BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24711_g6_i1 len=629 path=[7942:0-25 8169:26-125 5764:126-169
7239:170-628]

Length=629
                                                                      Score     E

ref|XP_002525394.1|  ubiquitin, putative                                191   7e-58   Ricinus communis
gb|KGN51791.1|  hypothetical protein Csa_5G600925                       191   1e-57   
gb|ABK42077.1|  ubiquitin extension protein                             191   2e-57   Capsicum annuum
gb|KDP26615.1|  hypothetical protein JCGZ_17773                         190   2e-57   
ref|XP_011082406.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    190   2e-57   
ref|NP_001269170.1|  ubiquitin-40S ribosomal protein S27a-like          190   2e-57   
ref|XP_006424488.1|  hypothetical protein CICLE_v10029476mg             190   2e-57   
ref|XP_011003162.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    191   2e-57   
gb|AAZ83341.1|  ubiquitin extension protein                             189   4e-57   Gossypium hirsutum [American cotton]
sp|P62980.2|RS27A_SOLLC  RecName: Full=Ubiquitin-40S ribosomal pr...    189   5e-57   Solanum lycopersicum
ref|XP_011079491.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    189   6e-57   
ref|XP_006488031.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    189   6e-57   
gb|AHA83529.1|  ubiquitin extension protein                             188   7e-57   
ref|XP_004229050.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    188   1e-56   
ref|XP_008389677.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    187   2e-56   
ref|NP_001275598.1|  ubiquitin-40S ribosomal protein S27a-like          187   2e-56   
ref|XP_006374591.1|  ubiquitin/ribosomal protein 27a                    187   2e-56   
ref|XP_002270170.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    187   2e-56   Vitis vinifera
emb|CAN80663.1|  hypothetical protein VITISV_036195                     187   2e-56   Vitis vinifera
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    190   2e-56   
gb|ABN72579.1|  ubiquitin extension protein                             187   3e-56   Hevea brasiliensis [jebe]
ref|XP_011040332.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    187   3e-56   
ref|XP_003634320.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    187   3e-56   
ref|XP_004288657.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    187   4e-56   
gb|AAZ53360.1|  ubiquitin extension protein                             186   5e-56   Nicotiana tabacum [American tobacco]
ref|XP_008358198.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    186   5e-56   
ref|XP_002279878.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    186   6e-56   Vitis vinifera
ref|XP_006492389.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    186   6e-56   
ref|XP_007157375.1|  hypothetical protein PHAVU_002G065000g             186   7e-56   
gb|AIX10775.1|  ubiquitin                                               186   8e-56   
ref|XP_010040181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    186   8e-56   
ref|XP_002320950.1|  ubiquitin/ribosomal protein 27a                    186   8e-56   Populus trichocarpa [western balsam poplar]
ref|XP_001774978.1|  predicted protein                                  186   1e-55   
ref|XP_004142977.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    185   1e-55   
ref|XP_003613203.1|  Ubiquitin                                          184   3e-55   
gb|ACJ83917.1|  unknown                                                 184   3e-55   Medicago truncatula
gb|EYU38434.1|  hypothetical protein MIMGU_mgv1a015486mg                184   3e-55   
ref|XP_010248517.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    184   3e-55   
ref|XP_010941490.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    184   3e-55   
gb|AAO38879.1|  ubiquitin/ribosomal fusion protein                      184   3e-55   Malus domestica [apple tree]
ref|XP_004504241.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    184   3e-55   
ref|XP_008781194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    184   4e-55   
gb|ABI84265.1|  ubiquitin/ribosomal protein S27a                        184   4e-55   Arachis hypogaea [goober]
ref|XP_008793306.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    184   4e-55   
ref|XP_003629895.1|  Ubiquitin                                          186   4e-55   
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    186   4e-55   
gb|EPS73110.1|  hypothetical protein M569_01646                         184   5e-55   
ref|XP_009772672.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    183   7e-55   
gb|AAG13985.1|AF298826_1  ubiquitin/ribosomal protein 27a               183   8e-55   Prunus avium [gean]
ref|XP_010270924.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    183   9e-55   
gb|ADF36485.1|  ubiquitin extension protein                             183   1e-54   
gb|AAL66206.1|AF386524_1  ubiquitin extension protein                   183   1e-54   Pyrus communis
gb|AFK49579.1|  unknown                                                 183   1e-54   
ref|XP_008776477.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    183   1e-54   
gb|ACJ84122.1|  unknown                                                 182   1e-54   Medicago truncatula
ref|XP_004489824.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    182   2e-54   
gb|AFX96040.1|  ubiquitin extension protein                             182   2e-54   
gb|AFK43562.1|  unknown                                                 182   2e-54   
ref|XP_010251196.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    182   2e-54   
ref|XP_010675161.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    182   3e-54   
ref|NP_001238181.1|  uncharacterized protein LOC100527579               182   3e-54   
emb|CAA80334.1|  ubiquitin extension protein                            181   4e-54   Lupinus albus
ref|XP_001754264.1|  predicted protein                                  181   4e-54   
ref|XP_001762629.1|  predicted protein                                  181   4e-54   
gb|EYU46866.1|  hypothetical protein MIMGU_mgv1a015483mg                181   5e-54   
ref|XP_006832935.1|  hypothetical protein AMTR_s00095p00146440          181   5e-54   
gb|ABH08969.1|  ubiquitin extension protein                             181   5e-54   Morus bombycis
ref|XP_010270921.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    181   7e-54   
gb|AER12038.1|  ubiquitin extension protein                             180   8e-54   
ref|NP_001275323.1|  putative ubiquitin extension protein               181   9e-54   
gb|ABR16172.1|  unknown                                                 181   1e-53   Picea sitchensis
gb|AIH15195.1|  ubiquitin-40S ribosomal protein S27a-like protein       181   1e-53   
ref|NP_001238483.1|  uncharacterized protein LOC100527854               180   1e-53   
ref|XP_003535084.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   1e-53   
sp|P47905.2|RS27A_LUPAL  RecName: Full=Ubiquitin-40S ribosomal pr...    180   1e-53   Lupinus albus
ref|XP_010413295.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    180   1e-53   
ref|XP_008362581.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    179   1e-53   
ref|XP_006402395.1|  hypothetical protein EUTSA_v10006290mg             180   1e-53   
ref|XP_002876668.1|  hypothetical protein ARALYDRAFT_486730             180   2e-53   
ref|XP_009104378.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    179   2e-53   
ref|XP_010506742.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    179   3e-53   
ref|NP_566095.1|  ubiquitin-40S ribosomal protein S27a-2                179   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397903.1|  hypothetical protein EUTSA_v10001668mg             179   4e-53   
ref|XP_009383724.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    179   4e-53   
ref|XP_009133797.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    179   4e-53   
gb|AEI29168.1|  ubiquitin-like protein                                  177   6e-53   
ref|NP_191784.1|  ubiquitin-40S ribosomal protein S27a-3                178   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507927.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    177   2e-52   
ref|XP_009385375.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    176   4e-52   
ref|XP_009416508.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    176   4e-52   
gb|KFK35409.1|  hypothetical protein AALP_AA5G280900                    176   4e-52   
ref|XP_009116899.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    176   5e-52   
gb|AAW56553.1|  ubiquitin/s27a 40s ribosomal protein                    176   6e-52   Nicotiana benthamiana
ref|XP_006846976.1|  hypothetical protein AMTR_s00017p00094950          176   8e-52   
ref|NP_001042915.1|  Os01g0328400                                       176   9e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968668.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    176   9e-52   
ref|XP_003568865.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    176   9e-52   
ref|XP_003567648.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    175   1e-51   
gb|AEI29167.1|  ubiquitin-like protein                                  174   1e-51   
gb|AFI60245.1|  ubiquitin                                               174   3e-51   
ref|XP_009414918.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    174   3e-51   
gb|AEE98366.1|  ubiquitin                                               174   3e-51   
sp|P0CG86.1|RS271_HORVU  RecName: Full=Ubiquitin-40S ribosomal pr...    174   3e-51   
ref|XP_004977103.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    174   3e-51   
gb|ACA24140.1|  ubiquitin                                               174   4e-51   Lolium temulentum
gb|ABR29645.1|  ubiquitin                                               174   4e-51   Lolium perenne [perennial ryegrass]
ref|XP_002457768.1|  hypothetical protein SORBIDRAFT_03g013260          174   4e-51   Sorghum bicolor [broomcorn]
gb|AEO11783.1|  ubiquitin                                               173   5e-51   
gb|ADE58112.1|  ubiquitin/ribosomal fusion protein                      173   6e-51   
sp|P31753.2|RS27A_ASPOF  RecName: Full=Ubiquitin-40S ribosomal pr...    172   8e-51   Asparagus officinalis
ref|NP_001131602.1|  ubiquitin                                          172   2e-50   Zea mays [maize]
ref|XP_006654079.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    172   2e-50   
ref|NP_001054720.2|  Os05g0160200                                       172   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649366.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    171   4e-50   
ref|XP_010914705.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    172   4e-50   
ref|XP_010544941.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    171   5e-50   
ref|XP_010914702.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    173   5e-50   
ref|XP_006306408.1|  hypothetical protein CARUB_v10012327mg             171   5e-50   
gb|ABV58643.1|  ubquitin                                                170   5e-50   Catharanthus roseus [chatas]
ref|XP_002890580.1|  hypothetical protein ARALYDRAFT_472603             171   5e-50   
ref|XP_010914703.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    172   6e-50   
ref|NP_173755.1|  40S ribosomal protein S27a-1                          171   8e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010914704.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    172   8e-50   
gb|ACG31121.1|  40S ribosomal protein S27a                              170   1e-49   Zea mays [maize]
gb|AAA70104.1|  ubiquitin fusion protein                                170   1e-49   Zea mays [maize]
ref|NP_001150700.1|  40S ribosomal protein S27a                         169   2e-49   Zea mays [maize]
ref|XP_009103181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    169   2e-49   
gb|AFX60090.1|  ribosomal protein S27a                                  169   2e-49   
ref|XP_010914701.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    171   3e-49   
gb|ADU04750.1|  ubiquitin extension protein                             168   4e-49   
ref|XP_006416085.1|  hypothetical protein EUTSA_v10008988mg             168   5e-49   
ref|NP_001105472.1|  ubiquitin-40S ribosomal protein S27a               168   5e-49   Zea mays [maize]
ref|XP_010519353.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    167   9e-49   
ref|XP_008347677.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    170   1e-48   
emb|CDY04715.1|  BnaC05g18740D                                          167   1e-48   
ref|XP_010498849.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    167   1e-48   
gb|KHN22999.1|  Ubiquitin-40S ribosomal protein S27a                    166   3e-48   
ref|XP_010460127.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    166   4e-48   
ref|XP_010477636.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    166   5e-48   
gb|KFK44432.1|  hypothetical protein AALP_AA1G255700                    166   6e-48   
ref|XP_004644620.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    165   9e-48   
gb|EHH55578.1|  hypothetical protein EGM_04813                          165   1e-47   
ref|XP_006349858.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    165   2e-47   
ref|XP_003216177.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   3e-47   
ref|XP_005486911.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    165   3e-47   
gb|KGL79724.1|  Ubiquitin-40S ribosomal protein S27a                    164   3e-47   
ref|XP_009286758.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   3e-47   
gb|KFP24383.1|  Ubiquitin-40S ribosomal protein S27a                    163   3e-47   
gb|KFV68543.1|  Ubiquitin-40S ribosomal protein S27a                    164   4e-47   
ref|XP_010216499.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   4e-47   
ref|XP_010283844.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    164   4e-47   
ref|XP_010146975.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    163   4e-47   
ref|XP_005238671.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_010573169.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   4e-47   
ref|NP_990284.1|  ubiquitin-40S ribosomal protein S27a                  164   4e-47   Gallus gallus [bantam]
gb|KFP93009.1|  Ubiquitin-40S ribosomal protein S27a                    163   4e-47   
ref|XP_009929631.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_009945702.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_009926111.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_006122235.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_009480940.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_010194368.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
ref|XP_005513215.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   4e-47   
gb|KFV78322.1|  Ubiquitin-40S ribosomal protein S27a                    163   5e-47   
ref|XP_009317915.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   5e-47   
ref|XP_006001599.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   5e-47   
gb|KFW64033.1|  Ubiquitin-40S ribosomal protein S27a                    163   5e-47   
gb|AAA36788.1|  pro-ubiquitin                                           163   5e-47   Homo sapiens [man]
ref|XP_006068942.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    163   5e-47   
gb|EOB01801.1|  Ubiquitin                                               163   5e-47   
gb|EMC80037.1|  40S ribosomal protein S27a                              163   5e-47   
ref|XP_008065389.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   5e-47   
gb|ERE90935.1|  ubiquitin-40S ribosomal protein S27a-like protein       163   6e-47   
gb|KFP00438.1|  Ubiquitin-40S ribosomal protein S27a                    163   6e-47   
ref|XP_004411170.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    163   6e-47   
ref|XP_010401401.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   6e-47   
ref|XP_005018946.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   6e-47   
ref|XP_009884369.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   6e-47   
ref|NP_002945.1|  ubiquitin-40S ribosomal protein S27a precursor        163   7e-47   Homo sapiens [man]
gb|AAA57047.1|  ubiquitin                                               163   7e-47   
gb|KFP35488.1|  Ubiquitin-40S ribosomal protein S27a                    163   7e-47   
ref|XP_001104764.1|  PREDICTED: hypothetical protein LOC709143          163   7e-47   Macaca mulatta [rhesus macaque]
gb|AGC65581.1|  UBQ5                                                    163   7e-47   
ref|XP_009667383.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   8e-47   
ref|XP_006901676.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    163   8e-47   
gb|AAH53371.1|  Ribosomal protein S27a                                  163   8e-47   Homo sapiens [man]
ref|XP_008365153.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    164   8e-47   
ref|XP_008640291.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   8e-47   
ref|XP_008923123.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   9e-47   
ref|XP_009639081.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   9e-47   
ref|XP_010003219.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    165   9e-47   
dbj|BAB79488.1|  ribosomal protein S27A                                 161   1e-46   Homo sapiens [man]
ref|XP_007051235.1|  Ribosomal protein S27a / Ubiquitin family pr...    163   1e-46   
gb|ERE90934.1|  ubiquitin-40S ribosomal protein S27a-like protein       161   1e-46   
ref|XP_010595590.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    162   1e-46   
ref|XP_002733357.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    162   1e-46   Saccoglossus kowalevskii
ref|XP_003758323.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   1e-46   
gb|ACH71005.1|  ribosomal protein S27-3                                 162   1e-46   Salmo salar
ref|XP_004710327.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    162   1e-46   
ref|XP_005575916.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    163   1e-46   
ref|XP_010552656.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    162   2e-46   
gb|ACO51599.1|  Ubiquitin                                               162   2e-46   Rana catesbeiana [bullfrog]
ref|XP_010704696.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    164   2e-46   
ref|XP_004396839.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    162   2e-46   
gb|KCW58175.1|  hypothetical protein EUGRSUZ_H00892                     161   2e-46   
ref|XP_010376465.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    162   2e-46   
ref|NP_956796.1|  ubiquitin-40S ribosomal protein S27a                  162   2e-46   Danio rerio [leopard danio]
gb|AAM27203.1|AF502248_1  40s ribosomal protein S27a                    162   2e-46   Epinephelus coioides [estuary cod]
ref|XP_006887475.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    161   3e-46   
gb|KFP78128.1|  Ubiquitin-40S ribosomal protein S27a                    161   3e-46   
gb|AAA74960.1|  ribosomal protein-linked ubiquitin                      161   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009235580.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   3e-46   
ref|XP_006738708.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    161   4e-46   
ref|NP_077239.1|  ubiquitin-40S ribosomal protein S27a precursor        161   4e-46   Mus musculus [mouse]
ref|XP_007514688.1|  predicted protein                                  161   4e-46   
ref|XP_009070695.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    160   4e-46   
ref|XP_003125184.2|  PREDICTED: ubiquitin-40S ribosomal protein S27a    162   4e-46   
ref|XP_001002242.2|  PREDICTED: ubiquitin-40S ribosomal protein S...    162   5e-46   Mus musculus [mouse]
ref|XP_004643097.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    160   5e-46   
ref|XP_006083528.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    163   6e-46   
gb|AAH49478.1|  Zgc:66168 protein                                       161   6e-46   Danio rerio [leopard danio]
ref|XP_004077285.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    162   7e-46   
gb|KDO86852.1|  hypothetical protein CISIN_1g031604mg                   160   8e-46   
ref|XP_006888789.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    160   1e-45   
ref|XP_004579614.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    160   1e-45   
ref|XP_004092958.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    160   1e-45   
ref|XP_005365195.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    160   1e-45   
emb|CAG12343.1|  unnamed protein product                                159   1e-45   Tetraodon nigroviridis
ref|XP_006860476.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    159   1e-45   
ref|XP_005352920.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    159   2e-45   
ref|XP_004629417.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    159   2e-45   
ref|XP_006729877.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    159   2e-45   
ref|XP_006890603.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    159   3e-45   
gb|ACO08409.1|  Ubiquitin                                               158   5e-45   Oncorhynchus mykiss
emb|CCQ18633.1|  Ubiquitin and ubiquitin-like proteins                  160   6e-45   
gb|ACO08429.1|  Ubiquitin                                               157   9e-45   Oncorhynchus mykiss
ref|XP_007185405.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    157   1e-44   
ref|XP_004663256.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    157   1e-44   
gb|ADV40075.1|  60S ribosomal protein L40A                              157   1e-44   
ref|XP_006544136.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    158   1e-44   
gb|KIM34102.1|  hypothetical protein M408DRAFT_19058                    157   1e-44   
ref|XP_784247.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a...    157   1e-44   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005345114.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    157   2e-44   
gb|AEA51100.1|  ubiquitin                                               157   2e-44   
ref|XP_006889610.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    157   2e-44   
ref|XP_001087600.1|  PREDICTED: hypothetical protein LOC697620          157   2e-44   Macaca mulatta [rhesus macaque]
ref|XP_003504023.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    157   2e-44   
emb|CCA70746.1|  probable ubiquitin/ribosomal protein S27a fusion...    157   2e-44   
gb|ADF45325.1|  ubiquitin/ribosomal S27 fusion protein 1                156   2e-44   
ref|XP_011208987.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    156   3e-44   
ref|XP_008773015.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    156   3e-44   
ref|XP_011194777.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    156   3e-44   
ref|XP_004519374.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    156   3e-44   
ref|NP_476778.1|  ribosomal protein S27A                                156   3e-44   Drosophila melanogaster
gb|AGO97083.1|  ubiquitin                                               155   3e-44   
sp|P59272.2|RS27A_DAUCA  RecName: Full=Ubiquitin-40S ribosomal pr...    155   3e-44   Daucus carota [carrots]
ref|XP_003263604.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    156   3e-44   
ref|XP_004015152.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    156   4e-44   
ref|XP_005175708.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    156   4e-44   
ref|XP_002002882.1|  GI10618                                            155   4e-44   Drosophila mojavensis
gb|ABX75386.1|  60S ribosomal protein L40A                              155   4e-44   Lycosa singoriensis
ref|XP_007261488.1|  ubiquitin-domain-containing protein                156   4e-44   
gb|AFI80900.1|  ubiquitin/ribosomal protein S27 precursor               155   4e-44   
emb|CCO31835.1|  Ubiquitin-40S ribosomal protein S27a AltName: Fu...    155   5e-44   
gb|AEB54653.1|  ubiquitin                                               155   5e-44   
gb|ACQ59064.1|  Ubiquitin                                               155   6e-44   Anoplopoma fimbria
ref|XP_574121.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a...    155   6e-44   Rattus norvegicus [brown rat]
ref|NP_001133210.1|  ribosomal protein S27-3                            155   6e-44   Salmo salar
ref|XP_007410422.1|  hypothetical protein MELLADRAFT_71955              155   6e-44   
ref|XP_003788227.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   7e-44   
ref|XP_004652431.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   7e-44   
ref|XP_005563631.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   7e-44   
ref|XP_002825892.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    155   7e-44   
ref|XP_003272229.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   7e-44   
gb|ACX50289.1|  ubiquitin                                               155   8e-44   Scylla serrata [Indo-Pacific swamp crab]
gb|AAV84206.1|  unknown                                                 155   8e-44   Culicoides sonorensis
gb|ADF45326.1|  ubiquitin/ribosomal S27 fusion protein 2                155   1e-43   
gb|KIK50599.1|  hypothetical protein GYMLUDRAFT_51110                   155   1e-43   
ref|XP_007400913.1|  hypothetical protein PHACADRAFT_264025             154   1e-43   
ref|XP_010513784.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    153   1e-43   
ref|XP_007400915.1|  hypothetical protein PHACADRAFT_213544             154   1e-43   
gb|EGN96831.1|  hypothetical protein SERLA73DRAFT_185014                154   1e-43   
ref|XP_007343921.1|  ubiquitin-domain-containing protein                154   2e-43   
gb|ACD65153.1|  putative ubiquitin/40S ribosomal protein RPS27A f...    154   2e-43   
gb|ABR23473.1|  ubiquitin/40S ribosomal protein S27a                    154   2e-43   
ref|XP_006871713.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    154   2e-43   
gb|AFM87647.1|  ubiquitin-40S ribosomal protein S27a-like protein       154   2e-43   
gb|EHH24108.1|  hypothetical protein EGK_07704                          153   2e-43   
ref|NP_001279942.1|  ribosomal protein S27a                             154   2e-43   
gb|AFM90373.1|  ubiquitin-40S ribosomal protein S27a-like protein       154   2e-43   
gb|ACD65107.1|  putative ubiquitin/40S ribosomal protein RPS27A f...    154   2e-43   
gb|AFM86275.1|  ubiquitin-40S ribosomal protein S27a-like protein       154   3e-43   
gb|AAY66925.1|  ubiquitin/ribosomal protein S27a fusion protein         154   3e-43   
gb|AFK10704.1|  ubiquitin-40S ribosomal protein S27a-like protein       154   3e-43   
ref|XP_001831329.1|  ubiquitin-40S ribosomal protein S31 fusion p...    154   3e-43   
ref|XP_007855532.1|  ubiquitin                                          154   3e-43   
ref|XP_001874554.1|  ubiquitin-40S ribosomal protein S31 fusion p...    154   3e-43   
ref|XP_006896080.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    154   3e-43   
ref|XP_006692377.1|  40S ribosomal protein S27a-like protein            153   3e-43   
gb|ELU44102.1|  ubiquitin                                               155   3e-43   
ref|XP_005356706.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    153   3e-43   
gb|ABM74399.1|  ubiquitin                                               153   3e-43   
gb|AFM86054.1|  ubiquitin-40S ribosomal protein S27a-like protein       153   3e-43   
gb|KDQ61543.1|  hypothetical protein JAAARDRAFT_30995                   154   3e-43   
gb|EUC60885.1|  ubiquitin/40S ribosomal protein S27a fusion protein     154   3e-43   
gb|AAL55470.1|  ubiquitin/ribosomal protein S27a fusion protein         153   4e-43   
gb|KIM90371.1|  hypothetical protein PILCRDRAFT_812107                  153   4e-43   
gb|KDR80707.1|  hypothetical protein GALMADRAFT_241118                  153   4e-43   
gb|KIK67659.1|  hypothetical protein GYMLUDRAFT_215796                  153   4e-43   
gb|KIJ65589.1|  hypothetical protein HYDPIDRAFT_39518                   153   4e-43   
gb|KDQ26602.1|  hypothetical protein PLEOSDRAFT_1113129                 153   4e-43   
ref|XP_003032858.1|  ubiquitin-40S ribosomal protein S31 fusion p...    153   4e-43   
gb|KIK23888.1|  hypothetical protein PISMIDRAFT_678904                  153   4e-43   
ref|XP_007865027.1|  ubiquitin-domain-containing protein                153   4e-43   
ref|XP_007771051.1|  ubiquitin-domain-containing protein                153   4e-43   
ref|XP_007304445.1|  ubiquitin/40s ribosomal protein S27a fusion        153   4e-43   
gb|EJU03816.1|  ubiquitin                                               153   5e-43   
ref|XP_009549036.1|  hypothetical protein HETIRDRAFT_441019             153   5e-43   
gb|ABI52648.1|  ubiquitin/40S ribosomal protein S27a fusion protein     155   5e-43   
ref|XP_002399366.1|  40S ribosomal protein S27A, putative               153   5e-43   
gb|ABW23155.1|  ribosomal protein rps27a                                153   6e-43   
gb|KII87325.1|  hypothetical protein PLICRDRAFT_42950                   153   6e-43   
gb|KIJ55337.1|  hypothetical protein M422DRAFT_23939                    153   6e-43   
gb|AGO97081.1|  ubiquitin                                               152   6e-43   
gb|KIM66010.1|  hypothetical protein SCLCIDRAFT_1211653                 153   6e-43   
gb|KFB48180.1|  ubiquitin (ribosomal protein L40)                       152   7e-43   
gb|ACB70325.1|  ubiquitin/40S ribosomal protein S27a                    152   8e-43   
gb|AGF25315.1|  ubiquitin 2                                             152   9e-43   
gb|EMD39293.1|  hypothetical protein CERSUDRAFT_112941                  152   9e-43   
ref|XP_001663729.1|  ubiquitin (ribosomal protein L40)                  152   1e-42   
gb|KIK48311.1|  hypothetical protein CY34DRAFT_705963                   152   1e-42   
gb|KDQ06872.1|  hypothetical protein BOTBODRAFT_39300                   152   1e-42   
gb|KIK08837.1|  hypothetical protein K443DRAFT_671895                   152   1e-42   
gb|KDN42452.1|  hypothetical protein RSAG8_06769                        152   1e-42   
gb|AAS79344.1|  ribosomal protein S27a                                  152   2e-42   
emb|CCM02543.1|  predicted protein                                      152   2e-42   
ref|XP_004654621.1|  PREDICTED: uncharacterized protein LOC101599255    157   2e-42   
ref|XP_002469300.1|  ubiquitin/40s ribosomal protein S27a fusion        151   2e-42   
gb|ABD98741.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    151   2e-42   
ref|XP_006461860.1|  hypothetical protein AGABI2DRAFT_193235            151   2e-42   
ref|XP_006901413.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    151   2e-42   
ref|XP_007382777.1|  ubiquitin-domain-containing protein                151   2e-42   
ref|XP_007875027.1|  hypothetical protein PNEG_02980                    151   3e-42   
gb|ACF35544.1|  ubiquitin/ribosomal protein S27a fusion protein         151   3e-42   
ref|XP_001244380.1|  ubiquitin-40S ribosomal protein S31 fusion p...    151   3e-42   
ref|XP_002501200.1|  predicted protein                                  150   3e-42   
ref|XP_008029241.1|  hypothetical protein SETTUDRAFT_94331              150   3e-42   
gb|KEZ38887.1|  Ubiquitin-40S ribosomal protein S27a                    150   4e-42   
ref|XP_007913990.1|  putative ubiquitin-40s ribosomal protein s31...    150   4e-42   
dbj|GAD99010.1|  ubiquitin                                              150   4e-42   
gb|ABM55591.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    150   5e-42   
ref|XP_008076828.1|  Ubiquitin-like protein                             150   5e-42   
ref|XP_007368145.1|  ubiquitin/40s ribosomal protein S27a fusion        150   6e-42   
ref|XP_008038358.1|  ubiquitin/40s ribosomal protein S27a fusion        150   6e-42   
ref|XP_005959116.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    153   6e-42   
ref|XP_006101651.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    150   6e-42   
ref|XP_001640566.1|  predicted protein                                  150   7e-42   
gb|EPT02993.1|  hypothetical protein FOMPIDRAFT_1142989                 150   7e-42   
dbj|BAC06474.1|  ubiquitin                                              150   8e-42   
dbj|BAJ23937.1|  ribosomal protein S27a                                 150   8e-42   
ref|XP_003296988.1|  ubiquitin-40S ribosomal protein S31 fusion p...    150   8e-42   
tpg|DAA26453.1|  TPA: ubiquitin and ribosomal protein S27a-like         150   8e-42   
gb|AGO97082.1|  ubiquitin                                               149   8e-42   
gb|KIJ20902.1|  hypothetical protein PAXINDRAFT_165728                  150   9e-42   
ref|XP_007195197.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    150   1e-41   
gb|EPQ66886.1|  hypothetical protein BGT96224_2407                      149   1e-41   
gb|KDE06402.1|  ubiquitin-40S ribosomal protein S27a-1                  150   1e-41   
ref|XP_001941819.1|  ubiquitin-40S ribosomal protein S31 fusion p...    149   1e-41   
gb|EEH04179.1|  ubiquitin                                               149   1e-41   
ref|XP_754493.1|  ubiquitin (UbiC)                                      149   2e-41   
ref|XP_003326773.1|  ubiquitin-40S ribosomal protein S31 fusion p...    149   2e-41   
ref|XP_002626672.1|  ubiquitin-40S ribosomal protein S31 fusion p...    149   2e-41   
gb|KIK98182.1|  hypothetical protein PAXRUDRAFT_824145                  149   2e-41   
ref|XP_001538961.1|  ubiquitin-40S ribosomal protein S31 fusion p...    149   2e-41   
ref|XP_003839401.1|  similar to ubiquitin / ribosomal protein S27a      149   2e-41   
gb|EQB50539.1|  hypothetical protein CGLO_10017                         149   2e-41   
ref|XP_003047931.1|  ubiquitin-40S ribosomal protein S31 fusion p...    149   2e-41   
ref|XP_007779099.1|  ubiquitin-40S ribosomal protein S27a               149   3e-41   
ref|XP_002582692.1|  ubiquitin                                          148   3e-41   
ref|XP_003062279.1|  predicted protein                                  148   3e-41   
ref|XP_007453416.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    148   4e-41   
ref|XP_006833816.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    148   4e-41   
ref|XP_007166707.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    148   4e-41   
ref|XP_011123943.1|  hypothetical protein AOL_s00083g462                148   5e-41   
gb|KHJ33942.1|  putative ubiquitin-40s ribosomal protein s31 fusi...    148   5e-41   
gb|AAX62431.1|  ribosomal protein S27a                                  148   5e-41   
ref|XP_003571935.2|  PREDICTED: ubiquitin-40S ribosomal protein S...    148   5e-41   
gb|AAS59432.1|  ribosomal protein S27a                                  146   5e-41   
ref|XP_011116118.1|  hypothetical protein H072_10672                    147   5e-41   
ref|XP_007722210.1|  ubiquitin-40S ribosomal protein S27a               147   6e-41   
ref|XP_004330561.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    147   6e-41   
ref|XP_009859843.1|  PREDICTED: r27a protein isoform X1                 147   8e-41   
ref|XP_005864530.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    147   8e-41   
gb|KEY73810.1|  hypothetical protein S7711_03110                        147   8e-41   
ref|NP_001027675.1|  r27a protein                                       147   8e-41   
ref|XP_004637391.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    147   9e-41   
ref|XP_007583549.1|  putative ubiquitin-40s ribosomal protein s31...    147   1e-40   
ref|XP_008216204.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    147   1e-40   
gb|AGF25314.1|  ubiquitin 1                                             146   1e-40   
ref|XP_004891890.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    147   1e-40   
gb|KIH93873.1|  small subunit ribosomal protein S27Ae                   147   1e-40   
gb|AGN29645.1|  40S ribosomal protein S27a                              147   1e-40   
ref|XP_007841585.1|  Ubiquitin-40S ribosomal protein S27a               147   1e-40   
gb|KEF62640.1|  ubiquitin-40S ribosomal protein S27a                    146   1e-40   
gb|AGN29644.1|  40S ribosomal protein S27a                              146   2e-40   
ref|XP_007115679.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    146   2e-40   
emb|CEF98605.1|  Ubiquitin supergroup                                   146   2e-40   
dbj|GAA93464.1|  hypothetical protein E5Q_00105                         151   2e-40   
ref|XP_006866205.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    146   2e-40   
gb|EUC60891.1|  ubiquitin/40S ribosomal protein S27a fusion protein     154   2e-40   
ref|XP_007795786.1|  putative ubiquitin-40s ribosomal protein s31...    146   2e-40   
gb|ELR03817.1|  ubiquitin-40S ribosomal protein S27a                    146   2e-40   
gb|ABM55417.1|  ribosomal protein S27                                   146   3e-40   
ref|XP_003400429.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    146   3e-40   
ref|XP_009159055.1|  ubiquitin-40S ribosomal protein S27a               146   3e-40   
dbj|BAC56381.1|  similar to ubiquitin-S27a fusion protein               145   3e-40   
gb|ETN58928.1|  hypothetical protein AND_009492                         152   4e-40   
ref|XP_003799950.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    145   4e-40   
emb|CAJ01876.1|  ubiquitin/ribosomal protein S27Ae fusion protein       145   4e-40   
gb|KFH46012.1|  Ubiquitin-40S ribosomal protein-like protein            145   5e-40   
emb|CCF45248.1|  ubiquitin-40S ribosomal protein S27a                   145   5e-40   
gb|ABX44800.1|  ubiquinated putative 40S ribosomal protein RPS27A       145   6e-40   
ref|XP_391117.1|  hypothetical protein FG10941.1                        145   6e-40   
ref|XP_003707148.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    145   6e-40   
emb|CAJ01879.1|  ubiquitin/ribosomal protein S27Ae fusion protein       145   7e-40   
ref|XP_006968883.1|  ubiquitin/small ribosomal subunit protein 31...    144   9e-40   
ref|XP_011159939.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    144   1e-39   
emb|CAH04347.1|  ubiquitin/S27Ae ribosomal protein                      144   1e-39   
ref|XP_011142713.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    144   1e-39   
emb|CAJ01881.1|  ubiquitin/ribosomal protein S27Ae fusion protein       144   1e-39   
ref|XP_007603155.1|  ubiquitin-40S ribosomal protein S27a               143   1e-39   
gb|KDR17238.1|  Ubiquitin                                               144   1e-39   
gb|ABN54483.1|  putative ubiquitin/ribosomal protein S27Ae fusion...    144   1e-39   
ref|XP_005586401.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   1e-39   
ref|XP_760735.1|  hypothetical protein UM04588.1                        144   1e-39   
emb|CDI55091.1|  probable ubiquitin/ribosomal protein S27a fusion...    144   1e-39   
gb|AGM32388.1|  ubiquitin-40S ribosomal protein                         144   1e-39   
ref|XP_004269939.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   1e-39   
emb|CBQ69010.1|  probable ubiquitin/ribosomal protein S27a fusion...    144   1e-39   
gb|AFS89619.1|  ubiquitin ribosomal protein RpS27a                      144   1e-39   
sp|P68202.2|RS27A_PLUXY  RecName: Full=Ubiquitin-40S ribosomal pr...    144   1e-39   
emb|CCF48698.1|  probable ubiquitin/ribosomal protein S27a fusion...    144   1e-39   
ref|XP_006731505.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   2e-39   
dbj|BAK02751.1|  predicted protein                                      144   2e-39   
emb|CCT71659.1|  probable ubiquitin/ribosomal protein S27a fusion...    144   2e-39   
ref|XP_004424623.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   2e-39   
ref|XP_007877229.1|  hypothetical protein PFL1_06937                    144   2e-39   
gb|AIY34646.1|  ribosomal protein                                       144   2e-39   
gb|KDN53338.1|  ubiquitin/40s ribosomal protein S27a fusion             144   2e-39   
ref|XP_397323.2|  PREDICTED: ribosome biogenesis protein NSA2 hom...    143   3e-39   
ref|XP_969023.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a       143   3e-39   
ref|XP_008875293.1|  ubiquitin-40S ribosomal protein S27a               143   3e-39   
gb|ESA15414.1|  hypothetical protein GLOINDRAFT_346052                  143   3e-39   
emb|CAH04128.1|  ubiquitin/ribosomal protein S27Ae fusion protein       143   3e-39   
sp|P68203.2|RS27A_SPOFR  RecName: Full=Ubiquitin-40S ribosomal pr...    143   3e-39   
sp|P29504.2|RS27A_MANSE  RecName: Full=Ubiquitin-40S ribosomal pr...    143   3e-39   
ref|XP_004318058.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    145   3e-39   
gb|EHJ77179.1|  Ubiquitin-40S ribosomal protein S27a                    143   3e-39   
ref|XP_006921707.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   4e-39   
ref|XP_011062194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   4e-39   
ref|XP_006747376.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    142   5e-39   
gb|EHH58652.1|  hypothetical protein EGM_08555                          142   6e-39   
gb|EMS21244.1|  small subunit ribosomal protein S27Ae                   142   7e-39   
ref|XP_005886667.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    142   7e-39   
emb|CAJ01880.1|  ubiquitin/ribosomal protein S27Ae fusion protein       142   7e-39   
gb|ABG46422.1|  ubiquitin/ribosomal protein S27 fusion protein          142   1e-38   
dbj|BAD05031.1|  ubiquitin                                              142   1e-38   
ref|NP_001155610.1|  ribosomal protein S27A-like                        141   1e-38   
gb|AAX48904.1|  S27a-ubiquitin                                          141   1e-38   
emb|CAA76578.1|  ubiquitin                                              141   1e-38   
ref|XP_009531416.1|  hypothetical protein PHYSODRAFT_355036             142   1e-38   
ref|XP_008608418.1|  ubiquitin-40S ribosomal protein S27a               141   1e-38   
ref|XP_001746700.1|  hypothetical protein                               141   2e-38   
ref|NP_001091826.1|  ubiquitin and ribosomal protein S27a               141   2e-38   
dbj|GAK66487.1|  ubiquitin/40S ribosomal protein S27a fusion            141   2e-38   
ref|XP_001091566.2|  PREDICTED: hypothetical protein LOC703267          142   2e-38   
ref|XP_007295337.1|  putative ubiquitin / ribosomal protein S27a        145   3e-38   
ref|XP_001729434.1|  hypothetical protein MGL_3469                      140   3e-38   
ref|XP_003851546.1|  ubiquitin-40S ribosomal protein S31                140   3e-38   
ref|XP_002902716.1|  ubiquitin, putative                                140   4e-38   
gb|AGH68503.1|  ubiquitin extension protein                             139   4e-38   
ref|XP_006158522.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   5e-38   
ref|XP_008480202.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    140   5e-38   
ref|XP_007928008.1|  hypothetical protein MYCFIDRAFT_54296              139   8e-38   
gb|EZA60553.1|  Ubiquitin-40S ribosomal protein S27a                    139   2e-37   
tpg|DAA31720.1|  TPA: ubiquitin and ribosomal protein S27a-like         139   2e-37   
ref|XP_006082981.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    138   2e-37   
ref|XP_006675175.1|  hypothetical protein BATDEDRAFT_18421              138   5e-37   
gb|EDL32307.1|  mCG9114                                                 137   5e-37   
ref|XP_002173465.1|  ribomal-ubiquitin fusion protein Ubi5              137   6e-37   
gb|ABZ04273.1|  ribosomal protein rps27a                                137   6e-37   
gb|KIL69292.1|  hypothetical protein M378DRAFT_775165                   137   7e-37   
ref|XP_009266087.1|  Ubiquitin-40S ribosomal protein S27a               137   9e-37   
gb|AFK78215.1|  putative ribosomal protein                              137   9e-37   
ref|XP_005109406.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    137   9e-37   
ref|XP_005317555.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    136   1e-36   
gb|ADK34019.1|  ubiquitin-Like family 1                                 137   1e-36   
ref|XP_005894970.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    136   1e-36   
ref|XP_002172480.1|  ribomal-ubiquitin fusion protein Ubi5              136   1e-36   
ref|XP_004646267.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    136   1e-36   



>ref|XP_002525394.1| ubiquitin, putative [Ricinus communis]
 ref|XP_009617530.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009629268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009761349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 ref|XP_009773069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 emb|CAA11268.1| ubiquitin extension protein [Nicotiana tabacum]
 gb|AAX07419.1| ubiquitin/s27a 40S ribosomal protein [Nicotiana benthamiana]
 gb|EEF37032.1| ubiquitin, putative [Ricinus communis]
Length=156

 Score =   191 bits (485),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG+D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGAD  156



>gb|KGN51791.1| hypothetical protein Csa_5G600925 [Cucumis sativus]
Length=188

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  71   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  130

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  131  KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  188



>gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum]
Length=179

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  62   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  121

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  122  KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  179



>gb|KDP26615.1| hypothetical protein JCGZ_17773 [Jatropha curcas]
Length=156

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTY KPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYPKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|XP_011082406.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
 gb|AFJ42574.1| ubiquitin extension protein 5 [Sesamum indicum]
 gb|KDP45613.1| hypothetical protein JCGZ_17220 [Jatropha curcas]
Length=156

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|NP_001269170.1| ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus]
 ref|XP_008446192.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cucumis melo]
 gb|AAQ76040.1| ubiquitin extension protein [Cucumis sativus]
 gb|ADN33826.1| ubiquitin extension protein [Cucumis melo subsp. melo]
Length=156

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
 gb|ESR37728.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
Length=156

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAGSD
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGSD  156



>ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=202

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  85   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  144

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  145  KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  202



>gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum]
Length=156

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>sp|P62980.2|RS27A_SOLLC RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum lycopersicum]
 sp|P62981.2|RS27A_SOLTU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum tuberosum]
 emb|CAA41207.1| ubiquitin [Solanum lycopersicum]
 emb|CAA77735.1| ubiquitin monomer/ribosomal protein [Solanum tuberosum]
 gb|AAA19247.1| ubiquitin/ribosomal fusion protein [Solanum tuberosum]
Length=156

 Score =   189 bits (480),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD++GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|XP_011079491.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
Length=156

 Score =   189 bits (479),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLR+ECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLREECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
Length=164

 Score =   189 bits (480),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  47   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  106

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  107  KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  164



>gb|AHA83529.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKV++SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|XP_004229050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Solanum lycopersicum]
Length=156

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL VLQFYKVD++GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLTVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008389867.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008343199.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008350959.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008353873.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008360710.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_009363083.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009367168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009376181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
Length=156

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [Solanum tuberosum]
 ref|XP_002297752.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_002301539.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 ref|XP_002515213.1| ubiquitin, putative [Ricinus communis]
 ref|XP_004252948.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252949.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252950.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_006376957.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_006438329.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 ref|XP_006483898.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 ref|XP_007044700.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 ref|XP_007221513.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 ref|XP_007223652.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 ref|XP_008227802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Prunus mume]
 ref|XP_009609224.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609225.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609226.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009775091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_009775093.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_010044607.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eucalyptus grandis]
 ref|XP_010999619.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Populus euphratica]
 emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum]
 gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum]
 gb|ABK92566.1| unknown [Populus trichocarpa]
 gb|ABK93901.1| unknown [Populus trichocarpa]
 gb|ABK94236.1| unknown [Populus trichocarpa]
 gb|ABK94239.1| unknown [Populus trichocarpa]
 gb|ABK94284.1| unknown [Populus trichocarpa]
 gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba]
 gb|EEE80812.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 gb|EEE82557.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|EEF47197.1| ubiquitin, putative [Ricinus communis]
 gb|EMJ22712.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 gb|EMJ24851.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 gb|EOY00532.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|ERP54754.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ESR51569.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 gb|KCW86699.1| hypothetical protein EUGRSUZ_B03309 [Eucalyptus grandis]
 gb|KDO60231.1| hypothetical protein CISIN_1g031613mg [Citrus sinensis]
 emb|CDO98715.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_006374591.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ERP52388.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
Length=156

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>emb|CAN80663.1| hypothetical protein VITISV_036195 [Vitis vinifera]
Length=156

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  115  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  174

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  175  KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  232


 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  114
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  76



>gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_011040332.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=156

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN75420.1| hypothetical protein VITISV_037877 [Vitis vinifera]
Length=156

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPN+ECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNSECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Fragaria 
vesca subsp. vesca]
 ref|XP_004297391.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Fragaria 
vesca subsp. vesca]
 gb|AEQ75492.1| ubiquitin extension protein [Rosa multiflora]
Length=156

 Score =   187 bits (474),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQ+LRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQKLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>gb|AAZ53360.1| ubiquitin extension protein [Nicotiana tabacum]
Length=156

 Score =   186 bits (473),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAG+FMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGSFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=156

 Score =   186 bits (473),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY +AG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQRAGGD  156



>ref|XP_002279878.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN71283.1| hypothetical protein VITISV_027093 [Vitis vinifera]
 emb|CAN70884.1| hypothetical protein VITISV_029192 [Vitis vinifera]
 gb|KDP28317.1| hypothetical protein JCGZ_14088 [Jatropha curcas]
Length=156

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG +
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGE  156



>ref|XP_006492389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 gb|KDO86853.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=156

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMA+HFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMASHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_007157375.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 ref|XP_007157378.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
 gb|ESW29369.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 gb|ESW29372.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
Length=155

 Score =   186 bits (472),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG+
Sbjct  99   KLAILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGA  155



>gb|AIX10775.1| ubiquitin, partial [Panax notoginseng]
Length=155

 Score =   186 bits (472),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  38   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  97

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKV++SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  98   KLAVLQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  155



>ref|XP_010040181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
 gb|KCW45422.1| hypothetical protein EUGRSUZ_L00891 [Eucalyptus grandis]
Length=156

 Score =   186 bits (472),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNGECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_002320950.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_011040582.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
 gb|ABK92725.1| unknown [Populus trichocarpa]
 gb|EEE99265.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   186 bits (471),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY  AG D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQTAGGD  156



>ref|XP_001774978.1| predicted protein [Physcomitrella patens]
 gb|EDQ60244.1| predicted protein [Physcomitrella patens]
Length=156

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG++
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNPECGAGTFMANHFDRHYCGKCGLTYVYQKAGAE  156



>ref|XP_004142977.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 ref|XP_004172998.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cucumis 
sativus]
 gb|KGN62301.1| Ubiquitin extension protein [Cucumis sativus]
Length=156

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL+VLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY K G D
Sbjct  99   KLSVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKPGGD  156



>ref|XP_003613203.1| Ubiquitin [Medicago truncatula]
 gb|AES96161.1| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA +
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKADA  155



>gb|ACJ83917.1| unknown [Medicago truncatula]
 gb|ACJ86209.1| unknown [Medicago truncatula]
 gb|AET04371.2| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|EYU38434.1| hypothetical protein MIMGU_mgv1a015486mg [Erythranthe guttata]
Length=156

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL+VLQ+YK+D+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLSVLQYYKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYAKAGGD  156



>ref|XP_010248517.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nelumbo nucifera]
Length=156

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLA+LQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLALLQFYKVDDSGKVQRLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_010941490.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=156

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG +
Sbjct  99   KLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGE  156



>gb|AAO38879.1| ubiquitin/ribosomal fusion protein [Malus domestica]
Length=156

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLED RTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDNRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SG+VQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKVDDSGQVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_004504241.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_008781194.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_008810072.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_010921349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Elaeis guineensis]
Length=156

 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG +
Sbjct  99   KLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGE  156



>gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea]
Length=155

 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLA+LQFYK+D+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA +
Sbjct  99   KLAILQFYKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAAA  155



>ref|XP_008793306.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Phoenix dactylifera]
Length=156

 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD++GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG++
Sbjct  99   KLAVLQFYKVDDTGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGAE  156



>ref|XP_003629895.1| Ubiquitin [Medicago truncatula]
Length=232

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  116  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  175

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  176  KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  230



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  115  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  174

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG +
Sbjct  175  KLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGDE  232


 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  114
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  76



>gb|EPS73110.1| hypothetical protein M569_01646, partial [Genlisea aurea]
Length=157

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  40   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  99

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLA+L FYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKC LTYVYNKAG +
Sbjct  100  KLAILHFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCNLTYVYNKAGGE  157



>ref|XP_009772672.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
Length=156

 Score =   183 bits (465),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLED RTLADYN+QKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDDRTLADYNLQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHY GKCGLTYVYNKAG+D
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYYGKCGLTYVYNKAGAD  156



>gb|AAG13985.1|AF298826_1 ubiquitin/ribosomal protein 27a [Prunus avium]
Length=156

 Score =   183 bits (465),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYK D+SGKVQ+LRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAVLQFYKGDDSGKVQKLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_010270924.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   183 bits (464),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL VLQFYKVD+SGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVY KAG +
Sbjct  99   KLPVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKAGGE  156



>gb|ADF36485.1| ubiquitin extension protein [Ageratina adenophora]
 gb|AID52926.1| ubiquitin [Carthamus tinctorius]
Length=153

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KL+VLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLSVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|AAL66206.1|AF386524_1 ubiquitin extension protein [Pyrus communis]
Length=154

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/116 (97%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KLAVLQFYKVD+S KVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG
Sbjct  99   KLAVLQFYKVDDSRKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAG  154



>gb|AFK49579.1| unknown [Lotus japonicus]
Length=155

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY K  +
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKPTA  155



>ref|XP_008776477.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Phoenix 
dactylifera]
Length=162

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKV RLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG +
Sbjct  99   KLAVLQFYKVDDSGKVTRLRKECPNVECGAGTFMANHFDRHYCGKCGLTYVYQKAGGE  156



>gb|ACJ84122.1| unknown [Medicago truncatula]
Length=155

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD+SG VQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA +
Sbjct  99   KLAVLQFYKVDDSGTVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKADA  155



>ref|XP_004489824.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY K  +
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKTDA  155



>gb|AFX96040.1| ubiquitin extension protein [Grimmia pilifera]
Length=156

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVY KA ++
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNPDCGAGTFMANHFDRHYCGKCGLTYVYQKAAAE  156



>gb|AFK43562.1| unknown [Medicago truncatula]
Length=155

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCG TYVY KA
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGPTYVYQKA  153



>ref|XP_010251196.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL++LQFYKVD+SGKVQ+LRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLSLLQFYKVDDSGKVQKLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_010675161.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Beta vulgaris 
subsp. vulgaris]
Length=156

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL VLQFYKV +S K+QRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLPVLQFYKVSDSAKIQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|NP_001238181.1| uncharacterized protein LOC100527579 [Glycine max]
 ref|XP_003517689.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
 gb|ACU16690.1| unknown [Glycine max]
 gb|KHN00366.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
 gb|KHN14565.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=155

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KL +LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLGILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>emb|CAA80334.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCG TYVY KA +
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGQTYVYQKADA  155



>ref|XP_001754264.1| predicted protein [Physcomitrella patens]
 ref|XP_001762712.1| predicted protein [Physcomitrella patens]
 gb|EDQ72511.1| predicted protein [Physcomitrella patens]
 gb|EDQ80714.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNPDCGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>ref|XP_001762629.1| predicted protein [Physcomitrella patens]
 gb|EDQ72428.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNPDCGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|EYU46866.1| hypothetical protein MIMGU_mgv1a015483mg [Erythranthe guttata]
Length=156

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL+VLQ+YK+D+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY K   D
Sbjct  99   KLSVLQYYKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYAKTAGD  156



>ref|XP_006832935.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
 gb|ERM98213.1| hypothetical protein AMTR_s00095p00146440 [Amborella trichopoda]
Length=156

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL +LQFYKVD+SGKVQ++RKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG++
Sbjct  99   KLPILQFYKVDDSGKVQKIRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQKAGAE  156



>gb|ABH08969.1| ubiquitin extension protein [Morus bombycis]
Length=156

 Score =   181 bits (459),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLA LQFYK+D+SGKV RLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  99   KLAALQFYKIDDSGKVSRLRKECPNDECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  156



>ref|XP_010270921.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nelumbo 
nucifera]
Length=156

 Score =   181 bits (459),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KL VLQFYKVD+SGKVQRLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLPVLQFYKVDDSGKVQRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYQKA  153



>gb|AER12038.1| ubiquitin extension protein, partial [Paeonia suffruticosa]
Length=140

 Score =   180 bits (457),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  23   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  82

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVY KA  +
Sbjct  83   KLAVLQFYKVDDSGKVQRLRKECPNGDCGAGTFMANHFDRHYCGKCGLTYVYKKAADE  140



>ref|NP_001275323.1| putative ubiquitin extension protein [Solanum tuberosum]
 gb|ABY21245.1| putative ubiquitin extension protein [Solanum tuberosum]
Length=156

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTY KPKKIK K KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYAKPKKIKPKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD++GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG D
Sbjct  99   KLAVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD  156



>gb|ABR16172.1| unknown [Picea sitchensis]
 gb|ABR16495.1| unknown [Picea sitchensis]
 gb|ABR16621.1| unknown [Picea sitchensis]
Length=156

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQ+YKVD+SGKVQRLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVY KA ++
Sbjct  99   KLAVLQYYKVDDSGKVQRLRKECPNQDCGAGTFMANHFDRHYCGKCGLTYVYQKAAAE  156



>gb|AIH15195.1| ubiquitin-40S ribosomal protein S27a-like protein [Hedychium 
coronarium]
Length=157

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQ+YKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG++
Sbjct  99   KLAVLQYYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGAE  157



>ref|NP_001238483.1| uncharacterized protein LOC100527854 [Glycine max]
 gb|ACU17047.1| unknown [Glycine max]
Length=155

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFD HYCGKCGLTYVY KA
Sbjct  99   KLALLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDPHYCGKCGLTYVYQKA  153



>ref|XP_003535084.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
Length=155

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLA+LQFYKVD+SGK+QRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY K+
Sbjct  99   KLALLQFYKVDDSGKLQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKS  153



>sp|P47905.2|RS27A_LUPAL RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Lupinus albus]
 emb|CAA80333.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD+SGKVQRLRKECPN ECGAGTFMANHFDRHYCGKCG TYVY KA +
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNTECGAGTFMANHFDRHYCGKCGKTYVYQKADA  155



>ref|XP_010413295.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
Length=157

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYK+D SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G D
Sbjct  99   KLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGGD  156



>ref|XP_008362581.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial 
[Malus domestica]
Length=115

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  10   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkLA  189
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA
Sbjct  1    RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLA  60

Query  190  VLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            VLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KAG D
Sbjct  61   VLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD  115



>ref|XP_006402395.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
 gb|ESQ43848.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
Length=157

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G++
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGAE  156



>ref|XP_002876668.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293091.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
 ref|XP_010512610.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010468976.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 gb|EFH52927.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA25989.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
Length=157

 Score =   180 bits (456),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYK+D SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G D
Sbjct  99   KLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGGD  156



>ref|XP_009104378.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3 [Brassica rapa]
 emb|CDY66301.1| BnaA04g27270D [Brassica napus]
 emb|CDY25100.1| BnaC06g18420D [Brassica napus]
 emb|CDY11410.1| BnaA09g39760D [Brassica napus]
 emb|CDX93983.1| BnaC04g21420D [Brassica napus]
 emb|CDX76623.1| BnaC08g32090D [Brassica napus]
 emb|CDX67885.1| BnaA07g19250D [Brassica napus]
Length=157

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G++
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGAE  156



>ref|XP_010506742.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G+
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGA  155



>ref|NP_566095.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|NP_001189768.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|XP_002880283.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006296217.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
 sp|P59232.2|R27AB_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK53000.1|AF375416_1 At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAA32907.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAC34235.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM65909.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM98297.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAN28749.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|EFH56542.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10801.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|AEC10802.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|EOA29115.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
Length=157

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGS  351
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G+
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGA  155



>ref|XP_006397903.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
 gb|ESQ39356.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
Length=157

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G +
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGGE  156



>ref|XP_009383724.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA +D
Sbjct  99   KLAVLQFYKVDDATGKVSRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYTKAQAD  157



>ref|XP_009133797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
 emb|CDY50916.1| BnaC03g72450D [Brassica napus]
 emb|CDX83344.1| BnaA03g21620D [Brassica napus]
Length=157

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G +
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGGE  156



>gb|AEI29168.1| ubiquitin-like protein [Phragmipedium longifolium]
Length=125

 Score =   177 bits (450),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  8    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  67

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KL VLQFYKVD+SGKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  68   KLPVLQFYKVDDSGKVARLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  122



>ref|NP_191784.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
 sp|P59233.2|R27AC_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-3; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32906.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 emb|CAB71885.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 gb|AAK97689.1| AT3g62250/T17J13_210 [Arabidopsis thaliana]
 gb|AAM61537.1| ubiquitin extension protein UBQ5 [Arabidopsis thaliana]
 gb|AAM98116.1| At3g62250/T17J13_210 [Arabidopsis thaliana]
 dbj|BAE98979.1| ubiquitin extension protein [Arabidopsis thaliana]
 gb|AEE80327.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
Length=157

 Score =   178 bits (451),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYK+D SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G +
Sbjct  99   KLAVLQFYKIDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGVE  156



>ref|XP_010507927.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010518402.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKH+KV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHRKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQK  152



>ref|XP_009385375.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=158

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 112/116 (97%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  154



>ref|XP_009416508.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391524.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414159.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 112/116 (97%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA  154



>gb|KFK35409.1| hypothetical protein AALP_AA5G280900 [Arabis alpina]
 gb|KFK37468.1| hypothetical protein AALP_AA4G260800 [Arabis alpina]
Length=157

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G +
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGVE  156



>ref|XP_009116899.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
Length=157

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYN QKESTLHLVL LRGGAKKRKKKTYTKPKK + KHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNTQKESTLHLVLPLRGGAKKRKKKTYTKPKKNERKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYVY K G++
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYVYQKEGAE  156



>gb|AAW56553.1| ubiquitin/s27a 40s ribosomal protein [Nicotiana benthamiana]
Length=156

 Score =   176 bits (446),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  4    QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkvk  183
            QQRLIFAGKQ+EDG TLADYNIQKESTLHLVLRL GGAKKRKKKTYTKPKKIKHK KKVK
Sbjct  40   QQRLIFAGKQVEDGCTLADYNIQKESTLHLVLRLHGGAKKRKKKTYTKPKKIKHKKKKVK  99

Query  184  LAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            LAVLQFYKVD+SGKVQRLRKECPNA+CGAGT+MANHFDR+YCGKCGLTYVYNKAG+D
Sbjct  100  LAVLQFYKVDDSGKVQRLRKECPNAKCGAGTYMANHFDRYYCGKCGLTYVYNKAGAD  156



>ref|XP_006846976.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
 gb|ERN08557.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
Length=156

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL VLQFYKVD+SGKVQ+LRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KAG++
Sbjct  99   KLPVLQFYKVDDSGKVQKLRKECPNQECGAGTFMANHFDRHYCGKCGLTYVYQKAGAE  156



>ref|NP_001042915.1| Os01g0328400 [Oryza sativa Japonica Group]
 ref|XP_006644130.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Oryza 
brachyantha]
 sp|Q9ARZ9.1|R27AA_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB39294.1| ubiquitin / ribosomal protein S27a.1 [Oryza sativa Japonica Group]
 dbj|BAF04829.1| Os01g0328400 [Oryza sativa Japonica Group]
 gb|EAY73811.1| hypothetical protein OsI_01687 [Oryza sativa Indica Group]
 gb|EAY73815.1| hypothetical protein OsI_01691 [Oryza sativa Indica Group]
 gb|EAZ11698.1| hypothetical protein OsJ_01558 [Oryza sativa Japonica Group]
 dbj|BAG88191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=155

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_004968668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Setaria 
italica]
Length=155

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_003568865.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Brachypodium 
distachyon]
 dbj|BAJ88878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_003567648.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Brachypodium 
distachyon]
 sp|P0CG87.1|RS272_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62699.1| ubiquitin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92072.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDES-GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+S GKV RLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDSTGKVTRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>gb|AEI29167.1| ubiquitin-like protein [Phalaenopsis hybrid cultivar]
Length=125

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  8    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  67

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KL VLQFYKVD+SGK+ RLRKECPN ECGAGTFMANHFDRHYCGKCGLTYVY KA
Sbjct  68   KLPVLQFYKVDDSGKMVRLRKECPNGECGAGTFMANHFDRHYCGKCGLTYVYQKA  122



>gb|AFI60245.1| ubiquitin, partial [Panicum virgatum]
Length=153

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  37   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  96

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  97   KLAVLQFYKVDDATGKVTRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYNQ  151



>ref|XP_009414918.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Musa 
acuminata subsp. malaccensis]
Length=167

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/116 (94%), Positives = 112/116 (97%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY K+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKS  154



>gb|AEE98366.1| ubiquitin [Deschampsia antarctica]
Length=155

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLALLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>sp|P0CG86.1|RS271_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62698.1| ubiquitin [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_004977103.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Setaria 
italica]
Length=155

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 113/115 (98%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNA+CGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNADCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>gb|ACA24140.1| ubiquitin [Lolium temulentum]
Length=155

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLALLQFYKVDDGTGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>gb|ABR29645.1| ubiquitin, partial [Lolium perenne]
Length=155

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLALLQFYKVDDGTGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_002457768.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 ref|XP_008655871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|EES02888.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 gb|AFW80667.1| polyubiquitin-like protein isoform 1 [Zea mays]
 gb|AFW80668.1| polyubiquitin-like protein isoform 2 [Zea mays]
Length=155

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPNAECGAG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNAECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>gb|AEO11783.1| ubiquitin [Lolium perenne]
Length=147

 Score =   173 bits (439),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  32   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  91

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  92   KLALLQFYKVDDGTGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  146



>gb|ADE58112.1| ubiquitin/ribosomal fusion protein [Citrus trifoliata]
Length=156

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLA+YNIQKESTLH VLR RGGAKK KKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLAEYNIQKESTLHFVLRFRGGAKKSKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLA LQF KVD+SGKVQRLRKECPNAECGAG FMANHFDR YCGKCGLTYVY KAG D
Sbjct  99   KLAFLQFSKVDDSGKVQRLRKECPNAECGAGPFMANHFDRQYCGKCGLTYVYQKAGGD  156



>sp|P31753.2|RS27A_ASPOF RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor, partial [Asparagus officinalis]
 emb|CAA47346.1| Ubiquitin /Ribosomal peptide [Asparagus officinalis]
Length=118

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  3    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  62

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD++GKV RLRKECPNAECGAGTFMANH DRHYCGKCGLTYVY K 
Sbjct  63   KLAVLQFYKVDDTGKVIRLRKECPNAECGAGTFMANHKDRHYCGKCGLTYVYQKG  117



>ref|NP_001131602.1| ubiquitin [Zea mays]
 ref|XP_002439338.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 sp|P27923.2|RS27A_MAIZE RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Zea mays]
 pir||JS0657 ubiquitin / ribosomal protein S27a - maize
 gb|AAA33519.1| ubiquitin fusion protein [Zea mays]
 gb|AAA70105.1| ubiquitin fusion protein [Zea mays]
 gb|ACF80088.1| unknown [Zea mays]
 gb|EES17768.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 gb|AFW84849.1| ubiquitin-40S ribosomal protein S27a Precursor [Zea mays]
 prf||2211240B ubiquitin fusion protein
Length=155

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPN ECGAG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNTECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_006654079.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oryza brachyantha]
Length=155

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNNDCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|NP_001054720.2| Os05g0160200 [Oryza sativa Japonica Group]
 sp|P51431.3|R27AB_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Oryza sativa Japonica 
Group]
 pdb|3J60|FF Chain f, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAT93912.1| putative ubiquitin extension protein [Oryza sativa Japonica Group]
 gb|AAV43924.1| putative ubiquitin fusion protein [Oryza sativa Japonica Group]
 gb|ABR25414.1| 40S ribosomal protein S27a [Oryza sativa Indica Group]
 dbj|BAG99770.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62418.1| hypothetical protein OsJ_17209 [Oryza sativa Japonica Group]
 dbj|BAF16634.2| Os05g0160200 [Oryza sativa Japonica Group]
Length=155

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPN +CGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNNDCGAGTFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_008649366.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|ACG24702.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG24773.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG36278.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG38230.1| 40S ribosomal protein S27a [Zea mays]
 gb|AFW77223.1| polyubiquitin-like protein [Zea mays]
Length=155

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KL+VLQFYKVD+ +GKV RLRKECPN ECGAG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLSVLQFYKVDDATGKVTRLRKECPNTECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010914705.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X5 [Elaeis guineensis]
Length=188

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 109/116 (94%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKI HK KKV
Sbjct  73   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKV  132

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDRHYCGKCGL  VY KAG
Sbjct  133  KLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>ref|XP_010544941.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Tarenaya 
hassleriana]
 ref|XP_010523893.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Tarenaya hassleriana]
Length=155

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 111/118 (94%), Gaps = 2/118 (2%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD S KVQRLRKECPN  CGAGTFMA+HFDRHYCGKCGLTYVY K G D
Sbjct  99   KLAVLQFYKVDGSNKVQRLRKECPN--CGAGTFMASHFDRHYCGKCGLTYVYQKDGGD  154



>ref|XP_010914702.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Elaeis guineensis]
Length=211

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKI HK KKV
Sbjct  73   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKV  132

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDRHYCGKCGL  VY KAG +
Sbjct  133  KLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCGKCGLN-VYQKAGGE  189



>ref|XP_006306408.1| hypothetical protein CARUB_v10012327mg [Capsella rubella]
 gb|EOA39306.1| hypothetical protein CARUB_v10012327mg [Capsella rubella]
Length=156

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRLRKECP+A CG GTFMA+HFDRHYCGKCG TYV+ K 
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSASCGPGTFMASHFDRHYCGKCGTTYVFKKP  153



>gb|ABV58643.1| ubquitin, partial [Catharanthus roseus]
Length=124

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/111 (97%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  14   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  73

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYV  333
            KLAVLQFYKVD SGKVQRLRKECPNA CGAGTFMA+HFDRHYCGKCGLTYV
Sbjct  74   KLAVLQFYKVDGSGKVQRLRKECPNATCGAGTFMASHFDRHYCGKCGLTYV  124



>ref|XP_002890580.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66839.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ KA
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKA  153



>ref|XP_010914703.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Elaeis guineensis]
Length=207

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 109/116 (94%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKI HK KKV
Sbjct  73   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKV  132

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDRHYCGKCGL  VY KAG
Sbjct  133  KLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>ref|NP_173755.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
 sp|P59271.2|R27AA_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF79581.1|AC007945_1 F28C11.5 [Arabidopsis thaliana]
 gb|AAF87001.1|AC005292_10 F26F24.28 [Arabidopsis thaliana]
 gb|AAM62617.1| ubiquitin extension protein, putative [Arabidopsis thaliana]
 gb|ABD59101.1| At1g23410 [Arabidopsis thaliana]
 gb|AEE30384.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
Length=156

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHTHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRL+KECP+  CG GTFMA+HFDRHYCGKCG TYV+ KA
Sbjct  99   KLAVLQFYKVDGSGKVQRLKKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKA  153



>ref|XP_010914704.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X4 [Elaeis guineensis]
Length=193

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 109/116 (94%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKI HK KKV
Sbjct  73   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKV  132

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDRHYCGKCGL  VY KAG
Sbjct  133  KLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>gb|ACG31121.1| 40S ribosomal protein S27a [Zea mays]
Length=155

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDES-GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KL+VLQFYKVD++  KV RLRKECPN+ECGAG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLSVLQFYKVDDTTSKVTRLRKECPNSECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>gb|AAA70104.1| ubiquitin fusion protein [Zea mays]
 prf||2211240A ubiquitin fusion protein
Length=155

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKTKHKHKKV  98

Query  181  kLAVLQFYKVDES-GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KL+VLQFYKVD++  KV RLRKECPN+ECGAG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLSVLQFYKVDDTTSKVTRLRKECPNSECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|NP_001150700.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG40048.1| 40S ribosomal protein S27a [Zea mays]
 tpg|DAA48105.1| TPA: polyubiquitin-like protein [Zea mays]
Length=155

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDES-GKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KL+VLQFYKVD++  KV RLRKECPN ECGAG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLSVLQFYKVDDTTSKVTRLRKECPNTECGAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_009103181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 ref|XP_009115529.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 emb|CDY44146.1| BnaA09g31060D [Brassica napus]
 emb|CDY25783.1| BnaA07g09990D [Brassica napus]
 emb|CDY12472.1| BnaC07g13120D [Brassica napus]
Length=156

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ K 
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKP  153



>gb|AFX60090.1| ribosomal protein S27a, partial [Brassica oleracea]
Length=152

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  35   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  94

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ K 
Sbjct  95   KLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKP  149



>ref|XP_010914701.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Elaeis guineensis]
Length=225

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 109/116 (94%), Gaps = 1/116 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKI HK KKV
Sbjct  73   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKINHKKKKV  132

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KL VLQFYK+D+SGKV RLRKECPNAECGAGTFMAN+FDRHYCGKCGL  VY KAG
Sbjct  133  KLPVLQFYKIDDSGKVTRLRKECPNAECGAGTFMANYFDRHYCGKCGLN-VYQKAG  187



>gb|ADU04750.1| ubiquitin extension protein, partial [Mesostigma viride]
 gb|ADU04751.1| ubiquitin extension protein, partial [Mesostigma viride]
Length=132

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKK KHK KKV
Sbjct  19   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKNKHKKKKV  78

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQ+YKVD+SGKVQRLRKECPN +CGAG FMA+H DRHYCGKCGLTYVY K
Sbjct  79   KLAVLQYYKVDDSGKVQRLRKECPNPDCGAGCFMASHKDRHYCGKCGLTYVYQK  132



>ref|XP_006416085.1| hypothetical protein EUTSA_v10008988mg [Eutrema salsugineum]
 gb|ESQ34438.1| hypothetical protein EUTSA_v10008988mg [Eutrema salsugineum]
Length=156

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD +GKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ K 
Sbjct  99   KLAVLQFYKVDGTGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKP  153



>ref|NP_001105472.1| ubiquitin-40S ribosomal protein S27a [Zea mays]
 emb|CAA63150.1| ORF [Zea mays]
Length=155

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGAKK KKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGAKKPKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRK+CPNAEC AG FMANHFDRHYCGKCGLTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKDCPNAECHAGVFMANHFDRHYCGKCGLTYVYNQ  153



>ref|XP_010519353.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2, partial [Tarenaya 
hassleriana]
Length=150

 Score =   167 bits (424),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 109/114 (96%), Gaps = 2/114 (2%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD S KVQRLRKECPN  CGAGTFMA+HFDRHYCGKCGLTYVY K
Sbjct  99   KLAVLQFYKVDGSNKVQRLRKECPN--CGAGTFMASHFDRHYCGKCGLTYVYQK  150



>ref|XP_008347677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=218

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFA KQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  101  DQQRLIFADKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  160

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+SGKVQRLRKEC NA+CG GTFMANHF+ HYC KCGLTYVY KAG D
Sbjct  161  KLAVLQFYKVDDSGKVQRLRKECLNAKCGVGTFMANHFNMHYCDKCGLTYVYQKAGGD  218



>emb|CDY04715.1| BnaC05g18740D [Brassica napus]
Length=156

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRH+CGKCG TYV+ K 
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHHCGKCGTTYVFKKP  153



>ref|XP_010498849.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Camelina sativa]
Length=156

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHVHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN  339
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ 
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFK  151



>gb|KHN22999.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=151

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 110/115 (96%), Gaps = 4/115 (3%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLA+LQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDR    KCGLTYVY K+
Sbjct  99   KLALLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDR----KCGLTYVYQKS  149



>ref|XP_010460127.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Camelina 
sativa]
Length=156

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHVHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN  339
            KLAVLQFY+VD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ 
Sbjct  99   KLAVLQFYRVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFK  151



>ref|XP_010477636.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Camelina 
sativa]
Length=156

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKH HKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHVHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN  339
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ 
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSVGCGPGTFMASHFDRHYCGKCGTTYVFK  151



>gb|KFK44432.1| hypothetical protein AALP_AA1G255700 [Arabis alpina]
Length=156

 Score =   166 bits (419),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGGAKKRKKKTYTKPKK+KHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYSIQKESTLHLVLRLRGGAKKRKKKTYTKPKKLKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVLQFYKVD SGKVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TYV+ K 
Sbjct  99   KLAVLQFYKVDGSGKVQRLRKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFKKP  153



>ref|XP_004644620.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   165 bits (418),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK G
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPG  154



>gb|EHH55578.1| hypothetical protein EGM_04813 [Macaca fascicularis]
Length=156

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGA+KRKKK+Y+ PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAQKRKKKSYSTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_006349858.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
tuberosum]
Length=181

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGK  315
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYCGK
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGK  143



>ref|XP_003216177.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Anolis carolinensis]
Length=156

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   TLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_005486911.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Zonotrichia 
albicollis]
Length=190

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  73   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  132

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  133  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  187



>gb|KGL79724.1| Ubiquitin-40S ribosomal protein S27a, partial [Tinamus guttatus]
Length=158

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  41   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  100

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  101  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  155



>ref|XP_009286758.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Aptenodytes 
forsteri]
Length=144

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  27   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  86

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  87   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  141



>gb|KFP24383.1| Ubiquitin-40S ribosomal protein S27a, partial [Colius striatus]
Length=144

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  27   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  86

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  87   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  141



>gb|KFV68543.1| Ubiquitin-40S ribosomal protein S27a, partial [Picoides pubescens]
Length=157

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  40   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  99

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  100  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  154



>ref|XP_010216499.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tinamus guttatus]
Length=156

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_010283844.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a, partial [Phaethon lepturus]
Length=155

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  38   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  97

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  98   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  152



>ref|XP_010146975.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a, partial [Eurypyga helias]
Length=143

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  26   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  85

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  86   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  140



>ref|XP_005238671.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Falco peregrinus]
 ref|XP_005445725.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Falco cherrug]
Length=142

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  25   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  84

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  85   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  139



>ref|XP_010573169.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Haliaeetus leucocephalus]
Length=156

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|NP_990284.1| ubiquitin-40S ribosomal protein S27a [Gallus gallus]
 ref|NP_001274134.1| ubiquitin-40S ribosomal protein S27a [Gallus gallus]
 ref|XP_002199635.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Taeniopygia 
guttata]
 ref|XP_005042727.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Ficedula 
albicollis]
 ref|XP_005144071.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Melopsittacus 
undulatus]
 ref|XP_005299091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chrysemys picta 
bellii]
 ref|XP_005422655.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Geospiza fortis]
 ref|XP_005525525.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pseudopodoces 
humilis]
 ref|XP_006021641.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Alligator sinensis]
 ref|XP_006274498.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Alligator mississippiensis]
 ref|XP_007070121.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chelonia mydas]
 ref|XP_007432077.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Python 
bivittatus]
 ref|XP_007432078.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Python 
bivittatus]
 ref|XP_008491469.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Calypte anna]
 ref|XP_009091973.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Serinus canaria]
 ref|XP_009474412.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nipponia nippon]
 ref|XP_009900360.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Picoides pubescens]
 sp|P79781.3|RS27A_CHICK RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Gallus gallus]
 gb|AAC60279.1| ubiquitin/ribosomal protein [Gallus gallus]
 gb|ADK26674.1| ribosomal protein S27a [Zonotrichia albicollis]
 gb|ADK26767.1| ribosomal protein S27a [Zonotrichia albicollis]
Length=156

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|KFP93009.1| Ubiquitin-40S ribosomal protein S27a, partial [Haliaeetus albicilla]
Length=141

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  24   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  83

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  84   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  138



>ref|XP_009929631.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Opisthocomus 
hoazin]
Length=144

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  27   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  86

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  87   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  141



>ref|XP_009945702.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Leptosomus discolor]
Length=154

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  37   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  96

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  97   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  151



>ref|XP_009926111.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Haliaeetus 
albicilla]
 gb|KFP09598.1| Ubiquitin-40S ribosomal protein S27a, partial [Egretta garzetta]
Length=140

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  23   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  82

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  83   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  137



>ref|XP_006122235.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pelodiscus sinensis]
Length=149

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  32   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  91

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  92   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  146



>ref|XP_009480940.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pelecanus 
crispus]
 ref|XP_009509387.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Phalacrocorax 
carbo]
 ref|XP_009556888.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Cuculus 
canorus]
 ref|XP_009574433.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Fulmarus 
glacialis]
 ref|XP_009814558.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Gavia 
stellata]
 ref|XP_009701052.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Cariama 
cristata]
 ref|XP_009875828.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Apaloderma 
vittatum]
 ref|XP_010011875.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Nestor 
notabilis]
 ref|XP_009978278.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Tauraco 
erythrolophus]
 ref|XP_009960864.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Tyto 
alba]
 ref|XP_010137009.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Buceros 
rhinoceros silvestris]
 ref|XP_010171881.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Caprimulgus 
carolinensis]
 ref|XP_010077283.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pterocles 
gutturalis]
 ref|XP_010190871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Mesitornis 
unicolor]
 ref|XP_010115032.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Chlamydotis 
macqueenii]
 ref|XP_010300523.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Balearica 
regulorum gibbericeps]
 gb|KFO04847.1| Ubiquitin-40S ribosomal protein S27a, partial [Balearica regulorum 
gibbericeps]
 gb|KFO65478.1| Ubiquitin-40S ribosomal protein S27a, partial [Corvus brachyrhynchos]
 gb|KFO74445.1| Ubiquitin-40S ribosomal protein S27a, partial [Cuculus canorus]
 gb|KFO91345.1| Ubiquitin-40S ribosomal protein S27a, partial [Buceros rhinoceros 
silvestris]
 gb|KFP59309.1| Ubiquitin-40S ribosomal protein S27a, partial [Cariama cristata]
 gb|KFP79901.1| Ubiquitin-40S ribosomal protein S27a, partial [Apaloderma vittatum]
 gb|KFQ07466.1| Ubiquitin-40S ribosomal protein S27a, partial [Leptosomus discolor]
 gb|KFQ40772.1| Ubiquitin-40S ribosomal protein S27a, partial [Mesitornis unicolor]
 gb|KFQ42387.1| Ubiquitin-40S ribosomal protein S27a, partial [Nestor notabilis]
 gb|KFQ61160.1| Ubiquitin-40S ribosomal protein S27a, partial [Pelecanus crispus]
 gb|KFQ67044.1| Ubiquitin-40S ribosomal protein S27a, partial [Phaethon lepturus]
 gb|KFQ87004.1| Ubiquitin-40S ribosomal protein S27a, partial [Phoenicopterus 
ruber ruber]
 gb|KFR06135.1| Ubiquitin-40S ribosomal protein S27a, partial [Opisthocomus hoazin]
 gb|KFU84604.1| Ubiquitin-40S ribosomal protein S27a, partial [Chaetura pelagica]
 gb|KFU99621.1| Ubiquitin-40S ribosomal protein S27a, partial [Pterocles gutturalis]
 gb|KFV11287.1| Ubiquitin-40S ribosomal protein S27a, partial [Tauraco erythrolophus]
 gb|KFV39162.1| Ubiquitin-40S ribosomal protein S27a, partial [Tyto alba]
 gb|KFV44563.1| Ubiquitin-40S ribosomal protein S27a, partial [Gavia stellata]
 gb|KFV89075.1| Ubiquitin-40S ribosomal protein S27a, partial [Fulmarus glacialis]
 gb|KFV92107.1| Ubiquitin-40S ribosomal protein S27a, partial [Eurypyga helias]
 gb|KFW81760.1| Ubiquitin-40S ribosomal protein S27a, partial [Manacus vitellinus]
 gb|KFW94448.1| Ubiquitin-40S ribosomal protein S27a, partial [Phalacrocorax 
carbo]
 gb|KFZ48189.1| Ubiquitin-40S ribosomal protein S27a, partial [Caprimulgus carolinensis]
 gb|KFZ56250.1| Ubiquitin-40S ribosomal protein S27a, partial [Podiceps cristatus]
 gb|KGL94129.1| Ubiquitin-40S ribosomal protein S27a, partial [Charadrius vociferus]
Length=140

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  23   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  82

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  83   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  137



>ref|XP_010194368.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Colius 
striatus]
Length=147

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  30   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  89

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  90   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  144



>ref|XP_005513215.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Columba livia]
Length=156

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|KFV78322.1| Ubiquitin-40S ribosomal protein S27a, partial [Struthio camelus 
australis]
Length=140

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  23   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  82

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  83   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  137



>ref|XP_009317915.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pygoscelis adeliae]
Length=142

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  25   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  84

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  85   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  139



>ref|XP_006001599.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Latimeria chalumnae]
Length=156

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKIHRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|KFW64033.1| Ubiquitin-40S ribosomal protein S27a, partial [Pygoscelis adeliae]
Length=141

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  24   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  83

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  84   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  138



>gb|AAA36788.1| pro-ubiquitin, partial [Homo sapiens]
Length=152

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  35   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  94

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  95   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  149



>ref|XP_006068942.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
Length=156

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|EOB01801.1| Ubiquitin, partial [Anas platyrhynchos]
 gb|KFM13706.1| Ubiquitin-40S ribosomal protein S27a, partial [Aptenodytes forsteri]
 gb|KFP47664.1| Ubiquitin-40S ribosomal protein S27a, partial [Cathartes aura]
Length=141

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  24   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  83

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  84   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  138



>gb|EMC80037.1| 40S ribosomal protein S27a, partial [Columba livia]
Length=160

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  43   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  102

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  103  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  157



>ref|XP_008065389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tarsius syrichta]
Length=156

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|ERE90935.1| ubiquitin-40S ribosomal protein S27a-like protein [Cricetulus 
griseus]
Length=161

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  44   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  103

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  104  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  158



>gb|KFP00438.1| Ubiquitin-40S ribosomal protein S27a, partial [Calypte anna]
 gb|KFQ92324.1| Ubiquitin-40S ribosomal protein S27a, partial [Nipponia nippon]
Length=160

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  43   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  102

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  103  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  157



>ref|XP_004411170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Odobenus 
rosmarus divergens]
Length=156

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_010401401.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Corvus cornix 
cornix]
Length=153

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  36   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  95

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  96   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  150



>ref|XP_005018946.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Anas platyrhynchos]
Length=159

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  42   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  101

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  102  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  156



>ref|XP_009884369.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Charadrius vociferus]
Length=161

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  44   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  103

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  104  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  158



>ref|NP_002945.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_777203.1| ubiquitin-40S ribosomal protein S27a [Bos taurus]
 ref|NP_001016172.1| ribosomal protein S27a [Xenopus (Silurana) tropicalis]
 ref|NP_001086065.1| ribosomal protein S27a [Xenopus laevis]
 ref|NP_001129064.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_001166537.1| ubiquitin-40S ribosomal protein S27a [Cavia porcellus]
 ref|NP_001170884.1| ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens]
 ref|NP_001180515.1| 40S ribosomal protein S27a [Macaca mulatta]
 ref|NP_001239157.1| 40S ribosomal protein S27a [Canis lupus familiaris]
 ref|NP_001239528.1| 40S ribosomal protein S27a [Pan troglodytes]
 ref|NP_001271613.1| uncharacterized protein LOC101864869 [Macaca fascicularis]
 ref|XP_001375230.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Monodelphis 
domestica]
 ref|XP_001509244.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ornithorhynchus 
anatinus]
 ref|XP_001496841.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Equus caballus]
 ref|XP_002724420.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Oryctolagus 
cuniculus]
 ref|XP_002748274.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002753065.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002757792.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Callithrix jacchus]
 ref|XP_002914089.1| PREDICTED: hypothetical protein LOC100476697 [Ailuropoda melanoleuca]
 ref|XP_003787974.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Otolemur garnettii]
 ref|XP_003830888.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan paniscus]
 ref|XP_003830889.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan paniscus]
 ref|XP_003908711.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Papio anubis]
 ref|XP_003908796.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Papio anubis]
 ref|XP_003949844.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan troglodytes]
 ref|XP_003949845.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pan troglodytes]
 ref|XP_003984057.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Felis catus]
 ref|XP_004005993.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ovis aries]
 ref|XP_004029299.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004029300.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004029301.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_004029302.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004284424.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Orcinus orca]
 ref|XP_004322708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tursiops truncatus]
 ref|XP_004369513.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Trichechus manatus 
latirostris]
 ref|XP_004403712.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Odobenus rosmarus 
divergens]
 ref|XP_004435735.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ceratotherium 
simum simum]
 ref|XP_004462050.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Dasypus novemcinctus]
 ref|XP_004580187.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ochotona princeps]
 ref|XP_004609268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sorex araneus]
 ref|XP_004669012.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Jaculus jaculus]
 ref|XP_004632487.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
 ref|XP_004691463.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Condylura 
cristata]
 ref|XP_004691464.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Condylura 
cristata]
 ref|XP_004775726.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mustela putorius 
furo]
 ref|XP_004806951.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mustela putorius 
furo]
 ref|XP_004889095.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Heterocephalus 
glaber]
 ref|XP_004867330.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Heterocephalus 
glaber]
 ref|XP_005002694.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Cavia 
porcellus]
 ref|XP_005070404.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Mesocricetus 
auratus]
 ref|XP_005212615.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Bos 
taurus]
 ref|XP_005322068.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005322069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_005385845.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chinchilla lanigera]
 ref|XP_005575917.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Macaca 
fascicularis]
 ref|XP_005686669.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Capra hircus]
 ref|XP_005884671.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis brandtii]
 ref|XP_005889537.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Bos 
mutus]
 ref|XP_005889538.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Bos 
mutus]
 ref|XP_005968746.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pantholops hodgsonii]
 ref|XP_006108994.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Myotis 
lucifugus]
 ref|XP_006174513.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus ferus]
 ref|XP_006217782.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vicugna pacos]
 ref|XP_006159100.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Tupaia chinensis]
 ref|XP_006778654.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis davidii]
 ref|XP_006738706.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006738707.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Leptonychotes weddellii]
 ref|XP_006752156.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes 
weddellii]
 ref|XP_006868070.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Chrysochloris 
asiatica]
 ref|XP_006909658.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pteropus alecto]
 ref|XP_006993251.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Peromyscus maniculatus 
bairdii]
 ref|XP_007075460.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Panthera tigris 
altaica]
 ref|XP_007107112.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Physeter catodon]
 ref|XP_006043311.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
 ref|XP_006071325.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Bubalus 
bubalis]
 ref|XP_007190066.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007465731.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Lipotes vexillifer]
 ref|XP_007532217.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Erinaceus europaeus]
 ref|XP_007532218.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Erinaceus europaeus]
 ref|XP_007636802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cricetulus griseus]
 ref|XP_007936193.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Orycteropus 
afer afer]
 ref|XP_007968797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chlorocebus 
sabaeus]
 ref|XP_008160344.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eptesicus fuscus]
 ref|XP_008577062.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Galeopterus 
variegatus]
 ref|XP_008698096.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Ursus maritimus]
 ref|XP_008821230.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nannospalax 
galili]
 ref|XP_008821231.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nannospalax 
galili]
 ref|XP_010331896.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Saimiri boliviensis 
boliviensis]
 ref|XP_010614144.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fukomys damarensis]
 ref|XP_010839969.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bison bison 
bison]
 ref|XP_010950168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus bactrianus]
 ref|XP_010988045.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Camelus dromedarius]
 sp|P62979.2|RS27A_HUMAN RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Homo sapiens]
 sp|P62992.2|RS27A_BOVIN RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Bos taurus]
 sp|P62978.2|RS27A_CAVPO RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Cavia porcellus]
 pir||UQHUR7 ubiquitin / ribosomal protein S27a, cytosolic [validated] - human
 pdb|4KZX|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|FF Chain f, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|FF Chain f, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|FF Chain f, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|FF Chain f, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|FF Chain f, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|FF Chain f, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 emb|CAA44911.1| ubiquitin [Homo sapiens]
 gb|AAB21188.1| ubiquitin carboxyl extension protein [Homo sapiens]
 dbj|BAA11843.1| ubiquitin extention protein [Cavia porcellus]
 gb|AAC77907.1| ubiquitin-S27a fusion protein [Bos taurus]
 gb|AAH01392.1| Ribosomal protein S27a [Homo sapiens]
 gb|AAH66293.1| Ribosomal protein S27a [Homo sapiens]
 gb|AAH74147.1| MGC81889 protein [Xenopus laevis]
 dbj|BAE01745.1| unnamed protein product [Macaca fascicularis]
 emb|CAJ83451.1| ribosomal protein S27a [Xenopus (Silurana) tropicalis]
 gb|EAX00108.1| ribosomal protein S27a, isoform CRA_c [Homo sapiens]
 gb|EAX00110.1| ribosomal protein S27a, isoform CRA_c [Homo sapiens]
 gb|AAI35494.1| hypothetical protein LOC548926 [Xenopus (Silurana) tropicalis]
 gb|AAI02492.2| Ribosomal protein S27a [Bos taurus]
 dbj|BAG38058.1| unnamed protein product [Homo sapiens]
 gb|ACJ13725.1| epididymis luminal protein 112 [Homo sapiens]
 dbj|BAI47114.1| ribosomal protein S27a [synthetic construct]
 tpg|DAA24675.1| TPA: 40S ribosomal protein S27a [Bos taurus]
 gb|ADQ33198.1| ribosomal protein S27a [synthetic construct]
 gb|EHB05725.1| 40S ribosomal protein S27a [Heterocephalus glaber]
 gb|EHH22128.1| hypothetical protein EGK_05333 [Macaca mulatta]
 gb|AIC49655.1| RPS27A, partial [synthetic construct]
 gb|KFO18488.1| Ubiquitin-40S ribosomal protein S27a [Fukomys damarensis]
Length=156

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|AAA57047.1| ubiquitin, partial [synthetic construct]
Length=157

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|KFP35488.1| Ubiquitin-40S ribosomal protein S27a, partial [Chlamydotis macqueenii]
Length=153

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  36   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  95

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  96   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  150



>ref|XP_001104764.1| PREDICTED: hypothetical protein LOC709143 [Macaca mulatta]
 ref|XP_005561572.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Macaca fascicularis]
Length=156

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|AGC65581.1| UBQ5, partial [Agrostis stolonifera]
Length=156

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTL+LVLRLRGGAKKRKKK YTKPKK +HKHKKV
Sbjct  40   DQQRLIFAGKQLEDGRTLADYNIQKESTLYLVLRLRGGAKKRKKKAYTKPKKQRHKHKKV  99

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLA+LQFYKVD+ +GKV RLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYN+
Sbjct  100  KLALLQFYKVDDATGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNQ  154



>ref|XP_009667383.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Struthio camelus 
australis]
Length=192

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  75   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  134

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  135  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  189



>ref|XP_006901676.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=164

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KK 
Sbjct  47   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKA  106

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  107  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  161



>gb|AAH53371.1| Ribosomal protein S27a [Homo sapiens]
Length=156

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+ T PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSCTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_008365153.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=180

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFA KQLEDG+TLADYNIQKESTLHLVL LRGGAKKRKKKTYTKPKKIKHKHK V
Sbjct  63   DQQRLIFASKQLEDGQTLADYNIQKESTLHLVLCLRGGAKKRKKKTYTKPKKIKHKHKTV  122

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD+  KVQRLRK+C NA+CGAGTFMANHF+RHYCGKCGLTYVY KAG D
Sbjct  123  KLAVLQFYKVDDFDKVQRLRKKCLNAKCGAGTFMANHFNRHYCGKCGLTYVYQKAGGD  180



>ref|XP_008640291.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Corvus brachyrhynchos]
Length=159

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  42   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  101

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  102  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  156



>ref|XP_008923123.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Manacus vitellinus]
Length=188

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  71   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  130

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  131  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  185



>ref|XP_009639081.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Egretta garzetta]
Length=182

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  65   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  124

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  125  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  179



>ref|XP_010003219.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Chaetura pelagica]
Length=240

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  123  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  182

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  183  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  237



>dbj|BAB79488.1| ribosomal protein S27A [Homo sapiens]
Length=121

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  4    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  63

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  64   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  118



>ref|XP_007051235.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|EOX95392.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
Length=172

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/103 (99%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYC  309
            KLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYC
Sbjct  99   KLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYC  141



>gb|ERE90934.1| ubiquitin-40S ribosomal protein S27a-like protein [Cricetulus 
griseus]
Length=128

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  11   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  70

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  71   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  125



>ref|XP_010595590.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Loxodonta africana]
Length=149

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  32   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  91

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  92   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  146



>ref|XP_002733357.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Saccoglossus 
kowalevskii]
Length=157

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKKT+T PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTFTTPKKTKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECPN +CGAG FMA+HFDR YCGKC LTYV+NK 
Sbjct  99   KLAVLKYYKVDENGKITRLRRECPNEDCGAGVFMASHFDRQYCGKCCLTYVFNKP  153



>ref|XP_003758323.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sarcophilus 
harrisii]
Length=228

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  111  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  170

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  171  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  225



>gb|ACH71005.1| ribosomal protein S27-3 [Salmo salar]
 gb|ACI66719.1| Ubiquitin [Salmo salar]
 gb|ACN09871.1| Ubiquitin [Salmo salar]
 gb|ACN12218.1| Ubiquitin [Salmo salar]
 gb|ADD37999.1| Ubiquitin [Lepeophtheirus salmonis]
 gb|ADM16009.1| Ubiquitin [Salmo salar]
 emb|CDQ70304.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKIHRLRRECPAEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_004710327.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Echinops telfairi]
Length=152

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  35   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  94

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  95   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  149



>ref|XP_005575916.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Macaca 
fascicularis]
Length=187

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  70   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  129

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  130  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  184



>ref|XP_010552656.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Tarenaya hassleriana]
Length=156

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKH  KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHTKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGSD  354
            KLAVLQFYKVD S KVQRLRKECP+  CG GTFMA+HFDRHYCGKCG TY + KA +D
Sbjct  99   KLAVLQFYKVDGSCKVQRLRKECPSVGCGPGTFMASHFDRHYCGKCGTTYAF-KAPAD  155



>gb|ACO51599.1| Ubiquitin [Rana catesbeiana]
Length=156

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKPYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_010704696.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Meleagris gallopavo]
Length=212

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  95   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  154

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  155  KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKP  209



>ref|XP_004396839.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Odobenus 
rosmarus divergens]
Length=156

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRG AKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGDAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|KCW58175.1| hypothetical protein EUGRSUZ_H00892 [Eucalyptus grandis]
Length=145

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/103 (98%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYC  309
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMANHFDRHYC
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYC  141



>ref|XP_010376465.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Rhinopithecus 
roxellana]
Length=156

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY  NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCLNKP  153



>ref|NP_956796.1| ubiquitin-40S ribosomal protein S27a [Danio rerio]
 ref|NP_001187222.1| ubiquitin-40S ribosomal protein S27a [Ictalurus punctatus]
 ref|XP_003455526.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oreochromis 
niloticus]
 ref|XP_003963790.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Takifugu 
rubripes]
 ref|XP_004575832.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Maylandia 
zebra]
 ref|XP_005743613.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Pundamilia 
nyererei]
 ref|XP_005812668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Xiphophorus 
maculatus]
 ref|XP_005945885.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Haplochromis 
burtoni]
 ref|XP_006638483.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Lepisosteus 
oculatus]
 ref|XP_006806933.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006806934.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Neolamprologus brichardi]
 ref|XP_007230176.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Astyanax mexicanus]
 ref|XP_007577064.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia formosa]
 ref|XP_008286554.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Stegastes partitus]
 ref|XP_008319624.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cynoglossus 
semilaevis]
 ref|XP_008428691.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Poecilia reticulata]
 ref|XP_010748172.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Larimichthys 
crocea]
 ref|XP_010790874.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Notothenia coriiceps]
 ref|XP_010868135.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Esox lucius]
 sp|P68200.2|RS27A_ICTPU RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Ictalurus punctatus]
 gb|AAK95212.1|AF402838_1 40S ribosomal protein S27a [Ictalurus punctatus]
 gb|AAH55524.1| Zgc:66168 [Danio rerio]
 dbj|BAF45917.1| ribosomal protein S27a [Solea senegalensis]
 gb|ACA05172.1| ribosomal protein S27a [Oncorhynchus masou formosanus]
 gb|AAI64449.1| Zgc:66168 protein [Danio rerio]
 gb|ACM08345.1| Ubiquitin [Salmo salar]
 gb|ACO09845.1| Ubiquitin [Osmerus mordax]
 gb|ACQ58277.1| Ubiquitin [Anoplopoma fimbria]
 gb|ADM64585.1| ribosomal protein S27a [Hypophthalmichthys nobilis]
 emb|CDQ88274.1| unnamed protein product [Oncorhynchus mykiss]
Length=156

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|AAM27203.1|AF502248_1 40s ribosomal protein S27a [Epinephelus coioides]
Length=156

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_006887475.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=156

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            D+QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DKQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|KFP78128.1| Ubiquitin-40S ribosomal protein S27a, partial [Acanthisitta chloris]
Length=140

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  23   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  82

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRHYCGKC LTY +NK 
Sbjct  83   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMGSHFDRHYCGKCCLTYCFNKP  137



>gb|AAA74960.1| ribosomal protein-linked ubiquitin [Oryza sativa]
Length=155

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQR IFAGKQLEDGRTLADYNIQKESTLH VLRLRGGAKKRKKKTYTKPKKIKHKHKKV
Sbjct  39   DQQRFIFAGKQLEDGRTLADYNIQKESTLHHVLRLRGGAKKRKKKTYTKPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDE-SGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNK  342
            KLAVLQFYKVD+ +GKV RLRKECPN +CGAGTFMANHFDRHYC KC LTYVYN+
Sbjct  99   KLAVLQFYKVDDATGKVTRLRKECPNHDCGAGTFMANHFDRHYCRKCRLTYVYNQ  153



>ref|XP_009235580.1| PREDICTED: ubiquitin-40S ribosomal protein S27a, partial [Pongo 
abelii]
Length=210

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  93   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  152

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  153  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  207



>ref|XP_006738708.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X3 [Leptonychotes weddellii]
Length=156

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+H DRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHLDRHYCGKCCLTYCFNKP  153



>ref|NP_077239.1| ubiquitin-40S ribosomal protein S27a precursor [Mus musculus]
 ref|NP_112375.1| ubiquitin-40S ribosomal protein S27a [Rattus norvegicus]
 ref|NP_001029037.1| ubiquitin-40S ribosomal protein S27a precursor [Mus musculus]
 ref|XP_003751469.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X2 [Rattus 
norvegicus]
 ref|XP_006221941.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform X1 [Rattus 
norvegicus]
 sp|P62983.2|RS27A_MOUSE RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Mus musculus]
 sp|P62982.2|RS27A_RAT RecName: Full=Ubiquitin-40S ribosomal protein S27a; AltName: 
Full=Ubiquitin carboxyl extension protein 80; Contains: RecName: 
Full=Ubiquitin; Contains: RecName: Full=40S ribosomal protein 
S27a; Flags: Precursor [Rattus norvegicus]
 emb|CAA57432.1| fusion protein: ubiquitin (bases 43_513); ribosomal protein S27a 
(bases 217_532) [Rattus norvegicus]
 gb|AAH02108.1| Ribosomal protein S27A [Mus musculus]
 dbj|BAB31357.1| unnamed protein product [Mus musculus]
 gb|AAH58139.1| Ribosomal protein S27a [Rattus norvegicus]
 gb|AAH81446.1| Ribosomal protein S27A [Mus musculus]
 gb|AAH96392.1| Ribosomal protein S27A [Mus musculus]
 gb|EDL23801.1| mCG13441 [Mus musculus]
 gb|EDL26463.1| mCG15222 [Mus musculus]
 gb|EDL98032.1| rCG23287, isoform CRA_a [Rattus norvegicus]
 gb|EDL98033.1| rCG23287, isoform CRA_a [Rattus norvegicus]
Length=156

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKP  153



>ref|XP_007514688.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14928.1| predicted protein [Bathycoccus prasinos]
Length=169

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG KKRKKKTYTKPKKIKH HKK 
Sbjct  55   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGKKRKKKTYTKPKKIKHVHKKN  114

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY  336
            KL  L+ YKVD++GKV RLRKECP  ECGAG FMANHFDRHYCGKCGLTYVY
Sbjct  115  KLGFLKLYKVDDAGKVTRLRKECPAPECGAGVFMANHFDRHYCGKCGLTYVY  166



>ref|XP_009070695.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a, partial [Acanthisitta chloris]
Length=153

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  36   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  95

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRHYCGKC LTY +NK 
Sbjct  96   KLAVLKYYKVDENGKISRLRRECPSEECGAGVFMGSHFDRHYCGKCCLTYCFNKP  150



>ref|XP_003125184.2| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sus scrofa]
Length=204

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  87   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  146

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  147  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  201



>ref|XP_001002242.2| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Mus musculus]
Length=185

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  68   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  127

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRHYCGKC LTY +NK 
Sbjct  128  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKP  182



>ref|XP_004643097.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RL +ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLHRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_006083528.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Myotis lucifugus]
Length=237

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  120  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  179

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  180  KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  234



>gb|AAH49478.1| Zgc:66168 protein, partial [Danio rerio]
Length=172

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  55   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  114

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  115  KLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLTYCFNKP  169



>ref|XP_004077285.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oryzias 
latipes]
Length=209

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  92   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  151

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  152  KLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCTLTYCFNKP  206



>gb|KDO86852.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=145

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYC  309
            KLAVLQFYKVD+SGKVQRLRKECPNAECGAGTFMA+HFDRHYC
Sbjct  99   KLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMASHFDRHYC  141



>ref|XP_006888789.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=156

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HF RHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFHRHYCGKCCLTYCFNKP  153



>ref|XP_004579614.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Ochotona 
princeps]
Length=156

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDG+T +DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGQTSSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVD++GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   TLAVLKYYKVDDNGKISRLRRECPSDECGAGVFMASHFDRHYCGKCSLTYCFNKP  153



>ref|XP_004092958.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein 
S27a [Nomascus leucogenys]
Length=156

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHL +RLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLXVRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_005365195.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Microtus 
ochrogaster]
Length=155

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKK   T  K    + K  
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKSYTTPKKNKHKRKKVK  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   -LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  152



>emb|CAG12343.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=140

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGK LEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  23   DQQRLIFAGKHLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  82

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  83   KLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLTYCFNKP  137



>ref|XP_006860476.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Chrysochloris 
asiatica]
Length=155

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRK    T  K    + K  
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKTSYITPRKNKHKRKKVK  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   -LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  152



>ref|XP_005352920.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Microtus 
ochrogaster]
Length=155

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKK   T  K    + K  
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKSYTTPKKNKHKRKKVK  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   -LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  152



>ref|XP_004629417.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Octodon 
degus]
Length=156

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTL+LVLRL GGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLNLVLRLHGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_006729877.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Leptonychotes 
weddellii]
Length=156

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDG TL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGCTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_006890603.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=156

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRH CGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDENGKISRLRQECPSDECGAGVFMASHFDRHCCGKCYLTYCFNKP  153



>gb|ACO08409.1| Ubiquitin [Oncorhynchus mykiss]
Length=156

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKV E+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVVENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>emb|CCQ18633.1| Ubiquitin and ubiquitin-like proteins [Sycon ciliatum]
Length=230

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK YT PKKIKHK KKV
Sbjct  115  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKNYTTPKKIKHKKKKV  174

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL+FYKVDE+GK+ RLR+ECP   CGAG FMA+HFDR YCGKCGLTYVYNKA
Sbjct  175  KLAVLKFYKVDENGKITRLRRECPAPACGAGVFMASHFDRQYCGKCGLTYVYNKA  229


 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  114
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  76



>gb|ACO08429.1| Ubiquitin [Oncorhynchus mykiss]
Length=156

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +1

Query  4    QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkvk  183
            QQRLIFAGKQLEDGRTL+DYNIQKESTL LVLRLRGGAKKRK+++YT PKK KHK KKVK
Sbjct  40   QQRLIFAGKQLEDGRTLSDYNIQKESTLRLVLRLRGGAKKRKERSYTTPKKNKHKRKKVK  99

Query  184  LAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            LAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  100  LAVLKYYKVDENGKIHRLRRECPAEECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>ref|XP_007185405.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Balaenoptera 
acutorostrata scammoni]
Length=156

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKE TLHLVLRLRGGAKKRKKK+YT P+K KHK K+V
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKEFTLHLVLRLRGGAKKRKKKSYTTPRKNKHKRKQV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YK+DE+GK+ RLR+ECP+ ECGAG FMA+HFDR YCGKC LTY +NK 
Sbjct  99   KLAVLKYYKMDENGKISRLRRECPSDECGAGVFMASHFDRQYCGKCCLTYCFNKP  153



>ref|XP_004663256.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Jaculus 
jaculus]
Length=156

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQK+STLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKKSTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVD++GK+  LR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   KLAVLKYYKVDKNGKISHLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  153



>gb|ADV40075.1| 60S ribosomal protein L40A [Latrodectus hesperus]
Length=156

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKNYTTPKKTKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KL+VL+FYKVDE+GK+ RLR+ECPN ECGAG FMA+HFDR YCGKC LT+VYNK 
Sbjct  99   KLSVLKFYKVDENGKITRLRRECPNEECGAGVFMASHFDRQYCGKCCLTFVYNKP  153



>ref|XP_006544136.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Mus musculus]
Length=184

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKK   T  K    + K  
Sbjct  68   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKSYTTPKKNKHKRKKVK  127

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FM +HFDRHYCGKC LTY +NK 
Sbjct  128  -LAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKP  181



>gb|KIM34102.1| hypothetical protein M408DRAFT_19058 [Serendipita vermifera MAFF 
305830]
Length=163

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKKTY  PKK+KHK KKV
Sbjct  43   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYNTPKKVKHKRKKV  102

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY  336
            K+A+L++YKVD  GK++RLRKECPNAECGAG FMA H DR YCGKCGLTY +
Sbjct  103  KMAILKYYKVDSDGKIKRLRKECPNAECGAGVFMAFHHDRQYCGKCGLTYQF  154



>ref|XP_784247.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Strongylocentrotus 
purpuratus]
Length=156

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKNYTTPKKTKHKKKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAG  348
            KLAVL+FYKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDR YCGKC LTYVYNK  
Sbjct  99   KLAVLKFYKVDENGKITRLRRECPSEECGAGVFMASHFDRQYCGKCCLTYVYNKPA  154



>ref|XP_005345114.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Microtus 
ochrogaster]
Length=155

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTL LVLRLRGGAKKRKK   T  K    + K  
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLRLVLRLRGGAKKRKKSYTTPKKNKHKRKKVK  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
             LAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  99   -LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  152



>gb|AEA51100.1| ubiquitin, partial [Oryzias melastigma]
Length=169

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  60   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  119

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTY  330
            KLAVL++YKVDE+GK+ RLR+ECP  ECGAG FMA+HFDRHYCGKC LTY
Sbjct  120  KLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCTLTY  169



>ref|XP_006889610.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elephantulus 
edwardii]
Length=155

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 1/115 (1%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQ ESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQ-ESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  97

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC LTY +NK 
Sbjct  98   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKP  152



>ref|XP_001087600.1| PREDICTED: hypothetical protein LOC697620 [Macaca mulatta]
 gb|EHH28585.1| hypothetical protein EGK_19055 [Macaca mulatta]
Length=156

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  7    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkvkL  186
            QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV L
Sbjct  41   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVML  100

Query  187  AVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            AVL++YKVDE GK+ RLR+ECP+ ECGAG FMA+HFDRHYC KC LTY +NK 
Sbjct  101  AVLKYYKVDEKGKISRLRRECPSDECGAGVFMASHFDRHYCDKCCLTYCFNKP  153



>ref|XP_003504023.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Cricetulus griseus]
Length=156

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK+YT PKK KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP+ ECGAG FMA+HFDRHYCGKC L Y +   
Sbjct  99   KLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLPYCFQNP  153



>emb|CCA70746.1| probable ubiquitin/ribosomal protein S27a fusion protein [Piriformospora 
indica DSM 11827]
Length=158

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKKTY  PKK+KHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYNTPKKVKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVY  336
            K+A+L++YKVD  GK++RLRKECPNAECGAG FMA H DR YCGKCGLTY +
Sbjct  99   KMAILKYYKVDSDGKIKRLRKECPNAECGAGVFMAFHHDRQYCGKCGLTYQF  150



>gb|ADF45325.1| ubiquitin/ribosomal S27 fusion protein 1 [Eriocheir sinensis]
 gb|ADH43625.1| ubiquitin a [Eriocheir sinensis]
 gb|ADW27184.1| ubiquitin/ribosomal S27 fusion protein [Eriocheir sinensis]
Length=154

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGAKKRKKK YT PKKIKHKHKKV
Sbjct  39   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKNYTTPKKIKHKHKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLA+L+FYKVD++GK+ R R+ECP+ ECGAG FMAN FDR YCG+C LTYV+NK 
Sbjct  99   KLAMLKFYKVDDNGKITRQRRECPSDECGAGVFMANMFDRQYCGRCHLTYVFNKP  153



>ref|XP_011208987.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Bactrocera dorsalis]
Length=156

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAkkrkkktytkpkkikhkhkkv  180
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKK Y+ PKKIKHK KKV
Sbjct  39   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKV  98

Query  181  kLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA  345
            KLAVL++YKVDE+GK+ RLR+ECP   CGAG FMA H DRHYCGKC LT+V++K 
Sbjct  99   KLAVLKYYKVDENGKIHRLRRECPGENCGAGVFMAAHEDRHYCGKCQLTFVFSKP  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 859090811640