BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24718_g2_i1 len=376 path=[2565:0-325 188:326-375]

Length=376
                                                                      Score     E

gb|AAS65426.1|  Kunitz-type trypsin inhibitor                           102   3e-25   Ipomoea batatas [batate]
ref|XP_003628979.1|  Defensin                                         87.4    1e-19   
emb|CDP10468.1|  unnamed protein product                              85.1    1e-18   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            84.0    3e-18   
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            81.6    2e-17   
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            81.3    3e-17   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  80.5    7e-17   Capsicum annuum
ref|XP_003628978.1|  Defensin                                         80.1    7e-17   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      79.7    1e-16   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      79.3    1e-16   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    79.3    2e-16   Vitis vinifera
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          79.3    2e-16   
ref|XP_003629332.1|  Defensin                                         79.0    2e-16   
dbj|BAA95697.1|  thionin like protein                                 79.0    3e-16   Nicotiana tabacum [American tobacco]
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 78.6    3e-16   
gb|AFW90621.1|  protease inhibitor-related protein                    77.8    6e-16   
gb|ACJ26760.1|  protease inhibitor-related protein                    77.4    7e-16   Solanum tuberosum [potatoes]
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            77.0    1e-15   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          77.0    1e-15   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            77.0    1e-15   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            77.0    1e-15   
gb|AIT42148.1|  defensin-like protein                                 76.6    1e-15   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               76.3    2e-15   
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            76.3    2e-15   
ref|NP_001048853.1|  Os03g0130300                                     76.3    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  75.5    5e-15   
gb|AIT42153.1|  defensin-like protein                                 75.1    6e-15   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 75.1    6e-15   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    74.7    7e-15   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    74.7    9e-15   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 74.3    1e-14   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    74.3    1e-14   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       74.3    1e-14   
gb|AIT42152.1|  defensin-like protein                                 74.3    1e-14   
gb|ACN93800.1|  defensin precursor                                    74.3    1e-14   Vigna unguiculata
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               74.3    1e-14   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    74.3    1e-14   
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  73.6    1e-14   Spinacia oleracea
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           74.3    1e-14   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  73.9    2e-14   Solanum tuberosum [potatoes]
gb|AIT42149.1|  defensin-like protein                                 73.9    2e-14   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           73.9    2e-14   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            73.9    2e-14   
gb|AIT42147.1|  defensin-like protein                                 73.6    2e-14   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 73.6    2e-14   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  73.6    3e-14   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  73.6    3e-14   Petunia integrifolia [violet-flowered petunia]
gb|AIT42150.1|  defensin-like protein                                 72.4    5e-14   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               72.4    6e-14   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        72.4    8e-14   Sorghum bicolor [broomcorn]
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         72.0    8e-14   
ref|XP_003599384.1|  Defensin                                         72.0    9e-14   
emb|CAH58740.1|  defensin                                             72.0    9e-14   Plantago major [cart-track plant]
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    71.6    1e-13   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               71.2    1e-13   
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    71.2    2e-13   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 71.2    2e-13   
dbj|BAK07043.1|  predicted protein                                    71.6    2e-13   
gb|ABK23404.1|  unknown                                               71.2    2e-13   Picea sitchensis
gb|EAY86781.1|  hypothetical protein OsI_08161                        75.9    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            71.2    2e-13   
gb|ACV84379.1|  defensin precursor                                    71.2    2e-13   Triticum aestivum [Canadian hard winter wheat]
gb|ACB32234.1|  gamma-thionin/defensin                                70.9    2e-13   Solanum chacoense
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               70.9    2e-13   
gb|ADK87340.1|  defensin                                              70.9    2e-13   
gb|KHN06998.1|  Defensin-like protein                                 70.9    3e-13   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              70.5    3e-13   
gb|AAL85480.1|  defensin protein 1                                    70.5    3e-13   Prunus persica
gb|ABO36637.1|  defensin protein                                      70.1    5e-13   Solanum lycopersicum
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         70.1    5e-13   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        70.1    5e-13   Sorghum bicolor [broomcorn]
emb|CAA62761.1|  putative gamma-thionin protein                       70.1    5e-13   Picea abies
gb|ABO36641.1|  defensin protein                                      70.1    5e-13   Solanum pimpinellifolium [currant tomato]
ref|NP_001234872.1|  gamma-thionin precursor                          69.7    5e-13   
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      69.7    6e-13   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       69.7    6e-13   
gb|ABK25062.1|  unknown                                               69.7    7e-13   Picea sitchensis
gb|AFK44299.1|  unknown                                               69.7    7e-13   
ref|XP_003630421.1|  Defensin                                         68.9    1e-12   
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  69.3    1e-12   
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       68.9    1e-12   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       68.9    1e-12   
gb|KEH35661.1|  Defensin                                              68.9    1e-12   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               68.9    1e-12   
ref|XP_003628977.1|  Defensin                                         68.6    2e-12   
ref|XP_002325734.2|  defensin-like family protein                     68.6    2e-12   Populus trichocarpa [western balsam poplar]
ref|NP_178320.1|  defensin-like protein 4                             68.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  68.2    3e-12   Capsicum annuum
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            68.2    3e-12   
gb|AFD01290.1|  defensin 3                                            68.2    3e-12   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               67.8    3e-12   
ref|XP_002886566.1|  protease inhibitor II                            67.8    3e-12   
ref|NP_176302.2|  defensin-like protein                               67.8    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               67.8    3e-12   
gb|AFE88173.1|  g-thionin                                             67.8    4e-12   
gb|EMS65297.1|  Defensin SD2                                          67.8    4e-12   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           67.8    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            68.9    4e-12   
gb|ABK28445.1|  unknown                                               67.8    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    67.4    4e-12   
gb|EMS65298.1|  Defensin-like protein 1                               67.8    4e-12   
gb|KHN23780.1|  Defensin SD2                                          67.4    5e-12   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      67.4    5e-12   Castanea sativa
dbj|BAK07823.1|  predicted protein                                    68.2    5e-12   
ref|NP_001234987.1|  protease inhibitor precursor                     67.4    6e-12   
ref|NP_001047493.1|  Os02g0629800                                     67.4    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           67.4    6e-12   
gb|ABS72000.1|  putative defensin protein 1                           66.6    6e-12   Olea europaea
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               67.0    6e-12   
gb|AIA67004.1|  defensin                                              67.4    7e-12   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               67.0    8e-12   
gb|AAL14240.1|  proteinase inhibitor                                  65.9    1e-11   Musa acuminata [banana]
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        66.6    1e-11   Sorghum bicolor [broomcorn]
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    66.6    1e-11   
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        66.6    1e-11   Sorghum bicolor [broomcorn]
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   67.0    1e-11   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       66.6    1e-11   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 66.6    1e-11   Jatropha curcas
gb|ABK93231.1|  unknown                                               66.2    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               66.2    1e-11   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           66.2    1e-11   
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    66.2    1e-11   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               66.2    1e-11   
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     66.2    2e-11   
gb|EEC76838.1|  hypothetical protein OsI_14993                        65.9    2e-11   Oryza sativa Indica Group [Indian rice]
gb|AIA67012.1|  defensin                                              66.2    2e-11   
ref|NP_001052199.1|  Os04g0189400                                     66.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  66.2    2e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EMT00351.1|  Defensin-like protein                                 65.9    2e-11   
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  65.9    2e-11   Ricinus communis
gb|EMT11359.1|  Defensin-like protein P322                            65.9    2e-11   
gb|EMT03364.1|  Defensin SD2                                          65.9    2e-11   
gb|AGT51229.1|  defensin                                              65.5    2e-11   
gb|ACS96442.1|  defensin                                              65.5    2e-11   Jatropha curcas
ref|XP_010088525.1|  Defensin-like protein 2                          65.5    3e-11   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 65.5    3e-11   
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     65.1    3e-11   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    65.1    3e-11   
ref|XP_003630422.1|  Defensin                                         65.1    3e-11   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             65.1    3e-11   
gb|EMT18782.1|  Defensin-like protein                                 69.3    3e-11   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               65.1    3e-11   
gb|ACV84384.1|  defensin precursor                                    65.1    3e-11   Triticum turgidum subsp. durum
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               65.1    4e-11   
gb|EMS49334.1|  Defensin-like protein                                 65.1    4e-11   
gb|AAM62652.1|  protease inhibitor II                                 64.7    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           66.2    5e-11   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               64.7    5e-11   
gb|AGC82207.1|  defensin                                              64.7    5e-11   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           64.7    5e-11   
emb|CDP10467.1|  unnamed protein product                              65.1    6e-11   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  64.7    6e-11   Helianthus annuus
ref|NP_178319.1|  defensin-like protein 2                             64.3    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045354.1|  Defensin-like protein isoform 2                  64.3    7e-11   
gb|AAR84643.1|  defensin                                              64.3    7e-11   Picea glauca
gb|ABA81896.1|  putative defensin                                     64.3    7e-11   Aquilegia formosa
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 64.3    7e-11   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           64.3    7e-11   
gb|AIA67014.1|  defensin                                              63.9    8e-11   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  63.9    1e-10   
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               63.9    1e-10   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               63.9    1e-10   
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               63.2    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48618.1|  BnaC09g20670D                                        63.5    1e-10   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           63.5    2e-10   
gb|ABK21016.1|  unknown                                               63.5    2e-10   Picea sitchensis
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           63.2    2e-10   
gb|AIA67010.1|  defensin                                              63.5    2e-10   
emb|CEJ09690.1|  Defensin protein                                     63.2    2e-10   
gb|ABK23037.1|  unknown                                               63.2    2e-10   Picea sitchensis
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  63.2    2e-10   
gb|EMT03365.1|  Defensin-like protein 1                               63.2    2e-10   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      63.2    2e-10   
gb|AHA50470.1|  defensin-like protein 1                               62.8    2e-10   
gb|AIA67015.1|  defensin                                              62.8    2e-10   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           62.8    2e-10   
gb|AAS13434.1|  defensin                                              62.4    3e-10   Nicotiana attenuata
gb|ACV84383.1|  defensin precursor                                    63.2    3e-10   Triticum turgidum subsp. durum
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               62.4    3e-10   
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            62.8    3e-10   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          62.8    3e-10   
gb|ABK20960.1|  unknown                                               62.8    3e-10   Picea sitchensis
gb|AHA50472.1|  defensin-like protein 5                               62.4    3e-10   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    62.0    3e-10   
gb|AIA66989.1|  defensin                                              62.8    3e-10   
gb|EMT30046.1|  Defensin-like protein P322                            62.4    3e-10   
ref|NP_178321.1|  defensin-like protein 1                             62.4    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             62.4    4e-10   
gb|AIA67009.1|  defensin                                              62.4    4e-10   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           62.4    4e-10   
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    62.0    4e-10   Vitis vinifera
ref|NP_001148158.1|  LOC100281766 precursor                           62.0    5e-10   Zea mays [maize]
gb|AGT51228.1|  defensin                                              62.0    5e-10   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               62.0    5e-10   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               62.0    5e-10   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               62.0    5e-10   
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    62.0    5e-10   
gb|ABA86586.1|  putative defensin 1                                   61.6    5e-10   Aquilegia formosa
gb|ADK36631.1|  defensin-like protein                                 61.2    6e-10   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           62.0    6e-10   
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  61.6    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ADQ43196.1|  unknown                                               61.6    6e-10   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               61.6    6e-10   
gb|KHN09675.1|  Defensin-like protein                                 61.2    7e-10   
gb|AIA66999.1|  defensin                                              61.6    7e-10   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  61.6    8e-10   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  61.2    8e-10   Glycine max [soybeans]
gb|KHN16909.1|  Defensin J1-2                                         61.6    8e-10   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               61.2    9e-10   
gb|EMT26158.1|  Defensin-like protein                                 61.2    1e-09   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            61.2    1e-09   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               61.2    1e-09   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   61.2    1e-09   Vitis vinifera
emb|CDM85870.1|  unnamed protein product                              61.2    1e-09   
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    61.2    1e-09   
gb|AFK47422.1|  unknown                                               60.8    1e-09   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     61.6    1e-09   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  60.8    1e-09   Capsicum annuum
sp|A4L7R8.1|DEF2_PINSY  RecName: Full=Defensin-2; Flags: Precursor    61.2    1e-09   Pinus sylvestris [Scotch pine]
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           60.8    1e-09   
gb|ACV84381.1|  defensin precursor                                    61.2    1e-09   Triticum turgidum subsp. durum
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  61.2    1e-09   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  60.8    1e-09   Zea mays [maize]
ref|NP_001149230.1|  LOC100282852 precursor                           60.8    1e-09   Zea mays [maize]
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           60.8    1e-09   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            60.8    1e-09   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           60.8    1e-09   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    60.8    1e-09   
gb|AIA67000.1|  defensin                                              60.8    1e-09   
gb|AAU04859.1|  defensin precursor                                    60.8    2e-09   Ginkgo biloba [ginkgo]
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               60.5    2e-09   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    60.5    2e-09   
gb|AHA50471.1|  defensin-like protein 4                               60.5    2e-09   
gb|ACV84382.1|  defensin precursor                                    60.8    2e-09   Triticum turgidum subsp. durum
gb|ABA86587.1|  putative defensin 1                                   60.5    2e-09   Aquilegia chrysantha
gb|AIA67013.1|  defensin                                              60.5    2e-09   
dbj|BAK07467.1|  predicted protein                                    60.5    2e-09   
sp|A4L7R7.1|DEF1_PINSY  RecName: Full=Defensin-1; Flags: Precursor    60.5    2e-09   Pinus sylvestris [Scotch pine]
gb|ABX84377.1|  amylase inhibitor-like protein                        60.5    2e-09   Triticum aestivum [Canadian hard winter wheat]
gb|AAN40688.1|  putative plant defensin SPI1B                         60.5    2e-09   Picea abies
gb|ABA86589.1|  putative defensin 1                                   60.1    2e-09   Aquilegia pyrenaica
gb|ABX84378.1|  amylase inhibitor-like protein                        60.5    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               60.5    2e-09   
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    60.1    2e-09   
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           60.5    2e-09   
dbj|BAK06284.1|  predicted protein                                    60.5    2e-09   
gb|AIC35288.1|  defensin 4                                            60.1    3e-09   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           60.1    3e-09   
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  60.1    3e-09   Zea mays [maize]
ref|NP_001147001.1|  LOC100280611 precursor                           60.1    3e-09   Zea mays [maize]
gb|ACB20518.1|  defensin precursor                                    60.1    3e-09   Saccharum officinarum [noble cane]
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            60.1    3e-09   
gb|AIA66987.1|  defensin                                              60.1    3e-09   
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   59.7    3e-09   Torenia fournieri [bluewings]
gb|AHA50473.1|  defensin-like protein 6                               59.7    3e-09   
gb|KHG09995.1|  Defensin-like protein 1                               59.7    4e-09   
gb|ABM89231.1|  defensin                                              59.7    4e-09   Setaria italica
gb|AHA50468.1|  defensin-like protein 2                               59.7    4e-09   
gb|AGT51227.1|  defensin                                              59.7    4e-09   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          59.3    5e-09   
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              59.3    5e-09   
ref|XP_004306561.1|  PREDICTED: defensin D2-like                      59.3    5e-09   
gb|AAA91049.1|  protease inhibitor II                                 59.3    5e-09   Brassica rapa
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               59.3    5e-09   
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            59.3    5e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    59.3    6e-09   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        59.3    6e-09   Sorghum bicolor [broomcorn]
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               59.3    6e-09   
gb|ACV84385.1|  defensin precursor                                    58.9    6e-09   Triticum turgidum subsp. durum
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  58.9    7e-09   Zea mays [maize]
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               59.3    7e-09   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    58.5    8e-09   
gb|EMS53152.1|  Defensin-like protein 2                               58.5    8e-09   
gb|EMT16291.1|  Defensin SD2                                          58.9    8e-09   
dbj|BAB64929.1|  defensin-like protein                                58.9    9e-09   Pyrus pyrifolia [sha li]
ref|XP_002862935.1|  low-molecular-weight cysteine-rich 76            58.5    9e-09   
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               58.5    9e-09   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       58.5    1e-08   
dbj|BAC10287.1|  defensin                                             58.5    1e-08   Triticum aestivum [Canadian hard winter wheat]
gb|KHG06821.1|  Defensin-like protein                                 58.5    1e-08   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  59.3    1e-08   
emb|CAH65876.1|  OSIGBa0160I04.2                                      58.2    1e-08   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           57.8    1e-08   
emb|CEJ09689.1|  Defensin protein                                     58.2    2e-08   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            57.4    2e-08   
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               58.2    2e-08   
gb|AIA66992.1|  defensin                                              57.8    2e-08   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           57.8    2e-08   
dbj|BAJ86109.1|  predicted protein                                    57.8    2e-08   
gb|ADK91098.1|  PCP17C2                                               57.4    2e-08   
emb|CAD41436.1|  OSJNBa0019D11.21                                     57.8    2e-08   
gb|EMT03363.1|  hypothetical protein F775_43918                       57.8    2e-08   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  57.8    2e-08   
gb|AIA66994.1|  defensin                                              57.8    2e-08   
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            57.8    2e-08   
gb|AIA66993.1|  defensin                                              57.8    2e-08   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           57.4    2e-08   
gb|ACV84380.1|  defensin precursor                                    57.4    2e-08   
gb|ACM50880.1|  defensin                                              57.0    2e-08   
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           57.8    2e-08   
emb|CDY04774.1|  BnaC05g18150D                                        58.2    3e-08   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    57.4    3e-08   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               57.4    3e-08   
gb|EMT06279.1|  Defensin-like protein 2                               57.4    3e-08   
dbj|BAJ89304.1|  predicted protein                                    57.4    3e-08   
ref|XP_006466198.1|  PREDICTED: defensin-like protein 6-like          57.0    3e-08   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               57.0    3e-08   
ref|XP_009351648.1|  PREDICTED: defensin-like protein 1               57.4    3e-08   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             57.0    4e-08   
gb|AAG38520.1|AF283535_1  proteinase inhibitor se60-like protein      57.0    4e-08   
dbj|BAD25113.1|  hypothetical protein                                 57.4    4e-08   
sp|P86518.1|DEF1_ECHCG  RecName: Full=Defensin Ec-AMP-D1              56.2    4e-08   
gb|AFQ69079.1|  defensin precursor                                    56.6    4e-08   
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    56.6    5e-08   
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      56.2    5e-08   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  56.2    5e-08   
ref|XP_006384382.1|  hypothetical protein POPTR_0004s14520g           56.2    5e-08   
ref|XP_008669654.1|  PREDICTED: defensin Ec-AMP-D1-like               56.2    5e-08   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  56.2    6e-08   
ref|NP_001031460.1|  low-molecular-weight cysteine-rich 76            56.6    6e-08   
sp|P86519.1|DEF2_ECHCG  RecName: Full=Defensin Ec-AMP-D2              55.8    6e-08   
emb|CEJ09688.1|  Defensin protein                                     56.2    6e-08   
gb|EPS67569.1|  gamma-thionin                                         55.5    7e-08   
ref|XP_011070572.1|  PREDICTED: defensin J1-2-like                    55.8    7e-08   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  55.8    8e-08   
sp|P84965.1|DEF11_TRIKH  RecName: Full=Defensin Tk-AMP-D1.1           55.5    8e-08   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               56.2    8e-08   
gb|AEW08922.1|  hypothetical protein CL2287Contig1_03                 55.5    9e-08   
gb|AIA66990.1|  defensin                                              55.8    1e-07   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           55.8    1e-07   
ref|XP_006426420.1|  hypothetical protein CICLE_v10026887mg           55.5    1e-07   
ref|XP_006426419.1|  hypothetical protein CICLE_v10026887mg           55.5    1e-07   
gb|EYU27578.1|  hypothetical protein MIMGU_mgv1a026683mg              55.5    1e-07   
gb|ADQ43197.1|  unknown                                               55.5    1e-07   
ref|XP_008667949.1|  PREDICTED: LOC100281986 isoform X1               59.3    1e-07   
ref|NP_201171.1|  defensin-like protein 6                             55.1    2e-07   
emb|CAA65045.1|  defensin                                             55.1    2e-07   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             55.1    2e-07   
ref|XP_002446148.1|  hypothetical protein SORBIDRAFT_06g002510        55.1    2e-07   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           54.7    2e-07   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        55.1    2e-07   
gb|AIA67011.1|  defensin                                              54.7    2e-07   
gb|EMT11361.1|  Defensin Tk-AMP-D6                                    54.7    2e-07   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  54.7    2e-07   
gb|EMS54459.1|  Defensin Tk-AMP-D5                                    54.3    3e-07   
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               54.7    3e-07   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           54.7    3e-07   
ref|XP_008385108.1|  PREDICTED: defensin-like protein 2               54.7    3e-07   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           54.7    3e-07   
ref|XP_010229304.1|  PREDICTED: defensin Tk-AMP-D1.1-like             54.3    3e-07   
ref|NP_178322.1|  defensin-like protein 10                            53.9    4e-07   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               53.9    4e-07   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               54.3    4e-07   
emb|CDY39856.1|  BnaC02g42620D                                        53.9    4e-07   
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           53.9    4e-07   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               53.9    4e-07   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               53.9    5e-07   
dbj|BAB64931.1|  defensin-like protein                                53.9    5e-07   
ref|XP_010246429.1|  PREDICTED: defensin-like protein                 53.9    5e-07   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           53.9    5e-07   
gb|ADK91116.1|  PCP17C2                                               53.1    5e-07   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  53.9    5e-07   
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  54.7    5e-07   
gb|EMT03877.1|  Defensin Tk-AMP-D3                                    53.5    5e-07   
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   53.5    6e-07   
gb|AAW33979.1|  proteinase inhibitor SE60-like protein                53.1    6e-07   
ref|XP_010038383.1|  PREDICTED: uncharacterized protein LOC104426904  55.5    6e-07   
sp|P83399.1|DEF1_VIGUN  RecName: Full=Defensin-like protein 1; Al...  52.8    6e-07   
ref|XP_003581056.1|  PREDICTED: defensin Ec-AMP-D1-like               53.1    7e-07   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           53.5    8e-07   
gb|EMT19618.1|  hypothetical protein F775_43215                       52.8    8e-07   
sp|Q07502.1|DEF_SOYBN  RecName: Full=Defensin-like protein; AltNa...  53.1    8e-07   
gb|EMT32128.1|  Defensin-like protein                                 53.5    9e-07   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             53.1    9e-07   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              52.8    9e-07   
ref|XP_004242654.1|  PREDICTED: defensin-like protein                 53.5    1e-06   
gb|EMT02837.1|  Defensin J1-2                                         52.8    1e-06   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           52.8    1e-06   
ref|XP_011070575.1|  PREDICTED: defensin Ec-AMP-D2-like               52.8    1e-06   
ref|XP_004972594.1|  PREDICTED: defensin-like protein 21-like         52.8    1e-06   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               52.8    1e-06   
ref|NP_001148374.1|  LOC100281986 precursor                           52.4    1e-06   
sp|P84964.1|DEF12_TRIMO  RecName: Full=Defensin Tm-AMP-D1.2           52.0    1e-06   
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  52.4    1e-06   
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               52.4    1e-06   
gb|KDO61571.1|  hypothetical protein CISIN_1g029977mg                 53.5    2e-06   
gb|ABW99097.1|  defensin                                              52.0    2e-06   
emb|CDP16306.1|  unnamed protein product                              52.4    2e-06   
ref|XP_006422269.1|  hypothetical protein CICLE_v10005867mg           53.9    2e-06   
ref|NP_001147137.1|  LOC100280744 precursor                           52.4    2e-06   
sp|P84968.1|DEF2_TRIKH  RecName: Full=Defensin Tk-AMP-D2              51.6    2e-06   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             52.4    2e-06   
gb|EMS54457.1|  Defensin Tk-AMP-D4                                    52.0    2e-06   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               52.0    2e-06   
ref|XP_002864860.1|  predicted protein                                52.0    2e-06   
ref|XP_004975163.1|  PREDICTED: defensin-like protein-like            51.6    3e-06   
dbj|BAK04173.1|  predicted protein                                    52.0    3e-06   
gb|EMS62517.1|  Defensin SD2                                          51.6    3e-06   
dbj|BAK04559.1|  predicted protein                                    51.6    3e-06   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               51.6    3e-06   
ref|XP_009342667.1|  PREDICTED: defensin-like protein 2               51.6    4e-06   
ref|NP_001146997.1|  flower-specific gamma-thionin                    50.8    4e-06   
ref|XP_003581053.1|  PREDICTED: defensin Tk-AMP-D5-like               51.2    4e-06   
gb|KHN17432.1|  Defensin-like protein                                 50.8    4e-06   
gb|AIA67003.1|  defensin                                              50.8    5e-06   
ref|XP_004976260.1|  PREDICTED: defensin-like protein-like            50.8    5e-06   
emb|CAH65875.1|  OSIGBa0160I04.1                                      50.8    5e-06   
ref|XP_011070576.1|  PREDICTED: defensin Ec-AMP-D1-like               50.8    5e-06   
ref|XP_003525155.1|  PREDICTED: uncharacterized LOC100306228          50.8    5e-06   
ref|XP_008780828.1|  PREDICTED: defensin-like protein 1               50.8    5e-06   
gb|EAY84990.1|  hypothetical protein OsI_06352                        50.8    6e-06   
ref|XP_008387251.1|  PREDICTED: uncharacterized protein LOC103449700  53.9    6e-06   
ref|XP_004975165.1|  PREDICTED: defensin-like protein 2-like          50.8    7e-06   
ref|XP_011086331.1|  PREDICTED: putative defensin-like protein 3      51.2    7e-06   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               50.4    7e-06   
ref|XP_009137059.1|  PREDICTED: LOW QUALITY PROTEIN: defensin-lik...  50.1    7e-06   
sp|P84966.1|DEF5_TRIKH  RecName: Full=Defensin Tk-AMP-D5              49.7    8e-06   
gb|ADQ43198.1|  unknown                                               50.4    8e-06   
ref|XP_010497013.1|  PREDICTED: putative defensin-like protein 9      50.4    8e-06   
sp|P84963.1|DEF1_TRIKH  RecName: Full=Defensin Tk-AMP-D1              49.7    8e-06   
gb|ACU14316.1|  unknown                                               50.1    8e-06   
sp|P84969.1|DEF61_TRIKH  RecName: Full=Defensin Tk-AMP-D6.1           49.7    9e-06   
ref|XP_007213203.1|  hypothetical protein PRUPE_ppb011708mg           50.1    9e-06   
ref|XP_009598624.1|  PREDICTED: defensin-like protein                 50.4    9e-06   
gb|KFK33429.1|  hypothetical protein AALP_AA5G012100                  50.8    1e-05   
ref|XP_010245186.1|  PREDICTED: defensin-like protein 1               49.7    1e-05   
sp|P81573.1|DEFD7_SPIOL  RecName: Full=Defensin D7; AltName: Full...  48.9    1e-05   
ref|NP_001146981.1|  flower-specific gamma-thionin precursor          49.7    1e-05   
gb|ABF74600.1|  defensin precursor                                    49.3    2e-05   
dbj|BAD25507.1|  hypothetical protein                                 49.7    2e-05   
sp|Q8GTM0.1|DEF_NICAL  RecName: Full=Flower-specific defensin; Al...  49.3    2e-05   
gb|ACI02057.1|  fabatin precursor                                     48.9    3e-05   
gb|EPS59162.1|  defensin                                              48.9    3e-05   
ref|XP_006365640.1|  PREDICTED: defensin-like protein-like            49.3    3e-05   
sp|P21924.1|DEF2_SORBI  RecName: Full=Defensin-like protein 2; Al...  48.1    3e-05   
sp|P84967.1|DEF6_TRIKH  RecName: Full=Defensin Tk-AMP-D6              48.1    3e-05   
ref|XP_009793542.1|  PREDICTED: defensin-like protein                 48.9    4e-05   
gb|ABU40984.1|  putative flower-specific thionin                      48.9    4e-05   
ref|XP_004954814.1|  PREDICTED: defensin SD2-like                     48.5    4e-05   
dbj|BAD25504.1|  hypothetical protein                                 48.5    4e-05   
ref|XP_009793541.1|  PREDICTED: defensin-like protein                 48.5    4e-05   
ref|NP_001172824.1|  Os02g0172500                                     48.5    4e-05   
gb|EMT11360.1|  Defensin Tk-AMP-D4                                    48.1    4e-05   
ref|XP_004250638.1|  PREDICTED: defensin-like protein                 48.1    6e-05   
ref|XP_011099655.1|  PREDICTED: defensin-like protein 1               47.8    6e-05   
gb|AGT51230.1|  defensin                                              47.4    6e-05   
ref|XP_011086334.1|  PREDICTED: uncharacterized protein LOC105168097  48.5    7e-05   
ref|XP_010481691.1|  PREDICTED: putative defensin-like protein 9      47.4    8e-05   
ref|XP_002879355.1|  hypothetical protein ARALYDRAFT_482123           47.0    9e-05   
dbj|BAA21114.1|  gamma-thionin                                        47.8    9e-05   
sp|P84970.1|DEF3_TRIKH  RecName: Full=Defensin Tk-AMP-D3              46.6    1e-04   
ref|XP_002513755.1|  Low-molecular-weight cysteine-rich protein L...  47.0    1e-04   
gb|EYU45261.1|  hypothetical protein MIMGU_mgv1a019713mg              47.0    1e-04   
gb|AIC35289.1|  defensin 5.1                                          47.0    1e-04   
gb|KHN31219.1|  Defensin-like protein 1                               46.6    1e-04   
ref|XP_009608875.1|  PREDICTED: defensin-like protein                 47.4    1e-04   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               47.0    1e-04   
gb|EYU33797.1|  hypothetical protein MIMGU_mgv1a018660mg              47.8    1e-04   
ref|XP_009761334.1|  PREDICTED: uncharacterized protein LOC104213512  47.4    1e-04   
emb|CDO99915.1|  unnamed protein product                              47.0    1e-04   
ref|XP_006292097.1|  hypothetical protein CARUB_v10018292mg           47.0    1e-04   
sp|P81008.1|DEF1_MAIZE  RecName: Full=Defensin-like protein 1; Al...  46.2    2e-04   
sp|P81457.1|DEF2_VICFA  RecName: Full=Defensin-like protein 2; Al...  45.8    2e-04   
ref|XP_006395807.1|  hypothetical protein EUTSA_v10005233mg           46.2    2e-04   
ref|NP_001150374.1|  low-molecular-weight cysteine-rich protein L...  46.2    2e-04   
gb|EMS56168.1|  Defensin-like protein 6                               46.2    2e-04   
sp|P81456.1|DEF1_VICFA  RecName: Full=Defensin-like protein 1; Al...  45.8    2e-04   
gb|EYU27579.1|  hypothetical protein MIMGU_mgv1a023110mg              46.6    2e-04   
gb|ACQ90609.1|  defensin-like protein                                 46.2    2e-04   
ref|XP_009630513.1|  PREDICTED: defensin-like protein 1               46.6    3e-04   
ref|XP_010240717.1|  PREDICTED: uncharacterized protein LOC104585502  46.6    3e-04   
gb|KFK42022.1|  hypothetical protein AALP_AA2G202100                  45.8    3e-04   
ref|XP_006301576.1|  hypothetical protein CARUB_v10022014mg           45.8    3e-04   
ref|XP_006339360.1|  PREDICTED: defensin-like protein-like            46.2    3e-04   
gb|AEY84981.1|  defensin-like protein                                 45.8    4e-04   
sp|Q09198.1|DEF21_SORBI  RecName: Full=Defensin-like protein 21; ...  45.1    4e-04   
ref|XP_007214706.1|  hypothetical protein PRUPE_ppb018272mg           45.4    4e-04   
ref|XP_006390264.1|  hypothetical protein EUTSA_v10019399mg           45.4    4e-04   
sp|B5LZ79.1|DEF_GYMCO  RecName: Full=Defensin-like protein; AltNa...  45.4    5e-04   
gb|AIC35290.1|  defensin 5.2                                          45.1    5e-04   
ref|XP_004301463.1|  PREDICTED: defensin-like protein-like            45.1    5e-04   
ref|XP_006466199.1|  PREDICTED: defensin-like protein-like            45.1    5e-04   
ref|NP_001172823.1|  Os02g0171900                                     48.1    6e-04   
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               45.1    6e-04   
sp|P21925.2|DEF3_SORBI  RecName: Full=Defensin-like protein 3; Al...  44.3    6e-04   
gb|AAF72043.1|  defensin CUA1                                         44.3    7e-04   
ref|XP_004250637.1|  PREDICTED: defensin-like protein                 45.1    7e-04   
ref|XP_006390263.1|  hypothetical protein EUTSA_v10019399mg           44.7    8e-04   
ref|XP_002451983.1|  hypothetical protein SORBIDRAFT_04g012170        44.7    8e-04   
gb|AAF66592.1|  defensin                                              43.9    0.001   
ref|XP_006409770.1|  hypothetical protein EUTSA_v10017555mg           44.3    0.001   



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score =   102 bits (253),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FVMLFM TELG N I+VAEAR CE+ SSK+KG C RD NCA+VC TEGF  GDCKG RR 
Sbjct  14   FVMLFMATELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRR  73

Query  191  CICSKPC  171
            C C+KPC
Sbjct  74   CFCTKPC  80



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F +L + TE+G   I+VAEAR CETPS+ +KG+C  D NCASVC+TEGFP G C+G R+
Sbjct  13   VFFLLLVATEMG--PIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQ  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +MLFM+TE+  + + VAEAR CE+ S ++KG C R  NCA+VC+TEGFP G C G+RR
Sbjct  13   LLLMLFMSTEM--DPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGLRR  70

Query  194  SCICSKPC  171
             C CSKPC
Sbjct  71   RCFCSKPC  78



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  +LFM TE+G  TI  AEAR CE+ S +++G+C R+ NCA+VC TEGF  GDC+G+RR
Sbjct  13   LLAILFMATEMGPMTI--AEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGDCRGLRR  70

Query  194  SCICSKPC  171
             C C++PC
Sbjct  71   RCFCTRPC  78



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G  TI  AEAR+CE+ S +++G C R+ NCA+VC TEGF  GDC+G+RR
Sbjct  13   LLAMLVMATEMGPMTI--AEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGLRR  70

Query  194  SCICSKPC  171
             C C++PC
Sbjct  71   RCFCTRPC  78



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  +L M TE+G  TI  AEAR CE+ S ++KG C RD NCA+VC TEGF  GDC+G RR
Sbjct  13   LIALLVMATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRR  70

Query  194  SCICSKPC  171
             C C++PC
Sbjct  71   RCFCTRPC  78



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G   + + EAR CE+ S ++KG+C  + NCASVC+TEGF  GDC+G RR
Sbjct  13   LLAMLVMATEMG--PMRIVEARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGFRR  70

Query  194  SCICSKPC  171
             C C++PC
Sbjct  71   RCFCTRPC  78



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F +L + TE+G + +    AR CETPS+ +KG C  D NCASVC+TEGFP G CKG R+
Sbjct  13   VFFLLIVATEMGPSMV---AARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGFRQ  69

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  70   RCFCTKPC  77



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +M+   TE+G   I+VAEAR CE+ S ++KG+C  + NCASVC TEGFP G CKG+RR
Sbjct  14   LLLMVVFATEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRR  71

Query  194  SCICSKPC  171
             C C + C
Sbjct  72   RCFCLRNC  79



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +++F T E+G   I+VAEAR CE+ S ++KG+C  + NCASVC TEGFP G CKG+RR
Sbjct  15   LLMVVFATEEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRR  72

Query  194  SCICSKPC  171
             C C + C
Sbjct  73   RCFCLRNC  80



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L ++LFM TE+G    +VAEAR CE+ S ++KG C R  NCA+VC+TEGF  G+C+G RR
Sbjct  13   LVILLFMATEMG---PMVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -3

Query  368  VMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSC  189
            ++L + T +G N  +VAEAR CET S K+KG C R+ NCASVC+TEGF  GDC+G+RR C
Sbjct  15   LLLLVATGMGPNA-MVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGLRRRC  73

Query  188  ICSKPC  171
             C+K C
Sbjct  74   FCTKHC  79



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF+++ + TE+G  +I+V EARKC + S  +KG+C  D NCA+VC TEGF  G C+G R+
Sbjct  13   LFLLVLVATEMG--SIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFRQ  70

Query  194  SCICSKPC  171
             C CSKPC
Sbjct  71   RCFCSKPC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  +L   TE+G  TI  AEAR CE+ S ++KG C RD NCA+VC TEGF  GDC+G RR
Sbjct  13   LIALLVTATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRR  70

Query  194  SCICSKPC  171
             C C++PC
Sbjct  71   RCFCTRPC  78



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +M+   TE+G   ++VAEAR CE+ S ++KG+C  + NCASVC TEGFP G CKG+RR
Sbjct  10   LLLMVVFATEMG--PVMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLRR  67

Query  194  SCICSKPC  171
             C C + C
Sbjct  68   RCFCLRNC  75



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G   + +AEAR CE+ S ++KG C RD NCASVC TE F  G+C G RR
Sbjct  13   LLAMLVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G   + +AEAR CE+ S ++KG C RD NCASVC TE F  G+C G RR
Sbjct  13   LLAMLVMATEMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  +L + TE+    I+VAEAR CE+ S  +KG+C RD NCA VC+TEGF  G CKG RR
Sbjct  13   VIFLLLVATEM--RPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQCKGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCNKPC  78



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = -3

Query  368  VMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSC  189
            ++L + T +G NT +VAEAR CE+ S K+KG C  + NCASVC+TEGF  GDC+G+RR C
Sbjct  15   LLLLVATGMGPNT-MVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGLRRRC  73

Query  188  ICSKPC  171
             C+K C
Sbjct  74   FCTKHC  79



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML +++E+G  T+  AEAR CE+ S+++KG C RD NCA+VC+TEGF  G+C+G RR
Sbjct  13   LVAMLLLSSEMG--TMSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGFRR  70

Query  194  SCICSKPC  171
             C C++ C
Sbjct  71   RCFCTRNC  78



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            M TE+G  TI  AEAR CE+   ++KG C RDGNCA+VC TEGF  GDC+G+RR C C++
Sbjct  19   MATEMGPMTI--AEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTR  76

Query  176  PC  171
            PC
Sbjct  77   PC  78



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+ M TE+G   + +AEAR CE+ S ++KG C RD NCASVC TE F  G+C G RR
Sbjct  13   LLAMIVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LFV+LF+ T  G     VAEAR CE+ S ++KGIC R  NCA+VC+TEGF  G C+G RR
Sbjct  11   LFVVLFLLTATGMGP-KVAEARTCESQSHRFKGICVRKSNCAAVCQTEGFHGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            M TE+G  TI  AEAR CE+ S ++KG C RD NCA+VC TEGF  GDC+G RR C C++
Sbjct  19   MATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTR  76

Query  176  PC  171
            PC
Sbjct  77   PC  78



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   ++VAEAR CE+ S ++KG C R  NCASVC TEGFP G C G+RR C+C+KP
Sbjct  21   TGEMG-GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKP  79

Query  173  C  171
            C
Sbjct  80   C  80



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  +L +T+++G  ++   EARKCE+ S K+KG+C R  NCA+VC+TEGF  G C+G+RR
Sbjct  13   LLFLLLITSDMGMTSV---EARKCESASHKFKGLCFRASNCANVCKTEGFHGGHCRGLRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M+TE+G   + + EAR CE+ S ++KG C  D NCASVC TE F  G+C+G RR
Sbjct  13   LLAMLVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE+G     VAEAR CE+ S ++KG C  D NCASVC+TEGFP GDCKG RR C C KPC
Sbjct  21   TEMGPK---VAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC  77



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 74.7 bits (182),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F   F+   L  +T +VAEARKCE+ S ++KGIC R  NCA+VC+TEGF  G C+G R 
Sbjct  7    MFATAFVMLMLVFSTGMVAEARKCESQSHRFKGICLRKANCAAVCQTEGFHSGHCRGFRG  66

Query  194  SCICSKPC  171
             C C+K C
Sbjct  67   RCFCTKHC  74



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 74.7 bits (182),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +ML   TE+G    +VA+AR CE+ S ++KG C R  NCA+VC+TEGF  G C+GIRR
Sbjct  13   LVLMLVFATEMG---TMVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRGIRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML + TE+G+  +  AEAR CE+ S ++ G C RD NCAS+C+TEGF  G+C+G RR
Sbjct  10   LVAMLLLATEMGQ--MSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRGFRR  67

Query  194  SCICSKPC  171
             C C++ C
Sbjct  68   RCFCTRNC  75



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +ML   TE+G    +VAEAR CE+ S ++KG C R  NCA+VC+TEGF  G C+G RR
Sbjct  13   LMLMLIFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
               ML M T++G   I+  EAR CE+PS ++KG C  D NCASVC TEGF  GDC+G+RR
Sbjct  13   FLAMLVMDTKMGPMRII--EARICESPSQRFKGPCLTDRNCASVCETEGFTGGDCRGLRR  70

Query  194  SCICSKPC  171
             C C+K C
Sbjct  71   RCFCTKEC  78



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G   + + EAR CE+ S ++KG C  D NCASVC TE F  G+C+G RR
Sbjct  13   LLAMLVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F++L + TE+G    +VAEAR CE+ S ++KG C  D NCASVCRTE F  G C+G RR
Sbjct  13   VFLLLLVATEMG--PTMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRR  70

Query  194  SCICSKPC  171
             C+C+K C
Sbjct  71   RCLCTKHC  78



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = -3

Query  374  LFVMLFM--TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGI  201
            L VML    T E+G     VAEAR CET S ++KGICGR  NCA+VC+ EGF  G C+G 
Sbjct  12   LLVMLLFSSTAEVGPK---VAEARTCETRSHRFKGICGRKANCAAVCQAEGFQGGHCRGF  68

Query  200  RRSCICSKPC  171
            RR C C+K C
Sbjct  69   RRRCFCTKHC  78



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +ML   TE+G    +VAEAR CE+ S ++KG C R  NCA+VC+TEGF  G C+G RR
Sbjct  13   LMLMLVFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>sp|P81571.1|DEFD2_SPIOL RecName: Full=Defensin D2; AltName: Full=Antimicrobial peptide 
D2; AltName: Full=So-D2, partial [Spinacia oleracea]
Length=52

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  +RKC+TPS  +KGIC RD NC + CR EG+P GDCKGIRR C+CSKPC
Sbjct  2    IFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC  52



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F++L + TE+G    +VAEAR CE+ S ++KG C  D NCASVCRTE F  G C+G RR
Sbjct  13   VFLLLLLATEMGPR--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRR  70

Query  194  SCICSKPC  171
             C C+K C
Sbjct  71   RCFCTKHC  78



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML + T++G   + +AEAR CE+ S ++KG C RD NCASVC TE F  G+C G RR
Sbjct  9    LLAMLVVATKMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRR  66

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  67   RCFCTKPC  74



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G   + + EAR CE+ S ++KG C  D NCASVC TE F  G+C+G RR
Sbjct  13   LLAMLVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   LCFCTKPC  78



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV   +    G    +VAEAR CE+ S+++KG C    NCASVC+TEGFP G C+G RR 
Sbjct  12   FVFFLLLAAAGMMGPMVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRR  71

Query  191  CICSKPC  171
            C C+K C
Sbjct  72   CFCTKHC  78



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M TE+G   I+  EAR CE+ S ++KG C  D NCASVC TE F  G+C+G RR
Sbjct  13   LLAMLVMATEMGPTRIV--EARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+ M TE+G   + + EAR CE+ S ++KG C  D NCASVC TE F  G+C+G RR
Sbjct  13   LLAMIVMATEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   RCFCTKPC  78



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = -3

Query  368  VMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSC  189
            ++L ++TE+G   I  AEAR CE+ S+ +KG C RD NCA+VC+TEGF  G+C+G RR C
Sbjct  16   MLLLLSTEMG--PISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRC  73

Query  188  ICSKPC  171
             C++ C
Sbjct  74   FCTRNC  79



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF++L  TT +G  T+   EAR CET S  + G C    NCA+VC  EGFP GDC+G RR
Sbjct  14   LFMLLVATTGIGPVTV---EARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGFRR  70

Query  194  SCICSKPC  171
             C+CS+PC
Sbjct  71   RCLCSRPC  78



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  MLF++TE+G  T   AEAR CE+ S ++ G C R+ NCASVC+TEGF  G+C+  RR
Sbjct  13   LIAMLFLSTEMGPMT--SAEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRR  70

Query  194  SCICSKPC  171
             C C++ C
Sbjct  71   RCFCTRNC  78



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 72.4 bits (176),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = -3

Query  365  MLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCI  186
            ML M+TE+G   + + EAR CE+ S ++KG C  D NCASVC TE F  G+C+G RR C 
Sbjct  1    MLVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCF  58

Query  185  CSKPC  171
            C+KPC
Sbjct  59   CTKPC  63



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV + +    G    L+AE R CE+ S K+KG C    NCASVC+TEGFP G+C+G RR 
Sbjct  12   FVFVLLLVATGMMGPLLAEGRTCESQSRKFKGTCLSKTNCASVCQTEGFPGGNCRGFRRR  71

Query  191  CICSKPC  171
            C C+K C
Sbjct  72   CFCTKHC  78



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 72.4 bits (176),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -3

Query  359  FMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICS  180
            +  T+LG   + +A ARKCE+PS +++G C RD NCA+VCRTEGF  G CKG+R  C C+
Sbjct  19   YTDTQLG--PVTMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCT  76

Query  179  KPC  171
            K C
Sbjct  77   KDC  79



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +ML   TE+G    +VAEAR CE+ S ++KG+C    NCASVC TEGF  G C+G RR
Sbjct  13   LMLMLVFATEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 72.0 bits (175),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
             F+ L ++TE+    +   EAR C++ S  +KG+C    NCA+VC+TEGF  G C G RR
Sbjct  13   FFLFLLVSTEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTEGFTGGHCHGFRR  72

Query  194  SCICSKPC  171
             C CSKPC
Sbjct  73   RCFCSKPC  80



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 72.0 bits (175),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF++L +T  +      V EARKC + S ++KG C  D NCASVC+TEGFP GDCKG+RR
Sbjct  11   LFLVLVITGPM------VGEARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCKGLRR  64

Query  194  SCICSKPC  171
             C C   C
Sbjct  65   RCFCETHC  72



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   ++VAEAR CE+ S ++ G+C R  NCASVC TEGF  G C+G RR C C+KP
Sbjct  21   TGEMG-GPVMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKP  79

Query  173  C  171
            C
Sbjct  80   C  80



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV L +    G    +VAE R CE+ S+++KG C    NCA+VC+TEGFP G+C+G+RR 
Sbjct  12   FVFLLLLVATG---TMVAEGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGNCRGLRRR  68

Query  191  CICSKPC  171
            C C+K C
Sbjct  69   CFCTKHC  75



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F++L + TE+      VAEAR CE+ S K+KG C  D NCASVC+TE FP G C+G RR
Sbjct  13   VFLLLLVATEM------VAEARTCESKSQKFKGACVSDRNCASVCQTERFPGGHCRGFRR  66

Query  194  SCICSKPC  171
             C C+  C
Sbjct  67   RCFCTTHC  74



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML + TE+G   +  AEAR CE+ S ++ G C R  NCASVC+TEGF  G+C+G+RR
Sbjct  10   LVAMLLLATEMG--PMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRGLRR  67

Query  194  SCICSKPC  171
             C C++ C
Sbjct  68   RCFCTRNC  75



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   + VAEAR+CE+PS  ++G C R  NCA+VCRTEGFP G+C+G+RR C C+  
Sbjct  43   TGEMG-GPVAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTH  101

Query  173  C  171
            C
Sbjct  102  C  102



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKG--I  201
             F+++ +   +G   + +AEAR C+TPS K+KG+C    NC +VC+TEGFP G C     
Sbjct  13   FFLLVLLVISIGMIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVA  72

Query  200  RRSCICSKPC  171
             R C CSKPC
Sbjct  73   NRKCYCSKPC  82



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
            L + + + TE+G  T  VAEAR C + S ++KG+C    NCA+VCRTE FP G+CK  G+
Sbjct  13   LLLAILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGL  70

Query  200  RRSCICSKPC  171
             R C C KPC
Sbjct  71   ERKCFCKKPC  80



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML ++TE+G  +   AEAR CE+ S  +KG C  D NCASVC+TEGF  GDC+G+RR
Sbjct  13   LVAMLLLSTEMGPMSG-GAEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGLRR  71

Query  194  SCICSKPC  171
             C C++ C
Sbjct  72   QCFCTRNC  79



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKG--I  201
            L + L + TE+G  T+ VAEAR C + S  +KG C    NCA+VCRTE FP G+C     
Sbjct  12   LLLFLLVATEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTENFPDGECHAPHY  71

Query  200  RRSCICSKPC  171
             R C C +PC
Sbjct  72   ERKCFCKRPC  81



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M T   R    + EAR CE+ S ++KG C  + NCASVC TEGF  GDC+G+RR
Sbjct  13   LLAMLVMATGPTR----IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGLRR  68

Query  194  SCICSKPC  171
             C C++PC
Sbjct  69   RCFCTRPC  76



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV + +    G    ++AE R CE+ S K+KG C    NCASVC+TEGFP G C+G RR 
Sbjct  12   FVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRR  71

Query  191  CICSKPC  171
            C C+K C
Sbjct  72   CFCTKHC  78



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV + +    G    ++AE R CE+ S K+KG C    NCASVC+TEGFP G C+G RR 
Sbjct  12   FVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRR  71

Query  191  CICSKPC  171
            C C+K C
Sbjct  72   CFCTKHC  78



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE+G    +VAEAR CE+ S ++KG C  D NC SVCRTEGF  G C+G  R
Sbjct  13   VLLLLLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSR  70

Query  194  SCICSKPC  171
             C C+K C
Sbjct  71   RCFCTKEC  78



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEA-RKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIR  198
            LF        L  +T +VAEA R CE  S ++KGIC R  NCA+VC+TEGF  G C+G R
Sbjct  7    LFATALFMVMLVFSTGMVAEATRTCEAKSHRFKGICARKANCAAVCQTEGFHGGHCRGFR  66

Query  197  RSCICSKPC  171
            R C C+K C
Sbjct  67   RRCFCTKHC  75



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+ S+++KG C    NCASVC+TEGFP G C+G RR C C+K C
Sbjct  28   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  79



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M T      + + EAR CE+ S ++KG C  + NCASVC TEGF  GDC+G RR
Sbjct  13   LLAMLVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRR  68

Query  194  SCICSKPC  171
             C C++PC
Sbjct  69   RCFCTRPC  76



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +ML    E+G    +VAEAR CE+ S ++KG+C    NCASVC TEGF  G C+G RR
Sbjct  13   LMLMLVFANEMGP---MVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 5/63 (8%)
 Frame = -3

Query  344  LGRNT-----ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICS  180
            +G NT     I +A ARKCE+PS K++G C RD NCASVC TEGF  G+CKG+R  C C+
Sbjct  16   IGYNTETQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCT  75

Query  179  KPC  171
            + C
Sbjct  76   RDC  78



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGI  201
            +F+++ +   +G   + +AE R C+TPS K+KG+C    NC +VC+TEGFP G C     
Sbjct  13   IFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVA  72

Query  200  RRSCICSKPC  171
             R C CSKPC
Sbjct  73   NRKCYCSKPC  82



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M T      + + EAR CE+ S ++KG C  + NCASVC TEGF  GDC+G RR
Sbjct  13   LLAMLVMAT----GPMKIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRR  68

Query  194  SCICSKPC  171
             C C++PC
Sbjct  69   RCFCTRPC  76



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  ML M T      + + EAR CE+ S ++KG C  + NCASVC TEGF  GDC+G RR
Sbjct  9    LLAMLVMAT----GPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRR  64

Query  194  SCICSKPC  171
             C C++PC
Sbjct  65   RCFCTRPC  72



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            ++V+L+   E     ++  +AR C+TPS  ++G+C  + NC + CR EGFP G CKG+RR
Sbjct  6    VYVLLWFVAE---EMVVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRR  62

Query  194  SCICSKPC  171
             C CS+PC
Sbjct  63   RCFCSRPC  70



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +FVM  +        I VAEAR C++ S+ +KG C  D +CA VC+TEGF  G C+G+RR
Sbjct  11   IFVMFLLLVATEMGPIKVAEARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRR  70

Query  194  SCICSKPC  171
             C C+KPC
Sbjct  71   ICFCTKPC  78



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKG--I  201
             F+++ +   +G   + +AE R C+TPS K+KG+C    NC +VC+TEGFP G C     
Sbjct  13   FFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVA  72

Query  200  RRSCICSKPC  171
             R C CSKPC
Sbjct  73   NRKCYCSKPC  82



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 69.7 bits (169),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F++L + TE+G    +VAEAR CE+ S ++KG C  D NCASVC  E F  G C+G RR
Sbjct  13   VFLLLLVATEMG--PTMVAEARDCESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGFRR  70

Query  194  SCICSKPC  171
             C C+K C
Sbjct  71   RCFCTKHC  78



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  332  TILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
             +  AE R+CE+ S K+KG C RD NCASVCR EGF  GDC+G RR C C++ C
Sbjct  21   AVKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +    ++  E R CE+ S+++KG C R  NCASVC+ EGFP G C+G+RR C+C KPC
Sbjct  20   IASEEMVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+ S ++KGIC R+ NCA++C+TEGF  G C+G+RR C C+K C
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKHC  77



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -3

Query  374  LFVM--LFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGI  201
            +FVM  L + TE+G N  +VAEAR C + S  YKG+C  D NCA+VCRTEGF  G C+G 
Sbjct  11   IFVMFLLLVVTEMGAN--MVAEARSCISKSFTYKGLCVHDRNCANVCRTEGFVEGHCRGF  68

Query  200  R--RSCICSKPC  171
                 C C KPC
Sbjct  69   AFGSRCFCYKPC  80



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
             F++L +   L    ++  E R CE+ S ++KG+C  D NCASVC  EGFP G+C+G RR
Sbjct  9    FFILLIL---LASQMMVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRGFRR  65

Query  194  SCICSKPC  171
             C C K C
Sbjct  66   RCFCKKRC  73



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
             FV++ +     R   +V EAR CE+ S ++KG C    NCASVC TEGFP G+C+G RR
Sbjct  8    FFVLMLVVISTERGP-MVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGFRR  66

Query  194  SCICSKPC  171
             C C+K C
Sbjct  67   RCFCTKHC  74



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +FV L +    G +  +VAEAR CE+ S K+KG C  D NCASVC+TE F  G C+G RR
Sbjct  11   IFVFLLLLVATGPS--MVAEARTCESQSHKFKGPCASDHNCASVCQTERFSGGHCRGFRR  68

Query  194  SCICSKPC  171
             C C+  C
Sbjct  69   RCFCTTHC  76



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF +L +        ++  EAR C++ S  +KG C RD NCA VCR EGF  G CKG RR
Sbjct  9    LFFLLLIVLASPEEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRR  68

Query  194  SCICSKPC  171
             C C+K C
Sbjct  69   RCFCTKLC  76



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
              VM+F+ T +G  T+   EAR C + S ++KG C  D NC +VC  EGFP GDC+G RR
Sbjct  13   FLVMIFVATGMGPVTV---EARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRNC  77



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -3

Query  362  LFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCIC  183
            +F+   L   T +VAEAR CE+ S ++KG+C    NC SVC TEGF  G C+G RR C C
Sbjct  11   IFLMMMLVFATGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFC  70

Query  182  SKPC  171
            ++ C
Sbjct  71   TRHC  74



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF+   + T +    +  AEAR CE+ S ++KG C  D  CA  CR EGF  GDC+G+RR
Sbjct  9    LFMFFLLLTAVTDVAVKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGLRR  68

Query  194  SCICSKPC  171
             C C++ C
Sbjct  69   RCFCNRLC  76



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGI  201
            +F+++ +   +G   + VAE R C+TPS K+KG C    NC +VCRTEGFP G C     
Sbjct  13   IFLLVLLVITIGMMAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGSCDFHVT  72

Query  200  RRSCICSKPC  171
             R C C KPC
Sbjct  73   SRKCYCYKPC  82



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L V++ + +E+     ++ EAR CE+ S K+KG C R  NCA+VC+TEGF  G C+G RR
Sbjct  13   LLVLIVVASEMA---TMMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
             ++LFM    G   + V EAR CET S+ + G C    NCA+VC  EGF  GDC+G RR 
Sbjct  11   LLLLFMILATGIGPVTV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRR  69

Query  191  CICSKPC  171
            C+C++PC
Sbjct  70   CLCTRPC  76



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L + + + T +G   ++  EAR CET S+ + G C    NCA+VC  EGF  GDC+G RR
Sbjct  12   LLLFMILATVMG---LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRR  68

Query  194  SCICSKPC  171
             C+C++PC
Sbjct  69   RCLCTRPC  76



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV + +    G    ++AE R CE  S K+KG C    NCA+VC+TEGF  G C GIRR 
Sbjct  12   FVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGIRRR  71

Query  191  CICSKPC  171
            C C+K C
Sbjct  72   CFCTKHC  78



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILV-AEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIR  198
            LF  +FM   L   T L  AE R CE+ S K+KG C    NCA+VC+TEGFP G C+G R
Sbjct  7    LFTTIFMVLMLLMATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGKCRGFR  66

Query  197  RSCICSKPC  171
            R C C+  C
Sbjct  67   RRCFCTTHC  75



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   + VAEAR+CE+ S ++ G+C R  NCA+VCRTEGFP G C+G RR C C+  
Sbjct  18   TGEMG-GPVAVAEARRCESLSHRFAGLCLRGHNCANVCRTEGFPDGKCRGARRRCFCTTH  76

Query  173  C  171
            C
Sbjct  77   C  77



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  ++ AEAR C + S  +KG C R  NCASVC+TEGFP G+CKG RR C C+KPC
Sbjct  19   QEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE+G    +VAEAR CE+ S ++KG C  D NC SVCRTEGF  G C+G  R
Sbjct  13   VLLLLLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSR  70

Query  194  SCICSK  177
             C C+K
Sbjct  71   RCFCTK  76



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L + + + T +G   ++  EAR CET S+ + G C    NCA+VC  EGF  GDC+G RR
Sbjct  12   LLLFMILATVMG---LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRR  68

Query  194  SCICSKPC  171
             C+C++PC
Sbjct  69   RCLCTRPC  76



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+PS  +KG+C  D NC ++C+TEGF  G C+G RR C C+K C
Sbjct  22   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC  73



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T ELG   ++VAEAR CE+ S +++G C R  NCA+VC+TEGFP G C+G RR C C+  
Sbjct  21   TGELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTH  79

Query  173  C  171
            C
Sbjct  80   C  80



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE+   T +VAEAR CE+ S ++KG C  D NC SVCRTE F  G C+G RR
Sbjct  13   VLLLLLVATEMMGPT-MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRR  71

Query  194  SCICSKPC  171
             C C+K C
Sbjct  72   RCFCTKHC  79



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+ S ++KG C R  NCASVC+TEGF  G C+G RR C C+K C
Sbjct  27   MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T ELG   ++VAEAR CE+ S +++G C R  NCA+VC+TEGFP G C+G RR C C+  
Sbjct  44   TGELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTH  102

Query  173  C  171
            C
Sbjct  103  C  103



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE+   T +VAEAR CE+ S ++KG C  D NC SVCRTE F  G C+G RR
Sbjct  13   VLLLLLVATEMMGPT-MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRR  71

Query  194  SCICSKPC  171
             C C+K C
Sbjct  72   RCFCTKHC  79



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
            L + + + TE+G  T  VAEAR C + S ++KG+C    NCA+VCRTE FP G+CK  G+
Sbjct  13   LLLAILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGL  70

Query  200  RRSCICSKPC  171
             R C C K C
Sbjct  71   ERKCFCKKVC  80



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + +ML + T +G  T+   EAR CE+ S  + G C    NCA++C  EGF  GDC+G RR
Sbjct  15   IMLMLLLATGMGPVTV---EARMCESSSQLFNGPCLSTTNCANICHNEGFTDGDCQGFRR  71

Query  194  SCICSKPC  171
             CIC++PC
Sbjct  72   RCICTRPC  79



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  329  ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            ++VA+AR CE+ S ++KG C    NCA+VC+TEGFP G C+G RR C CSK C
Sbjct  4    LMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +ML    EL        EAR CE+ S +YKG C R  NCA+VC+TEGF  G C+G RR
Sbjct  13   LVLMLVFAAEL-------TEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCRGFRR  65

Query  194  SCICSKPC  171
             C C+K C
Sbjct  66   RCFCAKHC  73



>gb|AIA67004.1| defensin [Triticum aestivum]
Length=84

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TE+G   +  A  R CE+ S +Y+G C RD NC  VC TEGFP G CK  G    C+C+K
Sbjct  22   TEMGTTRVAEARHRHCESQSHRYRGACWRDDNCKHVCNTEGFPSGKCKFHGFESKCVCTK  81

Query  176  PC  171
            PC
Sbjct  82   PC  83



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV + +    G    ++AE R CE  S K+KG C    NCASVC+TEGF  G C+G RR 
Sbjct  12   FVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGTCLGKSNCASVCQTEGFHGGHCRGFRRR  71

Query  191  CICSKPC  171
            C C+K C
Sbjct  72   CFCTKHC  78



>gb|AAL14240.1| proteinase inhibitor [Musa acuminata AAA Group]
Length=49

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  317  EARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            E+R CE+ S+++KG C R  NCASVC+ EGFP G C+G+RR C+C KPC
Sbjct  1    ESRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  49



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
             TE+G   + VAEAR C++ S +++G C R  NCA+VCRTEGFP G C+G RR C C   
Sbjct  20   ATEIG--AVAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTH  77

Query  173  C  171
            C
Sbjct  78   C  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L   + +   L  +T ++AEAR CE+ S ++KG+C    NC SVC TEGF  G C+G RR
Sbjct  7    LVATILLMLMLVFSTGMIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGFRR  66

Query  194  SCICSKPC  171
             C C++ C
Sbjct  67   RCFCTRHC  74



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  329  ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            + VA ARKC++ S K+KG C RD NCA+VC TEGF  G C+G+RR C C++ C
Sbjct  26   VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+ S ++KGIC R+ NCA++C+TEGF  G C+G+RR C C+  C
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTMYC  77



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
            L + + + TE+G  T  VAEAR C + S ++KG+C    NCA+VC+TE FP G+CK  G+
Sbjct  13   LLLAILVATEMG--TTQVAEARHCLSQSHRFKGMCVSSNNCANVCKTENFPDGECKSHGL  70

Query  200  RRSCICSKPC  171
             R C C K C
Sbjct  71   ERKCFCKKLC  80



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            + TE+G     +AEAR CE+ S K+KG C  + NCA+VC+TEGF  GDC+G+RR C C++
Sbjct  19   VATEIGSK---MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTR  75

Query  176  PC  171
             C
Sbjct  76   HC  77



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF +L +     +  ++  EAR C++ S  +KG C RD NCA VCR EGF  G CKG RR
Sbjct  9    LFFLLLIVLA-SQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRR  67

Query  194  SCICSKPC  171
             C C+K C
Sbjct  68   RCFCTKLC  75



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            M +E+G     VAEAR CE+ S K++G C R+ NCA+VC+TEGF  G C+G+RR C C++
Sbjct  19   MPSEMGTK---VAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTR  75

Query  176  PC  171
             C
Sbjct  76   LC  77



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = -3

Query  368  VMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSC  189
            ++LFM         +  E R CE+ S+ + G C  + NCA+VC TEGFP GDC+G RR C
Sbjct  12   LLLFMLL-----ATVTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGDCRGFRRRC  66

Query  188  ICSKPC  171
            +C++PC
Sbjct  67   MCTRPC  72



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+PS  +KG+C  D NC ++C+TEGF  G C+G RR C C+K C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE+     +V EAR CE+ S ++KG C    NCASVC+TEGF  G C+G RR
Sbjct  13   IVMLLLVATEM---EPMVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
             TE+G   + VAEAR C + S K++G C R  NCA+VCRTEGFP G C+G+RR C C+  
Sbjct  20   ATEVG-GPVGVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRGLRRRCFCTTH  78

Query  173  C  171
            C
Sbjct  79   C  79



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
             A+AR+CETPS+++KGIC    NCA+VC TEGF  G C G RR C+C+K C
Sbjct  22   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T ELG   ++VAEAR CE+ S +++G C R  NCA+VCRTEGF  G C+G RR C C+  
Sbjct  21   TGELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTH  79

Query  173  C  171
            C
Sbjct  80   C  80



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
             A+AR+CETPS+++KGIC    NCA+VC TEGF  G C G RR C+C+K C
Sbjct  61   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   + VAEARKCE+ S ++ G+C R  NCA+VCRTEGFP G C+G  R C C+  
Sbjct  30   TGEMG-GPVAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTH  88

Query  173  C  171
            C
Sbjct  89   C  89



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSK  177
            TE+G  T  VAEAR C + S K+KG C    NCA VCRTE FP G+C  + + R C C K
Sbjct  21   TEMGATTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRTENFPDGECHRQHLERKCFCKK  80

Query  176  PC  171
            PC
Sbjct  81   PC  82



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -3

Query  365  MLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCI  186
            +L +     +  I+  EAR CE+ S  +KG C RD NCA VCR E F  G CKG+RR C 
Sbjct  10   LLLLIVLASQEAIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCF  69

Query  185  CSKPC  171
            C+K C
Sbjct  70   CTKLC  74



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  + VA AR+C +PS K+KG+C  D NCASVC TE FP G C GIR+ C+C++ C
Sbjct  21   QGAVQVALARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   + VAEARKCE+ S ++ G+C R  NCA+VCRTEGFP G C+G  R C C+  
Sbjct  21   TGEMG-GPVAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTH  79

Query  173  C  171
            C
Sbjct  80   C  80



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  ++   EAR CE+ S ++KG C  D NCA+VC  EGF  G C+G+RR
Sbjct  13   LLFMIFVATGMGPVSV---EARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGKCRGLRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            + TE+G     +AEAR CE+ + K+KG C  + NCA+VC+TEGF  GDC+G+RR C C++
Sbjct  19   VATEIGSK---MAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTR  75

Query  176  PC  171
             C
Sbjct  76   HC  77



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            VA+AR C++ S ++KG C R+ NCA++CRTEGF  G+C+G RR C C+K C
Sbjct  26   VADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTKHC  76



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            + EAR CE+ S K+KG C  + NCASVC+TEGF  GDC+G+RR C C++ C
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +V EAR CE+PS ++KG+C    NC  VC+TEGF  G C+G RR C C+K C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +V EAR CE+PS ++KG+C    NC  VC+TEGF  G C+G RR C C+K C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  MLF+        +  AE R+CE+ S K+KG C  D NC SVCR EGF  GDC+G+R 
Sbjct  8    ILFMLFLVLA-ADVAVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCRGVRH  66

Query  194  SCICSKPC  171
             C C++ C
Sbjct  67   RCFCTRNC  74



>ref|XP_003575412.1| PREDICTED: defensin Tm-AMP-D1.2-like [Brachypodium distachyon]
Length=80

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TE+G  T  VAEAR C + S K+KG C R GNCA+VC+TE FP G+CK  G+ R C C +
Sbjct  21   TEMG--TTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKR  78

Query  176  PC  171
             C
Sbjct  79   VC  80



>gb|EMT18782.1| Defensin-like protein [Aegilops tauschii]
Length=404

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSKPC  171
            +G  T  VAEAR C + S K+KG C    NCAS+CRTE FP G+CK     R C C +P 
Sbjct  1    MGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKRP-  59

Query  170  *FIHLSYLYTGS  135
               H S  YT S
Sbjct  60   --THGSLGYTSS  69



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF++L  T  +G    +VAE R C++ S ++KG C    NCA+VC+TEGF  G C+G RR
Sbjct  13   LFLLLVATGMMG---PMVAEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGGHCRGFRR  69

Query  194  SCICSKPC  171
             C C+K C
Sbjct  70   RCFCTKHC  77



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSK  177
            TE+G  T+ +AEAR C + S K+KG C    NCA+VCRTE FP G+C      R C C +
Sbjct  21   TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  80

Query  176  PC  171
            PC
Sbjct  81   PC  82



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  ++  EAR C + S  +KG C R  NCA+VC+TEGFP G+CKG RR C C+KPC
Sbjct  19   QEMMVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>gb|EMS49334.1| Defensin-like protein [Triticum urartu]
 gb|AIA66991.1| defensin [Triticum aestivum]
Length=82

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSK  177
            TE+G  T  VAEAR C + S K+KG C    NCA+VCRTE FP G+C  + + R C C +
Sbjct  21   TEMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKR  80

Query  176  PC  171
            PC
Sbjct  81   PC  82



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
             ++LFM        + V EAR CET S+ + G C    NCA+VC  EGF  GDC+G RR 
Sbjct  11   LLLLFMILATVMGPVRV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRR  69

Query  191  CICSKPC  171
            C+C++PC
Sbjct  70   CLCTRPC  76



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
             F ML +   L    ++  E R CE+ S ++KG+C  D NCASVC  EGF  G+C+G RR
Sbjct  80   FFFMLLIL--LASQMMVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRGFRR  137

Query  194  SCICSKPC  171
             C C++ C
Sbjct  138  RCFCTRHC  145



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF +L +     +  ++  EAR C + S  +KG C RD NCA VCR EGF  G CKG RR
Sbjct  9    LFFLLLIVLA-SQEVVVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRR  67

Query  194  SCICSKPC  171
             C C+K C
Sbjct  68   RCFCTKLC  75



>gb|AGC82207.1| defensin [Persea americana var. drymifolia]
Length=78

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L   L + +E+    +   EA  CETPS  + G+C R  NCASVC  E F  G C+G+RR
Sbjct  14   LLCFLVIVSEIAVTRV---EAATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRR  70

Query  194  SCICSKPC  171
             C+C KPC
Sbjct  71   RCMCLKPC  78



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  T+   EARKCE+ S ++KG C  + NC +VC  EGF  G+C+G RR
Sbjct  13   LVFMIFVATGMGPVTV---EARKCESKSHRFKGKCLSETNCKNVCHNEGFTGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRNC  77



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +   + A  R CETPS ++KG C ++ NCA+VC+TEGF  G C+G+RR C C++PC
Sbjct  46   KAAAVAAIERTCETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L VM  +  E+G    LV EAR CE+ S K+KG C  D NCA+VC +E F  G C+G RR
Sbjct  13   LVVMCLLANEMG--GPLVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRR  70

Query  194  SCICSKPC  171
             C C+  C
Sbjct  71   RCFCTTHC  78



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  M+F+ T +G  T+   EAR CE+ S ++KG C    NCA+VC  EGF  G+C+G RR
Sbjct  13   IMFMIFVATGMGPVTV---EARTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE+G      AEAR C++ S ++KG+C R  NCA+VC+TEGF  G C+G  R C C+K C
Sbjct  21   TEMGPK---AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  77



>gb|AAR84643.1| defensin [Picea glauca]
Length=83

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSKPC  171
            +G   + +AEAR C+TPS K+KG+C    NC +VC+TEGFP G C      R C CSKPC
Sbjct  23   IGMMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  82



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE+G   + VAEAR CE+ S K+KG C R  NCASVC++EGF  G C+G+ R C C+  C
Sbjct  12   TEMG---LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNT--ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGI  201
            LF   F+   L   T      EAR CE+ S  +KG C  D NC SVCRTEGF  G+C+G 
Sbjct  7    LFATFFLVAMLLLATGPTTSVEARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGNCRGF  66

Query  200  RRSCICSKPC  171
            RR C C++ C
Sbjct  67   RRRCFCTRNC  76



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            F+ L          +  AEAR C + S  +KG+C  + NCA+VC TEGF  G C+G+RR 
Sbjct  8    FIFLLFLVLAADVAVKRAEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLRRR  67

Query  191  CICSKPC  171
            C CSK C
Sbjct  68   CFCSKNC  74



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 5/68 (7%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE     ++ A+AR+CET S ++ G+C    NCA VC  EGF  G C G++R
Sbjct  13   ILLLLVVATE-----VVPAQARECETESERFNGLCFVSANCAGVCNAEGFTGGKCSGLKR  67

Query  194  SCICSKPC  171
            SC+C+K C
Sbjct  68   SCMCTKEC  75



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
             AEAR C++ S ++KG+C R  NCA+VC+TEGF  G C+G  R C C+K C
Sbjct  28   AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  78



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  ++   EAR CE+ S ++KG C  + NCA+VC  EGF  G C+G+RR
Sbjct  13   LLFMIFVATGMGPVSV---EARTCESQSHRFKGPCVSENNCANVCHNEGFGGGKCRGLRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -3

Query  371  FVMLFMTTELGRNTIL-VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            F+ +F+   + +  ++   EAR C +PS  Y G C  D NCA VCR EGF  GDC GI+R
Sbjct  9    FLFVFLIIFVSQMEMMRQVEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQR  68

Query  194  SCICSKPC  171
             C C+K C
Sbjct  69   KCYCTKLC  76



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  329  ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            ++  EAR CET S+ + G C    NCA+VC  EGF  GDC+G RR C+C++PC
Sbjct  3    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ + +G  T+   EAR CE+ S K++G+C    NCA+VC  EGF  G C+G RR
Sbjct  13   LMFMIFVASGMGPVTV---EARTCESKSHKFRGLCVSRHNCANVCHNEGFHGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCYCTRHC  77



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  T+   EAR CE+ S ++KG C  + NC +VC  EGF  G+C+G+RR
Sbjct  13   LVFMIFVATGMGPVTV---EARTCESKSHRFKGACLSETNCKNVCHNEGFRGGNCRGLRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRNC  77



>gb|ABK21016.1| unknown [Picea sitchensis]
 gb|ABK23113.1| unknown [Picea sitchensis]
 gb|ACN39802.1| unknown [Picea sitchensis]
 gb|ACN40104.1| unknown [Picea sitchensis]
Length=83

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -3

Query  347  ELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSKP  174
             +G   + VAEAR C+TPSSK+KG C    NC +VCRTEGFP G C      R C C KP
Sbjct  22   SIGMMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  173  C  171
            C
Sbjct  82   C  82



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  M+F+ T +G  T+   EAR CE+ S ++KG C  + NC +VC  EGF  G+C+G RR
Sbjct  13   VMFMIFVATGMGPVTV---EARTCESKSHRFKGTCLSESNCKNVCHNEGFQGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   + VAEAR CE  S +++G C R  NCA+VC+TEGFP G C+G R  C C+  
Sbjct  23   TGEMG-GPVAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTH  81

Query  173  C  171
            C
Sbjct  82   C  82



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
            + ++L + TELG  T  VAEAR C + S ++KG+C    NCA+VC+TE FP G+CK  G 
Sbjct  13   VLMLLPVATELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGA  70

Query  200  RRSCICSKPC  171
             R C C K C
Sbjct  71   TRKCFCKKIC  80



>gb|ABK23037.1| unknown [Picea sitchensis]
 gb|ABR16956.1| unknown [Picea sitchensis]
Length=83

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -3

Query  347  ELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSKP  174
             +G   + VAEAR C+TPSSK+KG C    NC +VCRTEGFP G C      R C C KP
Sbjct  22   SIGMMQVEVAEARMCKTPSSKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  173  C  171
            C
Sbjct  82   C  82



>gb|EMS52277.1| Defensin Tk-AMP-D1.1 [Triticum urartu]
Length=77

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE    ++ VA AR CE+ S K+ G C  D NCA+VC+TEGF  G C G++R C C+K C
Sbjct  18   TEEQGGSVQVALARDCESDSHKFHGACFSDTNCANVCQTEGFTAGKCVGVQRHCHCTKDC  77



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            T E+G   + VAEAR CE  S +++G C R  NCA+VC+TEGFP G C+G R  C C+  
Sbjct  21   TGEMG-GPVAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTH  79

Query  173  C  171
            C
Sbjct  80   C  80



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
              +ML   +E+G  T  VAEAR C + S ++ G C    NC +VCRTEGFP G+C+  GI
Sbjct  15   FLLMLLAASEMG--TTRVAEARHCTSQSHRFVGACMSKSNCENVCRTEGFPWGECRWHGI  72

Query  200  RRSCICSKPC  171
             R C C + C
Sbjct  73   ERKCHCKRIC  82



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +V +AR CE+PS  +KG+C    NC  VC+TEGF  G C+G RR C C+K C
Sbjct  22   MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|AIA67015.1| defensin [Triticum aestivum]
Length=78

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  317  EARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            E R CET S+++KGIC    NCA++C TEGF  G C G++R CIC+KPC
Sbjct  30   EGRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L +++   +++G   ++ +EAR CE+PS  +KG+C  D NCA+VC TEGF  G C+G R 
Sbjct  11   LVLLVIFASDMG---VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGARH  67

Query  194  SCICSKPC  171
             C C+  C
Sbjct  68   RCFCTIIC  75



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +VAEAR CE+ S +++G+C    NC SVC TEGF  G C+G RR C C++ C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>gb|ACV84383.1| defensin precursor [Triticum turgidum subsp. durum]
Length=85

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = -3

Query  353  TTELGRNTILVAEARK----CETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRS  192
             TE+G  T+ VAEAR     CE+ S +Y+G C RD NC  VC TEGFP G CK     R 
Sbjct  21   ATEMG--TMRVAEARHGHRHCESQSHRYRGACWRDDNCEHVCNTEGFPWGKCKFHDFERK  78

Query  191  CICSKPC  171
            C C +PC
Sbjct  79   CFCKRPC  85



>ref|XP_009631841.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=62

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            M   L    +   EAR C +PS  Y G C  D NCA VCR EGF  GDC GI+R C C+K
Sbjct  1    MIFALQMEMMPQVEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCYCTK  60

Query  176  PC  171
             C
Sbjct  61   LC  62



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNT--ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGI  201
            LF   F+ T L   T      EAR CE+ S  +KG C  D NC SVC TEGF  G+C+G+
Sbjct  7    LFATFFLVTMLLLATGPTTRVEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGL  66

Query  200  RRSCICSKPC  171
            R+ C C++ C
Sbjct  67   RQRCFCTRNC  76



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
             F ML +   L    ++  E R CE+ S ++KG+C    NCASVC  EGF  G C+G RR
Sbjct  8    FFFMLLIL--LSSQMVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGFRR  65

Query  194  SCICSKPC  171
             C C++ C
Sbjct  66   RCFCTRHC  73



>gb|ABK20960.1| unknown [Picea sitchensis]
 gb|ABK25298.1| unknown [Picea sitchensis]
Length=83

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSKPC  171
            +G   + +AE R C+TPS K+KG+C    NC +VC+TEGFP G C      R C CSKPC
Sbjct  23   IGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  82



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +V EAR CE+ S  +KG+C    NC ++C+TEGF  G C+G RR C C+KPC
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>ref|XP_004509637.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=58

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIR--RSCICSKPC  171
            +VAEAR CE+ S  YKG+C  D NCA VCRTEGF  G CKG     +CIC KPC
Sbjct  5    MVAEARICESKSLSYKGLCVFDRNCALVCRTEGFVGGHCKGFAFGSTCICYKPC  58



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSK  177
            TE+G  T+ +AEAR C + S K+KG C    NCA+VCRTE FP G+C      R C C +
Sbjct  21   TEMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKR  80

Query  176  PC  171
             C
Sbjct  81   AC  82



>gb|EMT30046.1| Defensin-like protein P322 [Aegilops tauschii]
Length=78

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  317  EARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            E R CET S+++KGIC    NCA++C TEGF  G C G++R CIC+KPC
Sbjct  30   EPRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  T+   EAR CE+ S ++KG C    NCA+VC  EGF  G C+G RR
Sbjct  13   LLFMVFIATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCYCTRHC  77



>ref|XP_010228361.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=76

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            R  + VA AR+C +PS K+ G+C RD NCA++  TEGF  G C GIR  C C K C
Sbjct  21   RTLVQVALARECGSPSHKFHGMCTRDSNCANIWLTEGFKTGKCVGIRHRCFCYKNC  76



>gb|AIA67009.1| defensin [Triticum aestivum]
Length=77

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE    ++ VA AR CE+ S K+ G C  D NCA VC+TEGF  G C G++R C C+K C
Sbjct  18   TEEQGGSVQVALARDCESDSHKFHGACFSDTNCAYVCQTEGFTAGKCVGVQRHCHCTKDC  77



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  M+F+ T +G  T+   EAR CE+ S ++KG C  + NC +VC  EGF  G+C+G RR
Sbjct  13   VLFMIFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCKNVCHNEGFTGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_002272913.2| PREDICTED: defensin-like protein 1 isoform X1 [Vitis vinifera]
 emb|CBI27688.3| unnamed protein product [Vitis vinifera]
Length=75

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  ++ +EAR CE+ S K++G C  D NCA VCR EGF  G CKG+RR C C+K C
Sbjct  20   QEMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  75



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  329  ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            + +  ARKCE+ S ++KG C RD NCA+VC TEGF  G CKG+R  C C++ C
Sbjct  26   VTMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  T+   EAR CE+ S ++KG C    NC +VC  EGF  G C+G RR
Sbjct  12   LLFMIFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRR  68

Query  194  SCICSKPC  171
             C C++ C
Sbjct  69   RCYCTRHC  76



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  M+F+ T +G  T+   EAR CE+ S ++KG C  + NC +VC  EGF  G+C+G RR
Sbjct  13   VLFMIFVATGMGPVTV---EARTCESQSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRYC  77



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  M+F+ T +G  T+   EAR CE+ S ++KG C  + NC +VC  EGF  G+C+G RR
Sbjct  13   VLFMIFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  T+   EAR CE+ S ++KG C    NC +VC  EGF  G C+G RR
Sbjct  13   LLFMIFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCYCTRHC  77



>ref|XP_010653029.1| PREDICTED: defensin-like protein 1 isoform X2 [Vitis vinifera]
Length=74

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  335  NTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
              ++ +EAR CE+ S K++G C  D NCA VCR EGF  G CKG+RR C C+K C
Sbjct  20   QMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  74



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE+G     VAEAR CE+ S K+KG C R  NCASVC++EGF  G C+G+ R C C+  C
Sbjct  12   TEMGPK---VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  314  ARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            AR CE+ S ++KG C  + NCASVC TEGF  GDC+G RR C C++PC
Sbjct  1    ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  48



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +F++L + TE+G    +VAEAR CE+ S   +G C  D NCAS CRTE F  G C+G R 
Sbjct  13   VFLLLLLATEMGPR--MVAEARGCESRSRHLRGKCESDENCASACRTERFSGGHCRGFRC  70

Query  194  SCICSK  177
             C C K
Sbjct  71   RCFCDK  76



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = -3

Query  365  MLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCI  186
            M+ +    G  T+   EAR C++ S K+KG C  + NCA+VC TEGFP GDC G+ R C 
Sbjct  1    MMILVNAWGSVTV---EARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRCY  57

Query  185  CSKPC  171
            C+  C
Sbjct  58   CNTHC  62



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L + +     +G  T+   EAR CE+ S ++KG C  DGNC +VC  EGF  G C+G RR
Sbjct  12   LLMFMIFVAAMGPVTV---EARTCESQSHRFKGKCLSDGNCGNVCHNEGFGGGKCRGFRR  68

Query  194  SCICSKPC  171
             C C++ C
Sbjct  69   RCFCTRNC  76



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  335  NTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            + ++VAEAR CE+ S +++G C R  NC +VC+TEGF  G C+G RR C C   C
Sbjct  25   DQMMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>gb|KHN09675.1| Defensin-like protein, partial [Glycine soja]
Length=59

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  332  TILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
             ++  E R CE+ S  + G+C RD NCA VCR EGF  G CKG RR C C++ C
Sbjct  6    VVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC  59



>gb|AIA66999.1| defensin [Triticum aestivum]
Length=82

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSK  177
            TE+G  T+ VAEAR CE+ S  +KG C  D NCASVC TE FP G C    + R C C +
Sbjct  23   TEMG--TVKVAEARTCESQSHNFKGACFSDTNCASVCHTENFPRGQCHQHHVERKCYCER  80

Query  176  PC  171
             C
Sbjct  81   DC  82



>gb|EMT22726.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSK  177
            TE+G  T  VAEAR CE+ S  +KG C  D NCASVCRTE FP G C    + R C C +
Sbjct  23   TEMG--TTKVAEARTCESQSHNFKGACFSDTNCASVCRTENFPRGQCHQHHLERKCYCER  80

Query  176  PC  171
             C
Sbjct  81   DC  82



>emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine 
max]
Length=75

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  335  NTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
              ++  E R CE+ S  + G+C RD NCA VCR EGF  G CKG RR C C++ C
Sbjct  21   QVVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC  75



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  320  AEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            AE R C + S  +KG+C  D NCA VCRTEGF  GDC G RR C C++ C
Sbjct  35   AEGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGDCGGFRRRCFCTRIC  84



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  MLF+ T +G  T+   EAR CE+ S +++G C    NC +VC  EGF  G C+G RR
Sbjct  13   LMFMLFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>gb|EMT26158.1| Defensin-like protein [Aegilops tauschii]
Length=74

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  + VA AR C++ S K+KG+C RD NCASVC TEGFP G CKG   +C C K C
Sbjct  21   QGPVQVALARDCKSQSYKFKGMCVRDDNCASVCLTEGFPRGKCKGF--ACSCHKDC  74



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
            FV L +        +  AE R C + S  +KG+C  D NCA VCRTEGF  GDC G RR 
Sbjct  8    FVHLELLVICVDVAVKRAEGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGDCGGFRRR  67

Query  191  CICSKPC  171
            C C++ C
Sbjct  68   CFCTRIC  74



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ + +G  T+   EAR CE+ S K++G C    NCA+VC  EGF  G C+G RR
Sbjct  13   LMFMIFVASGMGPVTV---EARTCESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCYCTRHC  77



>emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera]
Length=74

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  329  ILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            ++ +EAR CE+ S K++G C  D NCA VCR EGF  G CKG RR C C+K C
Sbjct  22   VVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGXRRRCFCTKLC  74



>emb|CDM85870.1| unnamed protein product [Triticum aestivum]
 emb|CDM85874.1| unnamed protein product [Triticum aestivum]
Length=74

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -3

Query  338  RNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +  + VA AR C++ S K+KG+C RD NCASVC TEGFP G CKG   +C C K C
Sbjct  21   QGPVQVALARDCKSQSYKFKGMCVRDDNCASVCLTEGFPRGKCKGF--ACSCYKDC  74



>gb|EMT22729.1| Defensin Tk-AMP-D2 [Aegilops tauschii]
Length=76

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCIC  183
            + TE+G  T   AEAR CE+ S K+KG C  D NCA+VCRTE FP G C    + R C C
Sbjct  15   VATEMG--TTKTAEARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCYC  72

Query  182  SKPC  171
             + C
Sbjct  73   ERDC  76



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF +LF+        ++  E R CE+ S ++ G+C    NCASVC  EGF  G C+G R+
Sbjct  8    LFFVLFILLA-SHQMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGFRK  66

Query  194  SCICSKPC  171
             C C K C
Sbjct  67   RCFCKKRC  74



>gb|KGN62247.1| hypothetical protein Csa_2G340400 [Cucumis sativus]
Length=107

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  320  AEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            AEAR C++ S  + G C RD NCA VCRTEGF  G+C G RR C C+  C
Sbjct  58   AEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  107



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -3

Query  362  LFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCIC  183
            +F+   L   T ++AEA+ CE  S  +KG+C    +C +VCR EGF  G C G R  C C
Sbjct  11   IFLMMLLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFC  70

Query  182  SKPC  171
            +KPC
Sbjct  71   TKPC  74



>sp|A4L7R8.1|DEF2_PINSY RecName: Full=Defensin-2; Flags: Precursor [Pinus sylvestris]
 gb|ABO61349.1| defensin [Pinus sylvestris]
Length=83

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKG--IRRSCICSKPC  171
            +G   + VAE R C+TPS+K+KG C    NC +VCRTEGFP G C      R C C KPC
Sbjct  23   IGMMEVQVAEGRMCKTPSAKFKGYCVSSTNCKNVCRTEGFPTGSCDFHITSRKCYCYKPC  82



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +  M+F+ T +G  T+   EAR CE+ S ++KG C    NCA+VC  EGF  G C+G RR
Sbjct  13   IMFMVFVATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCYCTRHC  77



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TE+G  T  VAEAR C + S  +KG C    NC +VCRTE FP G+C      R C C +
Sbjct  21   TEMGATTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRTENFPDGECHTPHFERKCFCKR  80

Query  176  PC  171
            PC
Sbjct  81   PC  82



>gb|EMT22728.1| Defensin Tm-AMP-D1.2 [Aegilops tauschii]
Length=82

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 4/62 (6%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKG--IRRSCICSK  177
            TE+G  T+  AEAR C++ S K+KG C  D NCASVCRTE FP G C    + R C C +
Sbjct  23   TEMG--TMKTAEARTCQSQSHKFKGACFSDTNCASVCRTEKFPRGQCNTHYVERKCYCER  80

Query  176  PC  171
             C
Sbjct  81   DC  82



>gb|ACG41256.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
              +ML   +E+G  T  VAEAR C + S ++ G C    NC +VCRTEGFP  +C+  GI
Sbjct  15   FLLMLLAASEMG--TTRVAEARHCTSQSHRFVGACMSKSNCENVCRTEGFPWXECRWHGI  72

Query  200  RRSCICSKPC  171
             R C C + C
Sbjct  73   ERKCXCKRIC  82



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GI  201
              +ML   +E+G  T   AEAR C + S ++ G C    NC +VCRTEGFP G+C+  GI
Sbjct  15   FLLMLLAASEMG--TTRXAEARHCTSQSHRFVGACMSKSNCENVCRTEGFPWGECRWHGI  72

Query  200  RRSCICSKPC  171
             R C C + C
Sbjct  73   ERKCHCKRIC  82



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
             +E+G   +  AEAR CE+ S ++KG C    NCA+VC+TEGF  G C+G RR C C+K 
Sbjct  19   ASEMG---LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKR  75

Query  173  C  171
            C
Sbjct  76   C  76



>gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus]
Length=73

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -3

Query  335  NTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
              ++  EAR CE+ S  +KG C  D NCA VCR EGF  G+C+G RR C C+K C
Sbjct  19   QVVVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
 emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris]
 gb|ESW09810.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
Length=73

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -3

Query  335  NTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
              ++  EAR CE+ S  +KG C  D NCA VCR EGF  G+C+G RR C C+K C
Sbjct  19   QVVVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSK  177
            +++E+G     V EAR CE+ S ++KG C R  NCA+VC+TEGF  G C+G+R  C C+K
Sbjct  19   ISSEMG---TKVVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTK  75

Query  176  PC  171
             C
Sbjct  76   RC  77



>gb|AIA67000.1| defensin [Triticum aestivum]
Length=84

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = -3

Query  356  MTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCIC  183
            + TE+G  T   AEAR CE+ S K+KG C  D NCA+VCRTE FP G C    + R C C
Sbjct  23   VATEMG--TTKTAEARTCESQSHKFKGPCFSDSNCATVCRTENFPRGQCNTHHVERKCYC  80

Query  182  SKPC  171
             + C
Sbjct  81   ERDC  84



>gb|AAU04859.1| defensin precursor [Ginkgo biloba]
Length=80

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKG--IRRSCICSKPC  171
            VAEAR C+T SSK+KG C  D NC +VCRTEGFP G C      R C C KPC
Sbjct  27   VAEARTCKTQSSKFKGYCLSDTNCRNVCRTEGFPTGSCDFHVASRKCYCYKPC  79



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = -3

Query  371  FVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRS  192
             + L +     +  I  AE R C + S  Y+G C  D NCA VCR EGF  GDC G RR 
Sbjct  8    LIFLLLIVFASQMAIQRAEGRVCISQSHGYRGPCVHDHNCALVCRNEGFSGGDCIGWRRR  67

Query  191  CICSKPC  171
            C C+K C
Sbjct  68   CFCTKLC  74



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 5/68 (7%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF++LF + E+ +     AE R C++ S  +KG C RD NCA VCR EGF  G C G  R
Sbjct  11   LFLVLFASPEVKQ-----AEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGGRCHGFFR  65

Query  194  SCICSKPC  171
             C C++ C
Sbjct  66   RCYCTRLC  73



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  326  LVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            +V EAR CE+ S  +KG+C    NC ++C+TEGF  G C+G RR C C+K C
Sbjct  23   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGHCRGFRRRCFCTKHC  74



>gb|ACV84382.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TE+G  T+  AEAR C + S K+KG C    NCAS+CRTE FP G+CK     R C C +
Sbjct  21   TEMGTPTMKAAEARDCLSQSHKFKGSCLSSSNCASICRTENFPGGECKLESFARKCFCKR  80

Query  176  PC  171
             C
Sbjct  81   VC  82



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE+G   + VA AR CE+ S K+KG C R  NCASVC +EGF  G C+G+ R C C+  C
Sbjct  12   TEMG---LKVAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AIA67013.1| defensin [Triticum aestivum]
Length=76

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -3

Query  353  TTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKP  174
            TTE  +  + +A AR C++ S K+KG+C RD NCASVC  EGF  G CKG    C C+K 
Sbjct  17   TTE-DQGPVQLALARDCQSKSFKFKGMCVRDDNCASVCLLEGFTGGKCKGFWHRCYCTKD  75

Query  173  C  171
            C
Sbjct  76   C  76



>dbj|BAK07467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  311  RKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            R CET S+++KGIC    NCA+VC TEGF  G C G +R C+C+KPC
Sbjct  30   RVCETDSTQFKGICMVGTNCANVCLTEGFTSGKCSGFKRKCMCTKPC  76



>sp|A4L7R7.1|DEF1_PINSY RecName: Full=Defensin-1; Flags: Precursor [Pinus sylvestris]
 gb|ABO61348.1| defensin [Pinus sylvestris]
Length=83

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSKPC  171
            +G   + VAE R C+TPS K+KG C  + NC +VCRTEGFP G C      R C C KPC
Sbjct  23   IGMMQVQVAEGRMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPC  82



>gb|ABX84377.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66997.1| defensin [Triticum aestivum]
Length=82

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TE+G  T  VAEAR C + S K+KG C    NCAS+CRTE FP G+CK     R C C +
Sbjct  21   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  80

Query  176  PC  171
             C
Sbjct  81   VC  82



>gb|AAN40688.1| putative plant defensin SPI1B [Picea abies]
Length=83

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = -3

Query  344  LGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSKPC  171
            +G   +  AE R C+TPS K+KG+C    NC +VC+TEGFP G C      R C CSKPC
Sbjct  23   IGMMQLEPAEGRTCKTPSGKFKGVCASRNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  82



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            TE+G      AEAR CE+ S K+KG C R  NCASVC++EGF  G C+G+ R C C+  C
Sbjct  12   TEMGPK---AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|ABX84378.1| amylase inhibitor-like protein [Triticum aestivum]
 gb|AIA66996.1| defensin [Triticum aestivum]
Length=82

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TE+G  T  VAEAR C + S K+KG C    NCAS+CRTE FP G+CK     R C C +
Sbjct  21   TEMGTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKR  80

Query  176  PC  171
             C
Sbjct  81   VC  82



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            L  M+F+ T +G  T+   EAR CE+ S +++G C    NC +VC  EGF  G C+G RR
Sbjct  13   LMFMIFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRR  69

Query  194  SCICSKPC  171
             C C++ C
Sbjct  70   RCFCTRHC  77



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  323  VAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRRSCICSKPC  171
            V EAR CE+ S ++KG C R  NCA+VC+TEGF  G C+G+R  C C+K C
Sbjct  28   VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  78



>ref|XP_006295860.1| hypothetical protein CARUB_v10024990mg [Capsella rubella]
 gb|EOA28758.1| hypothetical protein CARUB_v10024990mg [Capsella rubella]
Length=83

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            +FV+L         T+   + + CET S  ++G+C +  NC  VC +EGFP G CKG  R
Sbjct  12   IFVILLFLGPSMMKTVEGQDPQLCETKSLYFRGMCTKWANCKRVCISEGFPDGRCKGFIR  71

Query  194  SCICSKPC  171
             C+C KPC
Sbjct  72   DCVCRKPC  79



>dbj|BAK06284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 5/68 (7%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            + ++L + TE     +  A+AR+CE  S ++ G+C    NCA VC  EGF  G C G++R
Sbjct  38   ILLLLVVATE-----VAPAQARECEVESERFNGLCFVSANCAGVCGAEGFTGGKCSGLKR  92

Query  194  SCICSKPC  171
            SC+C+K C
Sbjct  93   SCMCTKQC  100



>gb|AIC35288.1| defensin 4 [Pinus sylvestris]
Length=83

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = -3

Query  347  ELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDC--KGIRRSCICSKP  174
             +G   + VAE R C+TPS K+KG C    NC +VCRTEGFP G C      R C C KP
Sbjct  22   SIGMMEVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKP  81

Query  173  C  171
            C
Sbjct  82   C  82



>ref|XP_002865329.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41588.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  374  LFVMLFMTTELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCKGIRR  195
            LF ++ +    G    +V   + CET S  ++G+C +  NC  VC +EGFP G CKG  R
Sbjct  11   LFFLVILVLAPGMMK-MVEGQQMCETQSINFRGMCTKWRNCQRVCMSEGFPDGRCKGFIR  69

Query  194  SCICSKPC  171
             CIC+KPC
Sbjct  70   KCICTKPC  77



>gb|ACG25019.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
Length=80

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TELG  T  VAEAR C + S ++KG+C    NCA+VC+TE FP G+CK  G  R C C K
Sbjct  21   TELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKCFCKK  78

Query  176  PC  171
             C
Sbjct  79   IC  80



>ref|NP_001147001.1| LOC100280611 precursor [Zea mays]
 gb|ACG29535.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30746.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG30775.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG34029.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|ACG43919.1| low-molecular-weight cysteine-rich protein LCR69 precursor [Zea 
mays]
 gb|AFW72423.1| low-molecular-weight cysteine-rich protein LCR69 [Zea mays]
Length=80

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = -3

Query  350  TELGRNTILVAEARKCETPSSKYKGICGRDGNCASVCRTEGFPHGDCK--GIRRSCICSK  177
            TELG  T  VAEAR C + S ++KG+C    NCA+VC+TE FP G+CK  G  R C C K
Sbjct  21   TELG--TTKVAEARHCLSQSHRFKGLCMSSNNCANVCQTENFPGGECKAEGATRKCFCKK  78

Query  176  PC  171
             C
Sbjct  79   IC  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521260953510