPAERNT+GVP+GGWVAIRFLADNPG WFMHCHLEVHTSWGLKMAW+V DGKGRKQKL
Sbjct  431   LVDPAERNTIGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVNDGKGRKQKL  490

Query  1812  QPPPADLPKC  1841
              PPPADLPKC
Sbjct  491   PPPPADLPKC  500



>ref|NP_001105875.1| putative laccase precursor [Zea mays]
 emb|CAJ30500.1| putative laccase [Zea mays]
Length=587

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/557 (71%), Positives = 453/557 (81%), Gaps = 9/557 (2%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY F++ M NVTRLC +KSI+TVNG+FPGP+I+AREGDR+V++V NH ++N+++HW
Sbjct  31    GITRHYDFNVTMANVTRLCASKSIITVNGQFPGPKIVAREGDRLVIRVTNHAQHNISLHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLR+GWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL+WHAHISWLRAT+YGP+VI
Sbjct  91    HGIRQLRTGWADGPAYITQCPIQTGQSYVYNYTVVGQRGTLWWHAHISWLRATVYGPLVI  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP P+KEVP+IFGEWW ADTE +I QA Q G  PN+SDA TINGLPGPLYN
Sbjct  151   LPKLGVPYPFPAPYKEVPVIFGEWWLADTEVVIKQALQLGAGPNVSDAHTINGLPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD++KLKVK GKTY+LRLINAALNDELFFS+ANHSLTVVE DAVYVKPF  + +LI 
Sbjct  211   CSAKDTYKLKVKPGKTYMLRLINAALNDELFFSVANHSLTVVEVDAVYVKPFTVDTLLIA  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYs--------tnsnk  1070
             PGQTTNVLL     +P A Y +SA PY+T  PA FDN+T AGILEY         + S  
Sbjct  271   PGQTTNVLLAAKPSYPGANYYMSAAPYSTARPATFDNTTVAGILEYELYPDAPRPSASAG  330

Query  1071  tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC  1250
             +    LPL+ PTLP  NDTSF  NFT KLRSLA   +PA VP+ VDRRFFF VGLG  PC
Sbjct  331   SFNEALPLYRPTLPQLNDTSFVGNFTAKLRSLATPRYPAAVPRTVDRRFFFAVGLGTHPC  390

Query  1251  PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTG  1430
             P N TCQGPTN T+FAASVNN+SFV PT ALL +HF   S GVY+ DFP  P   FNYTG
Sbjct  391   PANATCQGPTNTTQFAASVNNVSFVLPTKALLHSHFTGLSSGVYSPDFPVAPLAPFNYTG  450

Query  1431  NPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPN  1610
              PP N  V S TK++ + + ++VELVMQ TSI+G ESHPLHLHGFNFFV+GQG+GNYDP 
Sbjct  451   TPPNNTNVASGTKLMVVPYGANVELVMQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPV  510

Query  1611  KDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDG  1790
              DPSKFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLE HT+WGL+MAW+V+DG
Sbjct  511   NDPSKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDG  570

Query  1791  KGRKQKLQPPPADLPKC  1841
                 QKL PPP+DLPKC
Sbjct  571   SLPHQKLLPPPSDLPKC  587



>ref|XP_010245131.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=589

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/577 (69%), Positives = 470/577 (81%), Gaps = 10/577 (2%)
 Frame = +3

Query  135   IIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             +I V++   W   ++ +A+++G TR+YKFDIK+Q VTRLC TKSIVTVNG FPGP+I A+
Sbjct  15    LIMVMSTL-WPLPELIVAEYSGKTRYYKFDIKLQTVTRLCHTKSIVTVNGLFPGPQITAQ  73

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR++++VVNHV  N+T+HWHG+RQL SGWADGPAY+TQCPIQTGQ+YVYNFTI GQRG
Sbjct  74    EGDRLLIEVVNHVPNNITLHWHGIRQLGSGWADGPAYVTQCPIQTGQTYVYNFTIIGQRG  133

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TL WHAHISWLR+TLYGPI+I+PK   +YPF  P+KEVPII GEWW  D E IIS+A Q 
Sbjct  134   TLLWHAHISWLRSTLYGPIIIIPKPDDSYPFANPYKEVPIILGEWWNGDPEAIISEALQA  193

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             G  PN+SDA+TINGLPGPLYNCSAKD+FKL VK GKTYLLR+INAAL++ELFFSIANHSL
Sbjct  194   GRGPNVSDAYTINGLPGPLYNCSAKDTFKLTVKTGKTYLLRMINAALDEELFFSIANHSL  253

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVE DAVYVKPF+T+ +LI PGQTTNVLL+T   +P AT+ ++ARPY TG   FDNST 
Sbjct  254   TVVEVDAVYVKPFHTDTLLIAPGQTTNVLLETKPDYPKATFFMAARPYFTGSGTFDNSTA  313

Query  1035  AGILEYstnsnktttnkLPLFTP--------TLPVFNDTSFATNFTKKLRSLANANFPAN  1190
             AGILEY   +    +  L   +P        +LP  ND +  T+F K LRSLA   FP N
Sbjct  314   AGILEYEYQAPSINSPSLISISPKDIPLLKPSLPPLNDIALVTSFQKSLRSLATTQFPCN  373

Query  1191  VPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQS  1370
             VP+ VDRRFFFTVGLG  PCP+N+TCQGP N  +F+ASVNN+SF  PTTALLQAHFF Q+
Sbjct  374   VPQTVDRRFFFTVGLGTRPCPKNRTCQGP-NGAQFSASVNNVSFTLPTTALLQAHFFGQA  432

Query  1371  KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPL  1550
              G+YT DFP NPP  F+YTG PP + +V   TKVV+L+FN+SVELVMQDTS++G +SHPL
Sbjct  433   NGIYTTDFPTNPPFSFDYTGTPPHDTVVNCGTKVVELAFNTSVELVMQDTSLLGTDSHPL  492

Query  1551  HLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMH  1730
             HLHGFNFFV+GQGFGNYDPNK P  FNLVDP ERNTVGVPSGGWVA+RFLADNPG WFMH
Sbjct  493   HLHGFNFFVVGQGFGNYDPNKHPPNFNLVDPVERNTVGVPSGGWVAVRFLADNPGVWFMH  552

Query  1731  CHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             CHLE+HTSWGL+MAW+VMDG+  +QKL PPP+DLPKC
Sbjct  553   CHLELHTSWGLRMAWVVMDGELPRQKLPPPPSDLPKC  589



>ref|XP_009345405.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=575

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/576 (71%), Positives = 465/576 (81%), Gaps = 12/576 (2%)
 Frame = +3

Query  147   LAAFCWVSGDVALAK---HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +AAF +    VAL      + ITRHY F+I+  NVTRLC T+SI++VN +FPGPR++ARE
Sbjct  1     MAAFLFSFCVVALLTPEFASSITRHYTFNIEYHNVTRLCNTRSILSVNKKFPGPRLVARE  60

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD+V++KV+NHV  NVTIHWHGV+QLRSGWADGPAYITQCPIQ GQSY YNFTI GQRGT
Sbjct  61    GDKVLIKVINHVSNNVTIHWHGVKQLRSGWADGPAYITQCPIQMGQSYTYNFTIQGQRGT  120

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L WHAHISWLR+T+YGPI+ILPK+  +YPF +P+KEVPII GEW+  D E +I+QA QTG
Sbjct  121   LLWHAHISWLRSTIYGPIIILPKRNESYPFVKPYKEVPIILGEWFNVDPEAVINQALQTG  180

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
               PN+SDAFTINGLPGPLYNCS+KD FKLKVK GKTYLLRLINAALNDELFFSIANH+LT
Sbjct  181   AGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  240

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADAVY KPF T+ +LITPGQTTNVLLKT  + PNAT+LI A PY TG    DN+TTA
Sbjct  241   VVEADAVYTKPFETDTLLITPGQTTNVLLKTKPNSPNATFLILASPYFTGGGTLDNTTTA  300

Query  1038  GILEYs--tnsnktttnkLPLFTPTLPVFNDTSFAT------NFTKKLRSLANANFPANV  1193
             GILEY     +  T+   LPLF P+LP FN T F        N  KK RSLA+  FPANV
Sbjct  301   GILEYEHPITNRHTSNKTLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKKFPANV  360

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             P+ VD++FFFTVGLG  PCPQN TCQGP N  KFAASVNN SF  P+TA+LQAHF  QS 
Sbjct  361   PQTVDKKFFFTVGLGTAPCPQNSTCQGP-NGLKFAASVNNFSFALPSTAMLQAHFSGQSN  419

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFPANP V FNYTG PP +  V + TK + L FN+SVELV+QDTSI+GAESHPLH
Sbjct  420   GVYTTDFPANPLVTFNYTGTPPNDTNVANGTKALVLPFNTSVELVLQDTSILGAESHPLH  479

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGNYDPNKDP+KFNLVDP ERNT GVP+GGW+A+RFLADNPG W MHC
Sbjct  480   LHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTGGVPAGGWIAVRFLADNPGVWLMHC  539

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HL++HTSWGL+MAWIV DG    QKL PPP+DLPKC
Sbjct  540   HLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  575



>gb|AAB17191.1| laccase [Liriodendron tulipifera]
Length=570

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/556 (70%), Positives = 468/556 (84%), Gaps = 1/556 (0%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             ++A A H G T HYKFD+++++V RLC  KSI+TVNGRFPGP+++AREGDRVVV+VVN+V
Sbjct  16    ELAFATHTGSTWHYKFDVQLKSVKRLCNRKSILTVNGRFPGPKLVAREGDRVVVEVVNNV  75

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
             + NVT+HWHG+RQL++GWADGP+YITQCPIQTGQ+YVYNFTI GQRGTLFWHAH SWLRA
Sbjct  76    QNNVTVHWHGIRQLQNGWADGPSYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHFSWLRA  135

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGP+++LP +   YPF +P KEVPIIFGEWW A+TE +I+Q+ QTG  PN+SDA+TIN
Sbjct  136   TLYGPLIVLPMQNATYPFGKPDKEVPIIFGEWWNANTEAVINQSLQTGAGPNVSDAYTIN  195

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             G+PGPLYNCSAKD+FKLKVK GKTYLLRLINAALNDELFF IA+H++TVVE DA YVKPF
Sbjct  196   GMPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFGIASHTITVVEVDATYVKPF  255

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnkt  1073
             N  I+LI PGQTTNVLLK   ++PNAT+ +SARPYATG   FDN+TT G+LEY   ++  
Sbjct  256   NMKILLIGPGQTTNVLLKAKPYYPNATFFMSARPYATGLGTFDNTTTVGLLEYQRPNSSL  315

Query  1074  ttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCP  1253
             ++ KL +F  +LP  NDT++A  ++++LRSLANA FPANVP+ VD+ FFFT+GL   PCP
Sbjct  316   SSTKLQIFKASLPALNDTAYAAKYSQRLRSLANAQFPANVPQTVDKHFFFTIGLSADPCP  375

Query  1254  QNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGN  1433
             +NQTCQGP N TKF+AS+NNISFV PTTALLQAHFF QS GVY   FP NP   FNYTG 
Sbjct  376   KNQTCQGP-NGTKFSASMNNISFVLPTTALLQAHFFGQSNGVYNTTFPNNPLFPFNYTGT  434

Query  1434  PPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNK  1613
             PP N  V+  TKVV + FN+SVE+V+Q+TSI+G ESH LHLHG+NFFV+GQGFGN+DP+K
Sbjct  435   PPNNTFVSHGTKVVVIPFNTSVEVVLQNTSILGMESHLLHLHGYNFFVVGQGFGNFDPDK  494

Query  1614  DPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGK  1793
             DP+KFNLVDP ERNTVGVPSGGW AIRF ADNPG WFMHCH +VH SWGLKMAW+V+DGK
Sbjct  495   DPAKFNLVDPIERNTVGVPSGGWAAIRFRADNPGVWFMHCHFDVHLSWGLKMAWVVLDGK  554

Query  1794  GRKQKLQPPPADLPKC  1841
                QKL PPP+DLPKC
Sbjct  555   LPNQKLLPPPSDLPKC  570



>ref|XP_009338597.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
 ref|XP_009338600.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=586

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/576 (71%), Positives = 464/576 (81%), Gaps = 12/576 (2%)
 Frame = +3

Query  147   LAAFCWVSGDVALAK---HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +AAF +    VAL      +GITRHY F+IK  NVTRLC T+SIV+VN +FPGPR++ARE
Sbjct  12    MAAFLFSFCVVALLTPEFASGITRHYTFNIKYHNVTRLCNTRSIVSVNKKFPGPRLVARE  71

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD+V++KV+NHV  NVTIHWHGV+QLRSGWADGPAYITQCPIQ GQSY YNFTI GQRGT
Sbjct  72    GDKVLIKVINHVSNNVTIHWHGVKQLRSGWADGPAYITQCPIQMGQSYTYNFTIQGQRGT  131

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L WHAHISWLR+T+YGPI+ILPK+  +YPF +P+KEVPII GEW+  D E +I+QA QTG
Sbjct  132   LLWHAHISWLRSTIYGPIIILPKRNESYPFVKPYKEVPIILGEWFNVDPEAVINQALQTG  191

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
               PN+SDAFTINGLPGPLYNCS+KD FKLKVK GKTYLLRLINAALNDELFFSIANH+LT
Sbjct  192   AGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  251

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADAVY KPF T+ +LITPGQTTNVLLKT  + PNAT+LI A PY TG    DN+TTA
Sbjct  252   VVEADAVYTKPFETDTLLITPGQTTNVLLKTKPNSPNATFLILASPYFTGGGTLDNTTTA  311

Query  1038  GILEYs--tnsnktttnkLPLFTPTLPVFNDTSFAT------NFTKKLRSLANANFPANV  1193
             GILEY     +  T+   LPLF P+LP FN T F        N  KK RSLA+  FPANV
Sbjct  312   GILEYEHPITTRHTSIKNLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKKFPANV  371

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             P+ VD++FFFTVGLG  PCPQN TCQGP N  KFAASVNN SF  P+TA+LQAHF  QS 
Sbjct  372   PQTVDKKFFFTVGLGTAPCPQNSTCQGP-NGLKFAASVNNFSFALPSTAMLQAHFSGQSN  430

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFPANP V FNYTG PP +  V + TK + L FN+SVELV+QDTSI+GAESHPLH
Sbjct  431   GVYTTDFPANPLVTFNYTGTPPNDTNVANGTKALVLPFNTSVELVLQDTSILGAESHPLH  490

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGNYDPNKDP+KFNLVDP ERNT  V +GGW+A+RFLADNPG W MHC
Sbjct  491   LHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTGSVQAGGWIAVRFLADNPGVWLMHC  550

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HL++HTSWGL+MAWIV DG    QKL PPP+DLPKC
Sbjct  551   HLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  586



>ref|XP_008665185.1| PREDICTED: laccase-4-like [Zea mays]
 gb|ACN28855.1| unknown [Zea mays]
 tpg|DAA50674.1| TPA: putative laccase family protein [Zea mays]
 tpg|DAA56881.1| TPA: putative laccase family protein [Zea mays]
Length=585

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/557 (71%), Positives = 453/557 (81%), Gaps = 9/557 (2%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY F++ M NVTRLC +KSI+TVNG+FPGP+I+AREGDR+V++V NH ++N+++HW
Sbjct  29    GITRHYDFNVTMANVTRLCASKSIITVNGQFPGPKIVAREGDRLVIRVTNHAQHNISLHW  88

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLR+GWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL+WHAHISWLRAT+YGP+VI
Sbjct  89    HGIRQLRTGWADGPAYITQCPIQTGQSYVYNYTVVGQRGTLWWHAHISWLRATVYGPLVI  148

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP P+KEVP+IFGEWW ADTE +I QA Q G  PN+SDA TINGLPGPLYN
Sbjct  149   LPKLGVPYPFPAPYKEVPVIFGEWWLADTEVVIKQALQLGAGPNVSDAHTINGLPGPLYN  208

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD++KLKVK GKTY+LRLINAALNDELFFS+ANHSLTVVE DAVYVKPF  + +LI 
Sbjct  209   CSAKDTYKLKVKPGKTYMLRLINAALNDELFFSVANHSLTVVEVDAVYVKPFTVDTLLIA  268

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYs--------tnsnk  1070
             PGQTTNVLL     +P A Y +SA PY+T  PA FDN+T AGILEY         + S  
Sbjct  269   PGQTTNVLLAAKPSYPGANYYMSAAPYSTARPATFDNTTVAGILEYELYPDAPRPSASAG  328

Query  1071  tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC  1250
             +    LPL+ PTLP  NDTSF  NFT KLRSLA   +PA VP+ VDRRFFF VGLG  PC
Sbjct  329   SFNEALPLYRPTLPQLNDTSFVGNFTAKLRSLATPRYPAAVPRTVDRRFFFAVGLGTHPC  388

Query  1251  PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTG  1430
             P N TCQGPTN T+FAASVNN+SFV PT ALL +HF   S GVY+ DFP  P   FNYTG
Sbjct  389   PANATCQGPTNTTQFAASVNNVSFVLPTKALLHSHFTGLSSGVYSPDFPVAPLAPFNYTG  448

Query  1431  NPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPN  1610
              PP N  V S TK++ + + ++VELVMQ TSI+G ESHPLHLHGFNFFV+GQG+GNYDP 
Sbjct  449   TPPNNTNVASGTKLMVVPYGANVELVMQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPV  508

Query  1611  KDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDG  1790
              DPSKFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLE HT+WGL+MAW+V+DG
Sbjct  509   NDPSKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTWGLRMAWLVLDG  568

Query  1791  KGRKQKLQPPPADLPKC  1841
                 QKL PPP+DLPKC
Sbjct  569   SLPHQKLLPPPSDLPKC  585



>ref|XP_002298223.2| hypothetical protein POPTR_0001s18500g [Populus trichocarpa]
 gb|EEE83028.2| hypothetical protein POPTR_0001s18500g [Populus trichocarpa]
Length=576

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/569 (70%), Positives = 472/569 (83%), Gaps = 8/569 (1%)
 Frame = +3

Query  138   IFVLAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I + A  C W   +VA AKHAGITRHYKF+IK++NVTRLC TKS+VTVNG+FPGPR++AR
Sbjct  15    ILLFAMSCLWAFPEVAGAKHAGITRHYKFNIKLKNVTRLCHTKSMVTVNGKFPGPRVVAR  74

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+VVKVVNHV  N++IHWHG+RQL+SGWADGPAYITQCPIQT Q+YVYNFT+TGQRG
Sbjct  75    EGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPAYITQCPIQTNQTYVYNFTVTGQRG  134

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAH+SWLRA++YGP++ILPK+ V+YPF +P KEV I+ GEW+ ADTE +ISQA QT
Sbjct  135   TLFWHAHLSWLRASVYGPLIILPKRNVSYPFAKPHKEVTIMLGEWFNADTEAVISQALQT  194

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+S+A+T NGLPGPLYNCS  +++KLKVK GKTYLLRLINAALND+LFFSIANH+ 
Sbjct  195   GGGPNVSEAYTFNGLPGPLYNCSENNTYKLKVKPGKTYLLRLINAALNDDLFFSIANHTF  254

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVE DA Y KPF TN+++IT GQTTNVLLKT +  PNA++ + ARPY TG   FDN+T 
Sbjct  255   TVVEVDATYAKPFETNLLVITAGQTTNVLLKTKSIAPNASFYMLARPYFTGQGTFDNTTV  314

Query  1035  AGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             AGILEY T+SN T       F PTLP  N T+   NFT+KLRSLAN+ FP NVP+ VD++
Sbjct  315   AGILEYETSSNSTA------FKPTLPPINATNVVANFTRKLRSLANSQFPVNVPQTVDKK  368

Query  1215  FFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADF  1394
             FFFTVGLG  PCP+NQTCQGP N TKFAASVNNIS   P++ALLQ++FF +S GVYT+DF
Sbjct  369   FFFTVGLGNSPCPKNQTCQGP-NGTKFAASVNNISMALPSSALLQSYFFKKSNGVYTSDF  427

Query  1395  PANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFF  1574
             P+ P   FNYTG PP N +VT+ TK+V + FN+SVE+VMQ T I GAESHPLHLHGFNF+
Sbjct  428   PSFPLYPFNYTGTPPNNTLVTNGTKLVVVPFNTSVEVVMQGTRIFGAESHPLHLHGFNFY  487

Query  1575  VIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTS  1754
             V+G+GFGN+DPN DP  FNLVDP ERNTVGVP+ GWVAIRF ADNPG WFMHCH +VH S
Sbjct  488   VVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPTAGWVAIRFYADNPGVWFMHCHFDVHLS  547

Query  1755  WGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WGL+MAWIV+DG    QKL PPP+DLPKC
Sbjct  548   WGLRMAWIVLDGTLPNQKLPPPPSDLPKC  576



>ref|XP_004970543.1| PREDICTED: laccase-12/13-like [Setaria italica]
Length=579

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/552 (73%), Positives = 459/552 (83%), Gaps = 4/552 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             G  R Y+FD++M +VTRLC +KSIVTVNG FPGP + AREGD VVV+VVNHV YN++IHW
Sbjct  28    GAIREYQFDVQMTSVTRLCSSKSIVTVNGLFPGPTVFAREGDLVVVRVVNHVPYNMSIHW  87

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQ+GQSYVY FTITGQRGTL+WHAHISWLRAT+YGPIVI
Sbjct  88    HGVRQLRSGWADGPAYITQCPIQSGQSYVYKFTITGQRGTLWWHAHISWLRATVYGPIVI  147

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP P+KEVP+IFGEWWKADTE +ISQA QTGG PN+SDAFTINGLPGPLYN
Sbjct  148   LPKPGVPYPFPAPYKEVPVIFGEWWKADTEAVISQALQTGGGPNVSDAFTINGLPGPLYN  207

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKV+ GKTY+LR+INAALNDELFFSIA H LT+V+ DAVY+KP     ++IT
Sbjct  208   CSAKDTFKLKVQPGKTYMLRIINAALNDELFFSIAGHPLTIVDVDAVYIKPITVETLIIT  267

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYs---tnsnktttnk  1085
             PGQTTNVLL T   +P A Y + A PY+T  P  FDN+T AGILEY    + S       
Sbjct  268   PGQTTNVLLTTKPSYPAANYYMLAAPYSTARPGTFDNTTVAGILEYEDPNSPSPAAFNKN  327

Query  1086  LPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQT  1265
             LP+  PTLP  NDTSF  NFT KLRSLA A +PA+VP++VDRRFFFTVGLG  PC  N T
Sbjct  328   LPILKPTLPQINDTSFVANFTGKLRSLATAEYPADVPREVDRRFFFTVGLGTHPCAVNGT  387

Query  1266  CQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTN  1445
             CQGPTN+T+FAASVNN+SFV PTTALLQAHF  +S GVY+ +FPA P + FNYTG PP N
Sbjct  388   CQGPTNDTRFAASVNNVSFVLPTTALLQAHFTGRSNGVYSPNFPAAPLIPFNYTGTPPNN  447

Query  1446  IMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSK  1625
               V++ TK+V L + +SVELVMQ TSI+G ESHPLHLHGFNFFV+GQGFGN+DP KDP++
Sbjct  448   TNVSNGTKLVVLPYGTSVELVMQGTSILGNESHPLHLHGFNFFVVGQGFGNFDPVKDPAQ  507

Query  1626  FNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQ  1805
             +NLVDP ERNTVGVP+GGWVAIRF ADNPG WFMHCHLEVH SWGLKMAW+V+DG   K+
Sbjct  508   YNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWLVLDGDKPKE  567

Query  1806  KLQPPPADLPKC  1841
             KL PPP+DLPKC
Sbjct  568   KLLPPPSDLPKC  579



>ref|XP_010047833.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW88962.1| hypothetical protein EUGRSUZ_A01282 [Eucalyptus grandis]
Length=571

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/568 (71%), Positives = 467/568 (82%), Gaps = 6/568 (1%)
 Frame = +3

Query  147   LAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGD  323
             L  FC  + G + LA+  G TRHY F I   N+TRLC T+S+++VN ++PGP ++AREGD
Sbjct  7     LFIFCTLLLGFLKLAE--GKTRHYTFHIDSHNMTRLCHTRSVLSVNKQYPGPPLVAREGD  64

Query  324   RvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLF  503
              ++VKVVNHV  NVTIHWHGVRQLR+GWADGPAY+TQCPIQT QSY YNFT+TGQRGTL 
Sbjct  65    NILVKVVNHVAANVTIHWHGVRQLRTGWADGPAYVTQCPIQTNQSYTYNFTLTGQRGTLL  124

Query  504   WHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGA  683
             WHAH+SWLR++++GPI+ILPK+  +YPF +P KEVPIIFGEW+  D E +I+QA Q+GG 
Sbjct  125   WHAHVSWLRSSIHGPIIILPKRNESYPFEKPSKEVPIIFGEWFNVDPEAVIAQALQSGGG  184

Query  684   PNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVV  863
             PN+SDA+TINGLPGPLYNCS+KD+FKLKVK GKTYLLRLINAALNDELFFSIANH++TVV
Sbjct  185   PNVSDAYTINGLPGPLYNCSSKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTVTVV  244

Query  864   EADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGI  1043
             E DAVY KPF+   + +TPGQT NVLLKT T  PN+T+L++A PY TG   FDNST AGI
Sbjct  245   EVDAVYTKPFSAGCLHLTPGQTMNVLLKTKTDFPNSTFLMAAWPYFTGMGTFDNSTVAGI  304

Query  1044  LEYstnsnktt--tnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRF  1217
             LEY    +       KLP + PTLP  N T F   FT +LRSLA+A FPANVP+KVDR+F
Sbjct  305   LEYEHPKSSNYPPLKKLPQYKPTLPPMNSTGFVAKFTGQLRSLASAKFPANVPQKVDRKF  364

Query  1218  FFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFP  1397
             FFTVGLG  PCP+N TCQGP N TKFAASVNNISFV P+ ALLQAHFF QS GVYT DFP
Sbjct  365   FFTVGLGTSPCPKNTTCQGP-NGTKFAASVNNISFVLPSVALLQAHFFGQSNGVYTTDFP  423

Query  1398  ANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFV  1577
              NPPV+FNYTG PP N MVT+ TK V L++N+SVELVMQDTSI+G ESH LHLHGFNFFV
Sbjct  424   TNPPVQFNYTGTPPNNTMVTNGTKTVVLAYNTSVELVMQDTSILGTESHALHLHGFNFFV  483

Query  1578  IGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSW  1757
             +GQG GNY+PNKDP+KFNLVDP ERNT GVPSGGWVAIRFLADNPG WFMHCHL+VHTSW
Sbjct  484   VGQGSGNYNPNKDPTKFNLVDPIERNTFGVPSGGWVAIRFLADNPGVWFMHCHLDVHTSW  543

Query  1758  GLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             GLKMAWIV+DG    QKL PPP+DLPKC
Sbjct  544   GLKMAWIVLDGPQPNQKLPPPPSDLPKC  571



>ref|XP_006644993.1| PREDICTED: laccase-4-like [Oryza brachyantha]
Length=578

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/557 (70%), Positives = 459/557 (82%), Gaps = 5/557 (1%)
 Frame = +3

Query  183   LAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkyn  362
             + +  GITRHY+F+++M N TRLC TKS+VTVNG+ PGP ++AREGDRVVV+V N+V +N
Sbjct  23    IVQAQGITRHYEFNVQMANATRLCATKSMVTVNGQCPGPELVAREGDRVVVRVTNNVAHN  82

Query  363   vTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLY  542
             +T+HWHG+RQ+R+GWADGPAY+TQCPIQTGQSYVYNFT+TGQRGTL+WHAHISWLRAT+Y
Sbjct  83    ITLHWHGIRQVRTGWADGPAYVTQCPIQTGQSYVYNFTVTGQRGTLWWHAHISWLRATVY  142

Query  543   GPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLP  722
             GPIVILPK GV YPFP P KE+P++FGEWW ADTE +++QA QTG  PN+SDAFTINGLP
Sbjct  143   GPIVILPKPGVPYPFPAPHKELPVVFGEWWTADTEEVVNQAVQTGAGPNVSDAFTINGLP  202

Query  723   GPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTN  902
             GPLYNCSA+D+FKLKVK  KTY+LRLINAALNDELFFS+ANH+LTVVE DAVYVKPF   
Sbjct  203   GPLYNCSAQDTFKLKVKPRKTYMLRLINAALNDELFFSVANHTLTVVEVDAVYVKPFTVE  262

Query  903   IVLITPGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEY---stnsnk  1070
              ++I+PGQTTNVLL    ++P A + +SA PY+T  P  FDN+T AGILEY    + S  
Sbjct  263   TLVISPGQTTNVLLAAKPYYPGANFYMSAAPYSTARPGTFDNTTVAGILEYENPMSASAA  322

Query  1071  tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC  1250
             +    LPLF PTLP  NDT F TNFT KLRSLA A +PA VP+ VDRRFFFTVGLG +PC
Sbjct  323   SFVKGLPLFRPTLPQLNDTDFVTNFTNKLRSLATAQYPAAVPQSVDRRFFFTVGLGTLPC  382

Query  1251  PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTG  1430
             P N TCQGP N T+ AA++NN+SFV P+ ALLQ+HF   S GVY  DFP  P   FNYTG
Sbjct  383   PANMTCQGP-NGTQMAAAMNNVSFVLPSRALLQSHFTGLSTGVYAPDFPVAPLSPFNYTG  441

Query  1431  NPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPN  1610
              PP N  V + TK++ L +N+SVELVMQDTSI+G ESHPLHLHGFNFFV+GQGFGNYD  
Sbjct  442   TPPNNTNVATGTKLLVLPYNASVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDAV  501

Query  1611  KDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDG  1790
              DP+KFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHT+WGL+MAW+V+DG
Sbjct  502   NDPAKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDG  561

Query  1791  KGRKQKLQPPPADLPKC  1841
                 QKL PPP+DLPKC
Sbjct  562   SQPDQKLLPPPSDLPKC  578



>ref|XP_006341212.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=571

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/573 (70%), Positives = 467/573 (82%), Gaps = 9/573 (2%)
 Frame = +3

Query  132   FIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIA  311
             +++F  A  C +           ITRHY F+I   NVTRLC TKSIV+VNGRFPGP IIA
Sbjct  5     YLLFGFAILCLLPQSTFC-----ITRHYTFNIVKHNVTRLCTTKSIVSVNGRFPGPHIIA  59

Query  312   REGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  491
             REGDRV+VKV+N V  N++IHWHG+RQL +GWADGPAY+TQCPIQ  +SY YNFTI GQR
Sbjct  60    REGDRVIVKVINQVSNNISIHWHGIRQLANGWADGPAYVTQCPIQFNKSYTYNFTIIGQR  119

Query  492   GTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQ  671
             GTLFWHAHISWLRAT+YGPI+ILP++  +YPF +P K++PI+FGEWW  DTE +I+QA Q
Sbjct  120   GTLFWHAHISWLRATVYGPIIILPRRNESYPFKKPHKQIPIMFGEWWNVDTEAVINQALQ  179

Query  672   TGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHS  851
             TGG PN+SDA+TINGLPGPLYNCS+KD+FKLKVK GKTY+LRLINAALNDELFFSIANH+
Sbjct  180   TGGGPNVSDAYTINGLPGPLYNCSSKDTFKLKVKPGKTYMLRLINAALNDELFFSIANHT  239

Query  852   LTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNST  1031
             LT+V+ DA+Y KPFNTN+V ITPGQTTNVLLKT  H+PNAT+L++A+PY +G   FDNST
Sbjct  240   LTIVDTDAIYTKPFNTNVVFITPGQTTNVLLKTKPHYPNATFLMAAQPYFSGLGTFDNST  299

Query  1032  TAGILEYst--nsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
              AGILEY +  +S+ T   K  LF PTLP    TSF  NFTK  RSLAN  FPANVP+ +
Sbjct  300   VAGILEYESPLHSSPTNKTKTKLFKPTLPNMTSTSFVANFTKNFRSLANTRFPANVPQNI  359

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             D+RF FT+GLG  PCP+N TCQGP N TKF+ASVNNISFV PTTALLQ+H+F QS G+YT
Sbjct  360   DKRFLFTIGLGSNPCPKNMTCQGP-NGTKFSASVNNISFVLPTTALLQSHYFGQSNGIYT  418

Query  1386  ADFPANPPVKFNYTGNP-PTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHG  1562
              DFPA P   FNYTG+P P N  VT+ATK+V L FNSSVE+V+QDTSI+GAE+HPLHLHG
Sbjct  419   TDFPATPLNPFNYTGSPQPNNTFVTNATKLVVLPFNSSVEVVLQDTSILGAENHPLHLHG  478

Query  1563  FNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLE  1742
              NFFV+G+GFGN+DPN DP  FNL DP ERNTVGVP+GGW+A RF ADNPG WFMHCH E
Sbjct  479   HNFFVVGEGFGNFDPNNDPINFNLKDPIERNTVGVPAGGWIAFRFFADNPGVWFMHCHFE  538

Query  1743  VHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             VHTSWGL+MAWIV+DG    QKL PPP+DLPKC
Sbjct  539   VHTSWGLRMAWIVLDGSLPSQKLPPPPSDLPKC  571



>ref|XP_002458747.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
 gb|EES03867.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
Length=579

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/553 (72%), Positives = 458/553 (83%), Gaps = 5/553 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             G  R Y+FD++M NVTRLC +KSIVTVNG+FPGP + AREGD VV++VVNHV YN++IHW
Sbjct  27    GAIREYQFDVQMTNVTRLCSSKSIVTVNGQFPGPPVFAREGDFVVIRVVNHVPYNMSIHW  86

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HGVRQLRSGWADGPAYITQCPIQ+GQSYVY FTITGQRGTL+WHAHISWLRAT+YG IVI
Sbjct  87    HGVRQLRSGWADGPAYITQCPIQSGQSYVYKFTITGQRGTLWWHAHISWLRATVYGAIVI  146

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP P+KEVP+IFGEWW ADTE +ISQA QTGG PN+SDAFTINGLPGPLYN
Sbjct  147   LPKPGVPYPFPAPYKEVPVIFGEWWTADTEAVISQALQTGGGPNVSDAFTINGLPGPLYN  206

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTY+LR+INAALNDELFFSIA H LTVV+ DAVY+KP   + +LIT
Sbjct  207   CSAKDTFKLKVKPGKTYMLRIINAALNDELFFSIAGHPLTVVDVDAVYIKPITVDTILIT  266

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYstnsn----ktttn  1082
             PGQTTNVLL T   +P ATY + A PY+T  P  FDN+T AGILEY   ++         
Sbjct  267   PGQTTNVLLTTKPSYPGATYYMLAAPYSTARPGTFDNTTVAGILEYEDPTSPPPHAAFNK  326

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
              LP   PTLP  NDTSF  N+T KLRSLA A +PA VP++VDRRFFFTVGLG  PC  N 
Sbjct  327   NLPALKPTLPQINDTSFVANYTAKLRSLATAEYPAAVPQEVDRRFFFTVGLGTHPCAVNG  386

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN+++FAASVNN+SFV PTTALLQ+HF  +SKGVY+++FPA P V FNYTG PP 
Sbjct  387   TCQGPTNSSRFAASVNNVSFVLPTTALLQSHFAGKSKGVYSSNFPAAPLVPFNYTGTPPN  446

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N  V + TK+V L + +SVELV+Q TSI+GAESHPLHLHGFNFFV+GQGFGN+DP KDP+
Sbjct  447   NTNVANGTKLVVLPYGASVELVLQGTSILGAESHPLHLHGFNFFVVGQGFGNFDPAKDPA  506

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
             K+NLVDP ERNTVGVP+ GWVAIRF ADNPG WFMHCHLEVH SWGLKMAW+V+DG    
Sbjct  507   KYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHCHLEVHVSWGLKMAWLVLDGDRPN  566

Query  1803  QKLQPPPADLPKC  1841
             +KL PPP+DLP+C
Sbjct  567   EKLLPPPSDLPRC  579



>ref|NP_001147942.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG29196.1| L-ascorbate oxidase precursor [Zea mays]
Length=582

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/586 (69%), Positives = 469/586 (80%), Gaps = 15/586 (3%)
 Frame = +3

Query  102   RMMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             R+  C +A   ++ VL  F  V          G  R Y+FD++M NVTRLC +KSIVTVN
Sbjct  6     RLPCCCYA---LVTVLVLFFSVDAT------EGAIREYQFDVQMTNVTRLCSSKSIVTVN  56

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGP + AREGD VV++VVNHV YN++IHWHG+RQLRSGWADGPAYITQCPIQ+GQSY
Sbjct  57    GQFPGPTVFAREGDFVVIRVVNHVPYNMSIHWHGIRQLRSGWADGPAYITQCPIQSGQSY  116

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VY FTITGQRGTL+WHAHISWLRAT+YGPIVILPK GV YPFP P+ EVP++FGEWW AD
Sbjct  117   VYKFTITGQRGTLWWHAHISWLRATVYGPIVILPKPGVPYPFPAPYDEVPVLFGEWWTAD  176

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
             TE +ISQA QTGG PN+SDAFTINGLPGPLYNCSAKD+FKLKVK GKTY+LR+INAALND
Sbjct  177   TEAVISQALQTGGGPNVSDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRIINAALND  236

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIA H LTVV+ DAVY+KP     ++ITPGQTTNVLL T   +P ATY + A PY+
Sbjct  237   ELFFSIAGHPLTVVDVDAVYIKPITVETIIITPGQTTNVLLTTKPSYPGATYYMLAAPYS  296

Query  1002  TG-PAPFDNSTTAGILEYstnsnk-----tttnkLPLFTPTLPVFNDTSFATNFTKKLRS  1163
             T  P  FDN+T AGILEY   ++           LP   PTLP  NDTSF  N+T +LRS
Sbjct  297   TARPGTFDNTTVAGILEYEDPTSSPPPHAAFDKNLPALKPTLPQINDTSFVANYTARLRS  356

Query  1164  LANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTAL  1343
             LA A +PA+VP++V RRFFFTVGLG  PC  N TCQGPTN+++FAASVNN+SFV PTTAL
Sbjct  357   LATAEYPADVPREVHRRFFFTVGLGTHPCAVNGTCQGPTNSSRFAASVNNVSFVLPTTAL  416

Query  1344  LQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTS  1523
             LQ+HF  +S+GVY+++FPA P V FNYTG PP N  V++ TK+V L + +SVELVMQ TS
Sbjct  417   LQSHFAGKSRGVYSSNFPAAPLVPFNYTGTPPNNTNVSNGTKLVVLPYGTSVELVMQGTS  476

Query  1524  IIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLA  1703
             I+GAESHPLHLHGFNFFV+GQGFGN+DP KDP+K+NLVDP ERNTVGVP+ GWVAIRF A
Sbjct  477   ILGAESHPLHLHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRA  536

Query  1704  DNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             DNPG WFMHCHLEVH SWGLKMAW+V+DG    +KL PPP+DLPKC
Sbjct  537   DNPGVWFMHCHLEVHVSWGLKMAWLVLDGDRPNEKLLPPPSDLPKC  582



>dbj|BAJ99773.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/557 (71%), Positives = 460/557 (83%), Gaps = 5/557 (1%)
 Frame = +3

Query  183   LAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkyn  362
             + +  GITRHY F+I+M NVTRLC TKSIVTVNG+FPGP +IAREGDRV V+V NHV +N
Sbjct  22    VVQAQGITRHYDFNIQMANVTRLCGTKSIVTVNGQFPGPELIAREGDRVHVRVTNHVAHN  81

Query  363   vTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLY  542
             ++IHWHGVRQ+R+GWADGPAYITQCPIQTGQ+YVY FT+T QRGTL+WHAHISW R+T+Y
Sbjct  82    MSIHWHGVRQMRTGWADGPAYITQCPIQTGQTYVYKFTVTAQRGTLWWHAHISWFRSTVY  141

Query  543   GPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLP  722
             G IVILPK GV YPFP P KE+P+IFGEWW +DTE I+S A + GGAPNISDAFTINGLP
Sbjct  142   GAIVILPKLGVPYPFPAPHKELPVIFGEWWLSDTEAIVSTALKVGGAPNISDAFTINGLP  201

Query  723   GPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTN  902
             GPLY+CSAKD+FKLKV+ GKTYLLRLINAALNDELFFS+ANH+LTVVE DAVYVKPF   
Sbjct  202   GPLYDCSAKDTFKLKVEPGKTYLLRLINAALNDELFFSVANHTLTVVEVDAVYVKPFTVK  261

Query  903   IVLITPGQTTNVLLKTTTHHPNATYLISARPYAT-GPAPFDNSTTAGILEYs---tnsnk  1070
              ++I+PGQTTNVLL T   +P A + + ARPY+T  P  FDNST AGILEY    + S+ 
Sbjct  262   TLVISPGQTTNVLLATKPVYPGANFYMLARPYSTIRPGTFDNSTVAGILEYRNPGSPSSS  321

Query  1071  tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC  1250
             +    LP+F P LP +NDT+F TNFT KLRSLA   +PA VP+ VDRRFFFT+GLG +PC
Sbjct  322   SFDKALPIFKPMLPYYNDTNFVTNFTTKLRSLATKQYPAAVPQSVDRRFFFTIGLGTLPC  381

Query  1251  PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTG  1430
             P+N TCQGP N T+FAA+VNN+S V P+TALLQ+HF   + GVY A+FP  P   FNYTG
Sbjct  382   PKNMTCQGP-NGTQFAAAVNNVSLVLPSTALLQSHFTGLTSGVYAANFPVMPLSPFNYTG  440

Query  1431  NPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPN  1610
              PP N  V + TK++ +SFN+SVELVMQDTSI+G ESHPLHLHGFNFFV+GQGFGNYD  
Sbjct  441   TPPNNTNVATGTKLLAVSFNTSVELVMQDTSILGIESHPLHLHGFNFFVVGQGFGNYDAV  500

Query  1611  KDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDG  1790
              DP+KFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHT+WGL+MAW+V DG
Sbjct  501   NDPAKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVQDG  560

Query  1791  KGRKQKLQPPPADLPKC  1841
                 QKL PPP+D+PKC
Sbjct  561   SKPSQKLLPPPSDMPKC  577



>ref|XP_010039668.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW45807.1| hypothetical protein EUGRSUZ_L00355 [Eucalyptus grandis]
Length=545

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/541 (73%), Positives = 454/541 (84%), Gaps = 5/541 (1%)
 Frame = +3

Query  231   MQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWA  410
             + NVTRLC TKS+VT+NG+FPGPR+IAREGDR++++VVNHV  N++IHWHGVRQL+SGWA
Sbjct  6     VANVTRLCYTKSMVTINGKFPGPRVIAREGDRLLIEVVNHVPNNISIHWHGVRQLQSGWA  65

Query  411   DGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFP  590
             DGPAY+TQCPIQT QSYVYN+TI GQRGTL+WHAHISWLR+TLYG ++ILPK   +YPF 
Sbjct  66    DGPAYVTQCPIQTNQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGSLIILPKHNDSYPFA  125

Query  591   QPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKV  770
             +P KE+PIIFGEW+ +DTE IISQA QTGG PN+SDA+TINGLPGPLYNCSAKD+++LKV
Sbjct  126   KPHKEIPIIFGEWFNSDTEAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTYRLKV  185

Query  771   KAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKT  950
             K GKTYLLRLINA LNDELFFSIANH+LTVVEADA Y+KPF T  +LI PGQTTNVL+KT
Sbjct  186   KPGKTYLLRLINAVLNDELFFSIANHTLTVVEADATYLKPFETETLLIAPGQTTNVLIKT  245

Query  951   TTHHPNATYLISARPYATGPAPFDNSTTAGILEYs----tnsnktttnkLPLFTPTLPVF  1118
               ++P AT+L++ARPY TG   FDNST AGILEY           +  +LPLF PTLP  
Sbjct  246   KPYYPKATFLMTARPYVTGLGTFDNSTVAGILEYEPPLNEPHQSPSIKQLPLFKPTLPPL  305

Query  1119  NDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFA  1298
             NDT+FATNFT KLRSLA   FPANVP KVDRRFFFTV LG IPC  NQTCQGP   T F 
Sbjct  306   NDTAFATNFTTKLRSLATPQFPANVPLKVDRRFFFTVSLGTIPCQGNQTCQGPY-GTMFT  364

Query  1299  ASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQ  1478
             A+VNN+SF  PTTALLQAH+  QS GVY+ DFP++P   FN+TG PP N  V + TK+V 
Sbjct  365   AAVNNVSFTMPTTALLQAHYTGQSNGVYSPDFPSHPKSIFNFTGTPPNNTNVGNGTKLVV  424

Query  1479  LSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNT  1658
             L FN+SVEL+MQDTSI+GAE HPLHLHGFNFFV+GQGFGN+DPNKDP+ FNLVDP ERNT
Sbjct  425   LPFNTSVELIMQDTSILGAEGHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNT  484

Query  1659  VGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPK  1838
             VGVPSGGWVA RFLADNPG WFMHCHLEVH+SWGLKMAW+V+DGK   QKL PPPADLPK
Sbjct  485   VGVPSGGWVATRFLADNPGVWFMHCHLEVHSSWGLKMAWLVLDGKLPNQKLLPPPADLPK  544

Query  1839  C  1841
             C
Sbjct  545   C  545



>ref|XP_009603099.1| PREDICTED: laccase-2-like [Nicotiana tomentosiformis]
Length=583

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/588 (69%), Positives = 478/588 (81%), Gaps = 14/588 (2%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKH--AGITRHYKFDIKMQNVTRLCQTKSIVTV  278
             M   +F+ + I+  LA FC         +   AG+TRHYKFDI+++NVTRLCQTK+IVTV
Sbjct  1     MSASIFSPQSIL--LAIFCITCSIFLFPEFVTAGVTRHYKFDIRLKNVTRLCQTKTIVTV  58

Query  279   NGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQS  458
             NG+FPGPR++AREGDRVVVKVVNHV  NV+ HWHG+RQ++SGWADGPAYITQCPIQT QS
Sbjct  59    NGKFPGPRVVAREGDRVVVKVVNHVSNNVSFHWHGIRQIQSGWADGPAYITQCPIQTSQS  118

Query  459   YVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKA  638
             YVYNFTITGQRGTL+WHAHISW+RATLYGP++I P+   +YPF +P KEVPIIFGEWW A
Sbjct  119   YVYNFTITGQRGTLWWHAHISWMRATLYGPLIIYPQHNTSYPFAKPHKEVPIIFGEWWNA  178

Query  639   DTERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALN  818
             +TE +I+Q+  TG  PN+SD++TINGLPGPLYNCSAKD+FKLKVK GKTY+LR+INAALN
Sbjct  179   NTEAVINQSLVTGAGPNVSDSYTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRMINAALN  238

Query  819   DELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPY  998
             D+LFF IANH++TVVEADAVYVKPF T+ +LITPGQTTNVLLKT  +    T+ ++ARPY
Sbjct  239   DDLFFRIANHTMTVVEADAVYVKPFETDTILITPGQTTNVLLKTHPNPQQTTFFMAARPY  298

Query  999   ATGPAPFDNSTTAGILEYstnsnk------tttnkLPLFTPTLPVFNDTSFATNFTKKLR  1160
              TG   FDNST AGIL Y   S        T    LP+  PTLP  N TSF  NFT K R
Sbjct  299   FTGQGTFDNSTIAGILMYDNVSASISSSSNTLIKNLPI--PTLPPINSTSFVANFTNKFR  356

Query  1161  SLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTA  1340
             SLANA FPANVP+KVD+ FFFTVGLG  PCP+NQTCQGP N++KF+ASVNN+S + PTTA
Sbjct  357   SLANARFPANVPQKVDKHFFFTVGLGSNPCPKNQTCQGPNNSSKFSASVNNVSMILPTTA  416

Query  1341  LLQAHFFNQSKGVYTA-DFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQD  1517
             LLQ+ +F +S GVYT  DFP+ P V FNYTG PP N  V++ TKVV L FN+SVELVMQ 
Sbjct  417   LLQS-YFKKSNGVYTTDDFPSVPLVPFNYTGTPPNNTHVSNGTKVVVLPFNTSVELVMQG  475

Query  1518  TSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRF  1697
             TSI+GAESHPLHLHG+NF+V+GQGFGN+DP KDP+ +NLVDP ERNT+GVPSGGWVAIRF
Sbjct  476   TSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWVAIRF  535

Query  1698  LADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LADNPG WFMHCH EVH SWGL+MAW+V+DG+   QKL PPPADLPKC
Sbjct  536   LADNPGVWFMHCHFEVHLSWGLRMAWLVLDGELPNQKLPPPPADLPKC  583



>ref|XP_003530212.1| PREDICTED: laccase-17-like [Glycine max]
Length=579

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/548 (71%), Positives = 462/548 (84%), Gaps = 1/548 (0%)
 Frame = +3

Query  201   ITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWH  380
             ITRHY F+++  NVTRLC T++I++VNG+FPGPR++AREGDRVVVKVVNHV  NV+IHWH
Sbjct  32    ITRHYTFNVEYLNVTRLCHTRNILSVNGKFPGPRLVAREGDRVVVKVVNHVSNNVSIHWH  91

Query  381   GVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVIL  560
             G+RQ+ +GWADGPAY+TQCPIQT QSY YNFTI GQRGTL WHAHISWLRAT+YGPI+IL
Sbjct  92    GIRQITTGWADGPAYVTQCPIQTNQSYTYNFTIVGQRGTLLWHAHISWLRATIYGPIIIL  151

Query  561   PKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNC  740
             PK   ++PF +P KE+PI+FGEW+  D E +ISQA QTGG PN+SDA+TINGLPGPLYNC
Sbjct  152   PKHNESFPFEKPHKEIPILFGEWFNVDPEAVISQALQTGGGPNVSDAYTINGLPGPLYNC  211

Query  741   SAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITP  920
             S+KD++ LKVK GKTYLLRLINAALN+ELFFSIANH+LTVVEADA Y KPF+T+ +LI P
Sbjct  212   SSKDTYTLKVKPGKTYLLRLINAALNEELFFSIANHTLTVVEADARYTKPFDTDTLLIAP  271

Query  921   GQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPLFT  1100
             GQTTNVLLKT  + PNAT+ +SARPY TG   FDNSTTAG L Y      ++   L L  
Sbjct  272   GQTTNVLLKTKPYFPNATFQMSARPYFTGRGTFDNSTTAGTLIYKQPLKNSSVKNLTLLK  331

Query  1101  PTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPT  1280
             PTLP  N TSF  NFT K RSLA+A FPA VP+KVDR+FFFTVGLG  PCP+N TCQGP+
Sbjct  332   PTLPPINATSFVANFTAKFRSLASAKFPAKVPQKVDRKFFFTVGLGTSPCPKNTTCQGPS  391

Query  1281  NNTKFAASVNNISFVQPTT-ALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVT  1457
             NNTKFAASVNNISF  P++ +++QA++  Q+ GV+  DFPA P   FNYTG PP N MVT
Sbjct  392   NNTKFAASVNNISFALPSSVSIMQAYYSGQANGVFKTDFPATPLNPFNYTGTPPNNTMVT  451

Query  1458  SATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLV  1637
             + TK+V L FN+SVE+V+QDTSI+GAESHPLHLHG++FF++GQGFGNYDPN DP+KFNL+
Sbjct  452   NDTKLVVLKFNTSVEVVLQDTSILGAESHPLHLHGYDFFIVGQGFGNYDPNNDPAKFNLI  511

Query  1638  DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQP  1817
             DP ERNTVGVP+GGW+A RFLADNPG WFMHCHL++HTSWGL+MAW+V+DG G KQKLQP
Sbjct  512   DPVERNTVGVPAGGWIAFRFLADNPGVWFMHCHLDLHTSWGLRMAWLVLDGPGPKQKLQP  571

Query  1818  PPADLPKC  1841
             PP+DLPKC
Sbjct  572   PPSDLPKC  579



>ref|XP_007132049.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris]
 gb|ESW04043.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris]
Length=607

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/574 (69%), Positives = 460/574 (80%), Gaps = 11/574 (2%)
 Frame = +3

Query  144   VLAAFCWVSGDVALA---KHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             +  AF +V+  + LA   KH  +TRHYKFDI+++NVTRLC TKSIVTVNG+FPGPR+ AR
Sbjct  37    LFVAFLFVTSFLVLATSSKHGSVTRHYKFDIRLRNVTRLCHTKSIVTVNGKFPGPRVAAR  96

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+VVKVVNHV  NVTIHWHGVRQLRSGWADGP+YITQCPIQTGQSYVYNFTI GQRG
Sbjct  97    EGDRIVVKVVNHVPNNVTIHWHGVRQLRSGWADGPSYITQCPIQTGQSYVYNFTIDGQRG  156

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAHISWLRATLYGP+++LP+   +YPF  P+KEVPI+FGEWW AD E +I+QA Q+
Sbjct  157   TLFWHAHISWLRATLYGPLILLPRSNESYPFENPYKEVPILFGEWWNADPEAVIAQALQS  216

Query  675   GGAPNISDAFTINGLPGPLYNCS----AKDSFKLKVKAGKTYLLRLINAALNDELFFSIA  842
             G  PN+SDA T NG PGPLYNCS      ++F+LKVK GKTYLLRLINAALNDELFFSIA
Sbjct  217   GAGPNVSDAHTFNGFPGPLYNCSNNETETETFRLKVKPGKTYLLRLINAALNDELFFSIA  276

Query  843   NHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFD  1022
             NH+L +VEADA YVKPF + I+++ PGQT+NVLLKT   +PNAT+ + ARPY TG   FD
Sbjct  277   NHTLVIVEADATYVKPFESKIIVLGPGQTSNVLLKTKPEYPNATFFMLARPYFTGMGTFD  336

Query  1023  NSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKK  1202
             NST AGILEY           +P F P+LP  NDTSF  NF+ K RSL  A +PA VP+K
Sbjct  337   NSTVAGILEY---KKPLAPKNIPTFKPSLPAINDTSFVANFSSKFRSLNTAKYPAKVPQK  393

Query  1203  VDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQS-KGV  1379
             VD+ FFFTVGLG  PCP+NQTCQGP N++KFAAS+NNISF  P+ ALLQ HFF Q+  G+
Sbjct  394   VDKSFFFTVGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSVALLQQHFFGQANNGI  453

Query  1380  YTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLH  1559
             YT DFPA P   FNYTG PP N  VT+ TK V + FN+ V++V+QDTSI+GAESHPLHLH
Sbjct  454   YTTDFPAVPLRTFNYTGTPPNNTRVTNGTKTVVILFNTKVQVVLQDTSILGAESHPLHLH  513

Query  1560  GFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHL  1739
             GFNF+V+GQGFGN++P  DP  FNLVDP ERNTVGVPSGGWVAIRFLADNPG W MHCH 
Sbjct  514   GFNFYVVGQGFGNFNPITDPPNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHF  573

Query  1740  EVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             +VH SWGL+MAWIV DGK   QKL PPPADLPKC
Sbjct  574   DVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  607



>gb|EYU41740.1| hypothetical protein MIMGU_mgv1a026682mg [Erythranthe guttata]
Length=564

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/563 (71%), Positives = 465/563 (83%), Gaps = 5/563 (1%)
 Frame = +3

Query  156   FCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvv  335
             FC +   +     +  TRHY F+I  +NVTRLC+TKSI+TVNG+FPGPR+IAREGD+V+V
Sbjct  6     FCVLVSSILTEPASCTTRHYTFNIVQKNVTRLCKTKSIITVNGKFPGPRLIAREGDQVLV  65

Query  336   kvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAH  515
             KVVN+V  N+T+HWHG+RQLRSGW+DGPAY+TQCPIQTGQ+Y YNFTITGQRGTLFWHAH
Sbjct  66    KVVNNVTNNITLHWHGIRQLRSGWSDGPAYVTQCPIQTGQNYTYNFTITGQRGTLFWHAH  125

Query  516   ISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNIS  695
             ISWLR+TL+GPI+ILPKK   YPF +P+KEVPIIFGEWW AD E +IS+A QTGG PN+S
Sbjct  126   ISWLRSTLHGPIIILPKKNETYPFRKPYKEVPIIFGEWWNADPEAVISEALQTGGGPNVS  185

Query  696   DAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADA  875
             DA+TING PGP YNCS+KD+FKLKVK GKTYLLRLINAA+NDELFF IANH+LT+VEADA
Sbjct  186   DAYTINGRPGPSYNCSSKDTFKLKVKPGKTYLLRLINAAMNDELFFGIANHTLTIVEADA  245

Query  876   VYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs  1055
             VYVKPF+T++V+ITPGQTTNVLLKT +HHPNAT++++A+PY+TG   FDNST    LEY 
Sbjct  246   VYVKPFSTSVVVITPGQTTNVLLKTKSHHPNATFIMAAQPYSTGQGTFDNSTVTAFLEYE  305

Query  1056  tnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP-ANVPKKVDRRFFFTVG  1232
               +         +FTPTLP FN TSF  NFTKK RSL N  +  ANVP+KVD++FFFTVG
Sbjct  306   GKNPSNKNA---IFTPTLPQFNATSFVANFTKKFRSLNNPKYTIANVPQKVDKQFFFTVG  362

Query  1233  LGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPV  1412
             LG  PC QN TC GP N TKFAASVNN+SF  P TALLQAHF  +S G+YT DFP NP  
Sbjct  363   LGTTPCNQNSTCAGP-NGTKFAASVNNVSFALPATALLQAHFSKKSNGIYTTDFPTNPQN  421

Query  1413  KFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGF  1592
              FNYTG PP N +V++ T++V L FN+SVELV+QDTSI+GAESHPLHLHGFNFF++G+GF
Sbjct  422   PFNYTGTPPNNTLVSNGTRLVSLPFNTSVELVLQDTSILGAESHPLHLHGFNFFIVGEGF  481

Query  1593  GNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMA  1772
             GNYDP  DP  FNLVDP ERNTVGVPSGGWVAIRFL DNPG WFMHCH +VHTSWGL+MA
Sbjct  482   GNYDPTNDPLNFNLVDPVERNTVGVPSGGWVAIRFLTDNPGVWFMHCHFDVHTSWGLRMA  541

Query  1773  WIVMDGKGRKQKLQPPPADLPKC  1841
             WIV+DG    Q+L PPP DLPKC
Sbjct  542   WIVLDGPLPSQQLPPPPFDLPKC  564



>ref|XP_002313424.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa]
 gb|EEE87379.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa]
Length=576

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/569 (71%), Positives = 472/569 (83%), Gaps = 8/569 (1%)
 Frame = +3

Query  138   IFVLAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I + A  C W   +VA AKHAGITRHYKF+IK+ NVTRLC TKS+VTVNG+FPGPR++AR
Sbjct  15    ILLFAMSCLWAFPEVAGAKHAGITRHYKFNIKLTNVTRLCHTKSMVTVNGKFPGPRVVAR  74

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+VVKVVNHV  N++IHWHG+RQL+SGWADGPAYITQCPIQT Q+YVYNFT+TGQRG
Sbjct  75    EGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPAYITQCPIQTNQTYVYNFTVTGQRG  134

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAH+SWLRA++YGP++I PK+ V+YPF +P KEV I+ GEW+ AD E +I QA QT
Sbjct  135   TLFWHAHLSWLRASVYGPLIIFPKRNVSYPFAKPHKEVTIMLGEWFNADPEAVIRQALQT  194

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+S+A+T NGL GPLYNCSA +++KLKVK GKTYLLRLINAALNDELFFSIANH+ 
Sbjct  195   GGGPNVSEAYTFNGLTGPLYNCSANNTYKLKVKPGKTYLLRLINAALNDELFFSIANHTF  254

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVE DA YVKPF TN+++ITPGQTTNVLLKT    PNA++ + ARPY TG   FDN+T 
Sbjct  255   TVVEVDATYVKPFETNLLVITPGQTTNVLLKTKPIAPNASFYMLARPYFTGQGTFDNTTV  314

Query  1035  AGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             AGILEY T+SN TT      F PTLP  N T+   NFT+KLRSLAN  FP NVP+ VD++
Sbjct  315   AGILEYETSSNSTT------FKPTLPPINATNAVANFTRKLRSLANFQFPVNVPQTVDKK  368

Query  1215  FFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADF  1394
             FFFTVGLG  PCP+NQTCQGP N TKF+ASVNNIS   P+TALLQ++FF +S GVYT+DF
Sbjct  369   FFFTVGLGNNPCPKNQTCQGP-NGTKFSASVNNISMALPSTALLQSYFFKKSNGVYTSDF  427

Query  1395  PANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFF  1574
             P++P   FNYTG PP N  VT+ TK++ L FN++VE+VMQ TSI+GAESHPLHLHGFNF+
Sbjct  428   PSSPLHPFNYTGTPPNNTFVTNGTKLIVLPFNTNVEVVMQGTSILGAESHPLHLHGFNFY  487

Query  1575  VIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTS  1754
             V+G+GFGN+DPN DP  FNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCH +VH S
Sbjct  488   VVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPSGGWVAIRFHADNPGVWFMHCHFDVHLS  547

Query  1755  WGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WGL+MAWIV+DG    QKL PPP+DLPKC
Sbjct  548   WGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_006592190.1| PREDICTED: laccase-2-like isoform X2 [Glycine max]
Length=588

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/578 (69%), Positives = 465/578 (80%), Gaps = 9/578 (2%)
 Frame = +3

Query  132   FIIFVLA-AFCWVSGDVALA--KHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPR  302
             F+ F+ A +F W   + ALA  KH  +TRHYKFDI+++N+TRLC TKS+VTVNG+FPGPR
Sbjct  12    FVAFLFATSFLWSFPEFALATSKHGSVTRHYKFDIRLRNITRLCHTKSMVTVNGKFPGPR  71

Query  303   IIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTIT  482
             ++AREGDR+VVKVVNHV  NV+IHWHGVRQL+SGWADGP+YITQCPIQTGQSYVYNFTI 
Sbjct  72    VVAREGDRIVVKVVNHVPNNVSIHWHGVRQLQSGWADGPSYITQCPIQTGQSYVYNFTIV  131

Query  483   GQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQ  662
             GQRGTLFWHAHISWLRATLYGP+++LP++  +YPF +P+KEVPI+FGEWW AD E +I+Q
Sbjct  132   GQRGTLFWHAHISWLRATLYGPLILLPRRNESYPFEKPYKEVPILFGEWWNADPEAVIAQ  191

Query  663   ASQTGGAPNISDAFTINGLPGPLYNCS----AKDSFKLKVKAGKTYLLRLINAALNDELF  830
             A QTG  PN+SDA+T NGLPGPLYNCS      D+F+LKVK GKTYLLRLINAALNDELF
Sbjct  192   ALQTGAGPNVSDAYTFNGLPGPLYNCSNNDTETDTFRLKVKPGKTYLLRLINAALNDELF  251

Query  831   FSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGP  1010
             FSIANH+L  VEADA YVKPF + I++I PGQT+N LLKT   +PN  +L+ ARPY TG 
Sbjct  252   FSIANHTLVTVEADATYVKPFESEIIVIGPGQTSNFLLKTKPEYPNVNFLMLARPYFTGM  311

Query  1011  APFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPAN  1190
               FDNST AGILEY         N +P   P+LP  NDTSF  NF+ K  SL    +PA 
Sbjct  312   GTFDNSTVAGILEY-KKPLVAPKNTIPTLKPSLPAINDTSFVANFSSKFLSLNTDKYPAK  370

Query  1191  VPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQS  1370
             VP+ VD+ FFFT+GLG  PCP+NQTCQGP N++KFAAS+NNISF  P+ ALLQ HFF Q+
Sbjct  371   VPQTVDKSFFFTIGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSIALLQQHFFGQA  430

Query  1371  -KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHP  1547
               G+YT DFPA P + FNYTG PP N  V++ TK V + FN+ V++V+QDTSI+GAESHP
Sbjct  431   NNGIYTTDFPAMPLMPFNYTGTPPNNTRVSNGTKTVVIPFNTRVQVVLQDTSILGAESHP  490

Query  1548  LHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  1727
             LHLHGFNF+V+GQGFGN++PN DP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG W M
Sbjct  491   LHLHGFNFYVVGQGFGNFNPNTDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLM  550

Query  1728  HCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HCH +VH SWGL+MAWIV DGK   QKL PPPADLPKC
Sbjct  551   HCHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  588



>ref|XP_006846265.1| hypothetical protein AMTR_s00012p00245710 [Amborella trichopoda]
 gb|ERN07940.1| hypothetical protein AMTR_s00012p00245710 [Amborella trichopoda]
Length=579

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/575 (70%), Positives = 472/575 (82%), Gaps = 10/575 (2%)
 Frame = +3

Query  132   FIIFVLAAFC--WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRI  305
             F+  +L   C  W+     LA     TRHY F ++++N+TRLC T+ +VTVNG  PGP+I
Sbjct  10    FMAILLWTLCALWLGPRHTLAS----TRHYLFSVRLKNMTRLCHTRQVVTVNGMVPGPKI  65

Query  306   IAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITG  485
             +AREGD+VV+KVVNHV  NVTIHWHGVRQL+SGWADGPAY+TQCPIQTGQ+YVYNFTITG
Sbjct  66    VAREGDQVVIKVVNHVPNNVTIHWHGVRQLQSGWADGPAYVTQCPIQTGQTYVYNFTITG  125

Query  486   QRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQA  665
             QRGTL WHAH +WLR+T+YGPIVILPK+GV YPFP+P +E+PIIFGEW+  D E +++QA
Sbjct  126   QRGTLLWHAHATWLRSTIYGPIVILPKRGVPYPFPEPHEEIPIIFGEWFNVDPEAVLAQA  185

Query  666   SQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIAN  845
              QTGG PN+SD++TING PGPLYNCSAKD+FKLKV+ GKTYLLRLI+AALNDELFFSIAN
Sbjct  186   LQTGGGPNVSDSYTINGHPGPLYNCSAKDTFKLKVERGKTYLLRLISAALNDELFFSIAN  245

Query  846   HSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDN  1025
             HSLTVVEADA+YVKPF T+IVLITPGQTTNVLL    + P  T++++ARPY TG   FDN
Sbjct  246   HSLTVVEADAIYVKPFTTDIVLITPGQTTNVLLTAKPNPPKTTFVMAARPYVTGQGSFDN  305

Query  1026  STTAGILEYstnsnktttnkL---PLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVP  1196
             STT GILEY + S   ++  +   PL  PTLP  NDT+FA NF+++ RSLA+  FPANVP
Sbjct  306   STTTGILEYHSPSLGNSSPSITKLPLLLPTLPALNDTNFAANFSRRFRSLASKQFPANVP  365

Query  1197  KKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKG  1376
             + VDR+F FTVGLG  PCP NQTCQGP N + F AS+NN+SF  PTTA+LQAHFF QS G
Sbjct  366   QTVDRKFLFTVGLGTNPCPNNQTCQGP-NGSMFTASINNVSFSMPTTAMLQAHFFGQSAG  424

Query  1377  VYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHL  1556
             VYT DFP NPP+ FNYTG PP N +V S TKV  L FN+SVELV+QDT I+GAESHPLHL
Sbjct  425   VYTTDFPENPPIPFNYTGAPPNNTLVMSGTKVEVLRFNTSVELVLQDTGILGAESHPLHL  484

Query  1557  HGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCH  1736
             HGFNFF++GQGFGNYDP+KDP+KFNLVDP ERNT GVPSGGW+A+RFLADNPG W MHCH
Sbjct  485   HGFNFFIVGQGFGNYDPSKDPAKFNLVDPMERNTAGVPSGGWLALRFLADNPGVWLMHCH  544

Query  1737  LEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             LEVHTSWGLKMAW+V DG    QKL PPP+DLPKC
Sbjct  545   LEVHTSWGLKMAWLVSDGTLPNQKLPPPPSDLPKC  579



>gb|ACN34362.1| unknown [Zea mays]
 tpg|DAA56880.1| TPA: putative laccase family protein [Zea mays]
Length=582

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/586 (68%), Positives = 469/586 (80%), Gaps = 15/586 (3%)
 Frame = +3

Query  102   RMMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVN  281
             R+  C +A   ++ VL  F  V          G  R Y+FD++M NVTRLC +KSIVTVN
Sbjct  6     RLPCCCYA---LVTVLVLFFSVDAT------EGAIREYQFDVQMTNVTRLCSSKSIVTVN  56

Query  282   GRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSY  461
             G+FPGP + AREGD VV++VVNHV YN++IHWHG+RQLRSGWADGPAYITQCPIQ+GQSY
Sbjct  57    GQFPGPTVFAREGDFVVIRVVNHVPYNMSIHWHGIRQLRSGWADGPAYITQCPIQSGQSY  116

Query  462   VYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKAD  641
             VY FTITGQRGTL+WHAHISWLRAT+YGPIVILPK GV YPFP P+ EVP++FGEWW AD
Sbjct  117   VYKFTITGQRGTLWWHAHISWLRATVYGPIVILPKPGVPYPFPAPYDEVPVLFGEWWTAD  176

Query  642   TERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALND  821
             TE +ISQA QTGG PN+SDAFTINGLPGPLYNCSAKD+FKLKVK GKTY+LR+INAALND
Sbjct  177   TEAVISQALQTGGGPNVSDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRIINAALND  236

Query  822   ELFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYA  1001
             ELFFSIA H LTVV+ DAVY+KP     ++ITPGQTTNVLL T   +P ATY + A PY+
Sbjct  237   ELFFSIAGHPLTVVDVDAVYIKPITVETIIITPGQTTNVLLTTKPSYPGATYYMLAAPYS  296

Query  1002  TG-PAPFDNSTTAGILEYstnsnk-----tttnkLPLFTPTLPVFNDTSFATNFTKKLRS  1163
             T  P  FDN+T AGILEY   ++           LP   PTLP  NDTSF  N+T +LRS
Sbjct  297   TARPGTFDNTTVAGILEYEDPTSSPPPHAAFDKNLPALKPTLPQINDTSFVANYTARLRS  356

Query  1164  LANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTAL  1343
             LA A +PA+VP++V RRFFFTVGLG  PC  N TCQGPTN+++FAASVNN+SFV PTTAL
Sbjct  357   LATAEYPADVPREVHRRFFFTVGLGTHPCAVNGTCQGPTNSSRFAASVNNVSFVLPTTAL  416

Query  1344  LQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTS  1523
             LQ+HF  +S+GVY+++FPA P V FNYTG PP N  V++ TK+V L + +SVELVMQ TS
Sbjct  417   LQSHFAGKSRGVYSSNFPAAPLVPFNYTGTPPNNTNVSNGTKLVVLPYGTSVELVMQGTS  476

Query  1524  IIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLA  1703
             I+GAESHPLHLHGFNFFV+GQGFGN+DP KDP+K+NLVDP ERNTVGVP+ GWVAIRF A
Sbjct  477   ILGAESHPLHLHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRA  536

Query  1704  DNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             DNPG WFMHCHLEVH SWGLKMAW+V+DG+   +KL PPP+DLP C
Sbjct  537   DNPGVWFMHCHLEVHVSWGLKMAWLVLDGERPNEKLLPPPSDLPTC  582



>ref|XP_008369916.1| PREDICTED: laccase-17-like [Malus domestica]
Length=586

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/576 (70%), Positives = 461/576 (80%), Gaps = 12/576 (2%)
 Frame = +3

Query  147   LAAFCWVSGDVALAK---HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +AAF +    VAL      +GITRHY F+IK  NVTRLC T+SIV+VN +FPGPR++ARE
Sbjct  12    MAAFLFSFCVVALLTPEFASGITRHYTFNIKYHNVTRLCNTRSIVSVNEKFPGPRLVARE  71

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD+V++KVVNHV  NVTIHWHGV+QLRSGWADGPAY+TQCPIQ GQSY YNFTI GQRGT
Sbjct  72    GDQVLIKVVNHVSNNVTIHWHGVKQLRSGWADGPAYVTQCPIQMGQSYTYNFTIQGQRGT  131

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L WHAH+SWLR+T+YGPI+ILPK+  +YPF +P+KEVPI+ GEW+  D E +I+QA QTG
Sbjct  132   LLWHAHVSWLRSTIYGPIIILPKRNESYPFVKPYKEVPILLGEWFNVDPEAVINQALQTG  191

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDAFTINGLPGPLYNCS+KD FKLKVK GKTYLLRLINAALNDELFFSIANH+LT
Sbjct  192   GGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  251

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADAVY KPF T+ +LI PGQTTNVLLKT  + P AT+LI A PY TG    DN+TTA
Sbjct  252   VVEADAVYTKPFETDTLLIAPGQTTNVLLKTKPNSPXATFLILASPYFTGRGTLDNTTTA  311

Query  1038  GILEYs--tnsnktttnkLPLFTPTLPVFNDTSFAT------NFTKKLRSLANANFPANV  1193
             GILEY     +  T+   LPLF P+LP FN T F        N  KK RSLA+  FPANV
Sbjct  312   GILEYEHPITTLHTSIKTLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKKFPANV  371

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             P+ VD++FFFT GLG  PCPQN TCQGP N  KFAASVNN SF  P+TA+LQAHF  QS 
Sbjct  372   PQTVDKKFFFTXGLGTAPCPQNSTCQGP-NGLKFAASVNNFSFALPSTAMLQAHFSGQSN  430

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFPANP V FNYTG PP    V + TK + L FN+SVELV+QDTSI+GAESHPLH
Sbjct  431   GVYTTDFPANPLVTFNYTGTPPNVTNVANGTKALVLPFNTSVELVLQDTSILGAESHPLH  490

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGNYDPNKDP+ FNLVDP ERNT GVP+GGW+A RFLADNPG W MHC
Sbjct  491   LHGFNFFVVGQGFGNYDPNKDPAXFNLVDPIERNTAGVPAGGWIAXRFLADNPGVWLMHC  550

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HL++HTSWGL+MAWIV DG    QKL PPP+DLPKC
Sbjct  551   HLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  586



>ref|XP_006592189.1| PREDICTED: laccase-2-like isoform X1 [Glycine max]
 gb|KHN32142.1| Laccase-2 [Glycine soja]
Length=590

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/580 (68%), Positives = 465/580 (80%), Gaps = 11/580 (2%)
 Frame = +3

Query  132   FIIFVLA-AFCWVSGDVALA--KHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPR  302
             F+ F+ A +F W   + ALA  KH  +TRHYKFDI+++N+TRLC TKS+VTVNG+FPGPR
Sbjct  12    FVAFLFATSFLWSFPEFALATSKHGSVTRHYKFDIRLRNITRLCHTKSMVTVNGKFPGPR  71

Query  303   IIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTIT  482
             ++AREGDR+VVKVVNHV  NV+IHWHGVRQL+SGWADGP+YITQCPIQTGQSYVYNFTI 
Sbjct  72    VVAREGDRIVVKVVNHVPNNVSIHWHGVRQLQSGWADGPSYITQCPIQTGQSYVYNFTIV  131

Query  483   GQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQ  662
             GQRGTLFWHAHISWLRATLYGP+++LP++  +YPF +P+KEVPI+FGEWW AD E +I+Q
Sbjct  132   GQRGTLFWHAHISWLRATLYGPLILLPRRNESYPFEKPYKEVPILFGEWWNADPEAVIAQ  191

Query  663   ASQTGGAPNISDAFTINGLPGPLYNCS------AKDSFKLKVKAGKTYLLRLINAALNDE  824
             A QTG  PN+SDA+T NGLPGPLYNCS        D+F+LKVK GKTYLLRLINAALNDE
Sbjct  192   ALQTGAGPNVSDAYTFNGLPGPLYNCSNNETDTETDTFRLKVKPGKTYLLRLINAALNDE  251

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFFSIANH+L  VEADA YVKPF + I++I PGQT+N LLKT   +PN  +L+ ARPY T
Sbjct  252   LFFSIANHTLVTVEADATYVKPFESEIIVIGPGQTSNFLLKTKPEYPNVNFLMLARPYFT  311

Query  1005  GPAPFDNSTTAGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFP  1184
             G   FDNST AGILEY         N +P   P+LP  NDTSF  NF+ K  SL    +P
Sbjct  312   GMGTFDNSTVAGILEY-KKPLVAPKNTIPTLKPSLPAINDTSFVANFSSKFLSLNTDKYP  370

Query  1185  ANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFN  1364
             A VP+ VD+ FFFT+GLG  PCP+NQTCQGP N++KFAAS+NNISF  P+ ALLQ HFF 
Sbjct  371   AKVPQTVDKSFFFTIGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSIALLQQHFFG  430

Query  1365  QS-KGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAES  1541
             Q+  G+YT DFPA P + FNYTG PP N  V++ TK V + FN+ V++V+QDTSI+GAES
Sbjct  431   QANNGIYTTDFPAMPLMPFNYTGTPPNNTRVSNGTKTVVIPFNTRVQVVLQDTSILGAES  490

Query  1542  HPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAW  1721
             HPLHLHGFNF+V+GQGFGN++PN DP KFNLVDP ERNTVGVPSGGWVAIRFLADNPG W
Sbjct  491   HPLHLHGFNFYVVGQGFGNFNPNTDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVW  550

Query  1722  FMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
              MHCH +VH SWGL+MAWIV DGK   QKL PPPADLPKC
Sbjct  551   LMHCHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  590



>emb|CAN80346.1| hypothetical protein VITISV_003134 [Vitis vinifera]
Length=611

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/530 (76%), Positives = 453/530 (85%), Gaps = 6/530 (1%)
 Frame = +3

Query  138   IFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +F   A C +  ++ALA+ +GITRHYKFDIK+QNVTRLC TKSI+TVNG+FPGPRI+ARE
Sbjct  16    VFSCMALCLLP-ELALAQDSGITRHYKFDIKLQNVTRLCHTKSILTVNGQFPGPRIVARE  74

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GDR+++KVVNHV+ N++IHWHG+RQLRSGWADGPAY+TQCPIQTGQSYVYNFT+ GQRGT
Sbjct  75    GDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGT  134

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             LFWHAHISWLR+TLYGP++ILPK+ V YPF +P KEVPIIFGEWW ADTE +ISQA QTG
Sbjct  135   LFWHAHISWLRSTLYGPLIILPKRNVPYPFEKPHKEVPIIFGEWWNADTEAVISQALQTG  194

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDA+TINGLPGPLYNCSAKD+FKL+VKA KTYLLRLINAALNDELFFSIANH+LT
Sbjct  195   GGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKASKTYLLRLINAALNDELFFSIANHTLT  254

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VV+ADA+YVKPF T+ +LI PGQTTNVLLKT  H PNA +LI+ARPY TG   FDNST A
Sbjct  255   VVDADAIYVKPFETDTLLIAPGQTTNVLLKTKPHFPNAAFLITARPYVTGLGTFDNSTVA  314

Query  1038  GILEYstnsnk----tttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKV  1205
             GILEY   S       +  KLPLF PTLP  NDTSFATNFT +LRSLA+  FPANVP+KV
Sbjct  315   GILEYELPSASPHSTVSIKKLPLFKPTLPPLNDTSFATNFTNRLRSLASPQFPANVPQKV  374

Query  1206  DRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYT  1385
             DR FFFT+GLG  PC QNQTCQGP N TKFAASVNN+SF   TTALLQAHF  QS GVY 
Sbjct  375   DRHFFFTIGLGTSPCDQNQTCQGP-NGTKFAASVNNVSFASSTTALLQAHFSGQSNGVYN  433

Query  1386  ADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGF  1565
              DFP  P + FNYTG PP N +V++ TKVV L FN+SVELVMQDTSI+GAESHPLHLHGF
Sbjct  434   PDFPITPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGF  493

Query  1566  NFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             NFFV+GQGFGNYDPNKDP+ FNLVDP ERNTVGVPSGGWVAIRFLADNP 
Sbjct  494   NFFVVGQGFGNYDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPA  543



>gb|KEH22909.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=578

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/548 (71%), Positives = 457/548 (83%), Gaps = 4/548 (1%)
 Frame = +3

Query  204   TRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHWHG  383
             TRHY F+I+ +NVTRLC T++I++VNG+FPGPR++AREGDRV+VKVVNH+  NVTIHWHG
Sbjct  33    TRHYTFNIEYKNVTRLCHTRTILSVNGKFPGPRLVAREGDRVLVKVVNHISNNVTIHWHG  92

Query  384   VRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILP  563
             +RQ  +GW+DGPAY+TQCPIQT Q+Y YNFTITGQRGTLFWHAHISWLRATLYGPI+ILP
Sbjct  93    IRQKTTGWSDGPAYVTQCPIQTNQTYTYNFTITGQRGTLFWHAHISWLRATLYGPIIILP  152

Query  564   KKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYNCS  743
             K   +YPF +P KE+PI+FGEW+  D E +I+QA QTGG PN+SDA+TINGLPGP YNCS
Sbjct  153   KHNESYPFQKPHKEIPILFGEWFNVDPEAVINQALQTGGGPNVSDAYTINGLPGPFYNCS  212

Query  744   AKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLITPG  923
             +KD+FKLKVK  KTYLLR+INAALN+ELFFSIANH+L VVEADA Y KPFNTN +LITPG
Sbjct  213   SKDTFKLKVKPNKTYLLRIINAALNEELFFSIANHTLIVVEADARYTKPFNTNTLLITPG  272

Query  924   QTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPLFTP  1103
             QTTNVLLKT    PN  +L+ ARPY TG   FDNST AGIL Y    + ++   L    P
Sbjct  273   QTTNVLLKTKPDFPNTNFLMIARPYITGLGTFDNSTPAGILHY--KQHNSSIKNLRFLKP  330

Query  1104  TLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTN  1283
             TLP  NDT+F +NFTKK RSLAN+ FP NVPKKVD++FFFTVGLG  PCP+N TCQGP N
Sbjct  331   TLPSLNDTNFVSNFTKKFRSLANSKFPINVPKKVDKKFFFTVGLGTFPCPKNSTCQGPNN  390

Query  1284  NTKFAASVNNISFVQPTTALLQAHFFNQ--SKGVYTADFPANPPVKFNYTGNPPTNIMVT  1457
             NTKFAASVNN SFV P+ +++QA++F +  S GVY  DFP  P   FNYTG  P N MV 
Sbjct  391   NTKFAASVNNFSFVLPSVSIMQAYYFGKSNSNGVYKTDFPETPLNPFNYTGTSPNNTMVN  450

Query  1458  SATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLV  1637
             + TK+V L+FN+SVELV+QDTSI+GAESHPLHLHG++FFV+GQGFGNYD NKDP+KFNLV
Sbjct  451   NDTKLVVLNFNTSVELVLQDTSILGAESHPLHLHGYDFFVVGQGFGNYDANKDPAKFNLV  510

Query  1638  DPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQP  1817
             DP ERNTVGVP+GGWVAIRF ADNPG WFMHCHL++HTSWGL+MAW+V+DG    QKLQP
Sbjct  511   DPVERNTVGVPAGGWVAIRFFADNPGVWFMHCHLDIHTSWGLRMAWLVLDGPDSNQKLQP  570

Query  1818  PPADLPKC  1841
             PP+DLPKC
Sbjct  571   PPSDLPKC  578



>ref|XP_002458746.1| hypothetical protein SORBIDRAFT_03g039520 [Sorghum bicolor]
 gb|EES03866.1| hypothetical protein SORBIDRAFT_03g039520 [Sorghum bicolor]
Length=579

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/553 (71%), Positives = 453/553 (82%), Gaps = 5/553 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY F++ M NVTRLC +KSI+TVNG+FPGP+I+AREGDR+V++V NH ++N+++HW
Sbjct  27    GITRHYDFNVTMANVTRLCASKSIITVNGQFPGPKIVAREGDRLVIRVTNHAQHNISLHW  86

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLR+GWADGPAYITQCPIQTGQSYVYN+TI GQRGTL+WHAHISWLRAT+YGP+V+
Sbjct  87    HGIRQLRTGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWWHAHISWLRATVYGPLVV  146

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LPK GV YPFP P+KEVP+IFGEWW ADTE +I QA Q G  PN+SDA TINGLPGPLYN
Sbjct  147   LPKLGVPYPFPAPYKEVPVIFGEWWLADTEVVIQQALQLGAGPNVSDAHTINGLPGPLYN  206

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD+FKLKVK GKTY+LRLINAALNDELFFSIANHSLTVVE DAVYVKPF  + ++I 
Sbjct  207   CSAKDTFKLKVKPGKTYMLRLINAALNDELFFSIANHSLTVVEVDAVYVKPFTVDTLVIA  266

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYst----nsnktttn  1082
             PGQTTNVLL     +P A Y ++AR Y+TG PA FDN+T AGILEY      ++  +   
Sbjct  267   PGQTTNVLLAAKPFYPAANYYMTARTYSTGRPATFDNTTVAGILEYEYPDAPSAAASFNK  326

Query  1083  kLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQ  1262
              LPL+ P LP  NDTSF  NFT KL SLA   +PA VP+ VD+RFFFTVGLG  PCP N 
Sbjct  327   ALPLYRPALPQLNDTSFVGNFTAKLLSLATPEYPAAVPQTVDKRFFFTVGLGTHPCPANT  386

Query  1263  TCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPT  1442
             TCQGPTN T+FAASVNN+SFV PT ALL +HF   S GVY +DFP  P   FNYTG PP 
Sbjct  387   TCQGPTNTTQFAASVNNVSFVLPTKALLHSHFAGLSSGVYESDFPVAPLAPFNYTGTPPN  446

Query  1443  NIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPS  1622
             N  V + TK++ + + ++VELVMQ TSI+G ESHPLHLHGFNFFV+GQG+GNYDP  DP 
Sbjct  447   NTNVANGTKLMVIPYGTNVELVMQGTSILGIESHPLHLHGFNFFVVGQGYGNYDPVNDPP  506

Query  1623  KFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRK  1802
             KFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHT+WGL+MAW+V+DG    
Sbjct  507   KFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSLPH  566

Query  1803  QKLQPPPADLPKC  1841
             QKL PPP+DLPKC
Sbjct  567   QKLLPPPSDLPKC  579



>ref|XP_008387791.1| PREDICTED: laccase-17-like [Malus domestica]
Length=586

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/576 (70%), Positives = 461/576 (80%), Gaps = 12/576 (2%)
 Frame = +3

Query  147   LAAFCWVSGDVALAK---HAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIARE  317
             +AAF +    VAL      +GITRH  F+IK  NVTRLC T+SIV+VN +FPGPR++ARE
Sbjct  12    MAAFLFSFCVVALLTPEFXSGITRHXTFNIKYHNVTRLCNTRSIVSVNEKFPGPRLVARE  71

Query  318   GDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  497
             GD+V++KVVNHV  NVTIHWHGV+QLRSGWADGPAY+TQCPIQ GQSY YNFTI GQRGT
Sbjct  72    GDQVLIKVVNHVSNNVTIHWHGVKQLRSGWADGPAYVTQCPIQMGQSYTYNFTIQGQRGT  131

Query  498   LFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTG  677
             L WHAH+SWLR+T+YGPI+ILPK+  +YPF +P+KEVPI+ GEW+  D E +I+QA QTG
Sbjct  132   LLWHAHVSWLRSTIYGPIIILPKRNESYPFVKPYKEVPILLGEWFNVDPEAVINQALQTG  191

Query  678   GAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLT  857
             G PN+SDAFTINGLPGPLYNCS+KD FKLKVK GKTYLLRLINAALNDELFFSIANH+LT
Sbjct  192   GGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  251

Query  858   VVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTA  1037
             VVEADAVY KPF T+ +LI PGQTTNVLLKT  + P AT+LI A PY TG    DN+TTA
Sbjct  252   VVEADAVYTKPFETDTLLIAPGQTTNVLLKTKPNSPXATFLILASPYFTGRGTLDNTTTA  311

Query  1038  GILEYs--tnsnktttnkLPLFTPTLPVFNDTSFAT------NFTKKLRSLANANFPANV  1193
             GILEY     +  T+   LPLF P+LP FN T F        N  KK RSLA+  FPANV
Sbjct  312   GILEYEHPITTLHTSIKTLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKKFPANV  371

Query  1194  PKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSK  1373
             P+ VD++FFFT GLG  PCPQN TCQGP N  KFAASVNN SF  P+TA+LQAHF  QS 
Sbjct  372   PQTVDKKFFFTXGLGTAPCPQNSTCQGP-NGLKFAASVNNFSFALPSTAMLQAHFSGQSN  430

Query  1374  GVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLH  1553
             GVYT DFPANP V FNYTG PP    V + TK + L FN+SVELV+QDTSI+GAESHPLH
Sbjct  431   GVYTTDFPANPLVTFNYTGTPPNVTNVANGTKALVLPFNTSVELVLQDTSILGAESHPLH  490

Query  1554  LHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHC  1733
             LHGFNFFV+GQGFGNYDPNKDP+KFNLVDP ERNT GVP+GGW+A RFLADNPG W MHC
Sbjct  491   LHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTAGVPAGGWIAXRFLADNPGVWLMHC  550

Query  1734  HLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             HL++HTSWGL+MAWIV DG    QKL PPP+DLPKC
Sbjct  551   HLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  586



>gb|KDP35659.1| hypothetical protein JCGZ_09097 [Jatropha curcas]
Length=574

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/558 (71%), Positives = 463/558 (83%), Gaps = 6/558 (1%)
 Frame = +3

Query  174   DVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhv  353
             D+ALA    ITRHYKF+IK++NVTRLC T SI+TVNG+FPGPRI+AREGDR+VVKVVNH 
Sbjct  21    DLALAS---ITRHYKFEIKLKNVTRLCNTTSILTVNGKFPGPRIVAREGDRLVVKVVNHS  77

Query  354   kynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRA  533
               N++IHWHG+RQL++GW DGP+YITQCPIQT QSYVYNFTI GQRGTLFWHAHISWLRA
Sbjct  78    PKNISIHWHGIRQLQTGWYDGPSYITQCPIQTNQSYVYNFTIVGQRGTLFWHAHISWLRA  137

Query  534   TLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTIN  713
             TLYGPI+ILPK GV YPFP+P+K+VPI+FGEW+  D + II+Q+ QTGG PN+SDA+TIN
Sbjct  138   TLYGPIIILPKLGVPYPFPKPYKQVPILFGEWFHVDPDEIINQSLQTGGGPNVSDAYTIN  197

Query  714   GLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPF  893
             GLPG  YNCSAKD++KLKVK  KTYLLRLINAALNDELF SIANH++TVVE DA YVKPF
Sbjct  198   GLPGQFYNCSAKDTYKLKVKPRKTYLLRLINAALNDELFVSIANHTVTVVEVDATYVKPF  257

Query  894   NTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsn--  1067
              T+ +LITPGQTTNVLLKT    PN+T+ I+ARPYATG   FDNST   I+EY   S+  
Sbjct  258   ETDKLLITPGQTTNVLLKTKPDFPNSTFFIAARPYATGMGTFDNSTVTAIIEYEIESSPT  317

Query  1068  ktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIP  1247
              T   +LP   P LP  NDT FA NF+ +LRSLA+  +PANVP+KVD+RFFFTVGLG  P
Sbjct  318   HTIKKQLPPLNPILPALNDTPFAFNFSTRLRSLASLEYPANVPQKVDKRFFFTVGLGTNP  377

Query  1248  CPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYT  1427
             CP+NQTCQGP N TKFAASVNNISF  PTTA+LQ++FF  S GVY+ DFP+ P + F+YT
Sbjct  378   CPKNQTCQGP-NGTKFAASVNNISFAFPTTAMLQSYFFRNSNGVYSTDFPSQPIIPFDYT  436

Query  1428  GNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDP  1607
             G P  N MV + TKVV L FN+SVE+V+QDTSI+G ESHPLHLHG+NF+VIG GFGN+DP
Sbjct  437   GTPSNNTMVINGTKVVVLPFNTSVEVVLQDTSILGNESHPLHLHGYNFYVIGSGFGNFDP  496

Query  1608  NKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMD  1787
             N DP+KFN+VDP ERNT+GVPSGGWVA +FLADNPG W MHCH +VH SWGL+MAWIV+D
Sbjct  497   NNDPAKFNVVDPVERNTIGVPSGGWVAFQFLADNPGVWLMHCHFDVHLSWGLRMAWIVLD  556

Query  1788  GKGRKQKLQPPPADLPKC  1841
             G    QKL PPP+DLPKC
Sbjct  557   GNLPNQKLPPPPSDLPKC  574



>ref|XP_011032272.1| PREDICTED: laccase-2-like [Populus euphratica]
Length=576

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/569 (70%), Positives = 468/569 (82%), Gaps = 8/569 (1%)
 Frame = +3

Query  138   IFVLAAFC-WVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAR  314
             I + A  C W   DVA AKHAGITRHYKF+I++ NVTRLC TKS+VTVNG+FPGPR++AR
Sbjct  15    ILLFAMSCLWAFPDVAGAKHAGITRHYKFNIELTNVTRLCHTKSMVTVNGKFPGPRVVAR  74

Query  315   EGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRG  494
             EGDR+VVKVVNHV  N+TIHWHG+RQL+SGWADGP YITQCPIQT Q+YV+NFT+TGQRG
Sbjct  75    EGDRLVVKVVNHVPNNITIHWHGIRQLQSGWADGPEYITQCPIQTNQTYVHNFTVTGQRG  134

Query  495   TLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQT  674
             TLFWHAH+SWLRA++YGP++I PK+ V YPF +P KEV I+ GEW+ AD E +I QA QT
Sbjct  135   TLFWHAHLSWLRASVYGPLIIFPKRNVPYPFAKPHKEVTIMLGEWFNADPEAVIRQALQT  194

Query  675   GGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSL  854
             GG PN+S+A+T NGLPGPLYNCSA  ++KLKVK GKTYLLRLINAALNDELFFSIANH+ 
Sbjct  195   GGGPNVSEAYTFNGLPGPLYNCSANHTYKLKVKPGKTYLLRLINAALNDELFFSIANHTF  254

Query  855   TVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTT  1034
             TVVE DA YVKPF TN+++ITPGQTTNVLLKT    PNA++ + ARPY TG   FDN+T 
Sbjct  255   TVVEVDATYVKPFETNLLVITPGQTTNVLLKTKPIAPNASFYMLARPYFTGQGTFDNTTV  314

Query  1035  AGILEYstnsnktttnkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRR  1214
             AGILEY T+SN T       F PTLP  N T+   NFT+KLRSLAN+ FP NVP+ VD+ 
Sbjct  315   AGILEYETSSNSTA------FKPTLPPINATNAVANFTRKLRSLANSQFPVNVPQTVDKT  368

Query  1215  FFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADF  1394
             FFFTVGLG  PCP+NQTCQGP N TKFAASVNNIS   P+TALLQ++FF +S GV+T+DF
Sbjct  369   FFFTVGLGNSPCPKNQTCQGP-NGTKFAASVNNISMALPSTALLQSYFFKKSNGVFTSDF  427

Query  1395  PANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFF  1574
             P++P   FNYTG PP N  V + TK+V L FN+SVE+VMQ TSI+GAESHPLH+HGFNF+
Sbjct  428   PSSPLHPFNYTGTPPNNTFVANGTKLVVLPFNTSVEVVMQGTSILGAESHPLHIHGFNFY  487

Query  1575  VIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTS  1754
             V+G+GFGN+DPN DP  FNLVDP ERNTVGVPSGGWVAIRF ADNPG WFMHCH +VH S
Sbjct  488   VVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPSGGWVAIRFHADNPGVWFMHCHFDVHLS  547

Query  1755  WGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WGL+MAWIV+DG    QKL PPP+DLPKC
Sbjct  548   WGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_009407501.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=574

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/549 (72%), Positives = 461/549 (84%), Gaps = 2/549 (0%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             +G TRHYKFDI ++NVTRLC+TKSIVTVNG FPGP+I+AREGDRVVVKVVNHV+ N+TIH
Sbjct  28    SGATRHYKFDITLRNVTRLCKTKSIVTVNGEFPGPKIVAREGDRVVVKVVNHVENNITIH  87

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQLRSGWADGP +ITQC IQTG+SYVYNFT+ GQRGT +WHAH SWLRAT+YG ++
Sbjct  88    WHGIRQLRSGWADGPEHITQCAIQTGRSYVYNFTLAGQRGTFWWHAHASWLRATVYGALI  147

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK GV YPFP+P+KEVPIIFGEW+ AD E +I+QA QTG  PN+SDA+TINGLPG LY
Sbjct  148   ILPKPGVPYPFPKPYKEVPIIFGEWFNADPEAVIAQALQTGAGPNVSDAYTINGLPGRLY  207

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS KD+FKLKVK GKTYLLRLINAALNDELFFSIANH++TVVE DA YVKPF+ + VL+
Sbjct  208   NCSGKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTVTVVETDANYVKPFDADTVLV  267

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYstnsnktttnkLPL  1094
             TPGQTTNVLL      PNA +L +ARPYATG   FDN+TTAG+LEY  N   + + KLPL
Sbjct  268   TPGQTTNVLLHAKPTFPNAAFLFAARPYATGQGTFDNTTTAGVLEY-RNPIGSGSTKLPL  326

Query  1095  FTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQG  1274
               P LP  NDT++ATNF+ KLRSLA+A +PANVP+ VD+RF+FTVGLG  PCP NQTCQG
Sbjct  327   LRPALPSLNDTAYATNFSSKLRSLADARYPANVPRTVDQRFYFTVGLGADPCPANQTCQG  386

Query  1275  PTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPPTNIMV  1454
             P+  TKFAAS+NN+SF  P+TALLQAH+  +S GVYT DFP NPP  FNYTG  P N  V
Sbjct  387   PS-GTKFAASINNVSFAFPSTALLQAHYLARSYGVYTTDFPNNPPSPFNYTGTAPNNTFV  445

Query  1455  TSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNL  1634
             +  TKVV L FN+SVE+VMQDTSI+GAE+HP+HLHG NF+V+G GFGNYDP  DP KFNL
Sbjct  446   SHGTKVVVLPFNTSVEVVMQDTSILGAENHPMHLHGHNFYVVGTGFGNYDPMNDPPKFNL  505

Query  1635  VDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQ  1814
             VDP E+NTVGVP+GGW+AIRFLADNPGAW MHCH++VH SWGL+MAW+V DG    QKL 
Sbjct  506   VDPVEKNTVGVPAGGWLAIRFLADNPGAWLMHCHIDVHLSWGLRMAWLVNDGALPTQKLP  565

Query  1815  PPPADLPKC  1841
             PPP+DLP+C
Sbjct  566   PPPSDLPRC  574



>ref|XP_006846275.1| hypothetical protein AMTR_s00012p00248430 [Amborella trichopoda]
 gb|ERN07950.1| hypothetical protein AMTR_s00012p00248430 [Amborella trichopoda]
Length=580

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/581 (69%), Positives = 468/581 (81%), Gaps = 4/581 (1%)
 Frame = +3

Query  108   MVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNGR  287
             M   F+   I+ +L  F  +     L + A ITR Y F++++QN+TRLC+TK ++TVNG+
Sbjct  1     MAAFFSSVAIVLILCTFSTLGFAPGLTE-ASITRRYTFNVRLQNITRLCRTKQVITVNGK  59

Query  288   FPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVY  467
              PGP+I+AREGD+V+VKVVN V  NVTIHWHGVRQL++GW+DGPAYITQCPIQTGQSY Y
Sbjct  60    VPGPKIVAREGDQVLVKVVNRVSNNVTIHWHGVRQLQTGWSDGPAYITQCPIQTGQSYTY  119

Query  468   NFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADTE  647
             NFTI GQRGTLFWHAH+SWLRAT+YGP VILPK GV YPFP+P KE+PI+ GEWW ADTE
Sbjct  120   NFTIIGQRGTLFWHAHVSWLRATIYGPFVILPKIGVPYPFPKPHKEIPIVLGEWWTADTE  179

Query  648   RIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDEL  827
              IISQA QTGG PNISD++TING PG LYNCSAKD+FKL V+ GKT+LLR+INAALN EL
Sbjct  180   AIISQALQTGGGPNISDSYTINGHPGALYNCSAKDTFKLGVRPGKTFLLRIINAALNAEL  239

Query  828   FFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYATG  1007
             FFSIANHSLTVVE DA+YVKPF TN VLITPGQTTNVLL    +  NAT+ I+ARPY TG
Sbjct  240   FFSIANHSLTVVEVDAIYVKPFTTNTVLITPGQTTNVLLTVKPNPTNATFAIAARPYVTG  299

Query  1008  PAPFDNSTTAGILEYstnsnktttnkLPLF---TPTLPVFNDTSFATNFTKKLRSLANAN  1178
                 DNSTT GIL Y  +S   ++  +P F    P+LP  NDT+FATNF+++LRSLA+  
Sbjct  300   RGASDNSTTTGILHYHNSSLSNSSISVPKFPLLLPSLPSLNDTNFATNFSRRLRSLASNQ  359

Query  1179  FPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHF  1358
             FPANVP+KVD+RF FTVGLG  PCP+NQTCQGP N TKFAAS+NN+SF  PTTALLQAHF
Sbjct  360   FPANVPQKVDKRFLFTVGLGTNPCPKNQTCQGPNNATKFAASINNVSFSLPTTALLQAHF  419

Query  1359  FNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAE  1538
             F QS GVY  DFP NPP KFNYTG PP N  V++ T+V  L FN+ VELV+QDT I+  E
Sbjct  420   FGQSAGVYRTDFPDNPPNKFNYTGMPPNNTNVSNGTRVEVLEFNTRVELVLQDTGILWVE  479

Query  1539  SHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGA  1718
             SHPLHLHGFNFFV+GQGFGNY+P+ DP+ FNLVDP ERNT+GVPSGGWVA+RFLADNPG 
Sbjct  480   SHPLHLHGFNFFVVGQGFGNYNPSTDPANFNLVDPVERNTIGVPSGGWVALRFLADNPGV  539

Query  1719  WFMHCHLEVHTSWGLKMAWIVMDGKGRKQKLQPPPADLPKC  1841
             WFMHCH+E H SWGL+MAW+V DGK   QKL PPP+ LP C
Sbjct  540   WFMHCHIEAHISWGLRMAWVVNDGKLPNQKLLPPPSHLPAC  580



>ref|XP_007208011.1| hypothetical protein PRUPE_ppa003319mg [Prunus persica]
 gb|EMJ09210.1| hypothetical protein PRUPE_ppa003319mg [Prunus persica]
Length=585

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/557 (71%), Positives = 456/557 (82%), Gaps = 9/557 (2%)
 Frame = +3

Query  195   AGITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIH  374
             AG TRHY F+I+  NVTRLC T+SI++VNG+FPGPR++AREGD+V++KVVNHV  N+TIH
Sbjct  30    AGKTRHYTFNIEYHNVTRLCNTRSILSVNGKFPGPRLVAREGDQVLIKVVNHVSNNITIH  89

Query  375   WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIV  554
             WHG+RQL++GWADGPAYITQCPIQTGQ+Y YNFTITGQRGTL WHAHISWLR+TL+GPI+
Sbjct  90    WHGIRQLQTGWADGPAYITQCPIQTGQAYTYNFTITGQRGTLLWHAHISWLRSTLHGPII  149

Query  555   ILPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLY  734
             ILPK+  +YPF +P+KEVPII GEW+  D E +ISQA QTG  PN+SDA+TINGLPGPLY
Sbjct  150   ILPKRNESYPFVKPYKEVPIILGEWFNVDPEAVISQALQTGAGPNVSDAYTINGLPGPLY  209

Query  735   NCSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLI  914
             NCS++D FKLKVK GKTYLLRLINAALNDELFFSIANHSLTVVEADAVY KPF T+I+LI
Sbjct  210   NCSSRDVFKLKVKPGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYTKPFETDILLI  269

Query  915   TPGQTTNVLLKTTTHHPNATYLISARPYATGPAPFDNSTTAGILEYs--tnsnktttnkL  1088
              PGQTTN+LLKT    PNAT+LI ARPY TG    DN+TTAGILEY     ++ T+   L
Sbjct  270   APGQTTNILLKTKPTSPNATFLILARPYFTGGGTLDNTTTAGILEYKHPNTTHHTSIKAL  329

Query  1089  PLFTPTLPVFNDTSFAT------NFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPC  1250
             PLF P+LP  N T F        N  KK RSLA   FPANVP+ VDRRFFFT+GLG  PC
Sbjct  330   PLFRPSLPPINATKFVNVTQFVENLAKKFRSLATKQFPANVPQTVDRRFFFTLGLGTSPC  389

Query  1251  PQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTG  1430
             PQN TCQGP N  KFAASVNN SF  P+TA+LQAHF  QS GVYT DFP  P V FNYTG
Sbjct  390   PQNSTCQGP-NGLKFAASVNNFSFALPSTAMLQAHFSGQSSGVYTTDFPTKPLVAFNYTG  448

Query  1431  NPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPN  1610
              PP    V++ATK V L FN+SVELV+QDTSI+GAESHPLHLHG+NFF++G GFGNYDP 
Sbjct  449   TPPNITNVSNATKAVVLPFNTSVELVLQDTSILGAESHPLHLHGYNFFIVGLGFGNYDPT  508

Query  1611  KDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDG  1790
             KDP+ FNLVDPAERNT GVP+GGW+AIRF ADNPG WFMHCHL++HTSWGL+MAWIV DG
Sbjct  509   KDPANFNLVDPAERNTAGVPAGGWIAIRFFADNPGVWFMHCHLDIHTSWGLRMAWIVQDG  568

Query  1791  KGRKQKLQPPPADLPKC  1841
                 QKL PPP+DLP+C
Sbjct  569   PQPNQKLPPPPSDLPQC  585



>ref|XP_006586249.1| PREDICTED: laccase-17-like isoform X2 [Glycine max]
Length=560

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/540 (74%), Positives = 455/540 (84%), Gaps = 4/540 (1%)
 Frame = +3

Query  105   MMVCLFAKRFIIFVLAAFCWVSGDVALAKHAGITRHYKFDIKMQNVTRLCQTKSIVTVNG  284
             M +  F     IF+ +   W+  ++ LAKHA ITRHY F++++QNVTRLCQTKSIVT+NG
Sbjct  1     MELASFCSLRAIFLFSCALWIMPELTLAKHAKITRHYNFNVQLQNVTRLCQTKSIVTING  60

Query  285   RFPGPRIIAREGDRvvvkvvnhvkynvTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYV  464
             RFPGPR+IAREGDR+V+KV N+V YNVTIHWHGVRQLRS WADGPAY+TQCPIQTGQ++V
Sbjct  61    RFPGPRVIAREGDRLVIKVTNNVPYNVTIHWHGVRQLRSAWADGPAYVTQCPIQTGQTFV  120

Query  465   YNFTITGQRGTLFWHAHISWLRATLYGPIVILPKKGVAYPFPQPFKEVPIIFGEWWKADT  644
             YNFT+TGQRGTL+WHAHISWLR TLYGPIVILPKK V YPFPQ FKEVPIIFGEWWKADT
Sbjct  121   YNFTVTGQRGTLWWHAHISWLRTTLYGPIVILPKKHVPYPFPQTFKEVPIIFGEWWKADT  180

Query  645   ERIISQASQTGGAPNISDAFTINGLPGPLYNCSAKDSFKLKVKAGKTYLLRLINAALNDE  824
             E +I+QA QTG APN+S+A+TING PG LYN + KD+FKLKVKAGKTYLLRLINAALN+E
Sbjct  181   ETVINQAMQTGLAPNLSNAYTINGFPGFLYNGTTKDTFKLKVKAGKTYLLRLINAALNNE  240

Query  825   LFFSIANHSLTVVEADAVYVKPFNTNIVLITPGQTTNVLLKTTTHHPNATYLISARPYAT  1004
             LFF IANH+LTVVEADAVYVKPF TN VLITPGQT NVLLKT +  PNA ++I+ARPYAT
Sbjct  241   LFFGIANHTLTVVEADAVYVKPFRTNYVLITPGQTINVLLKTKSKAPNAAFVIAARPYAT  300

Query  1005  GPAPFDNSTTAGILEYstnsnktttn---kLPLFTPTLPVFNDTSFATNFTKKLRSLANA  1175
             GPA FDN+T  G+LEY  +S   T     KL L  P LP FNDT FA  F KK+RSLANA
Sbjct  301   GPAAFDNTTATGLLEYKKSSVSNTKTKNKKLRLLRPVLPKFNDTIFAMKFNKKVRSLANA  360

Query  1176  NFPANVPKKVDRRFFFTVGLGVIPCPQNQTCQGPTNNTKFAASVNNISFVQPTTALLQAH  1355
              FPA VPK VD+ FFFTVGLG+  CP+NQ CQGP NNT+  A+VNN+SFV P  ALLQAH
Sbjct  361   RFPAKVPKTVDKHFFFTVGLGISSCPKNQACQGP-NNTRVTAAVNNVSFVMPNIALLQAH  419

Query  1356  FFNQSKGVYTADFPANPPVKFNYTGNPPTNIMVTSATKVVQLSFNSSVELVMQDTSIIGA  1535
             FFN+SKGVYT DFPANPP +FNYTG PP NIM++S TK V L FN+SVEL++QDTSIIGA
Sbjct  420   FFNKSKGVYTTDFPANPPFRFNYTGTPPNNIMISSGTKAVVLPFNASVELILQDTSIIGA  479

Query  1536  ESHPLHLHGFNFFVIGQGFGNYDPNKDPSKFNLVDPAERNTVGVPSGGWVAIRFLADNPG  1715
             ESHPLHLHGFNFFV+GQG GN+DP KDPSKFNLVDPAERNT+GVPSGGWVA+RF ADNPG
Sbjct  480   ESHPLHLHGFNFFVVGQGNGNFDPKKDPSKFNLVDPAERNTIGVPSGGWVAVRFFADNPG  539



>gb|AFW84624.1| putative laccase family protein [Zea mays]
Length=584

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/554 (70%), Positives = 452/554 (82%), Gaps = 6/554 (1%)
 Frame = +3

Query  198   GITRHYKFDIKMQNVTRLCQTKSIVTVNGRFPGPRIIAREGDRvvvkvvnhvkynvTIHW  377
             GITRHY F++ M NVTRLC TKSIVTVNG+FPGP+I+AREGDR++++V N  ++N+++HW
Sbjct  31    GITRHYDFNVTMANVTRLCATKSIVTVNGQFPGPKIVAREGDRLIIRVTNQAQHNISLHW  90

Query  378   HGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVI  557
             HG+RQLR+GWADGPAYITQCPIQTGQSYVYN+T+ GQRGTL+WHAHISWLRAT+YGP+V+
Sbjct  91    HGIRQLRTGWADGPAYITQCPIQTGQSYVYNYTVAGQRGTLWWHAHISWLRATVYGPLVV  150

Query  558   LPKKGVAYPFPQPFKEVPIIFGEWWKADTERIISQASQTGGAPNISDAFTINGLPGPLYN  737
             LP+ GV YPFP P+KEVP+IFGEWW ADTE ++ QA Q G  PN+SDA TINGLPGPLYN
Sbjct  151   LPRPGVPYPFPAPYKEVPVIFGEWWLADTEVVVEQALQLGAGPNVSDAHTINGLPGPLYN  210

Query  738   CSAKDSFKLKVKAGKTYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFNTNIVLIT  917
             CSAKD++KLKVK GKTY+LRLINAALNDELFFS+ANHSLTVVE DAVYVKPF  + + I 
Sbjct  211   CSAKDTYKLKVKPGKTYMLRLINAALNDELFFSVANHSLTVVEVDAVYVKPFTVDTLPIA  270

Query  918   PGQTTNVLLKTTTHHPNATYLISARPYATG-PAPFDNSTTAGILEYs-----tnsnkttt  1079
             PGQTTNVLL     +P A Y +SA+PY+T  PA FDN+T AGILEY      ++S  +  
Sbjct  271   PGQTTNVLLAAKPFYPGANYYMSAKPYSTARPATFDNTTVAGILEYEYPDAPSSSAASFD  330

Query  1080  nkLPLFTPTLPVFNDTSFATNFTKKLRSLANANFPANVPKKVDRRFFFTVGLGVIPCPQN  1259
               LPL  PTLP  NDTSF  NFT KLRSLA   +PA VP+ VDR FFFTVGLG  PCP N
Sbjct  331   KALPLHRPTLPQLNDTSFVGNFTAKLRSLATPQYPAAVPRTVDRAFFFTVGLGTHPCPGN  390

Query  1260  QTCQGPTNNTKFAASVNNISFVQPTTALLQAHFFNQSKGVYTADFPANPPVKFNYTGNPP  1439
              TC GPTN T+FAA+VNN+SFV PT ALL +HF   S GVY++DFP  P   FNYTG PP
Sbjct  391   ATCLGPTNTTQFAAAVNNVSFVLPTRALLHSHFAGLSSGVYSSDFPVAPLTPFNYTGTPP  450

Query  1440  TNIMVTSATKVVQLSFNSSVELVMQDTSIIGAESHPLHLHGFNFFVIGQGFGNYDPNKDP  1619
              N  V S TK++ + + ++VELV+Q TSI+G ESHPLHLHGFNFFV+GQG+GNYDP  DP
Sbjct  451   NNTNVASGTKLMVVPYGANVELVLQGTSILGVESHPLHLHGFNFFVVGQGYGNYDPVNDP  510

Query  1620  SKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFMHCHLEVHTSWGLKMAWIVMDGKGR  1799
              KFNLVDP ERNTVGVP+GGWVAIRFLADNPG WFMHCHLEVHT+WGL+MAW+V+DG   
Sbjct  511   PKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTTWGLRMAWLVLDGSLP  570

Query  1800  KQKLQPPPADLPKC  1841
              QKL PPP+DLPKC
Sbjct  571   HQKLLPPPSDLPKC  584



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6220794396204