BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24707_g1_i2 len=1866 path=[1:0-219 221:220-239 241:240-292
294:293-322 324:323-363 5972:364-430 432:431-468 3548:469-472
474:473-567 6268:568-585 587:586-631 3836:632-636 638:637-663
6189:664-719 721:720-758 6399:759-784 786:785-870 4887:871-1865]

Length=1866
                                                                      Score     E

ref|XP_009773016.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    559   0.0      
ref|XP_009597565.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    556   0.0      
ref|XP_004234774.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    535   0.0      
ref|XP_006349582.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    535   0.0      
ref|XP_002277003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      490   3e-164   Vitis vinifera
ref|XP_006443394.1|  hypothetical protein CICLE_v10023781mg             490   1e-163   
ref|XP_009793269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    488   4e-163   
gb|KDO55074.1|  hypothetical protein CISIN_1g048257mg                   488   6e-163   
ref|XP_006409040.1|  hypothetical protein EUTSA_v10022665mg             487   8e-163   
ref|XP_006348032.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    484   7e-162   
ref|XP_009610199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    484   7e-162   
ref|XP_010314012.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    484   7e-162   
gb|AFU52646.1|  beta-1,3-glucanase 11                                   484   9e-162   
gb|KHN32753.1|  Glucan endo-1,3-beta-glucosidase 8                      484   1e-161   
ref|XP_011078775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      484   1e-161   
ref|XP_004981482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    484   1e-161   
ref|XP_009786014.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   2e-161   
ref|XP_003624610.1|  Glucan endo-1,3-beta-glucosidase                   484   2e-161   
ref|XP_003548760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   2e-161   
ref|XP_009605785.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   2e-161   
ref|XP_010036190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    483   2e-161   
emb|CDP18693.1|  unnamed protein product                                484   3e-161   
gb|KHN00669.1|  Glucan endo-1,3-beta-glucosidase 8                      482   4e-161   
ref|XP_007161926.1|  hypothetical protein PHAVU_001G109400g             482   5e-161   
ref|NP_179534.1|  O-Glycosyl hydrolases family 17 protein               482   6e-161   Arabidopsis thaliana [mouse-ear cress]
gb|AAO37977.1|  putative beta-1,3 glucanase                             483   6e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006574750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    482   1e-160   
ref|NP_176656.1|  O-glycosyl hydrolases family 17 protein               481   3e-160   Arabidopsis thaliana [mouse-ear cress]
gb|AAS99718.1|  At1g64760                                               480   3e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463758.1|  hypothetical protein SORBIDRAFT_01g005610          481   4e-160   Sorghum bicolor [broomcorn]
ref|XP_004493147.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    480   4e-160   
ref|XP_007030700.1|  O-Glycosyl hydrolases family 17 protein            479   6e-160   
emb|CDP18694.1|  unnamed protein product                                479   7e-160   
ref|XP_006599436.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    479   8e-160   
ref|XP_006297581.1|  hypothetical protein CARUB_v10013602mg             479   1e-159   
gb|EPS74227.1|  beta-1,3-glucanase, acidic                              478   1e-159   
ref|XP_010257709.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    478   2e-159   
ref|XP_002888279.1|  glycosyl hydrolase family 17 protein               478   3e-159   
ref|XP_010054473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      476   1e-158   
ref|XP_006650710.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    476   1e-158   
ref|XP_004288532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    476   2e-158   
ref|XP_010909077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    476   2e-158   
ref|XP_004288531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    476   2e-158   
gb|AAQ90287.1|  beta-1,3-glucanase, acidic                              475   3e-158   Coffea arabica [arabica coffee]
gb|KFK26060.1|  hypothetical protein AALP_AA8G198000                    475   5e-158   
ref|XP_007151834.1|  hypothetical protein PHAVU_004G079100g             474   5e-158   
ref|XP_009353157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    474   1e-157   
emb|CDY03359.1|  BnaC09g09890D                                          474   1e-157   
ref|XP_008806060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   1e-157   
ref|XP_009112609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      473   1e-157   
ref|XP_010276412.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   3e-157   
ref|XP_006289696.1|  hypothetical protein CARUB_v10003257mg             473   3e-157   
ref|XP_010470322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   3e-157   
ref|XP_010495273.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    472   8e-157   
ref|XP_010496623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   1e-156   
ref|XP_011010121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      471   1e-156   
ref|XP_011034355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   2e-156   
emb|CDY48710.1|  BnaA09g09850D                                          471   2e-156   
ref|XP_009121000.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      471   2e-156   
ref|XP_003559620.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   2e-156   
ref|XP_004955566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    470   3e-156   
ref|XP_008391677.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      470   3e-156   
ref|XP_010454046.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   3e-156   
ref|XP_006400369.1|  hypothetical protein EUTSA_v10015448mg             469   9e-156   
ref|XP_008812061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      469   1e-155   
ref|XP_002884423.1|  glycosyl hydrolase family 17 protein               469   1e-155   
gb|KDP39719.1|  hypothetical protein JCGZ_02739                         468   1e-155   
ref|XP_002525445.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    468   2e-155   Ricinus communis
ref|XP_006362259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    468   2e-155   
ref|XP_010420566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   2e-155   
ref|NP_197323.1|  O-Glycosyl hydrolases family 17 protein               468   2e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    468   2e-155   
ref|XP_003619009.1|  Glucan endo-1,3-beta-glucosidase                   466   5e-155   
ref|XP_008465328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    467   5e-155   
gb|AIR93903.1|  glucanase                                               466   1e-154   
gb|AAD38251.1|AC006193_7  Similar to glucan endo-1,3-beta-glucosi...    464   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187051.3|  O-glycosyl hydrolases family 17 protein               466   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    465   3e-154   
ref|NP_001057968.1|  Os06g0590600                                       464   5e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412333.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    463   5e-154   
ref|XP_002459388.1|  hypothetical protein SORBIDRAFT_02g003910          464   7e-154   Sorghum bicolor [broomcorn]
ref|XP_010553811.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    464   1e-153   
gb|EAZ37505.1|  hypothetical protein OsJ_21839                          463   1e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006837787.1|  hypothetical protein AMTR_s00104p00085600          463   1e-153   
ref|XP_010467891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    463   1e-153   
ref|XP_008240488.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    463   2e-153   
ref|XP_002873877.1|  predicted protein                                  463   2e-153   
ref|XP_010672074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    462   3e-153   
ref|XP_010485770.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    462   5e-153   
ref|XP_002319699.1|  glycosyl hydrolase family 17 family protein        461   8e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006408232.1|  hypothetical protein EUTSA_v10020592mg             461   1e-152   
gb|ACG29689.1|  glucan endo-1,3-beta-glucosidase 5 precursor            461   1e-152   Zea mays [maize]
ref|XP_009418954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   1e-152   
emb|CDY42897.1|  BnaC05g47540D                                          461   2e-152   
ref|NP_001130924.1|  putative O-Glycosyl hydrolase superfamily pr...    461   2e-152   Zea mays [maize]
emb|CDM83452.1|  unnamed protein product                                460   2e-152   
ref|XP_009393970.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   3e-152   
ref|XP_010528707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   3e-152   
ref|XP_009130411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      460   4e-152   
ref|XP_010415342.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   4e-152   
gb|KFK37837.1|  hypothetical protein AALP_AA3G035600                    462   4e-152   
ref|XP_006297514.1|  hypothetical protein CARUB_v10013538mg             459   6e-152   
ref|XP_010463871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   9e-152   
ref|XP_010517383.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   1e-151   
ref|XP_009388996.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    458   2e-151   
ref|XP_006826313.1|  hypothetical protein AMTR_s00004p00082670          456   7e-151   
gb|KHN46790.1|  Glucan endo-1,3-beta-glucosidase 8                      454   1e-150   
ref|XP_010672072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      456   1e-150   
gb|KDP35276.1|  hypothetical protein JCGZ_09435                         455   1e-150   
dbj|BAJ94415.1|  predicted protein                                      456   1e-150   
ref|XP_010086599.1|  Glucan endo-1,3-beta-glucosidase 8                 456   1e-150   
gb|KDO55075.1|  hypothetical protein CISIN_1g011532mg                   455   2e-150   
ref|XP_006443393.1|  hypothetical protein CICLE_v10019922mg             455   2e-150   
ref|XP_006657484.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    455   2e-150   
ref|XP_010528719.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    455   3e-150   
ref|XP_008386810.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   6e-150   
ref|XP_002325410.1|  hypothetical protein POPTR_0019s04850g             455   7e-150   Populus trichocarpa [western balsam poplar]
ref|XP_003557824.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   1e-149   
dbj|BAD31779.1|  putative 3-glucanase                                   453   1e-149   Oryza sativa Japonica Group [Japonica rice]
gb|AAT42176.1|  putative 3-glucanase                                    454   1e-149   Zea mays [maize]
ref|XP_007204344.1|  hypothetical protein PRUPE_ppa005641mg             451   5e-149   
ref|XP_006656196.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    451   5e-149   
ref|XP_009366428.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      451   2e-148   
gb|AES75227.2|  O-glycosyl hydrolase family 17 protein                  449   2e-148   
ref|XP_008232375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
ref|NP_001147672.1|  glucan endo-1,3-beta-glucosidase 5                 450   3e-148   Zea mays [maize]
ref|NP_001058984.2|  Os07g0168600                                       452   4e-148   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90806.1|  predicted protein                                      449   4e-148   
dbj|BAJ98060.1|  predicted protein                                      449   5e-148   
ref|XP_009336373.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   6e-148   
ref|XP_010549610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   7e-148   
ref|XP_010928419.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   9e-148   
ref|XP_004982257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   1e-147   
ref|XP_008338651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   1e-147   
ref|XP_008361509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   1e-147   
dbj|BAK05853.1|  predicted protein                                      448   2e-147   
ref|XP_003561381.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   2e-147   
ref|XP_007207576.1|  hypothetical protein PRUPE_ppa018453mg             446   4e-147   
ref|XP_004966001.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   4e-147   
gb|ACG41694.1|  glucan endo-1,3-beta-glucosidase 5 precursor            446   1e-146   Zea mays [maize]
ref|XP_008457953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   1e-146   
ref|XP_002449743.1|  hypothetical protein SORBIDRAFT_05g022490          444   1e-145   Sorghum bicolor [broomcorn]
ref|XP_006299509.1|  hypothetical protein CARUB_v10015679mg             444   1e-145   
ref|NP_001050810.1|  Os03g0656800                                       443   1e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      440   2e-145   
ref|XP_008778100.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   2e-145   
ref|NP_001183732.1|  uncharacterized protein LOC100502325 precursor     442   2e-145   
ref|XP_010513396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   3e-145   
ref|XP_004982258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   4e-145   
ref|XP_008440124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      442   4e-145   
ref|NP_001140660.1|  putative O-Glycosyl hydrolase superfamily pr...    442   5e-145   Zea mays [maize]
ref|XP_008392630.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    441   5e-145   
ref|XP_009102513.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      441   9e-145   
ref|XP_002530257.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    441   1e-144   Ricinus communis
dbj|BAJ85378.1|  predicted protein                                      441   1e-144   
ref|XP_009336372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   1e-144   
ref|XP_006418767.1|  hypothetical protein EUTSA_v10002822mg             442   2e-144   
ref|XP_008793474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   3e-144   
emb|CDX77431.1|  BnaA07g05690D                                          440   3e-144   
ref|NP_001068140.2|  Os11g0577800                                       439   4e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004149714.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   4e-144   
ref|XP_004170594.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   5e-144   
emb|CDY66442.1|  BnaCnng50870D                                          439   5e-144   
dbj|BAK06743.1|  predicted protein                                      439   6e-144   
ref|XP_004142041.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   6e-144   
gb|EAZ18823.1|  hypothetical protein OsJ_34360                          439   6e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010242326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    438   7e-144   
ref|XP_008338633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    438   7e-144   
ref|NP_001152213.1|  glucan endo-1,3-beta-glucosidase 5 precursor       438   1e-143   Zea mays [maize]
ref|XP_007204529.1|  hypothetical protein PRUPE_ppa017632mg             437   2e-143   
ref|XP_002466725.1|  hypothetical protein SORBIDRAFT_01g012900          437   3e-143   Sorghum bicolor [broomcorn]
gb|KFK39737.1|  hypothetical protein AALP_AA3G281400                    436   3e-143   
ref|XP_010088872.1|  Glucan endo-1,3-beta-glucosidase 8                 437   4e-143   
ref|XP_004164948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   6e-143   
ref|NP_001056153.1|  Os05g0535100                                       436   7e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007208233.1|  hypothetical protein PRUPE_ppa017706mg             435   7e-143   
ref|NP_189076.1|  O-Glycosyl hydrolases family 17 protein               436   8e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440138.1|  hypothetical protein SORBIDRAFT_09g026690          436   9e-143   Sorghum bicolor [broomcorn]
ref|XP_007048158.1|  O-Glycosyl hydrolases family 17 protein, put...    436   9e-143   
ref|XP_008232612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   1e-142   
ref|XP_004250551.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      436   1e-142   
emb|CDM86682.1|  unnamed protein product                                436   1e-142   
ref|XP_002438620.1|  hypothetical protein SORBIDRAFT_10g022940          436   1e-142   Sorghum bicolor [broomcorn]
ref|XP_003565994.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
gb|EAY81406.1|  hypothetical protein OsI_36575                          435   2e-142   Oryza sativa Indica Group [Indian rice]
ref|XP_006352469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   2e-142   
ref|XP_004961391.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   3e-142   
ref|XP_010488537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   3e-142   
ref|XP_004979540.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    434   4e-142   
ref|XP_006394112.1|  hypothetical protein EUTSA_v10004092mg             434   4e-142   
ref|XP_010086919.1|  Glucan endo-1,3-beta-glucosidase 8                 434   4e-142   
gb|KFK28168.1|  hypothetical protein AALP_AA8G481200                    434   5e-142   
gb|KHG25475.1|  hypothetical protein F383_09937                         432   6e-142   
ref|XP_008242583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      434   6e-142   
ref|XP_009336879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   8e-142   
ref|XP_003560627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   1e-141   
ref|XP_010257791.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      432   1e-141   
ref|XP_003575938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    432   2e-141   
ref|XP_010915073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   3e-141   
ref|XP_009769717.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      431   3e-141   
gb|EEE64491.1|  hypothetical protein OsJ_19341                          431   4e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009402192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   6e-141   
ref|NP_201284.1|  O-Glycosyl hydrolases family 17 protein               431   8e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KHN10411.1|  Glucan endo-1,3-beta-glucosidase 8                      430   8e-141   
ref|XP_006655526.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   1e-140   
ref|XP_006355982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   1e-140   
gb|EPS65796.1|  hypothetical protein M569_08979                         430   1e-140   
ref|XP_003550844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   2e-140   
ref|XP_010049931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      430   2e-140   
ref|XP_010027756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      427   1e-139   
gb|KCW82758.1|  hypothetical protein EUGRSUZ_C04137                     430   2e-139   
gb|KCW54346.1|  hypothetical protein EUGRSUZ_I00311                     426   2e-139   
emb|CDP03371.1|  unnamed protein product                                426   2e-139   
ref|XP_002864921.1|  glycosyl hydrolase family 17 protein               426   4e-139   
ref|XP_008362938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   5e-139   
ref|XP_004498612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    425   1e-138   
ref|XP_009112157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    425   2e-138   
ref|XP_010444426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    424   2e-138   
ref|XP_009626950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    425   3e-138   
ref|XP_002991155.1|  hypothetical protein SELMODRAFT_132967             425   3e-138   
ref|XP_006281667.1|  hypothetical protein CARUB_v10027803mg             424   3e-138   
ref|XP_010261306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    424   3e-138   
ref|XP_008458070.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      424   3e-138   
ref|XP_002275701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      424   4e-138   Vitis vinifera
ref|XP_010688142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      424   4e-138   
ref|XP_009352686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    423   4e-138   
ref|XP_002310612.1|  glycosyl hydrolase family 17 family protein        424   5e-138   Populus trichocarpa [western balsam poplar]
emb|CCH47219.1|  similar to glucan endo-1,3-beta-glucosidase            423   7e-138   
emb|CAN62816.1|  hypothetical protein VITISV_031885                     423   8e-138   Vitis vinifera
ref|XP_010520102.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      423   8e-138   
gb|KDO80436.1|  hypothetical protein CISIN_1g047337mg                   423   8e-138   
gb|EMS57429.1|  Glucan endo-1,3-beta-glucosidase 8                      422   8e-138   
gb|EMS60021.1|  Glucan endo-1,3-beta-glucosidase 8                      427   1e-137   
ref|XP_002883518.1|  glycosyl hydrolase family 17 protein               422   1e-137   
ref|XP_002281500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      422   2e-137   Vitis vinifera
gb|KEH39797.1|  glucan endo-1,3-beta-glucosidase-like protein           422   2e-137   
ref|XP_006476105.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    422   2e-137   
gb|KGN60639.1|  hypothetical protein Csa_2G005360                       421   3e-137   
ref|XP_002970933.1|  hypothetical protein SELMODRAFT_267465             421   3e-137   
ref|XP_011082117.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      421   4e-137   
ref|XP_006283637.1|  hypothetical protein CARUB_v10004695mg             421   4e-137   
ref|XP_006580871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    420   4e-137   
ref|NP_194843.1|  glucan endo-1,3-beta-glucosidase 5                    421   5e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    421   6e-137   
ref|XP_004163604.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    421   6e-137   
ref|XP_010681060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    421   6e-137   
ref|XP_009418582.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    421   7e-137   
ref|XP_002968123.1|  hypothetical protein SELMODRAFT_231117             420   7e-137   
gb|EMS47593.1|  Glucan endo-1,3-beta-glucosidase 8                      420   7e-137   
ref|XP_011078347.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      421   8e-137   
ref|XP_002869343.1|  glycosyl hydrolase family 17 protein               420   1e-136   
gb|KEH41651.1|  O-glycosyl hydrolase family 17 protein                  420   1e-136   
gb|ACN32122.1|  unknown                                                 421   1e-136   Zea mays [maize]
gb|KDO67128.1|  hypothetical protein CISIN_1g010789mg                   421   1e-136   
gb|KHN38236.1|  Glucan endo-1,3-beta-glucosidase 8                      420   1e-136   
ref|XP_011025580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    420   2e-136   
gb|KFK29702.1|  hypothetical protein AALP_AA7G168000                    419   4e-136   
ref|XP_009127212.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      419   4e-136   
ref|XP_002970359.1|  hypothetical protein SELMODRAFT_231628             417   6e-136   
ref|XP_006450066.1|  hypothetical protein CICLE_v10008079mg             419   6e-136   
ref|XP_008787369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      417   9e-136   
emb|CDY46823.1|  BnaC02g43310D                                          417   1e-135   
ref|XP_010484272.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    417   1e-135   
emb|CDY28246.1|  BnaA01g06030D                                          417   1e-135   
ref|XP_004504006.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    417   1e-135   
ref|XP_010669543.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      418   2e-135   
gb|KEH32093.1|  glucan endo-1,3-beta-glucosidase-like protein           418   2e-135   
ref|XP_006596135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   3e-135   
ref|XP_002515573.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    416   4e-135   Ricinus communis
ref|XP_010447615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   4e-135   
gb|KDP32321.1|  hypothetical protein JCGZ_13246                         416   5e-135   
ref|XP_009130473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   5e-135   
ref|XP_004513603.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   6e-135   
ref|XP_011009207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      416   7e-135   
ref|XP_010914019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      415   8e-135   
ref|XP_004239361.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    415   1e-134   
ref|XP_006412625.1|  hypothetical protein EUTSA_v10025047mg             415   1e-134   
ref|XP_010438078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      415   1e-134   
ref|XP_010432901.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   2e-134   
gb|KHN10282.1|  Glucan endo-1,3-beta-glucosidase 5                      414   2e-134   
gb|EEC79587.1|  hypothetical protein OsI_20766                          413   2e-134   
ref|XP_003523713.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   2e-134   
ref|XP_010048510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      414   2e-134   
ref|XP_010913808.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   2e-134   
dbj|BAK03700.1|  predicted protein                                      414   3e-134   
ref|XP_004951931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   3e-134   
emb|CDX68724.1|  BnaC01g07290D                                          414   4e-134   
ref|XP_002324967.2|  hypothetical protein POPTR_0018s06250g             414   4e-134   
gb|KDO50472.1|  hypothetical protein CISIN_1g045344mg                   418   5e-134   
ref|XP_007159772.1|  hypothetical protein PHAVU_002G266100g             414   5e-134   
ref|XP_010526287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    413   6e-134   
ref|XP_004237474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    412   7e-134   
ref|XP_006483661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    413   7e-134   
ref|XP_011017570.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      412   8e-134   
ref|XP_009392760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    413   9e-134   
ref|XP_006372260.1|  hypothetical protein POPTR_0018s14730g             412   1e-133   
ref|XP_007155137.1|  hypothetical protein PHAVU_003G176600g             428   1e-133   
gb|EYU37424.1|  hypothetical protein MIMGU_mgv1a005873mg                411   1e-133   
gb|KHN16471.1|  Glucan endo-1,3-beta-glucosidase 5                      412   2e-133   
ref|XP_008776624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    412   2e-133   
ref|XP_009595344.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    410   5e-133   
ref|XP_003526446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    410   5e-133   
gb|ABK25447.1|  unknown                                                 410   5e-133   
dbj|BAK03448.1|  predicted protein                                      410   6e-133   
gb|EPS71987.1|  hypothetical protein M569_02770                         409   7e-133   
ref|XP_007013263.1|  O-Glycosyl hydrolases family 17 protein            410   7e-133   
emb|CDY54044.1|  BnaC09g54160D                                          407   7e-133   
ref|XP_009792045.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    410   8e-133   
ref|XP_010048500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      410   9e-133   
ref|XP_009781628.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    410   9e-133   
ref|XP_006451059.1|  hypothetical protein CICLE_v10007363mg             424   1e-132   
ref|XP_004288682.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    409   2e-132   
emb|CDP14258.1|  unnamed protein product                                409   2e-132   
gb|EMT04543.1|  Glucan endo-1,3-beta-glucosidase 8                      407   5e-132   
emb|CDY38496.1|  BnaA10g16620D                                          405   7e-132   
gb|AFK43211.1|  unknown                                                 407   8e-132   
ref|XP_010669627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      407   9e-132   
ref|XP_004289257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    406   1e-131   
ref|XP_007161283.1|  hypothetical protein PHAVU_001G057100g             407   1e-131   
ref|XP_011097609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    409   1e-131   
ref|XP_010525845.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    407   2e-131   
ref|XP_004508564.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    407   2e-131   
gb|EMS57703.1|  Glucan endo-1,3-beta-glucosidase 8                      405   2e-131   
gb|EYU23029.1|  hypothetical protein MIMGU_mgv1a006384mg                405   2e-131   
ref|XP_010415358.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   2e-131   
gb|EYU24023.1|  hypothetical protein MIMGU_mgv1a004416mg                407   4e-131   
ref|XP_006601109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    405   4e-131   
ref|XP_010099734.1|  Glucan endo-1,3-beta-glucosidase 6                 405   5e-131   
ref|XP_009623324.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   1e-130   
ref|XP_008466353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      404   1e-130   
ref|XP_010536989.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      404   1e-130   
ref|XP_010095481.1|  Glucan endo-1,3-beta-glucosidase 5                 405   1e-130   
ref|XP_004289256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   2e-130   
ref|XP_009797292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   2e-130   
ref|XP_004502874.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   2e-130   
ref|XP_003528028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   2e-130   
ref|XP_004239309.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      403   4e-130   
ref|XP_009407893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      403   4e-130   
gb|EYU24024.1|  hypothetical protein MIMGU_mgv1a004416mg                404   6e-130   
ref|XP_008781699.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    403   6e-130   
ref|XP_004972550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    403   7e-130   
ref|XP_006338109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    402   7e-130   
ref|XP_009126789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    402   8e-130   
ref|XP_009137993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    402   2e-129   
gb|KHN05785.1|  Glucan endo-1,3-beta-glucosidase 8                      401   3e-129   
ref|XP_006850025.1|  hypothetical protein AMTR_s00022p00188990          401   3e-129   
ref|XP_004246072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      401   4e-129   
ref|XP_006280397.1|  hypothetical protein CARUB_v10026324mg             400   4e-129   
emb|CDY13412.1|  BnaA03g51300D                                          400   4e-129   
ref|XP_003630124.1|  Glucan endo-1,3-beta-glucosidase                   404   4e-129   
ref|XP_010483379.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      400   4e-129   
ref|XP_009395879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    401   4e-129   
ref|XP_006578454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    401   4e-129   
gb|EMT08496.1|  Glucan endo-1,3-beta-glucosidase 5                      401   5e-129   
emb|CDX72294.1|  BnaC07g43160D                                          400   5e-129   
gb|AFU52650.1|  beta-1,3-glucanase 16                                   400   6e-129   
ref|XP_010928748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    400   9e-129   
ref|XP_007137587.1|  hypothetical protein PHAVU_009G138800g             400   1e-128   
gb|EYU20663.1|  hypothetical protein MIMGU_mgv1a018565mg                397   1e-128   
ref|XP_002982430.1|  hypothetical protein SELMODRAFT_155115             399   1e-128   
gb|KDO73371.1|  hypothetical protein CISIN_1g011636mg                   399   2e-128   
ref|XP_003574453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      399   2e-128   
ref|XP_009783390.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    398   2e-128   
ref|XP_006474357.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    398   3e-128   
ref|XP_002966594.1|  hypothetical protein SELMODRAFT_86140              398   4e-128   
ref|XP_010453200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    398   4e-128   
ref|XP_004136331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    398   5e-128   
ref|XP_002445228.1|  hypothetical protein SORBIDRAFT_07g006340          398   5e-128   
gb|EYU31104.1|  hypothetical protein MIMGU_mgv1a006003mg                397   5e-128   
ref|XP_003573567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   6e-128   
ref|XP_002866250.1|  glycosyl hydrolase family 17 protein               397   6e-128   
ref|XP_006648298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   7e-128   
ref|XP_004303439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   7e-128   
ref|XP_009120323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      397   7e-128   
ref|XP_006355222.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   7e-128   
ref|XP_003528268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   7e-128   
gb|EPS64137.1|  hypothetical protein M569_10642                         397   8e-128   
emb|CDY62695.1|  BnaA10g29270D                                          397   8e-128   
gb|KHN20653.1|  Glucan endo-1,3-beta-glucosidase 8                      397   8e-128   
ref|XP_010687609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   9e-128   
ref|XP_006401129.1|  hypothetical protein EUTSA_v10013422mg             397   1e-127   
ref|XP_009369739.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   1e-127   
emb|CDY43882.1|  BnaC09g33610D                                          397   1e-127   
ref|NP_001045844.1|  Os02g0139300                                       397   1e-127   
gb|EAY84415.1|  hypothetical protein OsI_05789                          397   1e-127   
gb|KFK27342.1|  hypothetical protein AALP_AA8G370600                    396   1e-127   
emb|CDP12875.1|  unnamed protein product                                396   2e-127   
ref|NP_200617.2|  glucan endo-1,3-beta-glucosidase 6                    396   2e-127   
ref|XP_008391995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   2e-127   
ref|XP_010443524.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   2e-127   
ref|XP_009376335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      397   2e-127   
ref|XP_006414264.1|  hypothetical protein EUTSA_v10024947mg             397   2e-127   
ref|XP_004242904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   2e-127   
emb|CDY02795.1|  BnaC02g10940D                                          396   2e-127   
ref|XP_007222346.1|  hypothetical protein PRUPE_ppa004814mg             396   3e-127   
gb|AFU52639.1|  beta-1,3-glucanase 4                                    396   3e-127   
ref|XP_003541322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   3e-127   
ref|XP_008380615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      396   5e-127   
ref|XP_008219823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    395   6e-127   
dbj|BAJ95993.1|  predicted protein                                      395   7e-127   
ref|XP_004296615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    395   9e-127   
gb|AAL24251.1|  AT5g58090/k21l19_70                                     394   1e-126   
ref|XP_004154666.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    394   1e-126   
ref|XP_008242139.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      394   1e-126   
gb|EYU25788.1|  hypothetical protein MIMGU_mgv1a027166mg                394   2e-126   
ref|XP_008443646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      394   2e-126   
ref|XP_010939839.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    394   2e-126   
ref|XP_010418908.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      390   2e-126   
gb|AES92122.2|  glucan endo-1,3-beta-glucosidase-like protein           394   2e-126   
gb|AAS75228.1|  unknown protein                                         400   3e-126   
ref|XP_009144687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      393   3e-126   
ref|XP_004508054.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    393   3e-126   
ref|XP_009363574.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    393   4e-126   
ref|XP_009601131.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    393   4e-126   
ref|NP_193451.2|  O-Glycosyl hydrolases family 17 protein               392   4e-126   
ref|XP_010273788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    393   5e-126   
ref|NP_001151032.1|  glucan endo-1,3-beta-glucosidase 6 precursor       393   5e-126   
emb|CAB10499.1|  glucanase like protein                                 393   5e-126   
ref|XP_011093909.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   6e-126   
ref|XP_002969872.1|  hypothetical protein SELMODRAFT_171231             392   8e-126   
ref|XP_003550587.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   8e-126   
ref|XP_011003008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   9e-126   
ref|XP_007222660.1|  hypothetical protein PRUPE_ppa004964mg             392   9e-126   
ref|XP_002530371.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    392   9e-126   
ref|XP_004139090.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   1e-125   
emb|CDY50874.1|  BnaA05g37350D                                          389   1e-125   
ref|XP_009618025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   2e-125   
ref|XP_002985205.1|  hypothetical protein SELMODRAFT_121927             392   2e-125   
ref|XP_006344579.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    391   2e-125   
ref|XP_002870120.1|  glycosyl hydrolase family 17 protein               391   2e-125   
ref|XP_002968207.1|  hypothetical protein SELMODRAFT_89756              393   2e-125   
ref|XP_009792149.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    391   2e-125   
ref|XP_010655026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      391   2e-125   
ref|XP_006284895.1|  hypothetical protein CARUB_v10006187mg             390   3e-125   
ref|XP_010929423.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   3e-125   
ref|XP_006851012.1|  hypothetical protein AMTR_s00025p00220320          390   3e-125   
ref|XP_009786880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    391   4e-125   
ref|XP_008678187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   4e-125   
ref|XP_002324127.1|  hypothetical protein POPTR_0018s04200g             391   4e-125   
ref|XP_009610855.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   4e-125   
ref|XP_008373974.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      390   5e-125   
ref|XP_006382223.1|  hypothetical protein POPTR_0006s29500g             391   5e-125   
ref|XP_002976170.1|  hypothetical protein SELMODRAFT_104523             392   6e-125   
ref|XP_010252157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   6e-125   
gb|KHG03269.1|  hypothetical protein F383_27500                         390   6e-125   
ref|XP_002516181.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    390   6e-125   
ref|XP_010434711.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   7e-125   
ref|XP_009776006.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    390   7e-125   
ref|XP_003609925.1|  Glucan endo-1 3-beta-glucosidase                   393   1e-124   
ref|XP_010440044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   1e-124   
ref|XP_008224566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      389   2e-124   
ref|XP_007201955.1|  hypothetical protein PRUPE_ppa004643mg             389   2e-124   
ref|XP_006474550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   2e-124   
ref|XP_001757439.1|  predicted protein                                  389   2e-124   
gb|KFK32198.1|  hypothetical protein AALP_AA6G210100                    388   3e-124   
ref|XP_009390478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    388   3e-124   
ref|XP_010449654.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    388   3e-124   
gb|KDO73724.1|  hypothetical protein CISIN_1g011391mg                   388   3e-124   
ref|NP_001051526.2|  Os03g0792800                                       385   3e-124   
ref|XP_002277217.3|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      388   4e-124   
emb|CDY35595.1|  BnaC01g21170D                                          387   4e-124   
ref|XP_004517299.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   4e-124   
ref|XP_011095873.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      387   4e-124   
ref|XP_006452923.1|  hypothetical protein CICLE_v10008127mg             387   5e-124   
emb|CDP19937.1|  unnamed protein product                                387   7e-124   
gb|EPS63303.1|  hypothetical protein M569_11481                         385   9e-124   
gb|ABD65105.1|  glycosyl hydrolase family protein                       386   1e-123   
ref|XP_009388760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    387   1e-123   
ref|XP_010278473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      386   1e-123   
ref|XP_010657459.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      387   2e-123   
ref|XP_007147571.1|  hypothetical protein PHAVU_006G135700g             386   2e-123   
dbj|BAG88662.1|  unnamed protein product                                382   3e-123   
gb|KDP39750.1|  hypothetical protein JCGZ_02770                         385   3e-123   
ref|XP_009359672.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    385   5e-123   
ref|XP_007012497.1|  O-Glycosyl hydrolases family 17 protein            385   6e-123   
gb|AES73764.2|  glucan endo-1,3-beta-glucosidase-like protein           384   7e-123   
ref|XP_008379681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    385   8e-123   
ref|XP_003603513.1|  Glucan endo-1 3-beta-glucosidase                   384   8e-123   
gb|KHN14405.1|  Glucan endo-1,3-beta-glucosidase 5                      384   8e-123   
ref|XP_007138338.1|  hypothetical protein PHAVU_009G200400g             384   9e-123   
ref|XP_001773368.1|  predicted protein                                  384   9e-123   
ref|XP_008347693.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   2e-122   
ref|XP_007154528.1|  hypothetical protein PHAVU_003G126100g             384   2e-122   
ref|XP_008782991.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      384   2e-122   
ref|XP_011078161.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   2e-122   
ref|XP_009407926.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    383   2e-122   
gb|AIR93902.1|  glucanase                                               382   3e-122   
ref|XP_008800518.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    383   3e-122   
gb|ABN08871.1|  Glycoside hydrolase, family 17; X8                      382   4e-122   
ref|XP_010496624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    379   4e-122   
ref|XP_011019284.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      383   4e-122   
ref|XP_009794224.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   4e-122   
ref|XP_010252866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   4e-122   
ref|XP_009395841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   5e-122   
ref|XP_006467225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    383   6e-122   
ref|XP_006857659.1|  hypothetical protein AMTR_s00061p00152190          381   9e-122   
ref|XP_003594346.1|  Glucan endo-1,3-beta-glucosidase                   382   1e-121   
ref|XP_006836569.1|  hypothetical protein AMTR_s00131p00072670          381   2e-121   
ref|XP_009595444.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 9      381   2e-121   
ref|XP_011040111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    380   3e-121   



>ref|XP_009773016.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=505

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/438 (64%), Positives = 329/438 (75%), Gaps = 6/438 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN+ E ILNALAGTGIEVMIG  N 
Sbjct  19    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETILNALAGTGIEVMIGISNQ  78

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK++VN DVA  +VKENVTR+ P SP GV ITL+G+GNEPFL+ Y K  L  VT PAL 
Sbjct  79    LLKDLVNPDVATKWVKENVTRFDPKSPKGVNITLIGVGNEPFLRDY-KDTLTNVTGPALE  137

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G TTKATVP NADVYLSP   PVPSAG FR DI   +  I+KVLD+N +
Sbjct  138   NIQNALNDAGLGDTTKATVPLNADVYLSPSWNPVPSAGFFRADIVDPLNYILKVLDKNKA  197

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALAREG  899
             PFM+N+YPFLSL++ NG+FPFD+AFFDGV  PL D +G  YTN FDAN DT  AALA  G
Sbjct  198   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVTNPLKDKDGIEYTNCFDANLDTCAAALAGAG  257

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +  MT+ VGE+GWPTDGN +AN +LA KFY GF+ +LA  KG+P RPG  LE Y+F LFD
Sbjct  258   YPNMTIMVGEMGWPTDGNPYANVTLAEKFYKGFVSYLAKGKGSPRRPG-YLEAYVFALFD  316

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED+KS LPG+FE HWGI   DG PKF LDLSG  K   L  VP +E LPKKWC VK + K
Sbjct  317   EDRKSTLPGNFETHWGIYYEDGTPKFPLDLSGKNKTSTLVPVPNVEKLPKKWCVVKPDVK  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
               N  + +SYACDRADCT  +NGSSC +L++ +K SY  NAYFQ  EQ+ GSCDF G   
Sbjct  377   --NFTSLMSYACDRADCTPLTNGSSCQNLSDADKASYALNAYFQNQEQKDGSCDFEGKAT  434

Query  1437  VTTTNLSTSTCNFNIGIK  1490
             VTT + S  TCNF IG K
Sbjct  435   VTTKDPSQGTCNFTIGFK  452



>ref|XP_009597565.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=503

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/437 (64%), Positives = 326/437 (75%), Gaps = 5/437 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN+ E  LNALAGTGIEVMIG  N 
Sbjct  18    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETTLNALAGTGIEVMIGISNQ  77

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK++VN DVA  +VKENVTR+ P SP GV ITL+G+GNEPFL+ Y K  L  VT PAL 
Sbjct  78    LLKDLVNPDVATKWVKENVTRFDPKSPKGVNITLIGVGNEPFLRDY-KDTLTNVTGPALE  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G TTKATVP NADVYLSP   PVPSAG FR DI   +  I+KVLD+N +
Sbjct  137   NIQNALNDAGLGDTTKATVPLNADVYLSPSWNPVPSAGFFRADIVDPLNYILKVLDKNKA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALAREG  899
             PFM+N+YPFLSL++ NG+FPFD+AFFDGV  PL D +G  YTN FDAN DT  AALA  G
Sbjct  197   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVTNPLKDKDGIEYTNCFDANLDTCAAALAGAG  256

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +  MT+ VGE+GWPTDGN +AN +LA KFY GF+ +LA  KG+P RPG  LE Y+F LFD
Sbjct  257   YPNMTIMVGEMGWPTDGNPYANVTLADKFYKGFVSYLAKGKGSPRRPG-YLEAYLFALFD  315

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             ED+KS LPG+FE HWGI   DG PKF LDLSG    +L  VP +E LPKKWC VK + K 
Sbjct  316   EDRKSTLPGNFETHWGIYYDDGTPKFPLDLSGKNKTSLVPVPNVEKLPKKWCVVKPDVK-  374

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              N    +SYACDRADCT  +NGSSC +L++ +K SY  NAYFQ  EQ+ GSCDF G   V
Sbjct  375   -NFTGLMSYACDRADCTPLTNGSSCQNLSDADKASYALNAYFQNQEQKDGSCDFEGKATV  433

Query  1440  TTTNLSTSTCNFNIGIK  1490
             TT + S   CNF +G K
Sbjct  434   TTKDPSQGACNFTVGFK  450



>ref|XP_004234774.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=502

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/437 (63%), Positives = 327/437 (75%), Gaps = 6/437 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN+ E ILNALAGTGIEVMIG  N 
Sbjct  21    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETILNALAGTGIEVMIGISNQ  80

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK++VN DVA+ +VKENVTRY+P SP GV ITLVG+GNEPFL+ Y K  L  VT PAL 
Sbjct  81    LLKDLVNPDVAKKWVKENVTRYEPKSPKGVNITLVGVGNEPFLRDY-KDTLTNVTGPALE  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G TTKATVP NADVYLSP   PVPS G FR DI   +  I+KVL++N +
Sbjct  140   NIQNALNDAGLGDTTKATVPLNADVYLSPSYNPVPSGGFFRADIVDPLNYILKVLNKNKA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALAREG  899
             PFM+N+YPFLSL++ NG+FPFD+AFFDGV  PL D +G  YTN FDAN DT  AALA  G
Sbjct  200   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVSNPLKDKDGVEYTNCFDANLDTCAAALAGAG  259

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +G MT+ VGE+GWPTDGN +AN +LA KFY GF+ +LA  KG+P RPG+ +E Y+F LFD
Sbjct  260   YGNMTIMVGEMGWPTDGNNYANVTLAEKFYKGFVSYLAKGKGSPRRPGN-VEAYIFALFD  318

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             ED+KS LPG+FE HWG+   DG PKF LDL G K K L  VP +E L KKWC +K + K 
Sbjct  319   EDRKSTLPGNFETHWGLYYDDGTPKFPLDLHGNK-KNLVPVPNVEKLSKKWCVIKPDVK-  376

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              N    ++YACDRADCT  +NGSSC +L +  K SY  NAYFQ  +Q+  SC+F G   V
Sbjct  377   -NFTDVMTYACDRADCTPLTNGSSCQNLNDAAKASYAVNAYFQNSQQKDDSCNFEGKATV  435

Query  1440  TTTNLSTSTCNFNIGIK  1490
             TT + S  TCNF IG K
Sbjct  436   TTKDPSQGTCNFTIGFK  452



>ref|XP_006349582.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=506

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/437 (62%), Positives = 327/437 (75%), Gaps = 6/437 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN+ E ILNALAGTGIEVMIG  N 
Sbjct  21    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETILNALAGTGIEVMIGISNQ  80

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK++VN DVA+ +VKENVTRY+P SP GV ITLVG+GNEPFL+ Y K  L  VT PAL 
Sbjct  81    LLKDLVNPDVAKKWVKENVTRYEPKSPKGVNITLVGVGNEPFLRDY-KDTLTNVTGPALE  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G TTKATVP NADVYLSP   PVPS G FR DI   +  I+KVL++N +
Sbjct  140   NIQNALNDAGLGDTTKATVPLNADVYLSPSWNPVPSGGFFRADIIDPLNSILKVLNKNKA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALAREG  899
             PFM+N+YPFLSL++ NG+FPFD+AFFDGV  PL D +G  YTN FDAN DT  AALA  G
Sbjct  200   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVSNPLKDKDGVEYTNCFDANLDTCAAALAGAG  259

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +G MT+ VGE+GWPTDGN + N +LA KFY GF+ +LA  KG+P RPG+ +E Y+F LFD
Sbjct  260   YGNMTIMVGEMGWPTDGNNYGNVTLAEKFYKGFVSYLAKGKGSPRRPGN-VEAYLFALFD  318

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             ED+KS LPG+FE HWG+   DG PKF LDL G K K L  VP +E L KKWC +K + K 
Sbjct  319   EDRKSTLPGNFETHWGLYYDDGTPKFPLDLHGNK-KTLVSVPNVEKLSKKWCVIKPDVK-  376

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              N    ++YACDRADCT  +NGSSC +L +  K SY  NAYFQ ++Q+  +C+F G   V
Sbjct  377   -NFTDLMTYACDRADCTPLTNGSSCQNLNDAAKASYAVNAYFQNNQQKDDTCNFEGKATV  435

Query  1440  TTTNLSTSTCNFNIGIK  1490
             TT + S  TCNF IG K
Sbjct  436   TTKDPSQGTCNFTIGFK  452



>ref|XP_002277003.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 ref|XP_010653839.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 emb|CAN83571.1| hypothetical protein VITISV_041708 [Vitis vinifera]
 emb|CBI29926.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   490 bits (1262),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 310/442 (70%), Gaps = 7/442 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G A ++GLGVNWG ++SH LPPK VV+MLK NGI+KVKLF++    ++ALAG+GIEVM+ 
Sbjct  18    GCASVEGLGVNWGTMASHKLPPKVVVQMLKDNGIQKVKLFDADSVTMSALAGSGIEVMVA  77

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN  L  M +YD A+A+V+ NVTRY      GV I  VG+GNEPFL  Y    L  +T 
Sbjct  78    IPNDQLAVMNDYDRAKAWVRRNVTRYNFNG--GVTIKYVGVGNEPFLSSYNGSFL-NITL  134

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI + + QI++ L+
Sbjct  135   PALQNIQNALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRTDISELMTQIVQFLN  194

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             +N++PF +N+YPFLSLY  N +FPFD+AFFDGV  P+ DNG +YTNVFDAN+DT V+AL 
Sbjct  195   KNNAPFTVNIYPFLSLY-GNDNFPFDYAFFDGVSNPIVDNGISYTNVFDANFDTLVSALK  253

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G MT+ VGE+GWPTDG++ AN++ A +FY G +  LA   GTP RPG  +EVY+FG
Sbjct  254   AVGLGDMTILVGEVGWPTDGDKNANSNNAYRFYNGLLPRLAGNIGTPLRPGY-IEVYLFG  312

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG+FERHWGI  YDGQPK+ LDLSG G+ K L    ++ YLP+KWC    
Sbjct  313   LIDEDAKSIAPGNFERHWGIFKYDGQPKYALDLSGQGQNKLLVAAKDVTYLPQKWCMFNP  372

Query  1248  NA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NA   + +   I+YAC  +DCTA   GSSC+ L      SY FN YFQ   Q+  SC F 
Sbjct  373   NAGDLSKLGDNINYACTFSDCTALGYGSSCNGLDAQGNASYAFNMYFQVKNQDDLSCYFQ  432

Query  1425  GLGEVTTTNLSTSTCNFNIGIK  1490
             GL +VTT N+S  +CNF + I+
Sbjct  433   GLAKVTTQNISQGSCNFIVQIE  454



>ref|XP_006443394.1| hypothetical protein CICLE_v10023781mg [Citrus clementina]
 ref|XP_006479327.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
 gb|ESR56634.1| hypothetical protein CICLE_v10023781mg [Citrus clementina]
Length=510

 Score =   490 bits (1262),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 316/445 (71%), Gaps = 9/445 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             GV G  ++GLGVNWG ++SH LPPK+ VK+LK NGI KVKLF++   IL+ALAGT IEVM
Sbjct  15    GVLGCRVNGLGVNWGTVASHQLPPKTTVKLLKDNGILKVKLFDADNTILDALAGTDIEVM  74

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +   N  LK M ++D A+ +VK NVT+Y  T+  GV I  V +GNEPFLK Y    +   
Sbjct  75    LAVSNQELKTMTDFDKAKEWVKANVTKY--TNKGGVNIKFVAVGNEPFLKAYNGSHI-NT  131

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+Q ALN+AG+G T KATVPFNADVY SP   P PSAG FRPDI   +++I+  
Sbjct  132   TFPALKNIQNALNDAGVGDTIKATVPFNADVYDSPDKNPDPSAGKFRPDIFATIQEIVDF  191

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD-NGKTYTNVFDANYDTAVA  881
             L EN +PF++N+YPFLSLY  N  FP D+AFFDG    +D   G  YT+VFDANYDT V+
Sbjct  192   LAENKAPFIVNIYPFLSLY-GNDDFPVDYAFFDGGKSIVDSVTGNKYTDVFDANYDTCVS  250

Query  882   ALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVY  1061
             AL   GHG M V VGEIGWPTDG++ AN + A ++Y G +  LA+ KGTP RPGS +EVY
Sbjct  251   ALKAAGHGDMPVVVGEIGWPTDGDKMANTANAFRYYSGLLPKLAADKGTPLRPGSYIEVY  310

Query  1062  MFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCT  1238
             MF LFDED KS+ PG+FE+HWGI  YDGQPKF +D SG G+ K L G  +++YLPKKWCT
Sbjct  311   MFSLFDEDSKSIDPGNFEKHWGIFTYDGQPKFPMDFSGKGENKTLVGAKDVKYLPKKWCT  370

Query  1239  VKSNAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSC  1415
             V  +A  T+ +   + +AC+++DCT+   GSSC+ L    K+SY FN Y+Q + Q+  +C
Sbjct  371   VNPDATDTSKLAEKMQFACNKSDCTSLGFGSSCNKLDGNGKVSYAFNMYYQMNNQDDRAC  430

Query  1416  DFGGLGEVTTTNLSTSTCNFNIGIK  1490
             DF GLG+VTT N+S  TCNF I ++
Sbjct  431   DFQGLGKVTTENISQGTCNFLIQLE  455



>ref|XP_009793269.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=480

 Score =   488 bits (1255),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 243/435 (56%), Positives = 299/435 (69%), Gaps = 7/435 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG ++SHPL PK VV+MLK NGIKKVKLF++ +  +NALAGT IEVM+  PN 
Sbjct  24    VEGLGVNWGTMASHPLEPKIVVQMLKENGIKKVKLFDADKTSMNALAGTDIEVMVAIPND  83

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +V+ NVTRY   S  GV I  V +GNEPFL  Y       +T+PAL 
Sbjct  84    QLLTMTDYDRAKDWVRRNVTRYNIKS--GVNIKYVAVGNEPFLTAYNNS-FVNLTFPALQ  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SP   PVPSAG FRPDI + + QI++ + +N +
Sbjct  141   NIQNALNEAGVGDYIKATVPLNADVYFSPESNPVPSAGRFRPDIAELMTQIVQFMSKNQA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY AN  FPFDFAFFDG   P+ DNG  YTNVFDAN+DT  +AL   G+
Sbjct  201   PFTVNIYPFLSLY-ANEHFPFDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGY  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MT+ VGE+GWPTDG++ AN + A +FY G    L + KGTP RPG  +EVY+FGL DE
Sbjct  260   GNMTILVGEVGWPTDGDKNANLNNAYRFYKGLFSRLGANKGTPLRPGY-IEVYLFGLIDE  318

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             D KS+ PG+FERHWGI  YDGQPKF +D+SG G  K L     ++YLPK+WC +  NA  
Sbjct  319   DAKSISPGNFERHWGIFRYDGQPKFAMDISGQGHEKHLVAAKNVQYLPKRWCMLNPNANN  378

Query  1260  TNMKA-TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              ++ A  I YAC  +DCTA   GSSC++L      SY FN Y+Q   Q   SCDF GL  
Sbjct  379   LSILANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLAM  438

Query  1437  VTTTNLSTSTCNFNI  1481
             VT  N+S  TCNF I
Sbjct  439   VTDKNISQGTCNFII  453



>gb|KDO55074.1| hypothetical protein CISIN_1g048257mg [Citrus sinensis]
Length=510

 Score =   488 bits (1257),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 315/445 (71%), Gaps = 9/445 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             GV G  ++GLGVNWG ++SH LPPK+ VK+LK NGI KVKLF++   IL+ALAGT IEVM
Sbjct  15    GVLGCRVNGLGVNWGTVASHQLPPKTTVKLLKDNGILKVKLFDADNTILDALAGTDIEVM  74

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +   N  LK M ++D A+ +VK NVT+Y  T+  GV I  V +GNEPFLK Y    +   
Sbjct  75    LAVSNQELKTMTDFDKAKEWVKANVTKY--TNKGGVNIKFVAVGNEPFLKAYNGSHI-NT  131

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+Q ALN+AG+G T KATVPFNADVY SP   P PSAG FR DI   +K+I+  
Sbjct  132   TFPALKNIQNALNDAGVGDTIKATVPFNADVYDSPDKNPYPSAGKFRTDIFATMKEIVDF  191

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD-NGKTYTNVFDANYDTAVA  881
             L EN +PF++N+YPFLSLY  N  FP D+AFFDG    +D   G  YT+VFDANYDT V+
Sbjct  192   LAENKAPFIVNIYPFLSLY-GNDDFPVDYAFFDGGKSIVDSVTGNKYTDVFDANYDTCVS  250

Query  882   ALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVY  1061
             AL   GHG M V VGEIGWPTDG++ AN + A ++Y G +  LA+ KGTP RPGS +EVY
Sbjct  251   ALKAAGHGDMPVVVGEIGWPTDGDKMANTANAFRYYSGLLPKLAADKGTPLRPGSYIEVY  310

Query  1062  MFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCT  1238
             MF LFDED KS+ PG+FE+HWGI  YDGQPKF +D SG G+ K L G  +++YLPKKWCT
Sbjct  311   MFSLFDEDSKSIDPGNFEKHWGIFTYDGQPKFPMDFSGKGENKTLVGAKDVKYLPKKWCT  370

Query  1239  VKSNAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSC  1415
             V  +A  T+ +   + +AC+++DCT+   GSSC+ L    K+SY FN Y+Q + Q+  +C
Sbjct  371   VNPDATDTSKLAEKMQFACNKSDCTSLGFGSSCNKLDGNGKVSYAFNMYYQMNNQDDRAC  430

Query  1416  DFGGLGEVTTTNLSTSTCNFNIGIK  1490
             DF GLG+VTT N+S  TCNF I ++
Sbjct  431   DFQGLGKVTTENISQGTCNFLIQLE  455



>ref|XP_006409040.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
 gb|ESQ50493.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
Length=482

 Score =   487 bits (1254),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 241/437 (55%), Positives = 303/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  ++ALAG+G++VM+  PN 
Sbjct  22    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADESTMSALAGSGLQVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V++NVTRY  T   GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMCSYDRAKDWVRKNVTRYNFTG--GVNITFVAVGNEPFLKSYNGS-FINITFPALQ  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P++DNG  YTNVFDAN+DT V+AL   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPLNYAFFDGA-QPINDNGVDYTNVFDANFDTLVSALKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN   A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANTGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PGDFERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWCT    AK 
Sbjct  316   DAKSIAPGDFERHWGIFKFDGQPKFPIDLSGQGQNKMLIGAQGVTYLPNKWCTFNPQAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I +AC  +DCT    GSSC+ L      SY FN YFQ   Q+ G+C F GL  
Sbjct  376   LTKLAANIDFACTYSDCTGLGYGSSCNGLDANGNASYAFNMYFQVKNQDEGACIFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   CNF I I
Sbjct  436   ITTQNISQGQCNFPIQI  452



>ref|XP_006348032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=475

 Score =   484 bits (1247),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 302/440 (69%), Gaps = 7/440 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             ++G+DGLGVNWG +++H LPPK+VV+MLK NGI KVKLF++ +  ++ALAG+ +EVM+  
Sbjct  17    LSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAI  76

Query  354   PNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             PN  L  M +YD A+ +VK NVTRY      GV I  V +GNEPFL  Y    L   T+P
Sbjct  77    PNDQLSAMNDYDRAKDWVKRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNSFL-NTTFP  133

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q ALNEAG+G + KATVP NADVY SP D PVPSAG FR DI   + QI++ + +
Sbjct  134   ALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQ  193

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N++PF +N+YPFLSLY AN  FP DFAFFDG   P+ DNG +YTNVFDAN+DT V+AL  
Sbjct  194   NNAPFTVNIYPFLSLY-ANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKA  252

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G G + + VGE+GWPTDG++ AN +LA +FY G +  LA+  GTP RPG  +EVY+FGL
Sbjct  253   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPG-FIEVYLFGL  311

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG+FERHWGI  YDGQPKF +DL G G+ K L     +EY  KKWC    N
Sbjct  312   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLMGQGQDKFLVAARNVEYFSKKWCMFNPN  371

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + +   I+YAC  +DCTA   GSSC+ L      SY FN Y+Q   QE  SC+F G
Sbjct  372   AKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQG  431

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  +T  N+S + CNF I I
Sbjct  432   LATLTDQNISQANCNFTIQI  451



>ref|XP_009610199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   484 bits (1246),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 303/440 (69%), Gaps = 7/440 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             ++G++GLGVNWG +++H LPPK+VV++LK NGI KVKLF++ +  ++ALAG+ IEVM+  
Sbjct  14    LSGVEGLGVNWGTMATHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGSDIEVMVAI  73

Query  354   PNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             PN  L  M +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y        T+P
Sbjct  74    PNDQLSAMNDYHRAKDWVRRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNS-FINTTFP  130

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI   + Q+++ +++
Sbjct  131   ALENIQNALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMVQFMNQ  190

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N++PF +N+YPFLSLY AN  FP DFAFFDG   P+ D G TYTNVFDAN+DT V+AL  
Sbjct  191   NNAPFTVNIYPFLSLY-ANEHFPVDFAFFDGASNPILDKGVTYTNVFDANFDTLVSALRA  249

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G G MT+ VGE+GWPTDG++ AN +LA +FY G +  LA+  GTP RPG  +EVY+FGL
Sbjct  250   AGVGNMTILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGY-IEVYLFGL  308

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG+FERHWGI  YDGQPKF +DL+G G+ K L G   +EYLPKKWC +  N
Sbjct  309   IDEDGKSIAPGNFERHWGIFRYDGQPKFSMDLTGQGQDKFLVGAQNVEYLPKKWCMLNPN  368

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + +   I+YAC  +DCTA   GSSC+ L      SY FN YFQ   Q   SC F G
Sbjct  369   AKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQAQNQGDFSCGFQG  428

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  VT  N+S + CNF I I
Sbjct  429   LAMVTDQNISQANCNFTIQI  448



>ref|XP_010314012.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=475

 Score =   484 bits (1246),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 304/440 (69%), Gaps = 7/440 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             ++G+DGLGVNWG +++H LPPK+VV+MLK NGI KVKLF++ +  ++ALAG+ +EVM+  
Sbjct  17    LSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAI  76

Query  354   PNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             PN  L  M +YD A+ +VK NVTRY      GV I  V +GNEPFL  Y    L   T+P
Sbjct  77    PNDQLSAMNDYDRAKDWVKRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNSFL-NTTFP  133

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q ALNEAG+G + KATVP NADVY SP D PVPSAG FR DI   + QI++ + +
Sbjct  134   ALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQ  193

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N++PF +N+YPFLSLY AN  FP +FAFFDG   P+ DNG +YTNVFDAN+DT V+AL  
Sbjct  194   NNAPFTVNIYPFLSLY-ANEHFPVNFAFFDGASNPIVDNGLSYTNVFDANFDTLVSALKA  252

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G G + + VGE+GWPTDG++ AN +LA +FY G +  LA+  GTP RPG  +EVY+FGL
Sbjct  253   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANVGTPLRPG-FIEVYLFGL  311

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG+FERHWGI  YDGQPKF +DL+G G+ K L     +EYL KKWC    N
Sbjct  312   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLTGQGQDKFLVAAQNVEYLSKKWCMFNPN  371

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + +   I+YAC  +DCTA   GSSC+ L      SY FN Y+Q   QE  SC+F G
Sbjct  372   AKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQG  431

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  +T  N+S + CNF I I
Sbjct  432   LATLTDQNISQANCNFTIQI  451



>gb|AFU52646.1| beta-1,3-glucanase 11 [Solanum tuberosum]
Length=469

 Score =   484 bits (1245),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 302/440 (69%), Gaps = 7/440 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             ++G+DGLGVNWG +++H LPPK+VV+MLK NGI KVKLF++ +  ++ALAG+ +EVM+  
Sbjct  11    LSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAI  70

Query  354   PNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             PN  L  M +YD A+ +VK NVTRY      GV I  V +GNEPFL  Y    L   T+P
Sbjct  71    PNDQLSAMNDYDRAKDWVKRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNSFL-NTTFP  127

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q ALNEAG+G + KATVP NADVY SP D PVPSAG FR DI   + QI++ + +
Sbjct  128   ALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQ  187

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N++PF +N+YPFLSLY AN  FP DFAFFDG   P+ DNG +YTNVFDAN+DT V+AL  
Sbjct  188   NNAPFTVNIYPFLSLY-ANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKA  246

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G G + + VGE+GWPTDG++ AN +LA +FY G +  LA+  GTP RPG  +EVY+FGL
Sbjct  247   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPG-FIEVYLFGL  305

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG+FERHWGI  YDGQPKF +DL G G+ K L     +EY  KKWC    N
Sbjct  306   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLMGQGQDKFLVAARNVEYFSKKWCMFNPN  365

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + +   I+YAC  +DCTA   GSSC+ L      SY FN Y+Q   QE  SC+F G
Sbjct  366   AKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQG  425

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  +T  N+S + CNF I I
Sbjct  426   LATLTDQNISQANCNFTIQI  445



>gb|KHN32753.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   484 bits (1245),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 311/438 (71%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H L   +VV+MLK NGI+KVKLF++ E  ++AL+G+GIEVM+  PN 
Sbjct  8     VEGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  67

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM +YD A  +VK+NVTRY      G+ I  V +GNEPFLK Y    L  +T PAL 
Sbjct  68    QLAEMNDYDRALQWVKKNVTRYNFRG--GINIKYVAVGNEPFLKSYNGSFL-NITLPALQ  124

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SPP+ PVPSAG+FRPDI   + QI++ L +N++
Sbjct  125   NIQNALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNA  184

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N +FPFD+AFFDGV  P++DNG +YTNVFDAN+DT V+AL + G+
Sbjct  185   PFTVNIYPFLSLY-GNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGY  243

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ AN   A +FY G +  LA  KGTP RPG  +EVY+FGL DE
Sbjct  244   GNMPILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPG-FIEVYLFGLIDE  302

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D K++ PG+FERHWGI GYDG+PKF +DLSG G+ K L G   + YL   WC    +A+ 
Sbjct  303   DAKTIAPGNFERHWGIFGYDGKPKFPMDLSGKGQNKLLVGAQNVHYLEPNWCMFNPDAQD  362

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  ADCTA   GSSC++L      SY FN Y+QT +Q   +C+F GL  
Sbjct  363   LSKLADNINYACTFADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLAR  422

Query  1437  VTTTNLSTSTCNFNIGIK  1490
             +TT+N+ST TCNF + I 
Sbjct  423   LTTSNISTPTCNFIVQIN  440



>ref|XP_011078775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=478

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/437 (54%), Positives = 301/437 (69%), Gaps = 7/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++ LGVNWG +++H LPPK VV+ML  NGIKKVKLF++ +  ++ALAGTG+EVM+  PN 
Sbjct  23    VESLGVNWGTMATHKLPPKVVVQMLTDNGIKKVKLFDADQSTMSALAGTGVEVMVAIPND  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +VK N+TRY      GV I  V +GNEPFL  Y        T+PAL 
Sbjct  83    QLSAMGSYDRAKEWVKRNITRYNFNG--GVTIKYVAVGNEPFLTSYNNS-FVNTTFPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP + PVPSAG FR DI  Q+ QI+K L++N +
Sbjct  140   NIQNALNEAGVGDSIKATVPLNADVYGSPENNPVPSAGRFRTDISDQMSQIVKFLNQNKA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY AN +FP D+AFFDGV  P+ DNG +Y+NVFDAN+DT V+AL   G+
Sbjct  200   PFTVNIYPFLSLY-ANENFPVDYAFFDGVSNPIVDNGISYSNVFDANFDTLVSALKALGY  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MT+ VGE+GWPTDG++ AN + A +FY G +  LA  KGTP RPG  +EVY+FGL DE
Sbjct  259   GDMTIIVGEVGWPTDGDKNANINYALRFYRGLLPRLAGNKGTPLRPG-YIEVYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF +DLSG +  K L G   + YLP KWC ++ +A  
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQQSDKYLVGAQNVNYLPTKWCMLRPDAND  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  +DCTA   GSSC+ L      SY FN YFQ   Q   +C+F GL  
Sbjct  378   LSKLADNINYACTFSDCTALGFGSSCNGLDANGNASYAFNMYFQVQNQRDLTCNFQGLAM  437

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VT  N+S   CNF I I
Sbjct  438   VTDKNISQGNCNFTIQI  454



>ref|XP_004981482.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
 ref|XP_004981483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X2 
[Setaria italica]
Length=494

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/442 (54%), Positives = 303/442 (69%), Gaps = 6/442 (1%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMI  347
             +GVA ++ LG+NWG  ++H LPPK VV+MLK NGIKKVKLF++ +  L+ALAGTGIEVM+
Sbjct  24    SGVARVEALGMNWGTQATHQLPPKIVVQMLKDNGIKKVKLFDADQSTLSALAGTGIEVMV  83

Query  348   GTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVT  527
               PN LL  + +YD A+ +V+ NV+RY      GV I  V +GNEPFL  Y      KVT
Sbjct  84    AIPNVLLDRITDYDTAKEWVRHNVSRYNFDG--GVTIKYVAVGNEPFLAAYNNT-FDKVT  140

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
             +PAL N+Q AL+EAG+G T KATVP NADVY+SP D PVPSAG +RPDI   + Q+++ L
Sbjct  141   FPALQNIQNALDEAGLGDTIKATVPLNADVYMSPTDNPVPSAGRWRPDIADLMTQMVQFL  200

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
               + +PF +N+YPF+SL F N +FP DFAFFDG   P+ DNG  YTNVFDAN+DT VAAL
Sbjct  201   SNHSAPFTVNIYPFISL-FLNDNFPVDFAFFDGGATPVLDNGVQYTNVFDANFDTLVAAL  259

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
                GHG + V VGE+GWPTDG++ A    A +FY G +K LA+  GTP RP   +EVY+F
Sbjct  260   KASGHGDLPVIVGEVGWPTDGDKHATNVYAQRFYNGLLKRLAANAGTPVRPNQYIEVYLF  319

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVK  1244
             GL DED KSV PG+FERHWGIL YDGQPK+ +DLSG G+   L     +EYLP+ WC V 
Sbjct  320   GLLDEDIKSVAPGNFERHWGILRYDGQPKYPMDLSGQGQNAMLVPAQGVEYLPRTWCVVN  379

Query  1245  SNA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
             + +     +   I++AC  ADCTA   GS+C  +      SY FNA+FQ  +Q   +CDF
Sbjct  380   TESPNMDKLADNINFACTFADCTALGYGSTCGGMDSNGNASYAFNAFFQMKDQADEACDF  439

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL   T T+ ST+TCNF I I
Sbjct  440   QGLARPTQTDPSTNTCNFTIQI  461



>ref|XP_009786014.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=474

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 300/437 (69%), Gaps = 7/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG ++ H LPPK+VV++LK NGI KVKLF++ +  ++ALAGT IEVM+  PN 
Sbjct  17    VEGLGVNWGTMAMHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGTDIEVMVAIPND  76

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +V+ NVTRY      GV I  V +GNEPFL  Y        T+PAL 
Sbjct  77    QLSAMNDYDRAKDWVRRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNS-FINTTFPALQ  133

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI   + Q+++ +++N++
Sbjct  134   NIQNALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMVQFMNQNNA  193

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY AN  FP DFAFFDG   P+ D G TYTNVFDAN+DT V+AL   G 
Sbjct  194   PFTVNIYPFLSLY-ANEHFPVDFAFFDGASSPILDKGVTYTNVFDANFDTLVSALRAAGV  252

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MT+ VGE+GWPTDG++ AN +LA +FY G +  LA+  GTP RPG  +EVY+FGL DE
Sbjct  253   GNMTILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGY-IEVYLFGLIDE  311

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF +DL+G G+ K L G   +EYLPKKWC +  NAK 
Sbjct  312   DGKSIAPGNFERHWGIFRYDGQPKFAMDLTGQGQDKFLVGAQNVEYLPKKWCMLNPNAKD  371

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  +DCTA   GSSC+ L      SY FN Y+Q   Q   SC F GL  
Sbjct  372   LSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQGDFSCGFQGLAM  431

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VT  N+S + CNF I I
Sbjct  432   VTDQNISQANCNFTIQI  448



>ref|XP_003624610.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|ABN09816.1| Glycoside hydrolase, family 17; X8 [Medicago truncatula]
 gb|AES80828.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=480

 Score =   484 bits (1245),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 310/437 (71%), Gaps = 7/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPP++VVKMLK NGI+KVKLF++ +  + ALAG+GIEVM+  PN 
Sbjct  23    VEGLGVNWGTQATHKLPPETVVKMLKDNGIQKVKLFDADDTTMTALAGSGIEVMVAIPNN  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM ++  A+ +V++NVTRY      GVKI  V +GNEPFLK Y    L  +T+PAL 
Sbjct  83    QLAEMNDFKRAQYWVRKNVTRYNFDG--GVKIKYVAVGNEPFLKAYNNSFL-NITFPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q A+NEAG+G T KATVP NADVY+SPPD  VPSAG+FRPDI   + Q+++ L++N +
Sbjct  140   NIQNAINEAGLGDTVKATVPLNADVYMSPPDNQVPSAGIFRPDINGLMTQMVQFLNKNGA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N  FPF+FAFFDGVDKP+ DNG  YTNVFDAN+DT V+AL   G 
Sbjct  200   PFTVNIYPFLSLY-GNDDFPFNFAFFDGVDKPITDNGIQYTNVFDANFDTLVSALKSIGF  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G   + VGE+GWPT+G++ AN+  A +FY G +  LA+ +GTP RPG  +EVY+FGL DE
Sbjct  259   GDTPILVGEVGWPTEGDKNANSGNAIRFYNGLLSRLAANRGTPLRPG-FIEVYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF +DLSG  + K L G   ++YL   WC    +AK 
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQLQNKLLVGAQGVKYLDPMWCMFNPDAKD  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I++AC   DCTA   GSSC++L      SY FN Y+QT  Q+  +C+F GL +
Sbjct  378   LSKLADNINFACTFGDCTALGYGSSCNNLDANGNASYAFNMYYQTQNQDRQACNFEGLAK  437

Query  1437  VTTTNLSTSTCNFNIGI  1487
              TT N+ST TCNF I I
Sbjct  438   PTTDNISTPTCNFIIQI  454



>ref|XP_003548760.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=478

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 305/437 (70%), Gaps = 7/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  ++H LPP +VV+MLK NGIKKVKLF+S +  ++ALAGTGIEVM+  PN 
Sbjct  20    VEGIGVNWGTQATHKLPPDTVVQMLKDNGIKKVKLFDSDDSTMSALAGTGIEVMVAIPNN  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM +Y  A+ +VK+NVTRY      GV +  V +GNEPFLK Y    L  +T PAL 
Sbjct  80    QLAEMNDYGRAKQWVKKNVTRYNFNG--GVNVKYVAVGNEPFLKSYNNSFL-NITLPALQ  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SP   PVPSAG+FRPDI   + QI++ L +N +
Sbjct  137   NIQNALNEAGLGDKIKATVPLNADVYQSPESNPVPSAGIFRPDISGLMTQIVQFLSKNGA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N  FPF++AFFDGVD P++DNG  YTNVFDAN+DT VAAL   G 
Sbjct  197   PFTVNIYPFLSLY-GNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGF  255

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + VGE+GWPT+G++ ANA  A +FY G +  LA+ +GTP RPG  +EVY+FGL DE
Sbjct  256   GDLPILVGEVGWPTEGDKNANAGNALRFYNGLLPRLAANRGTPRRPGY-IEVYLFGLIDE  314

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF +DLSG  + K L G   ++YL  +WC    +AK 
Sbjct  315   DAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQNQNKFLIGAQNVKYLAPRWCMFNPDAKD  374

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC   DCTA   GSSC++L      SY FN YFQ   Q   +C+F GL +
Sbjct  375   LSKLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAK  434

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+ST TCNF + I
Sbjct  435   LTTDNISTPTCNFIVQI  451



>ref|XP_009605785.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 300/435 (69%), Gaps = 7/435 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG ++SHPL PK VV+MLK NGIKKVKLF++ +  +NALAGT IEVM+  PN 
Sbjct  24    VEGLGVNWGTMASHPLEPKIVVQMLKDNGIKKVKLFDADKTTMNALAGTDIEVMVAIPND  83

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +V+ NVTRY   +  GV I  V +GNEPFL  Y       +T+PAL 
Sbjct  84    QLLTMTDYDRAKDWVRRNVTRYNIKA--GVNIKYVAVGNEPFLTAYNNS-FVNLTFPALQ  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI + + QI++ +++N +
Sbjct  141   NIQNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMNKNQA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY +N  FP DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL   G+
Sbjct  201   PFTVNIYPFLSLY-SNEHFPIDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGY  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ AN + A +FY G    LA+ KGTP RPG  +EVY+FGL DE
Sbjct  260   GNMNILVGEVGWPTDGDKNANLNYAYRFYKGLFSRLAANKGTPLRPGY-IEVYLFGLIDE  318

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             D KS+ PG+FERHWGI  YDGQPKF +D+SG G+ K L     ++YLPK+WC +  NA  
Sbjct  319   DAKSIAPGNFERHWGIFRYDGQPKFPMDISGQGQDKHLVAAKNVQYLPKRWCMLNPNANN  378

Query  1260  TNMKA-TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              ++ A  I YAC  +DCTA   GSSC++L      SY FN Y+Q   Q   SCDF GL  
Sbjct  379   LSILANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLAM  438

Query  1437  VTTTNLSTSTCNFNI  1481
             VT  N+S  TCNF I
Sbjct  439   VTDKNISQGTCNFII  453



>ref|XP_010036190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Eucalyptus 
grandis]
 gb|KCW47732.1| hypothetical protein EUGRSUZ_K01479 [Eucalyptus grandis]
Length=481

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 304/441 (69%), Gaps = 8/441 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G   +DGLGVNWG +++H LPPK+VV+MLK NGI+KVKLF++    ++ALAG+GIEVM+ 
Sbjct  21    GCGRVDGLGVNWGTLATHKLPPKTVVQMLKDNGIQKVKLFDADRKTMSALAGSGIEVMVA  80

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN  L  M +YD A+ +VK+NVT Y  T   GV +  V +GNEPFLK Y        T 
Sbjct  81    IPNDQLAVMGSYDRAQEWVKKNVTAYNFTG--GVNVKYVAVGNEPFLKSYNGS-FVNTTL  137

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+QKALNEAG+G T KATVP NADVY SP D P+PSAG FR DI   + QI+K + 
Sbjct  138   PALQNIQKALNEAGLGDTVKATVPLNADVYESPEDNPLPSAGTFRSDISDVMTQIVKFMA  197

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             EN++PF +N+YPFLSLY  N  FPF++AFFDG   P+ D G  YTNVFDAN+DT V+AL 
Sbjct  198   ENNAPFTVNIYPFLSLY-GNNDFPFNYAFFDGA-TPIVDKGIEYTNVFDANFDTLVSALK  255

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               GHG MT+ +GE+GWPT+G+  AN   A +FY G    L + +GTP RPG  +EVY+FG
Sbjct  256   AVGHGNMTIIIGEVGWPTEGDINANNGNAYRFYNGLFTKLGANRGTPLRPGY-IEVYLFG  314

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KSV PG+FERHWG+  YDGQPKF +DL+G G+ K L     +EY P+KWCT  +
Sbjct  315   LIDEDAKSVAPGNFERHWGLFRYDGQPKFLIDLTGRGQNKLLIPAQNVEYQPQKWCTFNA  374

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
              AK  + +   I++AC  ADCT    GSSC+SL      SY FNAYFQT  Q+  SC+F 
Sbjct  375   GAKDVSKLVDNINFACTYADCTTLGYGSSCNSLDANGNASYAFNAYFQTQNQDPDSCNFQ  434

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VTT N+S  +CNF I +
Sbjct  435   GLATVTTKNISQGSCNFTIQL  455



>emb|CDP18693.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   484 bits (1246),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 310/440 (70%), Gaps = 7/440 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             A ++GLGVNWG +SSH L P++V+++LK NGI+KVKLF++   IL ALAG+G+EVMI   
Sbjct  21    ACVEGLGVNWGTVSSHKLAPETVIQLLKDNGIQKVKLFDADPTILMALAGSGLEVMIAAT  80

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  L ++ +   A+ +V +NV  Y   S DGV IT+V +GNEPFL+ Y  +    VT PA
Sbjct  81    NLELADLGDPTKAKDWVHKNVIPYNVNSKDGVNITIVAVGNEPFLQAYGDK-FTGVTAPA  139

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+Q ALNEAG+GKTTKA++PFN DVY+SP   PVPSAG+FRPDI  +++ I+K+L  N
Sbjct  140   LKNIQDALNEAGVGKTTKASIPFNGDVYMSPLYNPVPSAGIFRPDIADKIRDILKILSAN  199

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
             ++PF++N+YPFLSLYFA   FP ++AFFDG   PL D    YTNV DAN DT V+AL  E
Sbjct  200   NAPFIVNIYPFLSLYFAK-DFPLEYAFFDGA-TPLVDGKIQYTNVLDANMDTLVSALKVE  257

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G+  M + VGEIGWPTDG+  AN +LA +F  G IKHLAS KG+P RPG  LE Y+FGLF
Sbjct  258   GYSDMPIIVGEIGWPTDGDTNANVTLAQRFLQGLIKHLASNKGSPLRPGY-LETYLFGLF  316

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED+KS LPG+FER WGI  YDGQPKF LDLSG G+ K L    +++YLPKKWC +K +A
Sbjct  317   DEDKKSTLPGNFERSWGIFKYDGQPKFPLDLSGKGENKTLVAAKDVQYLPKKWCVLKGDA  376

Query  1254  KF-TNMKATISYACDR-ADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
                 N+   ++YAC+   DCT   +GSSC+ L   +K SY FN+YFQ   Q   SCDF G
Sbjct  377   PTDANLADNMNYACNNGGDCTPIQDGSSCNFLDAKQKASYVFNSYFQIQNQSNTSCDFKG  436

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  VTT + S   CNF I I
Sbjct  437   LATVTTQDPSVPNCNFTIQI  456



>gb|KHN00669.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=468

 Score =   482 bits (1241),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 311/444 (70%), Gaps = 9/444 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             GV G  + GLGVNWG  ++H L   +VV+MLK NGI+KVKLF++ E  ++AL+G+GIEVM
Sbjct  4     GVMGWCVAGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVM  63

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  L EM +YD A  +VK+NVTRY      GV I  V +GNEPFLK Y    L  +
Sbjct  64    VAIPNNQLAEMNDYDRALQWVKKNVTRYNFRG--GVNIKYVAVGNEPFLKSYNGSFL-NI  120

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T PAL N+Q ALN+AG+G + KATVP NADVY SPP+ PVPSAG+FRPDI   + QI++ 
Sbjct  121   TLPALQNIQNALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQF  180

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L +N +PF +N+YPFLSLY  N +FPFD+AFFDGV  P+ DNG +YTNVFDAN+DT V+A
Sbjct  181   LAKNKAPFTVNIYPFLSLY-GNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSA  239

Query  885   LAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYM  1064
             L + G+G M V VGE+GWPTDG++ AN   A +FY G +  LA  KGTP RPG  +EVY+
Sbjct  240   LKKVGYGNMPVLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPG-FIEVYL  298

Query  1065  FGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV  1241
             FGL DED K++ PG+FERHWGI GYDG+PKF +DLSG G+ K L G   + YL   WC  
Sbjct  299   FGLIDEDAKNIAPGNFERHWGIFGYDGKPKFPMDLSGKGQKKVLVGAQNVHYLEPNWCMF  358

Query  1242  KSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
               +A+  + +   I+YAC  ADCTA   GSSC++L      SY FN Y+QT +Q   +C+
Sbjct  359   NPDAQDLSKLADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACN  418

Query  1419  FGGLGEVTTTNLSTSTCNFNIGIK  1490
             F GL  +TT+N+ST TCNF + I 
Sbjct  419   FEGLARLTTSNISTPTCNFIVQIN  442



>ref|XP_007161926.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
 gb|ESW33920.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
Length=477

 Score =   482 bits (1241),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 238/432 (55%), Positives = 305/432 (71%), Gaps = 7/432 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +G+GVNWG  ++H LPP +VV++LK NGI+KVKLF++ +  ++ALAGTGIEVM+  PN  
Sbjct  21    EGIGVNWGTQATHKLPPDTVVQLLKDNGIQKVKLFDADDSTMSALAGTGIEVMVAIPNIQ  80

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L EM ++  A+ +VK+NVTRY  T   GV I  V +GNEPFLK Y    L  +T+PAL N
Sbjct  81    LLEMNDFGRAKQWVKKNVTRY--TFNGGVNIKYVAVGNEPFLKSYNNSFL-NITFPALQN  137

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALN+AG+G T KATVP NADVY SP + PVPSAG+FRPDI   + QI++ L +N +P
Sbjct  138   IQNALNDAGVGDTIKATVPLNADVYQSPENNPVPSAGIFRPDITGLMTQIVQFLSKNGAP  197

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FPF++AFFDGVD P++DNG  YTNVFDAN+DT VAAL   G G
Sbjct  198   FTVNIYPFLSLY-GNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFG  256

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPT+G++ AN   A +FY G +  LA  +GTP RPG  +EVY+FGL DED
Sbjct  257   DLPILVGEVGWPTEGDKNANVGNALRFYNGLLPRLAGNRGTPCRPGH-IEVYLFGLIDED  315

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG+FERHWGI  YDGQPKF +DLSG  + K L G   ++YL  +WC    NAK  
Sbjct  316   AKSIAPGNFERHWGIFRYDGQPKFPMDLSGQNQNKFLIGAQNVKYLAPRWCMFNPNAKDL  375

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             T++   I+YAC   DCTA   GSSC++L      SY FN YFQ   Q   +C+F GL ++
Sbjct  376   TSLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAKI  435

Query  1440  TTTNLSTSTCNF  1475
             TT N+ST TCNF
Sbjct  436   TTDNISTPTCNF  447



>ref|NP_179534.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAD10143.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM14870.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC06881.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=478

 Score =   482 bits (1241),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 301/441 (68%), Gaps = 8/441 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G+  +DGLGVNWG +++H LPPK VV+MLK N I KVKLF++ E  ++AL+G+G+EVM+ 
Sbjct  14    GIVMVDGLGVNWGTMATHKLPPKKVVQMLKDNNINKVKLFDADETTMSALSGSGLEVMVA  73

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN  LK M +YD A+ +V +NVTRY      GV IT V +GNEPFLK Y       +T+
Sbjct  74    IPNDQLKVMGSYDRAKDWVHKNVTRYNFNG--GVNITFVAVGNEPFLKSYNGS-FINLTF  130

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L 
Sbjct  131   PALQNIQNALNEAGLGSSVKATVPLNADVYDSPSSNPVPSAGRFRPDIIGQMTQIVDFLG  190

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
              N +P  IN+YPFLSLY  N  FP ++AFFDG  KP+DDNG  YTNVFDAN+DT V+AL 
Sbjct  191   NNSAPITINIYPFLSLY-GNDDFPLNYAFFDGA-KPVDDNGIAYTNVFDANFDTLVSALK  248

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               GHG M + VGE+GWPT+G++ AN+  A +FY G +  L   +GTP RP + +EVY+FG
Sbjct  249   AVGHGDMPIIVGEVGWPTEGDKHANSGSAYRFYNGLLPRLGENRGTPLRP-TYIEVYLFG  307

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG+FERHWGI  +DGQPKF +DLSG G+ K L G   + Y PKKWC   +
Sbjct  308   LLDEDAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKLLIGAENVTYQPKKWCMFNT  367

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
              AK  T + A I YAC  +DCTA   GSSC++L      SY FN YFQ   Q+  +C F 
Sbjct  368   EAKDLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKNQDEDACIFQ  427

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  428   GLATITTKNISQGQCNFPIQI  448



>gb|AAO37977.1| putative beta-1,3 glucanase [Oryza sativa Japonica Group]
 gb|ABF99303.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY92146.1| hypothetical protein OsI_13858 [Oryza sativa Indica Group]
 gb|EAZ28873.1| hypothetical protein OsJ_12912 [Oryza sativa Japonica Group]
 dbj|BAH01366.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score =   483 bits (1242),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 302/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             + LG+NWG  +SHPLPPK V ++L+ NGIKKVKLF++ +  L+ALAGTGIEVM+  PN +
Sbjct  32    EALGMNWGTQASHPLPPKIVAQLLQDNGIKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  91

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +YD A+ +V+ NV+RY      GV I  V +GNEPFL  Y   G F KVT PAL 
Sbjct  92    LDSITDYDTAKEWVRRNVSRYNFDG--GVTIKYVAVGNEPFLAAYN--GTFDKVTLPALM  147

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SP D+ VPSAG FR DI   + Q+++ L  N +
Sbjct  148   NIQNALNDAGLGDSIKATVPLNADVYDSPQDQQVPSAGRFRADIADLMTQMVQFLANNSA  207

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPF+SLY  N  FP DFAFFDG   P+ DNG +YTNVFDAN+DT VAAL   GH
Sbjct  208   PFTVNIYPFISLYL-NDDFPVDFAFFDGGATPVVDNGISYTNVFDANFDTLVAALKGVGH  266

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ A A+ A +FY G +K LA+  GTPARPG  +EVY+FGL DE
Sbjct  267   GDMPIVVGEVGWPTDGDKHATATYAQRFYNGLLKRLAANAGTPARPGQYIEVYLFGLLDE  326

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             D KSV PGDFERHWGIL +DGQPK+ +DL+G G+   L     + YLP+ WC + +NAK 
Sbjct  327   DAKSVAPGDFERHWGILRFDGQPKYPVDLTGQGQNTMLVPAKGVTYLPRTWCVINTNAKD  386

Query  1260  TNMKA-TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
             T+  A  I++AC  ADCTA   GS+C  +      SY FNAYFQ   Q+  +CDF GL  
Sbjct  387   TSKLADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDDACDFQGLAM  446

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST  CNF I I
Sbjct  447   PTQTDPSTPACNFTIQI  463



>ref|XP_006574750.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=484

 Score =   482 bits (1240),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 311/444 (70%), Gaps = 9/444 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             GV G  + GLGVNWG  ++H L   +VV+MLK NGI+KVKLF++ E  ++AL+G+GIEVM
Sbjct  20    GVMGWCVAGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVM  79

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  L EM +YD A  +VK+NVTRY      GV I  V +GNEPFLK Y    L  +
Sbjct  80    VAIPNNQLAEMNDYDRALQWVKKNVTRYNFRG--GVNIKYVAVGNEPFLKSYNGSFL-NI  136

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T PAL N+Q ALN+AG+G + KATVP NADVY SPP+ PVPSAG+FRPDI   + QI++ 
Sbjct  137   TLPALQNIQNALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQF  196

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L +N +PF +N+YPFLSLY  N +FPFD+AFFDGV  P+ DNG +YTNVFDAN+DT V+A
Sbjct  197   LAKNKAPFTVNIYPFLSLY-GNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSA  255

Query  885   LAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYM  1064
             L + G+G M V VGE+GWPTDG++ AN   A +FY G +  LA  KGTP RPG  +EVY+
Sbjct  256   LKKVGYGNMPVLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPG-FIEVYL  314

Query  1065  FGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV  1241
             FGL DED K++ PG+FERHWGI GYDG+PKF +DLSG G+ K L G   + YL   WC  
Sbjct  315   FGLIDEDAKNIAPGNFERHWGIFGYDGKPKFPMDLSGKGQKKVLVGAQNVHYLEPNWCMF  374

Query  1242  KSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
               +A+  + +   I+YAC  ADCTA   GSSC++L      SY FN Y+QT +Q   +C+
Sbjct  375   NPDAQDLSKLADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACN  434

Query  1419  FGGLGEVTTTNLSTSTCNFNIGIK  1490
             F GL  +TT+N+ST TCNF + I 
Sbjct  435   FEGLARLTTSNISTPTCNFIVQIN  458



>ref|NP_176656.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 ref|NP_001031232.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q6NKW9.2|E138_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 8; AltName: Full=(1->3)-beta-glucan 
endohydrolase 8; Short=(1->3)-beta-glucanase 
8; AltName: Full=Beta-1,3-endoglucanase 8; Short=Beta-1,3-glucanase 
8; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD43273.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44619.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34283.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEE34284.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=481

 Score =   481 bits (1237),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 303/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PALA
Sbjct  82    QLKVMTSYDRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALA  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG + P++DNG  YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPLNYAFFDGAE-PINDNGIDYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ ANA  A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG FERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWCT    AK 
Sbjct  316   DAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQGQSKFLIGAQNVPYLPNKWCTFNPEAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I YAC  +DCTA   GSSC++L      SY FN +FQ   Q+  +C F GL  
Sbjct  376   LTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   CNF I I
Sbjct  436   ITTQNISQGQCNFPIQI  452



>gb|AAS99718.1| At1g64760 [Arabidopsis thaliana]
 dbj|BAD95084.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=481

 Score =   480 bits (1236),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 302/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+  V++NVTRY      GV IT V +GNEPFLK Y       +T+PALA
Sbjct  82    QLKVMTSYDRAKDLVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALA  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG + P++DNG  YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPLNYAFFDGAE-PINDNGIDYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ ANA  A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG FERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWCT    AK 
Sbjct  316   DAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQGQSKFLIGAQHVPYLPNKWCTFNPEAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I YAC  +DCTA   GSSC++L      SY FN +FQ   Q+  +C F GL  
Sbjct  376   LTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   CNF I I
Sbjct  436   ITTQNISQGQCNFPIQI  452



>ref|XP_002463758.1| hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor]
 gb|EER90756.1| hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor]
Length=495

 Score =   481 bits (1237),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 302/441 (68%), Gaps = 12/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPLPPK V ++L+ NGIKKVKLF++ +  L+ALAGTGIEVM+  PN +
Sbjct  29    DALGMNWGTQATHPLPPKIVAQLLRDNGIKKVKLFDADQETLSALAGTGIEVMVAIPNVM  88

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  M +YD A+ +V+ NV+RY      GV I  V +GNEPFL  Y   G F KVT+PAL 
Sbjct  89    LDTMTDYDTAKEWVRRNVSRYNFDG--GVTIKYVAVGNEPFLAAYN--GTFDKVTFPALQ  144

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G T KATVP NADVY+SP D PVPSAG +R DI   + Q+++ L  N +
Sbjct  145   NIQNALNEAGLGDTIKATVPLNADVYMSPKDNPVPSAGRWRTDITDLMTQMVQFLSNNSA  204

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALARE  896
             PF +N+YPF+SL F N  FP +FAFFDG   PL D   G +YTNVFDAN+DT VAAL   
Sbjct  205   PFTVNIYPFISL-FLNDDFPVNFAFFDGDATPLVDPGTGVSYTNVFDANFDTLVAALKSV  263

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             GHG M + VGE+GWPTDG++ A ++ A +FY G +K LA+  GTPARP   +EVY+FGL 
Sbjct  264   GHGDMPIVVGEVGWPTDGDKHATSAYAQRFYNGLLKRLAANAGTPARPNQYIEVYLFGLL  323

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KSV PG+FERHWGIL YDGQPK+ +DLSG G+   L     +EYLP+ WC V +NA
Sbjct  324   DEDVKSVAPGNFERHWGILRYDGQPKYPMDLSGQGQNTMLVPASGVEYLPRTWCVVNTNA  383

Query  1254  KFTNMKA---TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                 M+     I+YAC  ADCTA   GS+C  +      SY FNA+FQ   Q+  +C F 
Sbjct  384   GSDAMEKLADNINYACTFADCTALGYGSTCGGMDSNGNASYAFNAFFQVQNQKDEACGFQ  443

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL   T T+ ST+TCNF I I
Sbjct  444   GLAVPTQTDPSTATCNFTIQI  464



>ref|XP_004493147.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=477

 Score =   480 bits (1235),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 238/443 (54%), Positives = 310/443 (70%), Gaps = 9/443 (2%)
 Frame = +3

Query  171   GVAGL--DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             G+ GL  +GLGVNWG  ++H LPP++VV+MLK NGI+KVKLF++ ++ ++ALAG+GIEVM
Sbjct  14    GLMGLYVEGLGVNWGTQATHQLPPETVVQMLKDNGIQKVKLFDADDNTMSALAGSGIEVM  73

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  L  M +Y  A+ +VK+NVTRY      GV I  V +GNEPFLK Y    L  +
Sbjct  74    VAIPNNQLAVMNDYKRAQQWVKKNVTRYNFHG--GVNIKYVAVGNEPFLKSYNNSFL-NI  130

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T PAL N+Q A+NEAG+G T KATVP NADVY SP D P+PSAG FRPDI   + ++++ 
Sbjct  131   TLPALQNIQNAINEAGLGDTVKATVPLNADVYQSPEDNPLPSAGTFRPDISGLMTEMVQF  190

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L++N +PF +N+YPFLSLY  N  FPF++AFFDGVD P+ DNG  YTNVFDAN+DT V+A
Sbjct  191   LNKNSAPFTVNIYPFLSLY-GNDDFPFNYAFFDGVDAPIMDNGIQYTNVFDANFDTLVSA  249

Query  885   LAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYM  1064
             L   G G   + VGE+GWPT+G++ ANA  A +FY G +  LA+ KGTP RPG  +EVY+
Sbjct  250   LKSVGFGDTPILVGEVGWPTEGDKNANAGNALRFYNGLLSRLAANKGTPRRPG-FIEVYL  308

Query  1065  FGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV  1241
             FGL DED KS+ PG+FERHWGI  YDGQPKF +DL+G G+ K L G   ++YL   WC V
Sbjct  309   FGLIDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLTGQGQNKFLIGAQNVKYLSPTWCMV  368

Query  1242  KSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
               +AK  + +   +++AC   DCTA   GSSC++L      SY FN Y+Q   Q   +C+
Sbjct  369   NPDAKDLSKLADNLNFACAYGDCTALGYGSSCNNLDAIGNASYAFNMYYQVQNQNRQACN  428

Query  1419  FGGLGEVTTTNLSTSTCNFNIGI  1487
             F GL ++TT N+ST TCNF I I
Sbjct  429   FQGLAKLTTDNISTPTCNFTIQI  451



>ref|XP_007030700.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY11202.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=479

 Score =   479 bits (1234),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 303/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+M+K NGIKKVKLF++  + ++ALAG+ +EVM+  PN 
Sbjct  24    VNGLGVNWGTMATHKLPPKTVVQMIKDNGIKKVKLFDADSNTMSALAGSDLEVMVAIPND  83

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +V+ NVTRY      GV I  V +GNEPFL  Y       +T+PAL 
Sbjct  84    QLLAMNSYDRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTTYNGS-FVNITFPALQ  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SP   PVPSAG FR DI   + QI+  L +N +
Sbjct  141   NIQNALNDAGVGDSIKATVPLNADVYNSPDSNPVPSAGRFRSDISGIMTQIVDFLSKNSA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N  FPF++AFFDG   P+ DNG  YTNVFDAN+DT V+AL   GH
Sbjct  201   PFTVNIYPFLSLY-GNDDFPFNYAFFDG-GTPITDNGIQYTNVFDANFDTLVSALKAVGH  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MT+ VGE+GWPTDG++ AN + A +FY G +  LA+  GTP RPG  +EVY+FGL DE
Sbjct  259   GDMTIIVGEVGWPTDGDKNANVANAQRFYNGLMPRLAANTGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF LDLSG  + + L G   +EYLP+KWCT   NAK 
Sbjct  318   DAKSIAPGNFERHWGIYRYDGQPKFPLDLSGQNQNRFLIGAQNVEYLPQKWCTFNPNAKD  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  +DCTA   GSSC++L      S+ FN Y+Q   Q   +C+F GLG 
Sbjct  378   LSKLADNINYACTFSDCTALGYGSSCNNLDANGNASFAFNMYYQVQNQNDMACNFQGLGT  437

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VTT NLS  TCNF I I
Sbjct  438   VTTQNLSQGTCNFIIQI  454



>emb|CDP18694.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   479 bits (1234),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 242/442 (55%), Positives = 296/442 (67%), Gaps = 7/442 (2%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMI  347
             N V G++GLGVNWG  ++H LPPK VV+MLK NGI KVKLF++    ++ALAG+ IEVM+
Sbjct  20    NDVVGVEGLGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMV  79

Query  348   GTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVT  527
               PN  L  M +YD A+ +VK NVT Y      GV I  V +GNEPFL  Y        T
Sbjct  80    AIPNDQLLVMNDYDRAKNWVKRNVTVYLFNG--GVNIKYVAVGNEPFLASYNNS-FVNTT  136

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
             +PAL N+Q ALN+AG G T KATVP NADVY SP   PVPSAG FR DI  Q+ QI++ L
Sbjct  137   FPALQNIQNALNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFL  196

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             ++N++PF +N+YPFLSLY  N  FP D+AFFDG   P+ D+G  YTNVFDAN+DT V+AL
Sbjct  197   NQNNAPFTVNIYPFLSLYL-NSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDTLVSAL  255

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
                G+G M + VGE+GWPTDG+  AN + A +FY G +  LA+ KGTP RPG  +EVY+F
Sbjct  256   KGLGYGSMNILVGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGY-IEVYLF  314

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVK  1244
             GL DED KSV PG+FERHWGI  YDGQPKF +DLSG  + K L G   ++YLP KWC   
Sbjct  315   GLLDEDLKSVAPGNFERHWGIFRYDGQPKFPMDLSGQLQDKYLVGAQNVQYLPAKWCQFN  374

Query  1245  SNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
              NAK  + +   I+YAC  ADCTA   GSSC+ L      SY FN YFQ   Q   SC+F
Sbjct  375   PNAKDLSKLAENINYACTFADCTALGYGSSCNGLDSNGNASYAFNMYFQVQNQGDLSCNF  434

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL  VT  N+S + CNF I I
Sbjct  435   QGLAMVTEQNISQANCNFTIQI  456



>ref|XP_006599436.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=483

 Score =   479 bits (1234),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 310/438 (71%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H L   +VV+MLK NGI+KVKLF++ E  ++AL+G+GIEVM+  PN 
Sbjct  25    VEGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  84

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM +YD A  +VK+NVTRY      G+ I  V +GNEPFLK Y    L  +T PAL 
Sbjct  85    QLAEMNDYDRALQWVKKNVTRYNFRG--GINIKYVAVGNEPFLKSYNGSFL-NITLPALQ  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SPP+ PVPSAG+FRPDI   + QI++ L +N++
Sbjct  142   NIQNALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNA  201

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N +FPFD+AFFDGV  P++DNG +YTNVFDAN+DT V+AL + G+
Sbjct  202   PFTVNIYPFLSLY-GNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGY  260

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ AN   A +FY G +  LA  KGTP RPG  +EVY+FGL DE
Sbjct  261   GNMPILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPG-FIEVYLFGLIDE  319

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D K++ PG+FERHWGI GYDG+PKF +DLSG G+ K L G   + YL   WC    +A+ 
Sbjct  320   DAKTIAPGNFERHWGIFGYDGKPKFPMDLSGKGQNKLLVGAQNVHYLEPNWCMFNPDAQD  379

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  ADCTA   GSS ++L      SY FN Y+QT +Q   +C+F GL  
Sbjct  380   LSKLADNINYACTFADCTAIGYGSSGNNLDANGNASYAFNMYYQTQDQNYMACNFEGLAR  439

Query  1437  VTTTNLSTSTCNFNIGIK  1490
             +TT+N+ST TCNF + I 
Sbjct  440   LTTSNISTPTCNFIVQIN  457



>ref|XP_006297581.1| hypothetical protein CARUB_v10013602mg [Capsella rubella]
 gb|EOA30479.1| hypothetical protein CARUB_v10013602mg [Capsella rubella]
Length=477

 Score =   479 bits (1232),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 301/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK+VV+MLK N IKKVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  18    VDGLGVNWGTMATHKLPPKTVVQMLKDNNIKKVKLFDADETTMGALAGSGLEVMVAIPND  77

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  78    QLKVMGSYDRAKEWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  134

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SPP  PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  135   NIQNALNEAGVGNGVKATVPLNADVYDSPPSNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  194

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG   P+DD+G  YTNVFDAN+DT V++L   GH
Sbjct  195   PITINIYPFLSLY-GNDDFPLNYAFFDGA-TPVDDHGIAYTNVFDANFDTLVSSLKAVGH  252

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN+  A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  253   GDMPIIVGEVGWPTEGDKHANSGDAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  311

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  +DGQPKF +DLSG G+ K L G   + YL  KWC     AK 
Sbjct  312   DAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKMLIGAQNVSYLSNKWCMFNPAAKD  371

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I +AC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +C+F GL  
Sbjct  372   LTKLAANIDFACTFSDCTALGYGSSCNGLDAAGNASYAFNMYFQVKNQDEMACNFQGLAT  431

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   CNF I I
Sbjct  432   ITTQNISQGQCNFPIQI  448



>gb|EPS74227.1| beta-1,3-glucanase, acidic, partial [Genlisea aurea]
Length=444

 Score =   478 bits (1229),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 302/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++ LGVNWG +++H LPP  VV++LK NGI KVKLF++ +  +NALAGTGIEVM+  PN 
Sbjct  7     VESLGVNWGTMATHRLPPNVVVQILKDNGINKVKLFDADQSTMNALAGTGIEVMVAIPND  66

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +Y+ A+A+V+ NVTRY  +   GV I  V +GNEPFL  Y        T+PAL 
Sbjct  67    QLAAMGSYNRAKAWVRRNVTRYNFSG--GVNIKYVAVGNEPFLTSYNNS-FLHTTFPALQ  123

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ Q+++ L++N +
Sbjct  124   NIQNALNEAGLGDSVKATVPLNADVYGSPDSNPVPSAGRFRPDILDQMTQMVQFLNQNKA  183

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKP-LDDNGKTYTNVFDANYDTAVAALAREG  899
             PF +N+YPFLSLY AN +FP D+AFFDG   P +D NG  YTNVFDAN+DT V+AL   G
Sbjct  184   PFTVNIYPFLSLY-ANENFPVDYAFFDGAAAPVVDTNGIQYTNVFDANFDTLVSALRGLG  242

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +G M + VGE+GWPTDG+  AN + A +FY G +  LA+ +GTP RPG  +EVY+FGL D
Sbjct  243   YGDMAIVVGEVGWPTDGDRNANVNNAVRFYRGLLPRLAANRGTPLRPGY-VEVYLFGLID  301

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGIL YDGQPKF +DLSG G  + L G   ++YLPKKWC  + +AK
Sbjct  302   EDAKSVQPGNFERHWGILRYDGQPKFPMDLSGQGVERYLVGAQGVKYLPKKWCVFRQDAK  361

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +   I++AC  +DCTA   GSSC  L      SY FN YFQT  Q+  SC F GL 
Sbjct  362   DLSKLGPNINFACTFSDCTALGYGSSCGGLDANGNASYAFNMYFQTQNQDELSCVFQGLA  421

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              VT  N+S   CNF + I
Sbjct  422   VVTDQNVSQGNCNFTLQI  439



>ref|XP_010257709.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=475

 Score =   478 bits (1230),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 303/441 (69%), Gaps = 7/441 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G   ++GLGVNWG +++H LPP +VV+M+K NGIKKVKLF++ ++ ++ALAGT IEVM+ 
Sbjct  16    GSIAVEGLGVNWGTMATHKLPPNTVVQMMKDNGIKKVKLFDADQNTMSALAGTEIEVMVA  75

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN  L  M +Y  A+ +VK N+TRY      GV I  V +GNEPFL  Y    L  VT+
Sbjct  76    IPNDQLAVMNDYGRAKDWVKRNITRYLFNG--GVNIKYVAVGNEPFLASYNNSFL-NVTF  132

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q ALNEAG G + KATVP NADVY SP D  VPSAG FR DI   + QI++ L+
Sbjct  133   PALQNIQDALNEAGHGDSIKATVPLNADVYNSPSDNSVPSAGRFRSDISDLMTQIVQFLN  192

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             +N++PF +N+YPFLSLY AN +FP DFAFFDG   PL DNG  Y NVFDAN+DT V+AL 
Sbjct  193   KNNAPFTVNIYPFLSLY-ANENFPLDFAFFDGTPNPLLDNGIQYNNVFDANFDTLVSALK  251

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G+M + VGE+GWPTDG++ AN  LA +FY G +  LA+ KGTP RPG  LEVY+FG
Sbjct  252   AVGFGEMPILVGEVGWPTDGDKNANVGLAQRFYNGLLPRLAANKGTPLRPGY-LEVYLFG  310

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG+FERHWGI  YDGQPK+++DLSG G+   L     ++YLP++WC +  
Sbjct  311   LIDEDAKSIAPGNFERHWGIFRYDGQPKYQMDLSGQGQNTFLVAAKNVKYLPQRWCVLNP  370

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NA+  + +   I++AC  +DCTA   GSSC +L      SY FN Y+Q   Q+  SC+F 
Sbjct  371   NAEDLSKLGENINFACTHSDCTALGYGSSCGNLDTQGNASYAFNMYYQAQNQQDLSCNFQ  430

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VTT N S   CNF I I
Sbjct  431   GLAMVTTQNASQGNCNFTIQI  451



>ref|XP_002888279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64538.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   478 bits (1230),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 238/437 (54%), Positives = 302/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMTSYDRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALT  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P++DNG  YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPLNYAFFDGA-QPINDNGIDYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN+  A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG FERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWCT    AK 
Sbjct  316   DAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQGQNKLLIGAQNVPYLPNKWCTFNPEAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I +AC  +DCTA   GSSC++L      SY FN YFQ   Q+  +C F GL  
Sbjct  376   LTKLAANIDFACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKNQDESACFFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   CNF I I
Sbjct  436   ITTQNISQGQCNFPIQI  452



>ref|XP_010054473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
 gb|KCW89851.1| hypothetical protein EUGRSUZ_A02084 [Eucalyptus grandis]
Length=478

 Score =   476 bits (1225),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/440 (55%), Positives = 299/440 (68%), Gaps = 8/440 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             VA ++GLGVNWG +++H LPP +VV+MLK NGIKKVKLF++ ++ L+ALAG+ IEVM+  
Sbjct  19    VAHVEGLGVNWGTMATHELPPGTVVQMLKDNGIKKVKLFDADQYTLSALAGSNIEVMVAI  78

Query  354   PNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             PN  L  M +Y+ A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT+P
Sbjct  79    PNDQLASMTSYERAKQWVQRNVTRYNFNG--GVSIKYVAVGNEPFLSAYNGSFL-NVTFP  135

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q ALNE G+G T KATVP NADVY SP   PVPSAG FR DI   + QI++ L +
Sbjct  136   ALQNIQNALNEVGVGDTVKATVPVNADVYNSPVSNPVPSAGRFRTDISDLMTQIVEFLAK  195

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N +P  +N+YPFLSLY  N +FP D+AFFDG   P+ DNG  YTNVFDAN+DT V+AL  
Sbjct  196   NSAPLTVNIYPFLSLY-GNDNFPIDYAFFDGA-TPVVDNGIQYTNVFDANFDTLVSALKA  253

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              GHG MT+ VGE+GWPTDG++ AN + A +FY G +  LA+  GTP RPG  +EVY+FGL
Sbjct  254   VGHGDMTLMVGEVGWPTDGDKNANIASAVRFYNGLMPRLAANTGTPLRPGY-IEVYLFGL  312

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG FERHWGI  YDGQPKF LDLSG  + K L     + YLP++WC +   
Sbjct  313   IDEDAKSIAPGSFERHWGIFRYDGQPKFPLDLSGQNQNKFLVAAKNVNYLPQQWCVLNPK  372

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             A   + +   I+YAC  ADCT+   GSSC+SL      SY FN Y+Q   Q   SC+F G
Sbjct  373   ANDLSKLGTNINYACTFADCTSLGYGSSCNSLDANGNASYAFNMYYQVQNQNPLSCNFEG  432

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  VTT N+S  TCNF I I
Sbjct  433   LATVTTQNISQGTCNFIIQI  452



>ref|XP_006650710.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=493

 Score =   476 bits (1226),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 301/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             + LG+NWG  +SHPLPPK V ++LK NG+KKVKLF++ +  L+ALAGTGIEVM+  PN +
Sbjct  33    EALGMNWGTQASHPLPPKVVAQLLKDNGVKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  92

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +YD A+ +V+ NV+RY      GV I  V +GNEPFL  Y   G F KVT PAL 
Sbjct  93    LDSITDYDTAKEWVRRNVSRYNFDG--GVTIKYVAVGNEPFLAAYN--GTFDKVTLPALM  148

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SP D+ VPSAG FR DI   + Q+++ L  N +
Sbjct  149   NIQNALNDAGLGDSIKATVPLNADVYNSPADQQVPSAGRFRADIADLMTQMVQFLANNSA  208

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPF+SLY  N +FP DFAFFDG   P  DNG +YTNVFDAN+DT VAAL   GH
Sbjct  209   PFTVNIYPFISLYL-NDNFPVDFAFFDGGATPGADNGISYTNVFDANFDTLVAALKAVGH  267

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ A A+ A +FY G ++ LA+  GTP RPG  +EVY+FGL DE
Sbjct  268   GDMPIIVGEVGWPTDGDKHATAAYAQRFYNGLLRRLAANAGTPLRPGQYIEVYLFGLLDE  327

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             D KSV PG FERHWGIL +DGQPK+ +DL+G G+   L    +++YL + WC V +NAK 
Sbjct  328   DAKSVAPGSFERHWGILRFDGQPKYPVDLTGQGQNTMLVPAKDVQYLSRTWCVVNTNAKD  387

Query  1260  TNMKA-TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
             T+  A  I++AC  ADCTA   GS+C  +      SY FNAYFQ   Q+  +CDF GL  
Sbjct  388   TSKLADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDEACDFQGLAM  447

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST  CNF + I
Sbjct  448   PTQTDPSTPACNFTVQI  464



>ref|XP_004288532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   476 bits (1224),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 302/440 (69%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G++GLGVNWG +++H LPP +VV++LK NGI+KVKLF++ +  ++ALAGT IEVM+  PN
Sbjct  25    GVEGLGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPN  84

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
               L+ M +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  +T+PAL
Sbjct  85    DQLQAMTSYPRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NITFPAL  141

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G T KATVP NADVY SP   PVPSAG FR DI + + +I++ LD+N 
Sbjct  142   QNIQNALNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNK  201

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAR  893
             +PF IN+YPFLSLY  N  FPF++AFFDG   P+ D   G  YTNVFDAN+DT V++L  
Sbjct  202   APFTINIYPFLSLY-GNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKA  260

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G+G M + VGE+GWPTDG++ AN   A +FY G +  LA+ KGTP RPG  +E+Y+FGL
Sbjct  261   VGYGDMAIVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPG-FIEIYLFGL  319

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG FERHWGI  YDGQPKF +D+SG G+ K L G   ++YL KKWC    N
Sbjct  320   IDEDAKSIAPGSFERHWGIFSYDGQPKFPIDVSGQGQNKLLMGAKNVQYLEKKWCMFNPN  379

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + +   I+YAC  ADCTA   GSSC+ L      SY FN Y+Q   Q+  SC+F G
Sbjct  380   AKDLSKLADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFEG  439

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  VTT N+S  TCNF I I
Sbjct  440   LATVTTQNISQGTCNFIIQI  459



>ref|XP_010909077.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=478

 Score =   476 bits (1224),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 298/438 (68%), Gaps = 6/438 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++HPLPPK VV++LK NGIKKVKLF++    ++ALAG+GIEVM+  PN 
Sbjct  20    VEGLGVNWGTMATHPLPPKIVVQLLKDNGIKKVKLFDADAATMSALAGSGIEVMVAIPNN  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +V  NV+RY      GV I  V +GNEPFL  Y    L  VT+PAL 
Sbjct  80    QLGAMNDYDTAKKWVDRNVSRYHFDG--GVTIKYVAVGNEPFLSSYNGSFL-NVTFPALQ  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG G T KATVP NADVY SP + PVPSAG FR DI   + QI++  + + +
Sbjct  137   NIQNALNEAGFGDTIKATVPLNADVYNSPTNNPVPSAGRFRTDINDLMTQIVQFFNLSGA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N +FP DFAFFDG  +P+ DNG  YTNVFDAN+DT ++AL   G 
Sbjct  197   PFTVNIYPFLSLY-GNDNFPLDFAFFDGTSQPVVDNGIQYTNVFDANFDTLLSALKAVGL  255

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + VGE+GWPTDG++ A AS A +FY G +K LA+  GTP RP   LEVY+F L DE
Sbjct  256   GNLPIIVGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANVGTPLRPNQYLEVYLFSLIDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGIL YDGQP+F +DLSG G+ K L     +EYLP+ WC    NAK 
Sbjct  316   DAKSIAPGNFERHWGILKYDGQPQFPMDLSGQGQNKMLVAAKNVEYLPQTWCVFNPNAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  +DCT+   GS+C+ L      SY FN YFQ   Q+  SC F GL  
Sbjct  376   LSKLGDNINYACTFSDCTSLGYGSTCNQLDANGNASYAFNMYFQDQNQKDMSCFFQGLAM  435

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              TT N ST+ CNF I IK
Sbjct  436   QTTQNPSTTECNFTIQIK  453



>ref|XP_004288531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   476 bits (1224),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 302/440 (69%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G++GLGVNWG +++H LPP +VV++LK NGI+KVKLF++ +  ++ALAGT IEVM+  PN
Sbjct  25    GVEGLGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPN  84

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
               L+ M +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  +T+PAL
Sbjct  85    DQLQAMTSYPRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NITFPAL  141

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G T KATVP NADVY SP   PVPSAG FR DI + + +I++ LD+N 
Sbjct  142   QNIQNALNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNK  201

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAR  893
             +PF IN+YPFLSLY  N  FPF++AFFDG   P+ D   G  YTNVFDAN+DT V++L  
Sbjct  202   APFTINIYPFLSLY-GNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKA  260

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G+G M + VGE+GWPTDG++ AN   A +FY G +  LA+ KGTP RPG  +E+Y+FGL
Sbjct  261   VGYGDMAIVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPG-FIEIYLFGL  319

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG FERHWGI  YDGQPKF +D+SG G+ K L G   ++YL KKWC    N
Sbjct  320   IDEDAKSIAPGSFERHWGIFSYDGQPKFPIDVSGQGQNKLLMGAKNVQYLEKKWCMFNPN  379

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + +   I+YAC  ADCTA   GSSC+ L      SY FN Y+Q   Q+  SC+F G
Sbjct  380   AKDLSKLADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFEG  439

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  VTT N+S  TCNF I I
Sbjct  440   LATVTTQNISQGTCNFIIQI  459



>gb|AAQ90287.1| beta-1,3-glucanase, acidic [Coffea arabica]
Length=480

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 294/442 (67%), Gaps = 7/442 (2%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMI  347
             N V G++GLGVNWG  ++H LPPK VV+MLK NGI KVKLF++    ++ALAG+ IEVM+
Sbjct  20    NDVVGVEGLGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMV  79

Query  348   GTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVT  527
               PN  L  M +YD A+ +VK NVT Y      GV I  V +GNEPFL  Y        T
Sbjct  80    AIPNDQLLVMNDYDRAKNWVKRNVTVYLFNG--GVNIKYVAVGNEPFLASYNNS-FVNTT  136

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
             +PAL N+Q ALN+AG G T KATVP NADVY SP   PVPSAG FR DI  Q+ QI++ L
Sbjct  137   FPALQNIQNALNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFL  196

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             ++N++PF +N+YPFLSLY  N  FP D+AFFDG   P+ D+G  YTNVFDAN+D  V+AL
Sbjct  197   NQNNAPFTVNIYPFLSLYL-NSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDALVSAL  255

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
                G+G M + VGE+GWPTDG+  AN + A +FY G +  LA+ KGTP RPG  +EVY+F
Sbjct  256   KGLGYGSMNILVGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGY-IEVYLF  314

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVK  1244
             GL DED KSV PG+FERHWGI  YDGQPKF +DLSG  + K L G   ++Y P KWC   
Sbjct  315   GLLDEDLKSVAPGNFERHWGIFRYDGQPKFPMDLSGQLQDKYLVGAQNVQYFPAKWCQFN  374

Query  1245  SNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
              NAK  + +   I+YAC  ADCTA   GSSC+ L      SY FN YFQ   Q   SC+F
Sbjct  375   PNAKDLSKLVENINYACTFADCTALGYGSSCNGLDANGNASYAFNMYFQVQNQGDLSCNF  434

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL  VT  N+S + CNF I I
Sbjct  435   QGLAMVTEQNISQANCNFTIQI  456



>gb|KFK26060.1| hypothetical protein AALP_AA8G198000 [Arabis alpina]
Length=484

 Score =   475 bits (1222),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 305/441 (69%), Gaps = 14/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +S+H LPPK+VV+MLK N ++KVKLF++  + + ALAG+GIEVM+  PN 
Sbjct  25    VSALGVNWGTMSTHQLPPKTVVEMLKDNNVQKVKLFDADTNTMVALAGSGIEVMVAIPND  84

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M NY  A+ +V+ N+TR+     D VKI  V +GNEPFL  Y       VTYPAL 
Sbjct  85    QLKAMGNYSRAKDWVRRNITRFN----DSVKIKYVAVGNEPFLTSYNGT-FINVTYPALF  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+QKALNEAG+G   KATVP NADVY SPPD PVPSAG FR DI +++K I+  L +N +
Sbjct  140   NIQKALNEAGVGDFIKATVPLNADVYNSPPDNPVPSAGRFRQDIFEEMKLIVNFLAQNKA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFF+     ++DNG  YTNVFDAN+DT +A+L   GH
Sbjct  200   PFTVNIYPFLSLYLSS-DFPFDYAFFNS-QNTVNDNGLVYTNVFDANFDTLLASLRALGH  257

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G +TV VGE+GWPTDG++ AN + A +FY G +  LA+ +GTPARPG  ++VY+FG  DE
Sbjct  258   GDLTVIVGEVGWPTDGDKNANIANAERFYTGLLPKLAANRGTPARPG-YIQVYLFGFIDE  316

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-K  1256
             D KS+ PG+FERHWGI  YDGQPKF  DLSG G+ K+L G   ++YL  +WC +  N   
Sbjct  317   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQKKSLNGAQNVQYLQNQWCMLNPNGHS  376

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   GSSC +L E    SY FN YFQ   Q+A +CDF 
Sbjct  377   FSNSTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDFE  436

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  437   GLAMITTRNISREQCNFPIQI  457



>ref|XP_007151834.1| hypothetical protein PHAVU_004G079100g [Phaseolus vulgaris]
 gb|ESW23828.1| hypothetical protein PHAVU_004G079100g [Phaseolus vulgaris]
Length=479

 Score =   474 bits (1221),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 237/442 (54%), Positives = 307/442 (69%), Gaps = 7/442 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G  G++GLGVNWG  ++H L   +VV+MLK NGI+KVKLF++ E  ++AL+G+GIE M+ 
Sbjct  18    GWWGVEGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIETMVA  77

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN  L EM +YD A  +VK+NVT Y      GV I  V +GNEPFL+ Y      KVT+
Sbjct  78    IPNNQLSEMNDYDRAMQWVKKNVTSYNFRG--GVNIKYVAVGNEPFLRSYNGS-FMKVTF  134

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q ALNE G+G + KATVP NADVY SP + PVPSAGMFRPDI + + QI++ L 
Sbjct  135   PALQNIQNALNEVGVGDSIKATVPLNADVYESPINNPVPSAGMFRPDISELMIQIVQFLA  194

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             +N++PF +N+YPFLSLY  N +FPFD+AFFDGV  P++DNG +YTNVFDAN+DT V+AL 
Sbjct  195   KNNAPFTVNIYPFLSLY-GNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALQ  253

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
             + G+G M + VGE+GWPTDG++ AN   A +FY G +  LA  KGTP +P   +EVY+FG
Sbjct  254   KVGYGDMPILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLALNKGTPLKP-KYIEVYLFG  312

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG+FERHWGI  YDG+PKF +DLSG G  K L G   + YL  KWC    
Sbjct  313   LIDEDAKSIDPGNFERHWGIFKYDGKPKFPMDLSGKGPKKLLVGAQNVHYLDPKWCMFNP  372

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
               +  + +   I+YAC  ADCTA   GSSC++L      SY FN Y+QT +Q   +C+F 
Sbjct  373   ETQDISKLADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNDLACNFE  432

Query  1425  GLGEVTTTNLSTSTCNFNIGIK  1490
             GL  +TTTN+ST +CNF + I 
Sbjct  433   GLARLTTTNISTPSCNFILQIN  454



>ref|XP_009353157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=478

 Score =   474 bits (1219),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 303/441 (69%), Gaps = 9/441 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             +G++GLGVNWG +++H LPP++VV+MLK NGI+KVKLF++ E  ++ALAG+G+EVM+  P
Sbjct  18    SGVEGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIP  77

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  L  M +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT PA
Sbjct  78    NDQLAVMTSYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTLPA  134

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+Q ALNEAG+G + KATVP NADVY SP + PVPSAG FR DI + + +I++ LD+N
Sbjct  135   LQNIQNALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKN  194

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALA  890
              +PF IN+YPFLSLY  N  FPF++AFFDG   P+ D G    YTNVFDAN+DT V++L 
Sbjct  195   QAPFTINIYPFLSLY-GNDDFPFNYAFFDGDTNPIVDTGTGIQYTNVFDANFDTLVSSLK  253

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G M + VGE+GWPTDG++ ANA  A +FY G +  L + +GTP RPG  +EVY+FG
Sbjct  254   AVGFGNMPIVVGEVGWPTDGDKNANAGNALRFYNGLLTRLGTNRGTPLRPG-YIEVYLFG  312

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG FERHWGI GYDGQPKF +DLSG G+ K L     ++YL KKWC    
Sbjct  313   LIDEDAKSIAPGSFERHWGIFGYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNP  372

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NAK  + +   I+YAC  +DCTA   GSSC++L      SY FN Y+Q   Q+  SC+F 
Sbjct  373   NAKDVSKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFQ  432

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  433   GLATLTTQNISQGNCNFIIQI  453



>emb|CDY03359.1| BnaC09g09890D [Brassica napus]
Length=477

 Score =   474 bits (1219),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/437 (54%), Positives = 300/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  22    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V +NVTRY  +   GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYDRAKDWVHKNVTRYNFSG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASDPVPSAGRFRPDILGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P+DD+G +YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPINYAFFDGA-QPIDDHGVSYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN   A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG FERHWG+  +DGQPKF LDLSG G+ K L G   + YLP KWC    NAK 
Sbjct  316   DAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQGQNKLLIGARNVTYLPNKWCMFNPNAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T +   I +AC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +C F GL  
Sbjct  376   LTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VTT N+S   C+F + I
Sbjct  436   VTTQNISQGQCDFPVQI  452



>ref|XP_008806060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=460

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 232/438 (53%), Positives = 298/438 (68%), Gaps = 6/438 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++HPLPP  VV++LK NGI KVKLF++   +++ALAG+GIEVM+  PN 
Sbjct  2     VEGLGVNWGTLATHPLPPNIVVQLLKDNGINKVKLFDADAKMMSALAGSGIEVMVAIPNN  61

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +Y  A+ +V++NVTRY      GV IT V +GNEPFLK Y       VT+PAL 
Sbjct  62    QLAAMNDYTTAKEWVRKNVTRYHFDG--GVNITYVAVGNEPFLKSY-NDSFSNVTFPALQ  118

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP    VPSAG FR DI   + QI++  ++N +
Sbjct  119   NIQNALNEAGVGDSVKATVPLNADVYESPAGNAVPSAGRFRSDINDVMTQIVQFFNQNGA  178

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N +FP DFAFFDG   P+ DNG  YTNVFDAN+DT V+AL   G 
Sbjct  179   PFTVNIYPFLSLY-GNDNFPLDFAFFDGTSPPVVDNGIEYTNVFDANFDTLVSALNAVGL  237

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + VGE+GWPTDG++ A AS A +FY G +K LA+ +GTP RP   LEVY+FGL DE
Sbjct  238   GNLPIIVGEVGWPTDGDKSAEASYAQRFYNGLLKRLAAGQGTPLRPNQYLEVYLFGLLDE  297

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG+FERHWGI  YDGQPKF +DLSG G+ K L     +EYLP+KWC    +AK 
Sbjct  298   DAKSVAPGNFERHWGIFRYDGQPKFPVDLSGQGQNKMLAAAKNVEYLPQKWCVFNPDAKD  357

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   +++AC  +DCT+  +GS+C  L      SY FN Y+Q   Q+  SC F GL  
Sbjct  358   LSKLADNVNFACTFSDCTSLGSGSTCSDLDANGSASYAFNMYYQVQNQDDTSCFFQGLAM  417

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              T  + ST+ C F + IK
Sbjct  418   ETAQDPSTADCKFTVQIK  435



>ref|XP_009112609.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112611.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112614.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=478

 Score =   473 bits (1218),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/437 (54%), Positives = 300/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  23    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  83    QLKVMGSYDRAKDWVRKNVTRYNFNG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  140   NIQNALNEAGLGNSIKATVPLNADVYDSPVSDPVPSAGRFRPDILGQMTQIVDFLGKNNA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P+DD+G +YTNVFDAN+DT V++L   GH
Sbjct  200   PITINIYPFLSLY-GNDDFPINYAFFDGA-QPIDDHGVSYTNVFDANFDTLVSSLKAVGH  257

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN   A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  258   GDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  316

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG FERHWG+  +DGQPKF LDLSG G+ K L G   + YLP KWC    NAK 
Sbjct  317   DAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQGQNKLLIGARNVTYLPNKWCMFNPNAKD  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T +   I +AC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +C F GL  
Sbjct  377   LTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLAT  436

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VTT N+S   C+F + I
Sbjct  437   VTTQNISQGQCDFPVQI  453



>ref|XP_010276412.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=477

 Score =   473 bits (1217),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 299/441 (68%), Gaps = 9/441 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPP +VV+MLK NGIKKVKLF++ +  ++ALAGT IEVM+  PN 
Sbjct  20    IEGLGVNWGTMATHKLPPDTVVQMLKDNGIKKVKLFDADQSTMSALAGTEIEVMVAIPND  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +VK NVTRY      GV I  V +GNEPFL+ Y    L  +T PAL 
Sbjct  80    QLAVMNDYDRAKDWVKRNVTRYIFNG--GVNIKYVAVGNEPFLQSYNNSFL-NITLPALQ  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG G + KATVP NADVY SP   PVPSAG FR DI   + QI++ L++N++
Sbjct  137   NIQNALNEAGHGDSIKATVPLNADVYNSPVSNPVPSAGRFRTDISDLMTQIVQFLNKNNA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY A+ +FP DFAFFDG   P  D  NG  Y+NVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSLY-ADQNFPVDFAFFDGTANPTTDTGNGIQYSNVFDANFDTLVSALKSV  255

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G G M + VGE+GWPTDG++ AN +LA +FY G +  LA+ KGTP RPG  LEVY+FGL 
Sbjct  256   GFGDMPILVGEVGWPTDGDKNANVALAQRFYNGLLPRLAANKGTPLRPGY-LEVYLFGLI  314

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG+FERHWGI  YDGQPKF LD+SG G+   L     ++YLP++WC    NA
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFLLDISGQGQNTLLVAAKNVQYLPQRWCVFNPNA  374

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  + +   I+YAC  +DCT     SSC +L      SY FN YFQ   Q+  SC+F GL
Sbjct  375   KDLSKLADNINYACTFSDCTTLGYQSSCGNLDTQGNASYAFNMYFQAQNQQDMSCNFEGL  434

Query  1431  GEVTTTNLSTSTCNFNIGIKV  1493
               VTT N S   CNF I I +
Sbjct  435   AMVTTQNASQGNCNFTIQIAL  455



>ref|XP_006289696.1| hypothetical protein CARUB_v10003257mg [Capsella rubella]
 gb|EOA22594.1| hypothetical protein CARUB_v10003257mg [Capsella rubella]
Length=491

 Score =   473 bits (1217),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 303/441 (69%), Gaps = 14/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK+VV+M+K N +KKVKLF++  + + ALAGTGIEVM+  PN 
Sbjct  27    VSALGVNWGTMATHQLPPKTVVQMMKDNNVKKVKLFDADTNTMVALAGTGIEVMVAIPND  86

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y+ A+ +V+ N+TR+     D VKI  V +GNEPFL  Y       VTYPAL 
Sbjct  87    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINVTYPALF  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+QKALNEAG+G   KATVP NADVY SPPD PVPSAG FR DI +++K I+  L  N +
Sbjct  142   NIQKALNEAGVGDFIKATVPLNADVYNSPPDNPVPSAGSFRQDIFEEMKLIVNFLAHNKA  201

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFFDG    + DNG  YTNVFDAN+DT +A+L   GH
Sbjct  202   PFTVNIYPFLSLYLSS-DFPFDYAFFDG-QNTVSDNGVIYTNVFDANFDTLLASLRALGH  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MTV VGE+GWPTDG++ AN   A +FY G +  LA  +GTP RPG  ++VY+FG  DE
Sbjct  260   GDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAGNRGTPMRPGY-IQVYLFGFIDE  318

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  +DGQPKF  DLSG G+ K L G   ++Y   +WC +  +A  
Sbjct  319   DAKSIAPGNFERHWGIFKFDGQPKFPADLSGEGQKKILNGAQNVQYFQNQWCMLNPDAHT  378

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   GSSC +L E    SY FN YFQ H+Q+A +CDF 
Sbjct  379   FSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVHDQKAEACDFE  438

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VTT N+S   CNF I I
Sbjct  439   GLAMVTTRNISREQCNFPIQI  459



>ref|XP_010470322.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=481

 Score =   473 bits (1216),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 301/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y  A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYHRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P++DNG  YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPLNYAFFDGA-QPINDNGVDYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN+  A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWC     AK 
Sbjct  316   DAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKFLIGAQNVPYLPNKWCVFNPEAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I +AC  +DCTA   GSSC+SL      SY FN YFQ   Q+  +C F GL  
Sbjct  376   LTKLAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKNQDESACFFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   C+F I I
Sbjct  436   ITTQNISQGQCSFPIQI  452



>ref|XP_010495273.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=491

 Score =   472 bits (1214),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 237/439 (54%), Positives = 303/439 (69%), Gaps = 14/439 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
              LGVNWG +++H LPPK+VV+MLK N +KKVKLF++  + + ALAG+GIEVM+  PN  L
Sbjct  31    ALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPNDQL  90

Query  369   KEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             K M +Y+ A+ +V+ N+TR+     D VKI  V +GNEPFL  Y       +TYPAL ++
Sbjct  91    KAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALFHI  145

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKALNEAG+G   KATVP NADVY SPP+ PVPSAG FR DI +++K I+  L  N +PF
Sbjct  146   QKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGSFRQDIYEEMKLIVNFLAHNKAPF  205

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY ++  FPFD+AFF+G    + DNG  YTNVFDAN+DT +A+L   GHG 
Sbjct  206   TVNIYPFLSLYLSS-DFPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLRALGHGD  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             MTV VGE+GWPTDG++ AN   A +FY G +  LA  KGTP RPG  +EVY+FG  DED 
Sbjct  264   MTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNKGTPMRPGY-IEVYLFGFIDEDA  322

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG+FERHWGI  YDGQPKF  DLSG G+ K L G   ++YL  +WC +  NA  F+
Sbjct  323   KSIAPGNFERHWGIFKYDGQPKFPADLSGEGQKKMLNGAQSVQYLQNQWCMLNPNAHTFS  382

Query  1263  N----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             N    +   ++YAC  +DCTA   G+SC +L E    SY FN YFQ H+Q+A +CDF GL
Sbjct  383   NSTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  443   AIITTHNISREQCNFPIQI  461



>ref|XP_010496623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=482

 Score =   471 bits (1213),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 300/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+MLK N I K KLF++ E  + ALAG+GIEVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKFKLFDADETTMGALAGSGIEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y  A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYHRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P++DNG  YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPLNYAFFDGA-QPINDNGVDYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN+  A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWC     AK 
Sbjct  316   DAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQGQNKFLIGAQNVPYLPNKWCVFNPEAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T + A I +AC  +DCTA   GSSC+SL      SY FN YFQ   Q+  +C F GL  
Sbjct  376   LTKLAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKNQDESACFFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   C+F I I
Sbjct  436   ITTQNISQGQCSFPIQI  452



>ref|XP_011010121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Populus euphratica]
Length=480

 Score =   471 bits (1212),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 298/439 (68%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG ++   LPP++VV+MLK NGI+KVKLF++ ++ +N+LAGTGIEVM+  PN 
Sbjct  20    VDGLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPND  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +Y+ A+ +VK NVTRY      GV I  V +GNEPFLK Y        T+PAL 
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYNFNG--GVTIKYVAVGNEPFLKSYNGS-FLNTTFPALR  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SP D+  PS+G FR DI   + +I++ L +N++
Sbjct  137   NIQNALNDAGVGDSIKATVPLNADVYNSPDDQAYPSSGRFRSDINDLMTEIVQFLAQNNA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY  N  FPFD+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSLY-GNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAA  255

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             GHG M + VGE+GWPTDG++ AN   A +FY G +  LA  +GTP RPG  +EVY+FGL 
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANIGNAIRFYNGLLPRLAGNRGTPLRPGY-IEVYLFGLL  314

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG+FERHWGI  YDGQPKF +DLSG    K L G   ++YLP +WC    NA
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQVANKWLVGAQNVQYLPSRWCMFNPNA  374

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  + +   I+YAC R+DCTA   GSSC+ L      SY FN Y+Q   Q+  +C+F GL
Sbjct  375   KDLSKLADNINYACSRSDCTALGYGSSCNGLDTNGNASYAFNMYYQVQNQDEFACNFEGL  434

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               VT  N+S   CNF I I
Sbjct  435   ATVTEQNISQGNCNFTIQI  453



>ref|XP_011034355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Populus euphratica]
Length=479

 Score =   471 bits (1212),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 297/439 (68%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + GLGVNWG ++   LPP++VV+MLK NGI+KVKLF++ ++ +N+LAGTGIEVM+  PN 
Sbjct  20    VHGLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPND  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +Y+ A+ +VK NVTRY      GV I  V +GNEPFL  Y    L   T+PAL 
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYNFNG--GVTIKYVAVGNEPFLSSYNGSFL-NTTFPALR  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SP D+  PS+G FR DI   + QI++ L +N +
Sbjct  137   NIQNALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY  N  FPFD+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSLY-GNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAA  255

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             GHG M + VGE+GWPTDG++ AN   A +FY G I  L   +GTP RPG  +EVY+FGL 
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANTGYAIRFYNGLIPRLVGNRGTPLRPGY-IEVYLFGLL  314

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG+FERHWGI  YDGQPKF LDLSG  + K L G   ++YLP KWC    NA
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLAGARNVQYLPAKWCMFNPNA  374

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  + +   I YAC R+DCTA   GSSC+SL      SY FN Y+Q   Q+  +C+F GL
Sbjct  375   KDLSKLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEGL  434

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +T+ N+S   CNF I I
Sbjct  435   ATITSQNISQGNCNFIIQI  453



>emb|CDY48710.1| BnaA09g09850D [Brassica napus]
Length=477

 Score =   471 bits (1211),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 298/437 (68%), Gaps = 8/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALA +G+EVM+  PN 
Sbjct  22    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALASSGLEVMVAIPND  81

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +YD A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYDRAKDWVRKNVTRYNFNG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G T KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++
Sbjct  139   NIQNALNEAGLGNTVKATVPLNADVYDSPVSDPVPSAGRFRPDILGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             P  IN+YPFLSLY  N  FP ++AFFDG  +P+DD+G +YTNVFDAN+DT V++L   GH
Sbjct  199   PITINIYPFLSLY-GNDDFPINYAFFDGA-QPIDDHGVSYTNVFDANFDTLVSSLKAVGH  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN   A +FY G +  L + KGTP RP + +EVY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG FERHWG+  +DGQPKF LDLSG G+   L G   + YLP KWC    NAK 
Sbjct  316   DAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQGQNTLLIGARNVTYLPNKWCMFNPNAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T +   I +AC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +C F GL  
Sbjct  376   LTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLAT  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VTT N+S   C+F + I
Sbjct  436   VTTQNISQGQCDFPVQI  452



>ref|XP_009121000.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=492

 Score =   471 bits (1213),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 307/444 (69%), Gaps = 14/444 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             + +  LGVNWG +++H LPPK+VV+MLK N ++KVKLF++  + + ALAG+GIEVM+  P
Sbjct  27    SNVSALGVNWGTMATHQLPPKTVVQMLKDNNVQKVKLFDADTNTMVALAGSGIEVMVAIP  86

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  LK M +Y+ A+ +V+ N+TR+     D +KI  V +GNEPFL  Y       +TYPA
Sbjct  87    NDQLKAMGSYNRAKDWVRRNITRFN----DDIKIKYVAVGNEPFLTSYNGS-FINLTYPA  141

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+QKALNEAG+G   KATVP NADVY SPP+ PVPSAG FR DI ++++ I+  L  N
Sbjct  142   LFNIQKALNEAGVGDFIKATVPSNADVYSSPPENPVPSAGRFRQDIYEEMRLIVNFLAHN  201

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD-NGKTYTNVFDANYDTAVAALAR  893
              +PF +N+YPFLSLY ++  FPFD+AFF+G +   D+ NG  YTNVFDAN+DT +A+L  
Sbjct  202   KAPFTVNIYPFLSLYLSS-DFPFDYAFFNGQNTVNDNGNGVVYTNVFDANFDTLLASLKE  260

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              GHG MTV VGE+GWPTDG++ AN   A +FY G +  LA+ +GTP RPG  +EVY+FG 
Sbjct  261   LGHGDMTVIVGEVGWPTDGDKNANIPNAERFYAGLLPKLAANRGTPMRPG-YIEVYLFGF  319

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS+ PG+FERHWGI  YDGQPKF  DLSG G+ KALTG   ++YL  +WC +  N
Sbjct  320   IDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGEKKALTGAQNVQYLQNQWCMLNPN  379

Query  1251  A-KFTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSC  1415
             A  F+N    +   ++YAC  +DCTA   GSSC +L E    SY FN YFQ   Q+A +C
Sbjct  380   AISFSNSTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEAC  439

Query  1416  DFGGLGEVTTTNLSTSTCNFNIGI  1487
             DF GL  +TT N+S   CNF I I
Sbjct  440   DFEGLAMITTKNISRDQCNFPIQI  463



>ref|XP_003559620.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=492

 Score =   471 bits (1212),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 296/439 (67%), Gaps = 10/439 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG ++SH LPP SVV+ML+ NGIKKVKLF++    L ALAG+GIEVM+  PN +L 
Sbjct  30    LGVNWGTMASHQLPPSSVVRMLQDNGIKKVKLFDADAGPLEALAGSGIEVMVAIPNIMLD  89

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +YD A  +V +NV+ Y      GV I  V +GNEPFL          VT+PAL N+Q
Sbjct  90    MMTDYDTARDWVHKNVSAYNFDG--GVNIKYVAVGNEPFLSSLNGT-FLNVTFPALQNIQ  146

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             +ALNEAG+G T KATVP NADVY SP D PVPSAG FR +I   + +I++ L+++ +PF 
Sbjct  147   RALNEAGVGDTVKATVPLNADVYESPKDNPVPSAGRFRAEISGLMTEIVQFLNQSGAPFT  206

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAREGHG  905
             +N+YP+LSLY  N  FP DFAFFDG   P+ D  +G +YTNVFDAN+DT V+AL   G G
Sbjct  207   VNIYPYLSLY-GNAGFPLDFAFFDGTTSPVVDTNSGISYTNVFDANFDTLVSALNAAGVG  265

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + V VGE+GWPTDG++ A A+ A +FY G +K LAS  GTP R    +EVY+F L DED
Sbjct  266   GLPVMVGEVGWPTDGDKQATAAYAQRFYAGLLKKLASNAGTPLRANQYVEVYLFSLIDED  325

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KSV PG+FERHWGI+ YDGQPK+ +DL+G G+  AL G   +EYLP+ WC + +NA   
Sbjct  326   VKSVAPGNFERHWGIMRYDGQPKYAMDLTGQGRNTALVGARGVEYLPRAWCVLNANAPAE  385

Query  1263  NMKA---TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
             +M      + YAC  ADCTA S GS+C  L      SY FNAYFQ   QE  +C F GL 
Sbjct  386   SMSRLGDNVDYACSNADCTALSYGSTCGGLDAAGNASYAFNAYFQVQNQEVEACGFQGLA  445

Query  1434  EVTTTNLSTSTCNFNIGIK  1490
               TT + ST TCNF+I I+
Sbjct  446   ASTTQDPSTGTCNFSIQIE  464



>ref|XP_004955566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=487

 Score =   470 bits (1210),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/440 (54%), Positives = 301/440 (68%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G + LG+NWG  +SHPLPPK+VV++L+ NGIKKVKLF++    ++AL+GTGIEVM   PN
Sbjct  22    GAEALGMNWGTQASHPLPPKAVVQVLRDNGIKKVKLFDTDFAAMSALSGTGIEVMAAIPN  81

Query  360   ALLKEMVNYDVAEA--FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
              +L ++ + D  +A  +VK NV RY      GV I  V +GNEPFL+ Y       +T+P
Sbjct  82    NMLADLAD-DAGKAKDWVKRNVKRYDFDG--GVTIKYVAVGNEPFLQSYNGT-FINITFP  137

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q ALN+AG+G   KATVP NADVY SP   PVPSAG FRPDI   +  I+K L +
Sbjct  138   ALQNIQNALNDAGVGDRIKATVPLNADVYNSPDSHPVPSAGRFRPDISGLMTDIVKFLAK  197

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N++PF +N+YPFLSLY ++ +FP D+AFFDG   P++DNG  YTNVFDAN+DT VAAL  
Sbjct  198   NNAPFTVNIYPFLSLYLSD-NFPLDYAFFDGGATPVNDNGVLYTNVFDANFDTLVAALRA  256

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              GHG M V VGE+GWPTDG++ A  S A +FY G ++ LA+  GTPARP   +EVY+FGL
Sbjct  257   VGHGDMPVVVGEVGWPTDGDKHAKVSYAQRFYAGLLRRLAANAGTPARPNQYIEVYLFGL  316

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KSV PG+FERHWGIL YDGQPK+ +DL+G G+   L     I+YLPK WC +  N
Sbjct  317   VDEDLKSVAPGNFERHWGILRYDGQPKYPMDLAGQGRNTMLVPAKGIKYLPKTWCALNPN  376

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             AK  + + A I YAC  ADCT    GS+C+ +      SY FNAY+Q   Q+  +CDF G
Sbjct  377   AKDLSKLGANIDYACTFADCTPLGYGSTCNGMDTAGNASYAFNAYYQVQNQKDDACDFQG  436

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L   T T+ ST+ CNF I I
Sbjct  437   LALPTETDPSTAACNFTIQI  456



>ref|XP_008391677.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Malus domestica]
Length=484

 Score =   470 bits (1210),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 303/441 (69%), Gaps = 9/441 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             +G++GLGVNWG +++H LPP++VV+MLK NGI+KVKLF++ E  ++ALAG+G+EVM+  P
Sbjct  18    SGVEGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIP  77

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  L  M +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT+PA
Sbjct  78    NDQLAVMTSYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTFPA  134

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+Q ALNEAG+G + KATVP NADVY SP + PVPSAG FR DI + + +I++ LD+N
Sbjct  135   LQNIQNALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKN  194

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALA  890
              +PF IN+YPFLSLY  N  FPF++AFFDG   P+ D G    YTNVFDAN+DT V++L 
Sbjct  195   QAPFSINIYPFLSLY-GNDDFPFNYAFFDGDTNPIVDAGTGIQYTNVFDANFDTLVSSLK  253

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G M + VGE+GWPTDG++ ANA  A +FY G +  L + +GTP RPG  +EVY+FG
Sbjct  254   AVGFGNMPIVVGEVGWPTDGDKNANAGNALRFYNGLLPRLGTNRGTPLRPG-YIEVYLFG  312

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG FERHWGI  YDGQPKF +DLSG G+ K L     ++YL KKWC    
Sbjct  313   LIDEDAKSIAPGSFERHWGIFRYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNP  372

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NAK  + +   I+YAC  +DCTA   GSSC++L      SY FN Y+Q   Q+  SC+F 
Sbjct  373   NAKDVSKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFQ  432

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  433   GLATLTTQNISQGNCNFIIQI  453



>ref|XP_010454046.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   471 bits (1211),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 303/441 (69%), Gaps = 14/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK+VV+MLK N +KKVKLF++  + + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPND  88

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y+ A  +V+ N+TR+     D VKI  V +GNEPFL  Y       +TYPAL 
Sbjct  89    QLKAMGSYNRARDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  143

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             ++QKALNEAG+G   KATVP NADVY SPP+ PVPSAG FR DI +++K I+  L  N +
Sbjct  144   HIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGSFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFF+G    + DNG  YTNVFDAN+DT +A+L   GH
Sbjct  204   PFTVNIYPFLSLYLSS-DFPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLRALGH  261

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MTV VGE+GWPTDG++ AN   A +FY G +  LA  +GTP RPG  +EVY+FG  DE
Sbjct  262   GDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNRGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF  DLSG G+ K L G   ++YL  +WC +  NA  
Sbjct  321   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQKKMLNGAQSVQYLQNQWCMLNPNAHT  380

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   G+SC +L E    SY FN YFQ H+Q+A +CDF 
Sbjct  381   FSNNTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEACDFE  440

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  441   GLAIITTHNISREQCNFPIQI  461



>ref|XP_006400369.1| hypothetical protein EUTSA_v10015448mg [Eutrema salsugineum]
 gb|ESQ41822.1| hypothetical protein EUTSA_v10015448mg [Eutrema salsugineum]
Length=494

 Score =   469 bits (1208),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 302/439 (69%), Gaps = 14/439 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK+VV+MLK N ++KVKLF++  + + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVQKVKLFDADTNTMGALAGSGIEVMVAIPND  88

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK M +Y+ A+ +V+ N+TR+     D VKI  V +GNE FL  Y       +TYPAL 
Sbjct  89    LLKAMGSYNRAKDWVRRNITRFN----DAVKIKYVAVGNEAFLSSYNGS-FINLTYPALF  143

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+QKALNEAG+G   KATVP NADVY SPP+ PVPSAG FR DI +++K I+  L  N +
Sbjct  144   NIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGRFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFF+G    ++DNG  YTNVFDAN+DT +A+L   GH
Sbjct  204   PFTVNIYPFLSLYLSS-DFPFDYAFFNG-QNTVNDNGVIYTNVFDANFDTLLASLRALGH  261

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MTV VGE+GWPTDG++ AN   A +FY G +  LA  +GTP RPG  +EVY+FG  DE
Sbjct  262   GDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNRGTPMRPG-YIEVYLFGFIDE  320

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  +DGQPKF  DLSG GK K LTG   ++YL  +WC +  N   
Sbjct  321   DAKSIAPGNFERHWGIFRFDGQPKFPADLSGEGKKKILTGAQNVQYLQNQWCMLNPNGHS  380

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   GSSC +L E    SY FN YFQ   Q+A +CDF 
Sbjct  381   FSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDFE  440

Query  1425  GLGEVTTTNLSTSTCNFNI  1481
             GL  +TT N+S   CNF I
Sbjct  441   GLAMITTRNISREQCNFPI  459



>ref|XP_008812061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Phoenix dactylifera]
Length=477

 Score =   469 bits (1206),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 295/438 (67%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++HPLPP+ VV++LK NGIKKVKLF++    ++ALAG+GIEVM+  PN 
Sbjct  20    VEGLGVNWGTMATHPLPPEIVVQLLKDNGIKKVKLFDADAATMSALAGSGIEVMVAIPNN  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +Y  A+ +V  NVTRY      GV I  V +GNEPFL  Y    L  VT+PAL 
Sbjct  80    QLGAMNDYATAKKWVNRNVTRYNFDG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQ  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG G   KATVP NADVY SP + PVPSAG FR DI   + QI++ L++  +
Sbjct  137   NIQNALNEAGAGGI-KATVPLNADVYNSPTNNPVPSAGRFRSDINDLMTQIVQFLNQAGA  195

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N +FP DFAFFDG  +P+ DNG  Y NVFDAN+DT V+AL   G 
Sbjct  196   PFTVNIYPFLSLY-DNDNFPLDFAFFDGTSQPVVDNGIQYANVFDANFDTLVSALKAVGL  254

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + V VGE+GWPTDG++ A AS A +FY G +K LA+  GTP RP   LEVY+F L DE
Sbjct  255   GDLPVIVGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANSGTPLRPNQYLEVYLFSLIDE  314

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGIL YDGQPKF +DLSG G+ K L     +EYLP+ WC    NAK 
Sbjct  315   DAKSIAPGNFERHWGILKYDGQPKFPMDLSGQGQNKMLVAAKNVEYLPQTWCVFNPNAKD  374

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  +DCT    GS+C+ L      SY FN YFQ   Q+  SC F GL  
Sbjct  375   LSKLGDNINYACTFSDCTPLGYGSTCNQLDANGNASYAFNMYFQVQNQKDMSCFFQGLAM  434

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              TT N ST+ CNF I IK
Sbjct  435   QTTQNPSTAECNFTIQIK  452



>ref|XP_002884423.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60682.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   469 bits (1207),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 299/439 (68%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+ GLGVNWG +++H LPPK+VV+MLK N I+KVKLF++  + + ALAG+G+EVM+  PN
Sbjct  29    GVSGLGVNWGTMATHQLPPKTVVEMLKDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ M NY  A+ +V+ NV+R+     +GVKI  V +GNEPFL  Y       + YPAL
Sbjct  89    DLLQAMGNYQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLIYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G  TKATVP NADVY SPPD  VPSAG FR DI +++ QI+  L +N 
Sbjct  146   FNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY ++  FPFD+AFFDG    ++DNG  YTNVFDAN+DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-DFPFDYAFFDG-QNTVNDNGVVYTNVFDANFDTLLASLNALN  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN   A +FY G +  LA+  GTP R G  +EVY+FG  D
Sbjct  264   HGNMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPRLANNVGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGI  +DGQPKF +D  G G+ K LTG   ++YL  +WC    N +
Sbjct  323   EDVKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQKKFLTGAQNVQYLLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                +++   I+YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNMSSLGDNINYACSHSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  443   ATITTQNISQGECNFPIQI  461



>gb|KDP39719.1| hypothetical protein JCGZ_02739 [Jatropha curcas]
Length=478

 Score =   468 bits (1205),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/437 (54%), Positives = 293/437 (67%), Gaps = 9/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG  ++H LPPK+VV+MLK NGIKKVKLF++    + ALAGTGIEVM+  PN  L
Sbjct  22    GLGVNWGTQATHKLPPKTVVQMLKDNGIKKVKLFDTEASTMRALAGTGIEVMVAIPNDQL  81

Query  369   KEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
               M +Y  A+ FVK N++ Y      GV I  V +GNEPFL  Y        T+PAL N+
Sbjct  82    LAMNDYKRAKDFVKSNISIYNFNG--GVNIKYVAVGNEPFLTSYNGS-FINTTFPALQNI  138

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q ALNEAG+G + KATVP NADVY SP  +  PSAG FR DI   + QI++ L++N++PF
Sbjct  139   QNALNEAGVGDSIKATVPLNADVYNSPTGQSYPSAGRFRSDINDLMTQIVQFLNKNNAPF  198

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAREGH  902
              +N+YPFLSLY  N +FP D+AFFDGV + + D  +G  YTNVFDAN+DT V+AL   G 
Sbjct  199   TVNIYPFLSLY-GNDNFPIDYAFFDGVSQTVVDVGSGIQYTNVFDANFDTLVSALKAVGF  257

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MTV VGE+GWPTDG++ A    A +FY G +  LAS +GTP RPG  +EVY+FGL DE
Sbjct  258   GDMTVIVGEVGWPTDGDKSATVDYAYRFYNGLLPRLASNRGTPLRPG-FIEVYLFGLLDE  316

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF LDLSG G+ K L G   ++YLP KWCT   NA+ 
Sbjct  317   DAKSIAPGNFERHWGIFKYDGQPKFALDLSGQGQNKLLIGAQNVQYLPSKWCTFNPNAQD  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I YAC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +CDF GL  
Sbjct  377   LSKLADNIDYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVQNQDPMACDFQGLAT  436

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VT  N+S   CNF I I
Sbjct  437   VTNVNISQGKCNFIIQI  453



>ref|XP_002525445.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36935.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=480

 Score =   468 bits (1205),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 294/437 (67%), Gaps = 9/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG  ++H LPPK+VV+MLK NGI+KVKLF+S  + + ALAG+G+EVM+  PN  L
Sbjct  22    GLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDSDRNTMTALAGSGLEVMVAIPNDQL  81

Query  369   KEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
               M +YD A+ +VK NV+ Y      GV I  V +GNEPFL  Y       +T+PAL N+
Sbjct  82    AAMNDYDRAKDWVKRNVSIYNFNG--GVNIKYVAVGNEPFLTSYNGS-FINITFPALQNI  138

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q ALNEAG+G + KATVP NADVY SP D+P PSAG FR DI   +  I++ L +N++PF
Sbjct  139   QNALNEAGVGDSVKATVPLNADVYNSPTDQPYPSAGRFRIDINDIMTNIVQFLHKNNAPF  198

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALAREGH  902
              +N+YPFLSLY  N  FPFD+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   G 
Sbjct  199   TVNIYPFLSLY-GNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAVGF  257

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ A    A +FY G +  LA  +GTP RPG  +EVY+FGL DE
Sbjct  258   GDMPIIVGEVGWPTDGDKNAKVDYAYRFYNGLLPRLAGNRGTPLRPG-FIEVYLFGLLDE  316

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF LDLSG G+ K L G   ++Y P KWC    NAK 
Sbjct  317   DAKSIAPGNFERHWGIFRYDGQPKFALDLSGQGQNKLLVGAQNVQYQPSKWCMFNPNAKD  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I YAC  +DCTA   GSSC+ L      SY FN Y+Q  +Q+  +C+F GL  
Sbjct  377   LSKLADNIDYACTFSDCTALGYGSSCNGLDSNGNASYAFNMYYQVQKQDDMACNFQGLAM  436

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VTT NLS  TCNF I I
Sbjct  437   VTTQNLSQGTCNFIIQI  453



>ref|XP_006362259.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=479

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/435 (54%), Positives = 294/435 (68%), Gaps = 7/435 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G GVNWG +++H L PK VV+MLK NGI KVKLF++ +  +NALAGT IEVM+  PN 
Sbjct  23    VEGFGVNWGTMATHMLEPKIVVQMLKDNGINKVKLFDADKSTMNALAGTDIEVMVAIPND  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +V+ NVTRY     +GV I  V +GNEPFL  Y    L  +T+PAL 
Sbjct  83    QLLTMTDYDRAKDWVRRNVTRYN--FKNGVNIKYVAVGNEPFLTAYNNSFL-NLTFPALR  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI + + QI++ + +N +
Sbjct  140   NIQNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVEFMSKNQA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY AN  FP DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL   G+
Sbjct  200   PFTVNIYPFLSLY-ANEHFPIDFAFFDGTPSPVLDNGVEYTNVFDANFDTLYSALKAVGY  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ AN + A +FY G    LAS +GTP RPG  +EVY+FGL DE
Sbjct  259   GNMAILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-K  1256
             D KS+ PG+FERHWGI  YDGQ KF +D+SG G+ K L     ++YLP +WC +  NA  
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQSKFPMDISGQGQDKHLVAAKNVQYLPNRWCMLNPNATD  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I YAC  +DCT+   GSSC++L      SY FN ++Q   Q   SCDF GL  
Sbjct  378   LSKLANNIDYACTFSDCTSLGYGSSCNNLDAIGNASYAFNMFYQVQNQLDLSCDFEGLAM  437

Query  1437  VTTTNLSTSTCNFNI  1481
             VT  NLS  TCNF I
Sbjct  438   VTNRNLSQGTCNFII  452



>ref|XP_010420566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=494

 Score =   469 bits (1206),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 303/441 (69%), Gaps = 14/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK+VV+MLK N +KKVKLF++  + + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPND  88

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y+ A+ +V+ N+TR+     D VKI  V +GNEPFL  Y       +TYPAL 
Sbjct  89    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  143

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             ++QKALNEAG+G   KATVP NADVY SPP+ PVPSAG FR DI +++K I+  L  N +
Sbjct  144   HIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGTFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSL  ++  FPFD+AFF+G    + DNG  YTNVFDAN+DT +A+L   GH
Sbjct  204   PFTVNIYPFLSLSLSS-DFPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLRALGH  261

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MTV VGE+GWPTDG++ AN   A +FY G +  LA  KGTP RPG  +EVY+FG  DE
Sbjct  262   GDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNKGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF  DL G G+ K LTG   ++YL  +WC +  NA  
Sbjct  321   DAKSIAPGNFERHWGIFKYDGQPKFPADLPGEGQKKVLTGAQSVQYLQNQWCMLNPNAHT  380

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   G+SC +L E    SY FN YFQ H+Q+A +CDF 
Sbjct  381   FSNNTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEACDFE  440

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  441   GLAIITTHNISREQCNFPIQI  461



>ref|NP_197323.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB09480.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AED92520.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=488

 Score =   468 bits (1205),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 302/441 (68%), Gaps = 14/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +S+H LPPK+VV+MLK N +KKVKLF++  + + ALAG+GIEVM+  PN 
Sbjct  27    VSALGVNWGTMSTHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPND  86

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y+ A+ +V+ N+TR+     D VKI  V +GNEPFL  Y       +TYPAL 
Sbjct  87    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+QKALNEAG+G   KATVP NADVY SP + PVPSAG FR DI +++K I+  L  N +
Sbjct  142   NIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGSFRQDIFEEMKLIVNFLAHNKA  201

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFF+G    + DNG  YTNVFDAN+DT +A+L   GH
Sbjct  202   PFTVNIYPFLSLYLSS-DFPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLKALGH  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G MTV VGE+GWPTDG++ AN   A +FY G +  LA+ +GTP RPG  +EVY+FG  DE
Sbjct  260   GDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANRGTPMRPG-YIEVYLFGFIDE  318

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-K  1256
             D KS+ PG+FERHWGI  YDGQPKF  DLSG G+ K LTG   ++YL  +WC    NA  
Sbjct  319   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQKKILTGAQNVQYLRNQWCMFNPNALT  378

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   GSSC +L E    SY FN YFQ   Q+A +CDF 
Sbjct  379   FSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDFE  438

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  439   GLAIITTRNISREQCNFPIQI  459



>ref|XP_004249143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=479

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 232/435 (53%), Positives = 295/435 (68%), Gaps = 7/435 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G GVNWG +++H L PK +V+ML+ NGIKKVKLF++ +  ++ALAGT IEVM+  PN 
Sbjct  23    VEGFGVNWGTMATHMLEPKILVQMLRDNGIKKVKLFDADKSTMDALAGTDIEVMVAIPND  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M + D A+ +V+ NVTRY     +GV I  V +GNEPFL  Y       +T+PAL 
Sbjct  83    QLLTMTDIDRAKDWVRRNVTRYN--FKNGVNIKYVAVGNEPFLTSYNNS-FVNLTFPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI + + QI++ + +N +
Sbjct  140   NIQNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMSKNQA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY AN  FP DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL   G+
Sbjct  200   PFTVNIYPFLSLY-ANEHFPMDFAFFDGTPNPVLDNGVEYTNVFDANFDTLYSALKAVGY  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ AN + A +FY G    LAS +GTP RPG  +EVY+FGL DE
Sbjct  259   GHMAILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF +D+SG G+ K L     ++YLP +WC +  NAK 
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQPKFPMDISGQGQDKHLVAAKNVQYLPNRWCMLNPNAKD  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I YAC  +DCT+   GSSC++L      SY FN Y+Q   Q   SCDF GL  
Sbjct  378   LSKLANNIDYACTFSDCTSLGFGSSCNNLDAIGNASYAFNMYYQVQNQLDLSCDFEGLAM  437

Query  1437  VTTTNLSTSTCNFNI  1481
             VT  NLS  TCNF I
Sbjct  438   VTNKNLSQGTCNFII  452



>ref|XP_003619009.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=449

 Score =   466 bits (1199),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 233/435 (54%), Positives = 301/435 (69%), Gaps = 8/435 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++HPL P +VV+MLK NGI+KVKLF++ E  ++AL G+GIEVM+  PN 
Sbjct  15    VEGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNN  74

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM +YD A  +V++NVTRY   S  GV I  V +GNEPFLK Y    L  VT+PAL 
Sbjct  75    QLAEMSDYDRALQWVRKNVTRYNFKS-GGVNIKYVAVGNEPFLKAYNNSFL-NVTFPALM  132

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSP-PDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
             N+Q ALN+ G+G + KATVP NADVY SP  +  VPSAG+FRPD+ + + QI++ L +N+
Sbjct  133   NIQNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNN  192

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  N +FPFD+AFFDGV  P++DNG  YTNVFDAN+DT V+AL   G
Sbjct  193   APFTVNIYPFLSLY-GNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIG  251

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G M + VGE+GWPTDG++ AN   A +FY G +  LAS KGTP R G  +EVY+FGL D
Sbjct  252   FGNMPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQG-YIEVYLFGLID  310

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG--GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             ED KS+ PG+FERHWGI  +DG+PKF + +S   G+ K L G  ++ YL  KWC    NA
Sbjct  311   EDAKSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNA  370

Query  1254  -KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                +N+   I+YAC  ADCT    GSSC++L      SY FN Y+Q   Q   +C+F GL
Sbjct  371   NNLSNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEGL  430

Query  1431  GEVTTTNLSTSTCNF  1475
               +TT N+ST TC F
Sbjct  431   AMLTTNNISTPTCVF  445



>ref|XP_008465328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=479

 Score =   467 bits (1201),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 304/445 (68%), Gaps = 11/445 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             GV G  ++GLGVNWG +++H LPPK+VV+MLK NGI+KVKLF++ +  + ALAGTGIEVM
Sbjct  14    GVLGSCVEGLGVNWGTMANHRLPPKTVVQMLKDNGIQKVKLFDADQSSMGALAGTGIEVM  73

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  L  M +Y+ A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  V
Sbjct  74    VAIPNDQLSAMGDYNRAKQWVQRNVTRY--IFDGGVTIKYVAVGNEPFLSSYNGSFL-NV  130

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+Q ALNEAG G + KATVP NADVY SP + P PSAG FR DI + +  I++ 
Sbjct  131   TFPALQNIQNALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRSDINQLMNDIVQF  190

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L++N +PF +N+YPFLSLY  N +FPFD+AFFDG   P+ D   G  YTNVFDAN+DT V
Sbjct  191   LNKNKAPFTVNIYPFLSLY-GNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLV  249

Query  879   AALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEV  1058
             ++L   G G M + VGE+GWPTDG++ AN   A +FY G +  LA+ KGTP RPG  +EV
Sbjct  250   SSLKAVGLGDMPILVGEVGWPTDGDKNANDGNAYRFYNGLLPRLAANKGTPLRPG-FIEV  308

Query  1059  YMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWC  1235
             Y+F   DE+ KS+ PG+FERHWGI GYDGQPKF +DLSG G+ K L G   +EYLP+KWC
Sbjct  309   YLFSFLDENGKSIAPGNFERHWGIFGYDGQPKFGMDLSGQGQNKLLVGAQNVEYLPQKWC  368

Query  1236  TVKSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGS  1412
                 NAK  + +   I YAC  +DCT+   GSSC++L      SY FN YFQ   Q+  +
Sbjct  369   MFNPNAKDLSKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDELA  428

Query  1413  CDFGGLGEVTTTNLSTSTCNFNIGI  1487
             C+F GL  +T+ NLS  TCNF I +
Sbjct  429   CNFQGLATITSRNLSQGTCNFIIQL  453



>gb|AIR93903.1| glucanase [Cicer arietinum]
Length=480

 Score =   466 bits (1199),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 232/438 (53%), Positives = 300/438 (68%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  ++HPL   +VV+MLK NGI+KVKLF++ +  ++AL G+GIEVM+  PN 
Sbjct  23    VEGVGVNWGTQATHPLKADTVVEMLKDNGIQKVKLFDTDDATMSALGGSGIEVMVAIPNN  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM NYD A  +V++NVTR+  T   GV I  V +GNEPFLK Y    L  VT+PAL 
Sbjct  83    QLAEMNNYDRALQWVRKNVTRF--TFKGGVNIKYVAVGNEPFLKSYNNT-LLNVTFPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNE G+G + KATVP NAD+Y SP +  VPSAG+FRPD+   + QII+ L++N++
Sbjct  140   NIQNALNEVGLGDSIKATVPLNADIYESPIENSVPSAGIFRPDLIGLMTQIIQFLNKNNA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N +FPFDFAFFDG   P++DNG  YTNVFDAN+DT V+AL   G 
Sbjct  200   PFTVNIYPFLSLY-GNENFPFDFAFFDGNSNPINDNGILYTNVFDANFDTLVSALKSIGF  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ AN   A +FY G  + +AS KGTP RPG  +E+Y+FGL DE
Sbjct  259   GDMPIFVGEVGWPTDGDKNANIENALRFYNGLFQKIASNKGTPKRPG-YIEIYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-K  1256
             D K++ PG+FERHWGI  +DG+PKF + +S  G+ K L G   + YL  KWC    N+  
Sbjct  318   DAKAIAPGNFERHWGIFSFDGKPKFPMHISSQGQNKLLIGAKNVYYLDPKWCIFNPNSNN  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T +   I YAC  ADCT    GSSC++L      SY FN Y+Q   Q   +C+F GL  
Sbjct  378   LTKLAENIDYACTYADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQVDMACNFEGLAM  437

Query  1437  VTTTNLSTSTCNFNIGIK  1490
             VTT N+ST TCNF I I 
Sbjct  438   VTTKNISTPTCNFIIEIN  455



>gb|AAD38251.1|AC006193_7 Similar to glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
Length=450

 Score =   464 bits (1194),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/427 (55%), Positives = 294/427 (69%), Gaps = 8/427 (2%)
 Frame = +3

Query  213   ISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMVNYDV  392
             +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN  LK M +YD 
Sbjct  1     MATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQLKVMTSYDR  60

Query  393   AEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEAG  572
             A+ +V++NVTRY      GV IT V +GNEPFLK Y       +T+PALAN+Q ALNEAG
Sbjct  61    AKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALANIQNALNEAG  117

Query  573   IGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFL  752
             +G + KATVP NADVY SP   PVPSAG FRPDI  Q+ QI+  L +N++P  IN+YPFL
Sbjct  118   LGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPITINIYPFL  177

Query  753   SLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGEI  932
             SLY  N  FP ++AFFDG + P++DNG  YTNVFDAN+DT V++L   GHG M + VGE+
Sbjct  178   SLY-GNDDFPLNYAFFDGAE-PINDNGIDYTNVFDANFDTLVSSLKAVGHGDMPIIVGEV  235

Query  933   GWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGDF  1112
             GWPT+G++ ANA  A +FY G +  L + KGTP RP + +EVY+FGL DED KS+ PG F
Sbjct  236   GWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDEDAKSIAPGPF  294

Query  1113  ERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTNMKATISY  1286
             ERHWGI  +DGQPKF +DLSG G+ K L G   + YLP KWCT    AK  T + A I Y
Sbjct  295   ERHWGIFKFDGQPKFPIDLSGQGQSKFLIGAQNVPYLPNKWCTFNPEAKDLTKLAANIDY  354

Query  1287  ACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTST  1466
             AC  +DCTA   GSSC++L      SY FN +FQ   Q+  +C F GL  +TT N+S   
Sbjct  355   ACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLATITTQNISQGQ  414

Query  1467  CNFNIGI  1487
             CNF I I
Sbjct  415   CNFPIQI  421



>ref|NP_187051.3| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF05860.1|AC011698_11 putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABJ98575.1| At3g04010 [Arabidopsis thaliana]
 gb|AEE74025.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=491

 Score =   466 bits (1198),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/439 (53%), Positives = 297/439 (68%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+ GLGVNWG ++SH LPPK+VV+MLK N I+KVKLF++  + + ALAG+G+EVM+  PN
Sbjct  29    GVSGLGVNWGTMASHQLPPKTVVEMLKDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LL  M NY  A+ +V+ NV+R+     +GVKI  V +GNEPFL  Y       +TYPAL
Sbjct  89    DLLLAMGNYQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G  TKATVP NADVY SPPD  VPSAG FR DI +++ QI+  L +N 
Sbjct  146   FNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY ++  FPF++AFFDG    ++DNG  YTNVFDA++DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-DFPFEYAFFDG-QNTVNDNGVIYTNVFDASFDTLLASLNALN  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN   A +FY G +  LA+  GTP R G  +EVY+FG  D
Sbjct  264   HGNMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPMRKG-YIEVYLFGFID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGI  +DGQPKF +D  G G+ K LTG   ++Y   +WC    N +
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQKKFLTGAQNVQYFLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                + +   I+YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNMSRLGDNINYACSHSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  443   ATITTQNISQGQCNFPIQI  461



>ref|XP_004141142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 ref|XP_004171752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN59764.1| hypothetical protein Csa_3G843830 [Cucumis sativus]
Length=479

 Score =   465 bits (1196),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 237/445 (53%), Positives = 303/445 (68%), Gaps = 11/445 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             GV G  ++GLGVNWG +++H LPPK+VV+M K NGI+KVKLF++ +  + ALAGTGIEVM
Sbjct  14    GVLGSCVEGLGVNWGTMANHRLPPKTVVQMFKDNGIQKVKLFDADQSSMGALAGTGIEVM  73

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  L  M +Y+ A+ +V+ NVTRY  T   GV I  V +GNEPFL  Y    L  V
Sbjct  74    VAIPNDQLSAMGDYNRAKQWVQRNVTRY--TFDGGVTIKYVAVGNEPFLSSYNGSFL-NV  130

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+Q ALNEAG G + KATVP NADVY SP + P PSAG FR DI + +  I++ 
Sbjct  131   TFPALLNIQNALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRNDINQLMTDIVQF  190

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L++N +PF +N+YPFLSLY  N +FPFD+AFFDG   P+ D   G  YTNVFDAN+DT V
Sbjct  191   LNKNKAPFTVNIYPFLSLY-GNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLV  249

Query  879   AALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEV  1058
             ++L   G G M + VGE+GWPTDG++  N   A +FY G +  LA+ KGTP RPG  +EV
Sbjct  250   SSLKAVGLGDMPILVGEVGWPTDGDKNGNVGNAYRFYNGLLPRLAANKGTPLRPG-FIEV  308

Query  1059  YMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWC  1235
             Y+F   DE+ KS+ PG+FERHWGI GYDGQPKF +DLSG G+ K L G   ++YLP+KWC
Sbjct  309   YLFSFLDENGKSIAPGNFERHWGIFGYDGQPKFGMDLSGQGQNKLLVGAQNVQYLPQKWC  368

Query  1236  TVKSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGS  1412
                 NAK  + +   I YAC  +DCT+   GSSC++L      SY FN YFQ   Q+  +
Sbjct  369   MFNPNAKDLSKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDELA  428

Query  1413  CDFGGLGEVTTTNLSTSTCNFNIGI  1487
             C+F GL  VT+ NLS  TCNF I +
Sbjct  429   CNFQGLATVTSQNLSQGTCNFIIQL  453



>ref|NP_001057968.1| Os06g0590600 [Oryza sativa Japonica Group]
 dbj|BAD32917.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF19882.1| Os06g0590600 [Oryza sativa Japonica Group]
 gb|EAZ01513.1| hypothetical protein OsI_23546 [Oryza sativa Indica Group]
Length=483

 Score =   464 bits (1195),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 238/434 (55%), Positives = 298/434 (69%), Gaps = 11/434 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL PKSVV+MLK NGI KVKLF++    + AL  +GIEVM+G PN +L+
Sbjct  33    VGVNWGSQLSHPLLPKSVVQMLKENGILKVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  92

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  A+ +VKENVT Y     D +KI  V +GNEPFLK Y      K T+PAL N+Q
Sbjct  93    TMNSYGNAQDWVKENVTSYG----DKLKIKYVAVGNEPFLKAYNGS-FMKTTFPALKNIQ  147

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KALNEAG+G   KATVP NADVY+SP +KP  S+G FRPDIQ  +  ++K L E+ SPF+
Sbjct  148   KALNEAGVGDKVKATVPLNADVYVSPDNKP--SSGAFRPDIQGLMTDMVKFLHEHGSPFV  205

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++  FPF+FAF DG     D  G +Y+NVFDANYDT V AL + G   +
Sbjct  206   VNIYPFLSLYQSD-DFPFEFAFVDGGKTIQDKGGISYSNVFDANYDTLVTALKKAGVPSL  264

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGE+GWPTDG++ AN  LA ++Y G +K L+ K+GTP RPG  ++VYMFGLFDED K
Sbjct  265   KVVVGEVGWPTDGDKNANLKLARRYYDGLLKKLSKKEGTPLRPGK-MDVYMFGLFDEDMK  323

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTN  1265
             S+LPG+FERHWGI  YDG+PKF +DLSG G  K L GVP +EYLPK+WC     A+  + 
Sbjct  324   SILPGNFERHWGIFTYDGKPKFPMDLSGHGNDKPLAGVPGVEYLPKQWCVFDDGAEDKSK  383

Query  1266  MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTT  1445
             +   I YAC   DCTA   G SC+ L E   +SY FN YFQ  +Q+  +CDF GL ++TT
Sbjct  384   LPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKITT  443

Query  1446  TNLSTSTCNFNIGI  1487
              N S   C F I I
Sbjct  444   KNASARGCAFPIQI  457



>ref|XP_009412333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   463 bits (1191),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 226/427 (53%), Positives = 289/427 (68%), Gaps = 6/427 (1%)
 Frame = +3

Query  213   ISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMVNYDV  392
             +++H LPPK++ ++L+ NGIKKVK+F++    ++ALAGTGIEVMI  PN +L +M +YD 
Sbjct  1     MATHRLPPKTIAQLLQDNGIKKVKIFDADPSSMSALAGTGIEVMIAIPNDMLAKMNDYDA  60

Query  393   AEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEAG  572
             A+ +VK+NVTRY     DGV I  V +GNEPFLK Y       +T+PAL N+Q ALNEAG
Sbjct  61    AKQWVKKNVTRYNFN--DGVDIKYVAVGNEPFLKSYNDS-FTNITFPALKNIQNALNEAG  117

Query  573   IGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFL  752
             IG   KATVP NADVY SP   PVPSAG FR DI+  + QI++    N +PF +N+YPFL
Sbjct  118   IGDAIKATVPLNADVYDSPASNPVPSAGDFRADIRDLMAQIVEFFSLNGAPFTVNIYPFL  177

Query  753   SLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGEI  932
             SLY  N  FP DFAFFDG   P+ DNG  YTNVFDAN+DT V+AL + G G + + VGE+
Sbjct  178   SLY-GNSDFPIDFAFFDGTSAPVVDNGVAYTNVFDANFDTLVSALRKAGFGDLPIVVGEV  236

Query  933   GWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGDF  1112
             GWPTDG+  AN ++A +F+GG +K LA+K GTP RP   ++VY+FGL DED KSV PG+F
Sbjct  237   GWPTDGDVNANVAMAERFFGGLLKRLAAKSGTPLRPNMEMQVYLFGLVDEDAKSVAPGNF  296

Query  1113  ERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFTNMKATISY  1286
             ERHWG+  YDG+PKF +D SG G+     G   ++YLP +WC +   A     +   +++
Sbjct  297   ERHWGLFTYDGRPKFAVDFSGQGQNGMPVGAKGVQYLPTRWCALNPAATDLGKLADNVNF  356

Query  1287  ACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTST  1466
             AC  ADCTA   G SC +L    K SY FNAYFQ   Q   SC F GL  VTT N+S  +
Sbjct  357   ACTYADCTALGGGCSCDALDASGKASYAFNAYFQAQSQNGESCYFQGLAMVTTQNISQGS  416

Query  1467  CNFNIGI  1487
             CNF I I
Sbjct  417   CNFTIQI  423



>ref|XP_002459388.1| hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
 gb|EER95909.1| hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
Length=490

 Score =   464 bits (1195),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 234/437 (54%), Positives = 297/437 (68%), Gaps = 9/437 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LG+NWG  ++HPLPPK+VV++L+ NGIKKVKLF++    ++ALAGTGIEVM+  PN +L 
Sbjct  29    LGMNWGTQATHPLPPKAVVQVLQDNGIKKVKLFDTDPAAMSALAGTGIEVMVAIPNNMLA  88

Query  372   EMVNYDVAEA--FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             ++ + D  +A  +VK NV RY      GV I  V +GNEPFL+ Y       VT+PAL N
Sbjct  89    DLAD-DAGKAKDWVKRNVRRYDFDG--GVTIKYVAVGNEPFLESYNGS-FINVTFPALEN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALN AGIG   KATVP NADVY SP +  VPSAG FR DI   +  ++K L +N++P
Sbjct  145   IQNALNNAGIGDRIKATVPLNADVYNSPKNNQVPSAGRFRADIAGLMTDMVKFLAKNNAP  204

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N +FP D+AFFDG   P++DNG  YTNVFDAN+DT VAAL   GHG
Sbjct  205   FTVNIYPFLSLYL-NDNFPLDYAFFDGGATPVNDNGVLYTNVFDANFDTLVAALKAVGHG  263

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPTDG++ A AS A +FY G +K LA+  GTPARP    EVY+FGL DED
Sbjct  264   DLPIVVGEVGWPTDGDKHAKASYAERFYAGLLKRLAANTGTPARPNQYTEVYLFGLVDED  323

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KSV PG FERHWG+L YDGQPKF +DL+G G+   L     ++YLP+ WC +  NAK  
Sbjct  324   AKSVAPGSFERHWGVLRYDGQPKFAMDLAGQGRNTMLVPAKGVKYLPRAWCALNPNAKDL  383

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               + A I YAC  ADCT    GS+C+ +      SY FNAY+Q   Q+  +CDF GL   
Sbjct  384   GKLGANIDYACTFADCTPLGYGSTCNGMDVAGNASYAFNAYYQVQNQKDEACDFQGLALP  443

Query  1440  TTTNLSTSTCNFNIGIK  1490
             T T+ ST+TCNF I I+
Sbjct  444   TETDPSTATCNFTIQIQ  460



>ref|XP_010553811.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=488

 Score =   464 bits (1193),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 235/437 (54%), Positives = 295/437 (68%), Gaps = 9/437 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM+  PN 
Sbjct  27    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMKALAGSGMEVMVAIPND  86

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L+ M +YD A+ +V+ NV+RY      GV IT V +GNEPFLK Y       +T+PAL 
Sbjct  87    QLRVMGSYDRAKEWVQRNVSRYNFNG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALQ  143

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SP   PVPS G FRPDI  Q+ QI+  L +N++
Sbjct  144   NIQNALNEAGLGN-VKATVPLNADVYDSPASNPVPSTGRFRPDILGQMTQIVDFLGKNNA  202

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF IN+YPFLSLY  N  FPF++AFFDG   P+ DNG  Y NVFDAN+DT V+AL   GH
Sbjct  203   PFTINIYPFLSLY-GNDDFPFNYAFFDGA-TPIIDNGIEYNNVFDANFDTLVSALKAAGH  260

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPT+G++ AN   A +FY G +  LA+ +GTP R G  +EVY+FGL DE
Sbjct  261   GDMPIIVGEVGWPTEGDKNANNGNAFRFYNGLLPRLAANRGTPLRQGY-IEVYLFGLLDE  319

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  +DGQPKF LDLSG G+ K L G   + YLP KWC     AK 
Sbjct  320   DAKSIAPGNFERHWGIFRFDGQPKFPLDLSGQGQNKLLIGAQNVTYLPSKWCQFNPQAKD  379

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I +AC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +C F GL  
Sbjct  380   ISKLADNIDFACTYSDCTALEYGSSCNGLDVNGNASYAFNMYFQVKNQDEDACFFQGLAA  439

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S   CNF I I
Sbjct  440   ITTVNISQGQCNFPIQI  456



>gb|EAZ37505.1| hypothetical protein OsJ_21839 [Oryza sativa Japonica Group]
Length=483

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 237/434 (55%), Positives = 298/434 (69%), Gaps = 11/434 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL PKSVV+MLK NGI KVKLF++    + AL  +GIEVM+G PN +L+
Sbjct  33    VGVNWGSQLSHPLLPKSVVQMLKENGILKVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  92

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  A+ +VKENVT Y     D +KI  V +GNEPFLK Y      K T+PAL N+Q
Sbjct  93    TMNSYGNAQDWVKENVTSYG----DKLKIKYVAVGNEPFLKAYNGS-FMKTTFPALKNIQ  147

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KALNEAG+G   KATVP NADVY+SP +KP  S+G FRPDIQ  +  ++K L E+ SPF+
Sbjct  148   KALNEAGVGDKVKATVPLNADVYVSPDNKP--SSGAFRPDIQGLMTDMVKFLHEHGSPFV  205

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++  FPF+FAF DG     D  G +Y+NVFDANYDT V AL + G   +
Sbjct  206   VNIYPFLSLYQSD-DFPFEFAFVDGGKTIQDKGGISYSNVFDANYDTLVTALKKAGVPSL  264

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGE+GWPTDG++ AN  LA ++Y G +K L+ K+GTP RPG  ++VYMFGLFDED K
Sbjct  265   KVVVGEVGWPTDGDKNANLKLARRYYDGLLKKLSKKEGTPLRPGK-MDVYMFGLFDEDMK  323

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTN  1265
             S+LPG+FERHWGI  YDG+PKF +DLSG G  K L GVP +EYLPK+WC     A+  + 
Sbjct  324   SILPGNFERHWGIFTYDGKPKFPMDLSGHGNDKPLAGVPGVEYLPKQWCVFDDGAEDKSK  383

Query  1266  MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTT  1445
             +   I YAC   DCTA   G SC+ L E   +SY FN Y+Q  +Q+  +CDF GL ++TT
Sbjct  384   LPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYYQMQDQDVRACDFDGLAKITT  443

Query  1446  TNLSTSTCNFNIGI  1487
              N S   C F I I
Sbjct  444   KNASARGCAFPIQI  457



>ref|XP_006837787.1| hypothetical protein AMTR_s00104p00085600 [Amborella trichopoda]
 gb|ERN00356.1| hypothetical protein AMTR_s00104p00085600 [Amborella trichopoda]
Length=479

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 230/437 (53%), Positives = 301/437 (69%), Gaps = 8/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG++++HPL P  VV+MLK NGIKKVKLF++    L++L G+GIEV +  PN +
Sbjct  21    EGLGVNWGNMATHPLKPDIVVQMLKDNGIKKVKLFDADAWTLSSLVGSGIEVTVAIPNDM  80

Query  366   LKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             L  M   Y+ A+ +VK+NVTRY      GV I  V +GNEPFL  Y      K T+PAL 
Sbjct  81    LGRMAGKYEHAKEWVKKNVTRYNYEG--GVNIKYVAVGNEPFLTSYNGS-FMKSTFPALQ  137

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+QKALNEAGIG   KAT+P NADVY SP D P+PS+G FR DI+  +K+I+  L+E++S
Sbjct  138   NIQKALNEAGIGDKIKATIPLNADVYNSPSDDPMPSSGDFRADIRSLMKEIVHFLNEHNS  197

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PFM+N+YPFLSLY  N +FP DFAFFDG  KPL+D G +Y NVFDAN+DT V +L + G 
Sbjct  198   PFMVNIYPFLSLY-QNKNFPVDFAFFDGGSKPLNDKGLSYLNVFDANFDTLVWSLRKAGV  256

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
               M + VGE+GWPTDG++  N  LA +FY G IK+LA+ KGTP +PG  +E Y+F L DE
Sbjct  257   PNMNIAVGEVGWPTDGDKNGNVMLAKRFYNGLIKNLANNKGTPLKPGH-IETYLFSLLDE  315

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVK-SNAK  1256
             D KS+LPGDFERHWGI  +DG+PKF++DLSG G+ K L G   +EY+P++WC +K  +  
Sbjct  316   DAKSILPGDFERHWGIFRFDGKPKFEMDLSGEGREKQLVGAKNVEYMPRQWCVMKPGHVD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +   + YAC  +DCT+     SC  L     +SY FN YFQT +Q+  +C+F GL  
Sbjct  376   VAKVANNVDYACSLSDCTSLGFERSCGYLDLKGNVSYAFNMYFQTQDQDVQACNFQGLAM  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N +  TC F I I
Sbjct  436   ITTKNPAHDTCLFPIQI  452



>ref|XP_010467891.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=477

 Score =   463 bits (1191),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 300/443 (68%), Gaps = 10/443 (2%)
 Frame = +3

Query  171   GVAGL--DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             G+ G+  DGLGVNWG +++H L PK+VV++LK N I KVKLF++ E  + ALAG+G+EVM
Sbjct  12    GIMGIVVDGLGVNWGTMATHKLSPKTVVQLLKDNNINKVKLFDADETTMGALAGSGLEVM  71

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  LK M +YD A+ +V+ NVTRY      GV IT V +GNEPFLK Y      K+
Sbjct  72    VAIPNDQLKVMGSYDRAKDWVRHNVTRYNFDG--GVNITSVAVGNEPFLKSYNGS-FIKL  128

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FRPDI   + QI+  
Sbjct  129   TFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGPMTQIVDF  188

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L  N +P  IN+YPFLSLY  N  FP ++AFFDG   P+DDNG  YTNVFDAN+DT V++
Sbjct  189   LGNNSAPIAINIYPFLSLY-GNDDFPLNYAFFDGA-PPIDDNGIAYTNVFDANFDTLVSS  246

Query  885   LAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYM  1064
             L   GHG M + VGE+GWPT+G++ AN+  A +FY G +  L +KKGTP RP + +EVY+
Sbjct  247   LKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTKKGTPLRP-TYIEVYL  305

Query  1065  FGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV  1241
             FGL DE+ KS+ PG FERHWG+  +DGQPKF +DLSG G+ K L G   + YL  KWC  
Sbjct  306   FGLLDENAKSIAPGPFERHWGLFKFDGQPKFPIDLSGQGQNKLLIGAQNVTYLSSKWCMF  365

Query  1242  KSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
               ++K  T +   I++AC  +DCTA   GSSC+SL      SY FN YFQ   Q+  +C 
Sbjct  366   NPDSKDLTKLADNINFACTYSDCTALGYGSSCNSLDANGNASYAFNMYFQEKNQDEYACV  425

Query  1419  FGGLGEVTTTNLSTSTCNFNIGI  1487
             F G+  +TT N+S   CNF I I
Sbjct  426   FQGMATITTQNISQGQCNFPIQI  448



>ref|XP_008240488.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=485

 Score =   463 bits (1192),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 236/439 (54%), Positives = 296/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPP++VV+MLK NGI+KVKLF++ E  ++ALAG+G+EVM+  PN 
Sbjct  26    VEGLGVNWGTMATHELPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPND  85

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M  Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT+PAL 
Sbjct  86    QLAVMATYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTFPALQ  142

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP   PVPSAG FR DI   +  I++ L +N +
Sbjct  143   NIQNALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRSDISPLMIAIVQFLAKNKA  202

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALARE  896
             PF IN+YPFLSLY  N  FPF++AFFDG   P+ D   G  YTNVFDAN+DT V++L   
Sbjct  203   PFTINIYPFLSLY-GNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAV  261

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G G MT+ VGE+GWPTDG++ AN   A +FY G +  L + +GTP RPG  +EVY+FGL 
Sbjct  262   GFGDMTIVVGEVGWPTDGDKNANTGNAYRFYNGLLPKLGTNRGTPLRPGY-IEVYLFGLI  320

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG FERHWGI  YDGQPKF +DLSG G+ K L     ++YL KKWC    NA
Sbjct  321   DEDAKSIAPGSFERHWGIFRYDGQPKFLVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNA  380

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  T +   I+YAC  ADCTA   GSSC++L      SY FN Y+Q   Q+  SC+F GL
Sbjct  381   KDVTKLADNINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEGL  440

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  441   ATMTTQNISQGNCNFIIQI  459



>ref|XP_002873877.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50136.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 303/441 (69%), Gaps = 14/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK+VV+MLK N ++KVKLF++  + + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVRKVKLFDADTNTMVALAGSGIEVMVAIPND  88

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              LK M +Y+ A+ +V+ N+TR+     D VKI  V +GNEPFL  Y    L  +TYPAL 
Sbjct  89    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGSFL-NLTYPALF  143

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+QKALNEAG+G   KATVP NADVY SP + PVPSAG FR DI +++K I+  L  N +
Sbjct  144   NIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGSFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFF+G    + DNG  YTNVFDAN+DT +A+L   GH
Sbjct  204   PFTVNIYPFLSLYLSS-DFPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLKALGH  261

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M+V VGE+GWPTDG++ AN   A +FY G +  LA+ +GTP RPG  +EVY+FG  DE
Sbjct  262   GDMSVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANRGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-K  1256
             D KS+ PG+FERHWGI  YDGQPKF  DLSG G+ K LTG   ++YL  +WC +  +   
Sbjct  321   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQKKILTGAQNVQYLQNQWCMLNPDGLT  380

Query  1257  FTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             F+N    +   ++YAC  +DCTA   GSSC +L E    SY FN YFQ   Q+A +CDF 
Sbjct  381   FSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDFE  440

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  +TT N+S   CNF I I
Sbjct  441   GLAIITTRNISREQCNFPIQI  461



>ref|XP_010672074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   462 bits (1190),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/438 (53%), Positives = 297/438 (68%), Gaps = 9/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  + H LPP +VV+MLK NGI+KVKLF++ E  L+A +GT IEVM+  PN 
Sbjct  31    VEGLGVNWGTQAIHKLPPSTVVQMLKDNGIQKVKLFDADESTLSAFSGTNIEVMVAIPNG  90

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VTYPAL  539
              L  M++YD A  +V++NVTRY      GV I  V +GNEPFLK Y   G F+  T+PAL
Sbjct  91    DLVAMLDYDRARKWVEKNVTRYNFKG--GVNIKYVAVGNEPFLKAY--NGTFENATFPAL  146

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G T KATVP NADVY SP   PVPSAG FRPD+   + Q+++ L +N+
Sbjct  147   KNIQNALNEAGVGNTVKATVPLNADVYESPEGTPVPSAGRFRPDVADLMTQMVQFLSQNN  206

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  N  FP D+AFFDG   P+ DNG  YTNVFDAN+DT V+AL   G
Sbjct  207   APFSVNIYPFLSLY-GNPGFPVDYAFFDGGAAPIADNGIEYTNVFDANFDTLVSALKAAG  265

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +G + + VGE+GWPT+G+  AN + A +FY G +  +A+  GTP RPG+ +E+Y+FGL D
Sbjct  266   YGDLPIIVGEVGWPTNGDVNANINNAIRFYRGLLPRIAANTGTPLRPGN-IEMYLFGLLD  324

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED K+V PG+FERHWGI  YDGQPKF +DL+G  +   L G  ++ YL  +WC    NAK
Sbjct  325   EDAKTVAPGNFERHWGIFRYDGQPKFPMDLTGQNRDVYLVGAKDVTYLQNQWCEFNPNAK  384

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +   I +AC  ADCT    GSSCH +     +SY FN YFQT  Q   +C+F GL 
Sbjct  385   DVSKLAENIDFACTFADCTPLGYGSSCHGMDANGNISYAFNVYFQTQNQNLEACNFQGLA  444

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              +T  N+S  TCNF I I
Sbjct  445   RLTLQNISAPTCNFTIQI  462



>ref|XP_010485770.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   462 bits (1190),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 295/438 (67%), Gaps = 9/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + GLGVNWG +++H LPPK+VV+M + N I+KVKLF++  + + ALAG+G+EVM+  PN 
Sbjct  30    VSGLGVNWGTMATHQLPPKTVVEMFRDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPND  89

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK M N+  A+ +V+ NV+R+     +GVKI  V +GNEPFL  Y       +TYPAL 
Sbjct  90    LLKAMGNFQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  146

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SPPD  VPSAG FR DI +++ QI+  L +N +
Sbjct  147   NIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNKA  206

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFFDG    ++DNG  YTNVFDA++DT VA+L    H
Sbjct  207   PFTVNIYPFLSLYLSS-DFPFDYAFFDG-QNTVNDNGVIYTNVFDASFDTLVASLNALNH  264

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M V VGE+GWPTDG++ AN   A +FY G +  L +  GTP R G  +EVY+FG  DE
Sbjct  265   GDMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPRLTNNVGTPMRKG-YIEVYLFGFIDE  323

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG+FERHWGI  +DGQPKF  D  G G+ K LTG   ++Y+  +WC    NA+ 
Sbjct  324   DAKSVAPGNFERHWGIFKFDGQPKFPFDFRGQGQKKFLTGARNVQYMLNQWCMFNPNARG  383

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +   I YAC  +DCTA  +GSSC +L      SY FN YFQ   QEA +CDF GL 
Sbjct  384   NMSKLGDNIDYACSLSDCTALGSGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGLA  443

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              +TT N+S   CNF I I
Sbjct  444   TITTRNISQGQCNFPIQI  461



>ref|XP_002319699.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE95622.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=478

 Score =   461 bits (1187),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 232/439 (53%), Positives = 292/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + GLGVNWG ++   L P++VV+MLK NGI KVKLF++ +  + ALAG+GIEVM+  PN 
Sbjct  20    VHGLGVNWGTMAIRKLSPETVVQMLKDNGILKVKLFDADQTTMTALAGSGIEVMVAIPND  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +Y+ A+ +VK NVTRY      G+ I  V +GNEPFL  Y    L   T+PAL 
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYNFNG--GITIKYVAVGNEPFLTSYNGSFL-NTTFPALR  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G + KATVP NADVY SP D+  PS+G FR DI   + QI++ L +N +
Sbjct  137   NIQNALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY  N  FPFD+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSLY-GNDDFPFDYAFFDGAPQPVVDKGTGIQYTNVFDANFDTLVSALKAA  255

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             GHG M + VGE+GWPTDG++ AN   A +FY G I  L   +GTP RPG  +EVY+FGL 
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANIGYATRFYNGLIPRLVGNRGTPLRPGY-IEVYLFGLL  314

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG+FERHWGI  YDGQPKF LDLSG  + K L G   ++YLP KWC    NA
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLAGARNVQYLPAKWCMFNPNA  374

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  + +   I YAC R+DCTA   GSSC+SL      SY FN Y+Q   Q+  +C+F GL
Sbjct  375   KDLSKLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEGL  434

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +T  N+S   CNF I I
Sbjct  435   ATLTNQNISQGNCNFIIQI  453



>ref|XP_006408232.1| hypothetical protein EUTSA_v10020592mg [Eutrema salsugineum]
 gb|ESQ49685.1| hypothetical protein EUTSA_v10020592mg [Eutrema salsugineum]
Length=493

 Score =   461 bits (1187),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 232/439 (53%), Positives = 295/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+  LGVNWG ++SH LPPK+VV+MLK N IKKVKLF++  + + ALAG+GIEVM+  PN
Sbjct  29    GVSALGVNWGTMASHQLPPKTVVQMLKDNNIKKVKLFDADTNTMGALAGSGIEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LLK M +Y  A+ +V+ NVTR+     +GVKI  V +GNEPFL  Y    +  +TYPAL
Sbjct  89    DLLKAMGSYQRAKDWVQRNVTRFNFN--NGVKIKYVAVGNEPFLTAYNGSYI-NLTYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALN+AGIG   KATVP NADVY SPPD  VPSAG FR DI +++  I+  L +N 
Sbjct  146   VNIQTALNDAGIGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTLIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY ++  FPFD+AFFDG    ++DNG  YTNV DAN+DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-DFPFDYAFFDG-QNTINDNGVIYTNVLDANFDTLLASLNALN  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN   A +FY G +  LA+  GTP R  S +EVY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPMRK-SYIEVYLFGFID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWG+  +DGQPKF +D  G G+ + LTG   ++YL  +WC    N +
Sbjct  323   EDAKSVAPGNFERHWGLFKFDGQPKFPVDFQGQGQKRFLTGAQNVQYLLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                + +   I YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNISKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  443   ATITTRNISQGQCNFPIQI  461



>gb|ACG29689.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=485

 Score =   461 bits (1186),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/438 (54%), Positives = 291/438 (66%), Gaps = 10/438 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG  ++HPLPPK+VV++L+ NGIKKVKLF++    + ALAGTGIEVM+  PNA+L 
Sbjct  21    LGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAMLA  80

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              +  +   A  +VK NV RY      GV I  V +GNEPFL+ Y       VT PAL N+
Sbjct  81    GLAADAGQARDWVKRNVRRYDFDG--GVTIKYVAVGNEPFLESYNGS-FINVTLPALQNV  137

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q ALN+AGIG   KATVP NADVY SP   PVPSAG FR DI   +  +++ L  N +PF
Sbjct  138   QNALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPF  197

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP D+AFFDG   P+DD+G  YTNVFDAN+DT VAAL   GHG 
Sbjct  198   TVNIYPFLSLYL-NEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGD  256

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSA-LEVYMFGLFDED  1085
             M V VGE+GWPTDG+  A AS A +FY G ++ LA+  GTPARPG    EVY+FGL DED
Sbjct  257   MPVVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANAGTPARPGQRPAEVYLFGLVDED  316

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNAK-  1256
              KSV PG+FERHWG+L YDGQPKF +DL+ G+G+  T VP   + YL + WC +   AK 
Sbjct  317   AKSVAPGNFERHWGVLRYDGQPKFAMDLT-GQGRDTTLVPARGVAYLSRTWCALNPRAKD  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                + A + YAC  ADCT    GS+C  +      SY FNAY+Q   Q+  +CDF GL  
Sbjct  376   LGRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLAL  435

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              T T+ ST+TCNF I I+
Sbjct  436   PTETDPSTATCNFTIQIQ  453



>ref|XP_009418954.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 289/437 (66%), Gaps = 7/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++HPLPPK VV++LK NGI+KVK+F++    +NALAG+GIEVM+  PN +
Sbjct  21    DGLGVNWGTMATHPLPPKIVVQLLKDNGIRKVKIFDADAATMNALAGSGIEVMVAIPNNM  80

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L  M++Y+ A+ +V +NVTRY      GV I  V +GNEPFL  Y    L  +T PAL N
Sbjct  81    LGYMIDYETAKKWVNQNVTRYNFQG--GVNIKYVAVGNEPFLTTYNGSFL-NLTLPALQN  137

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALN AGIG T KATVP NADVY SP   PVPSAG FR DI   + +I+  L+++ +P
Sbjct  138   VQTALNNAGIGDTIKATVPLNADVYNSPVSNPVPSAGRFRADINDLMTEIVMFLNQSGAP  197

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N +FP D+AFFDG   P+ DNG  YTNVFDAN+DT V+AL   G G
Sbjct  198   FTVNIYPFLSLY-DNPNFPVDYAFFDGTSTPVVDNGIQYTNVFDANFDTLVSALNAVGLG  256

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPTDG+  A  S A +FY G ++ L   +GTP RP   +EVYMF L DED
Sbjct  257   NLPIIVGEVGWPTDGDINAKVSYAQRFYNGLLRRLTVNQGTPLRPNQYIEVYMFSLIDED  316

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN--AK  1256
              KS+ PG+FERHWGI  YDGQPK+ LD SG G+         ++YLP+KWC    N    
Sbjct  317   AKSIDPGNFERHWGIFKYDGQPKYALDPSGQGQNMMPVAAKGVQYLPQKWCVFNPNGGGD  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC R+DCTA   GS+C+ L      S+ FN YFQ   Q   SC F GL  
Sbjct  377   MSKLGDNINYACSRSDCTALGYGSTCNGLDANGNASFAFNMYFQVQNQMTQSCFFQGLAV  436

Query  1437  VTTTNLSTSTCNFNIGI  1487
              TT N ST+ CNF I I
Sbjct  437   ETTQNPSTADCNFTIQI  453



>emb|CDY42897.1| BnaC05g47540D [Brassica napus]
Length=492

 Score =   461 bits (1186),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 232/439 (53%), Positives = 293/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+  LGVNWG +SSH LPPK+VV+ML  N IKKVKLF++    + ALAG+G+EVM+  PN
Sbjct  29    GVSALGVNWGTMSSHQLPPKTVVRMLTDNNIKKVKLFDADTDTMGALAGSGVEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ M  Y  A+ +V+ NV+R+     DGVKI  V +GNEPFL  Y       +TYPAL
Sbjct  89    DLLQAMGTYQRAKDWVQRNVSRFNFN--DGVKIKYVAVGNEPFLTSYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAGIG   KATVP NADVY SPPD  VPSAG FR DI +++  I+  L +N 
Sbjct  146   VNIQTALNEAGIGDYIKATVPLNADVYNSPPDNQVPSAGRFRSDILQEMTDIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY ++  FPF++AFFDG    ++DNG  YTNVFDA++DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-DFPFEYAFFDG-QNTVNDNGVIYTNVFDASFDTLLASLNALN  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN + A +FY G +  LA+  GTP R G  +EVY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVANAERFYSGLLPRLANNIGTPMRKG-YIEVYLFGFID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGI  +DGQPKF +DL G G+ K LTG   ++YL  +WC    N +
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGQPKFPVDLQGQGQKKFLTGAQNVQYLLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                + +   I YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNISKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   C F I I
Sbjct  443   ATITTQNISQGQCVFPIQI  461



>ref|NP_001130924.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF79312.1| unknown [Zea mays]
 gb|ACG29657.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 tpg|DAA42581.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=486

 Score =   461 bits (1185),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 236/438 (54%), Positives = 291/438 (66%), Gaps = 10/438 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG  ++HPLPPK+VV++L+ NGIKKVKLF++    + ALAGTGIEVM+  PNA+L 
Sbjct  22    LGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAMLA  81

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              +  +   A  +VK NV RY      GV I  V +GNEPFL+ Y       VT PAL N+
Sbjct  82    GLAADAGQARNWVKHNVRRYDFDG--GVTIKYVAVGNEPFLESYNGS-FINVTLPALKNV  138

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q ALN+AGIG   KATVP NADVY SP   PVPSAG FR DI   +  +++ L  N +PF
Sbjct  139   QNALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPF  198

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP D+AFFDG   P+DD+G  YTNVFDAN+DT VAAL   GHG 
Sbjct  199   TVNIYPFLSLYL-NEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGD  257

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSA-LEVYMFGLFDED  1085
             M V VGE+GWPTDG+  A AS A +FY G ++ LA+  GTPARPG    EVY+FGL DED
Sbjct  258   MPVVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANTGTPARPGQRPAEVYLFGLVDED  317

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNAK-  1256
              KSV PG+FERHWG+L YDGQPKF +DL+ G+G+  T VP   + YL + WC +   AK 
Sbjct  318   AKSVAPGNFERHWGVLRYDGQPKFAMDLT-GQGRDTTLVPARGVAYLSRTWCALNPRAKD  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                + A + YAC  ADCT    GS+C  +      SY FNAY+Q   Q+  +CDF GL  
Sbjct  377   LGRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLAL  436

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              T T+ ST+TCNF I I+
Sbjct  437   PTETDPSTATCNFTIQIQ  454



>emb|CDM83452.1| unnamed protein product [Triticum aestivum]
Length=485

 Score =   460 bits (1184),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 292/442 (66%), Gaps = 6/442 (1%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G+    GLGVNWG ++SH LPP +VV+ML+ NGIKKVKLF++    L ALA +GIEVM+ 
Sbjct  19    GLPAAVGLGVNWGTMASHQLPPSTVVQMLQDNGIKKVKLFDADAEPLGALARSGIEVMVA  78

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN +L  M +YD A  +V +NV+ Y      GV I  V +GNEPFL          VT 
Sbjct  79    IPNKMLDMMTDYDTAREWVHKNVSAYNFGG--GVNIRYVAVGNEPFLSSLNGT-FLNVTL  135

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+QKAL+EAG+G T KATVP NADVY SP D PVPSAG FRP+I   + +I++ L+
Sbjct  136   PALQNIQKALDEAGVGDTIKATVPLNADVYQSPKDTPVPSAGRFRPEISGLMTEIVQFLN  195

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             ++ +PF +N+YP+LSLY  N  FP DFAFFDG   P+ D    YTNVFDAN+DT V+AL 
Sbjct  196   QSGAPFTVNIYPYLSLY-GNDDFPLDFAFFDGASSPVVDGNIQYTNVFDANFDTLVSALT  254

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G + V VGE+GWPTDG + A A+ A +FY G  + LAS  GTP RP   +E+Y+F 
Sbjct  255   AAGVGGLPVIVGEVGWPTDGEKHATAAYAQRFYTGLFRKLASNAGTPLRPNQYIEIYLFS  314

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KS+ PG FERHWG++ YDGQPK+ +D +G G+  AL G   +EYLP+ WC + +
Sbjct  315   LIDEDVKSIDPGYFERHWGVMRYDGQPKYAMDPTGQGRNTALVGARGVEYLPRVWCVLNA  374

Query  1248  NA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NA   + +   + YAC  ADCT+ S GS+C+ +      SY FNAYFQ  +Q+  +C F 
Sbjct  375   NAGNMSRLADNVGYACSNADCTSLSLGSTCNGMDPAGNASYAFNAYFQVQDQDEQACGFD  434

Query  1425  GLGEVTTTNLSTSTCNFNIGIK  1490
             GL   T  + ST TCNF I ++
Sbjct  435   GLAVRTRQDPSTGTCNFTIQLE  456



>ref|XP_009393970.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=479

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 227/440 (52%), Positives = 302/440 (69%), Gaps = 8/440 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             A  DG+GVNWG + SHP+ P +VV+MLK NGI+KVKLF++    + ALAGT IEVM+  P
Sbjct  20    ATADGVGVNWGTMMSHPMLPTTVVQMLKDNGIRKVKLFDADPWTVGALAGTAIEVMLAIP  79

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  L+ M  +  A  +VKENVT+Y      GV I  V +GNEPFLK Y        T+PA
Sbjct  80    NDQLQRMCKHKHAAEWVKENVTQYDHEG--GVHIKYVAVGNEPFLKSYNGS-FINSTFPA  136

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+Q AL+EAG+G   KA VP NADVY SP + PVPSAG FR DI++ +  I++ L+ N
Sbjct  137   LKNVQSALDEAGVGDRIKAVVPLNADVYFSPANDPVPSAGSFRKDIEELMVDIVRFLNSN  196

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              +PF++N+YPFLSL   N +FP +FAFFDG  +P+ D G  YTNVFDANYDT V ++ + 
Sbjct  197   GAPFVVNIYPFLSLN-QNPNFPVEFAFFDGGSQPVTDKGAQYTNVFDANYDTLVWSVKKA  255

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   M +T+GEIGWPTDG + AN   A +F+ GF + +A K+GTP RPG  L+ Y+FGL 
Sbjct  256   GVPDMKITIGEIGWPTDGVKNANVDYAKRFFDGFSRKMAKKEGTPLRPGP-LDFYLFGLL  314

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCT--VKS  1247
             DED KSVLPG+FERHWGI  +DG+PKF +DLSG GK + L G   +++LP +WC   V+ 
Sbjct  315   DEDMKSVLPGNFERHWGIFTFDGKPKFPMDLSGKGKDEYLVGAKGVQHLPAQWCVLNVED  374

Query  1248  NAKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
                F ++ ++++YAC  ADCTA   GSSC+ L+    +SY FN+YFQT +Q+  +C+F G
Sbjct  375   RGNFRSIPSSVNYACANADCTALGYGSSCNGLSSEGNVSYAFNSYFQTMDQDVRACNFDG  434

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  + TTN+ST +C F + I
Sbjct  435   LATIVTTNMSTGSCLFPVQI  454



>ref|XP_010528707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=495

 Score =   460 bits (1184),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 296/434 (68%), Gaps = 9/434 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+GIEVM+  PN  
Sbjct  28    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMRALAGSGIEVMVAIPNDQ  87

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L+ M +YD A+ +V+ NV+RY      GV IT V +GNEPFL  Y       +T+PAL N
Sbjct  88    LRVMGSYDRAKEWVQMNVSRYNFDG--GVNITYVAVGNEPFLTSYNG-SFVNLTFPALQN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALNEA +G   KATVP NADVY SP +  VPSAG FRPDI  Q+ +I+  L +N++P
Sbjct  145   VQNALNEARLGH-VKATVPLNADVYDSPANNQVPSAGRFRPDIISQMTEIVDFLGKNNAP  203

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F IN+YPFLSLY  +  FPFD+AFFDG  + + DNG  Y NVFDAN+DT V+AL   GHG
Sbjct  204   FTINIYPFLSLY-GSSDFPFDYAFFDGPTQ-IVDNGIQYNNVFDANFDTLVSALKAIGHG  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG++ AN   A ++Y G +  LA+KKGTP RPG  +EVY+FGL DED
Sbjct  262   DMPIIVGEVGWPTDGDKNANTGNALRYYNGLLPRLAAKKGTPLRPGY-IEVYLFGLLDED  320

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG+FERHWGI+ +DGQPKF LDLSG G+ K L G   ++YL  KWC     AK  
Sbjct  321   AKSIAPGNFERHWGIVRFDGQPKFPLDLSGQGQNKFLIGAQNVKYLQNKWCMFNPEAKDI  380

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             + +   + YAC  +DCTA   GSSC+SL      SY FN YFQ   QE  +C F GL  +
Sbjct  381   SKLVENVDYACTHSDCTALGFGSSCNSLDGHRNASYAFNMYFQVRNQEEDACFFQGLATI  440

Query  1440  TTTNLSTSTCNFNI  1481
             TT N+S   CNF I
Sbjct  441   TTQNISQGQCNFPI  454



>ref|XP_009130411.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=492

 Score =   460 bits (1184),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 231/439 (53%), Positives = 294/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+  LGVNWG ++SH LPPK+VV+ML  N IKKVKLF++    + ALAG+G+EVM+  PN
Sbjct  29    GVSALGVNWGTMASHQLPPKTVVRMLTDNNIKKVKLFDADTDTMGALAGSGVEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ M  Y  A+ +V+ NV+R+     DGVKI  V +GNEPFL  Y       +TYPAL
Sbjct  89    DLLQTMGTYQRAKDWVQRNVSRFNFN--DGVKIKYVAVGNEPFLTSYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAGIG   KATVP NADVY SPPD  VPSAG FR DI +++  I+  L +N 
Sbjct  146   VNIQTALNEAGIGDYIKATVPLNADVYNSPPDNQVPSAGRFRSDILQEMTDIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY ++  FPF++AFFDG    ++DNG  YTNVFDA++DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-DFPFEYAFFDG-QNTVNDNGVIYTNVFDASFDTLLASLNALN  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN + A +FY G +  LA+  GTP R G  +EVY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVANAERFYSGLLPRLANNIGTPMRKG-YIEVYLFGFID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGI  +DGQPKF +DL G G+ K LTG   ++YL  +WC    N +
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGQPKFPVDLQGQGQKKFLTGAQNVQYLLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                + +   I+YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNISKLGDNINYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   C F I I
Sbjct  443   ATITTQNISQGQCVFPIQI  461



>ref|XP_010415342.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
 ref|XP_010415349.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=477

 Score =   459 bits (1182),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 233/443 (53%), Positives = 297/443 (67%), Gaps = 10/443 (2%)
 Frame = +3

Query  171   GVAGL--DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             G+ G+  DGLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+G+EVM
Sbjct  12    GIMGIVVDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVM  71

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +  PN  LK M +YD A+ +V++NVTRY      GV IT V +GNEPFLK Y       +
Sbjct  72    VAIPNNQLKVMGSYDRAKDWVRQNVTRYNFDG--GVNITSVAVGNEPFLKSYNGS-FINL  128

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+Q ALNEAG+G + KATVP NADVY SP   PVP AG FRPDI   + QI+  
Sbjct  129   TFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPYAGRFRPDIIGPMTQIVDF  188

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L  N +P  IN+YPFLSLY  N  FP ++AFFDG   P+DDNG  YTNVFDAN+DT V++
Sbjct  189   LGNNSAPIAINIYPFLSLY-GNDDFPINYAFFDGA-PPVDDNGIDYTNVFDANFDTLVSS  246

Query  885   LAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYM  1064
             L   GHG M + VGE+GWPT+G++ AN+  A +FY G +  L + KGTP RP + +EVY+
Sbjct  247   LKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYL  305

Query  1065  FGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV  1241
             FGL DE+ KS+ PG FERHWG+  +DGQPKF +DLSG G+ K L G   + YL  KWC  
Sbjct  306   FGLLDENAKSIAPGPFERHWGLFKFDGQPKFPIDLSGQGQNKLLIGAQNVTYLSSKWCMF  365

Query  1242  KSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
               ++K  T +   I++AC  +DCTA   GSSC+ L      SY FN YFQ   Q+  +C 
Sbjct  366   NPDSKDLTKLADNINFACTYSDCTALGYGSSCNGLDANGNASYAFNMYFQEKNQDENACV  425

Query  1419  FGGLGEVTTTNLSTSTCNFNIGI  1487
             F G+   TT N+S   CNF I I
Sbjct  426   FQGMATTTTQNISQGQCNFPIQI  448



>gb|KFK37837.1| hypothetical protein AALP_AA3G035600 [Arabis alpina]
Length=553

 Score =   462 bits (1189),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 292/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+  LGVNWG +++H LPPK+VV+ML+ N IKKVKLF++    + ALAG+G+EVM+  PN
Sbjct  29    GVSALGVNWGTMATHQLPPKTVVEMLRDNNIKKVKLFDADTKTMGALAGSGVEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ M NY  A+ +V+ NVTR+     +GVKI  V +GNEPFL  Y       +TYPAL
Sbjct  89    DLLQAMGNYQRAKDWVQRNVTRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALN+AGIG   KATVP NADVY SPPD  VPSAG FR DI +++  I+  L +N 
Sbjct  146   VNIQTALNDAGIGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIMQEMTNIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  +  FPFD+ FFDG    ++DNG  YTNVFDAN+DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLTS-DFPFDYTFFDG-QNTVNDNGVVYTNVFDANFDTLLASLNALN  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN   A +FY G +  LA+  GTP R G  +EVY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVPNAERFYAGLLPRLANNVGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             E+ KSV PG+FERHWG+  +DGQPKF +D  G G+ K LTG   ++YL  +WC    N +
Sbjct  323   EEAKSVAPGNFERHWGLFKFDGQPKFPVDFIGQGQKKFLTGAQNVQYLLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                +     + YAC RADCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNISKFGDNVDYACSRADCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFDGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  443   ATITTQNISQGQCNFPIQI  461



>ref|XP_006297514.1| hypothetical protein CARUB_v10013538mg [Capsella rubella]
 gb|EOA30412.1| hypothetical protein CARUB_v10013538mg [Capsella rubella]
Length=493

 Score =   459 bits (1182),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 231/439 (53%), Positives = 296/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G+ GLGVNWG +++H LPPK+VV+ML+ N I+KVKLF++  + + ALAG+GIEVM+  PN
Sbjct  29    GVSGLGVNWGTMATHQLPPKTVVEMLRDNNIQKVKLFDADTNTMGALAGSGIEVMVAIPN  88

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              LLK M N   A+ +V+ NV+R+     +GVKI  V +GNEPFL  Y       +TYPAL
Sbjct  89    DLLKAMGNPQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G   KATVP NADVY SPPD  VPSAG FR DI +++ QI+  L +N 
Sbjct  146   FNIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNK  205

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY ++  FPFD+AFFDG    ++DNG  YTNVFDAN+DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-EFPFDYAFFDG-QNTVNDNGVIYTNVFDANFDTLLASLKALD  263

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M V VGE+GWPTDG++ AN   A +FY G +  LA+  GTP R G  +EVY+FGL D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPVRKG-YIEVYLFGLID  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGI  +DG+PKF +   G G+ K LTG   ++Y+  +WC    N +
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGKPKFPVGFGGQGQKKYLTGARNVQYMLNQWCMFNPNGR  382

Query  1257  --FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                + +   I YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL
Sbjct  383   GNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +TT N+S   CNF I I
Sbjct  443   ATITTRNISQGQCNFPIQI  461



>ref|XP_010463871.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   459 bits (1181),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 294/438 (67%), Gaps = 9/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + GLGVNWG +++H LPPK+VV+M K N I+KVKLF++  + + ALAG+G+EVM+  PN 
Sbjct  30    VSGLGVNWGTMATHQLPPKTVVEMFKDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPND  89

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK M N+  A+ +V+ NV+R+     +GVKI  V +GNEPFL  Y       +TYPAL 
Sbjct  90    LLKAMGNFQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  146

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SPPD  VPSAG FR DI +++ QI+  L +N +
Sbjct  147   NIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNKA  206

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFFDG    ++DNG  YTNVFDA++DT VA+L    H
Sbjct  207   PFTVNIYPFLSLYLSS-DFPFDYAFFDG-QNTVNDNGVIYTNVFDASFDTLVASLNALNH  264

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M V VGE+GWPTDG++ AN   A +FY G +  L++  GTP R G  +EVY+FG  DE
Sbjct  265   GDMEVIVGEVGWPTDGDKNANIQNAERFYSGLLPRLSNNVGTPMRKG-YIEVYLFGFIDE  323

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG+FERHWGI  +DGQPKF  D  G G+ K LTG   ++Y+  +WC    N + 
Sbjct  324   DAKSVAPGNFERHWGIFKFDGQPKFPFDFRGQGQKKFLTGARNVQYMLNQWCMFNPNGRG  383

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +   I YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL 
Sbjct  384   NMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGLA  443

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              +TT N+S   CNF I I
Sbjct  444   TITTRNISQGQCNFPIQI  461



>ref|XP_010517383.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   459 bits (1180),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 295/438 (67%), Gaps = 9/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + GLGVNWG +++H LPPK+VV+ML+ N I+KVKLF++  + + ALAG+G+EVM+  PN 
Sbjct  30    VSGLGVNWGTMATHQLPPKTVVEMLRDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPND  89

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             LLK M N+  A+ +V+ NV+R+     +GVKI  V +GNEPFL  Y       +TYPAL 
Sbjct  90    LLKAMGNFQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  146

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G   KATVP NADVY SPPD  VPSAG FR DI +++ QI+  L +N +
Sbjct  147   NIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNKA  206

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY ++  FPFD+AFFDG    ++DNG  YTNVFDA++DT VA+L    H
Sbjct  207   PFTVNIYPFLSLYLSS-DFPFDYAFFDG-QNTVNDNGVIYTNVFDASFDTLVASLNALNH  264

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M V VGE+GWPTDG++ AN   A +FY G +  L++  GTP R G  +EVY+FG  DE
Sbjct  265   GDMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPRLSNNLGTPMRKG-YIEVYLFGFIDE  323

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG+FERHWGI  +DG+PKF  D  G G+ K LTG   ++Y+  +WC    N + 
Sbjct  324   DAKSVAPGNFERHWGIFKFDGKPKFPFDFRGQGQKKFLTGARNVQYMLNQWCMFNPNGRG  383

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +   I YAC  +DCTA   GSSC +L      SY FN YFQ   QEA +CDF GL 
Sbjct  384   NMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGLA  443

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              +TT N+S   CNF I I
Sbjct  444   MITTRNISQGQCNFPIQI  461



>ref|XP_009388996.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 226/436 (52%), Positives = 292/436 (67%), Gaps = 7/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SHPLPPK VV++LK NGI KVK+F++    + ALAG+ IEVM+  PN +L
Sbjct  23    GLGVNWGTMASHPLPPKIVVQLLKDNGIDKVKIFDADSSTMKALAGSDIEVMVAIPNNML  82

Query  369   KEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             + M +Y  A  +VK NVTRY      GV I  V +GNEPFL  Y       VT+PAL N+
Sbjct  83    RTMTDYGAARDWVKTNVTRYHFEG--GVNIKYVAVGNEPFLSSYNGS-FLNVTFPALKNI  139

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q ALN+AG+G + KATVP NADVY SP   PVPSAG FR DI   + +I++ L+++ +PF
Sbjct  140   QNALNDAGVGGSIKATVPLNADVYNSPESNPVPSAGRFRTDISDLMTEIVQFLNQSGAPF  199

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N +FP +FAFFDG   P+ DNG  YTNVFDAN+DT V+AL   G G 
Sbjct  200   TVNIYPFLSLY-GNPNFPVEFAFFDGGSDPVVDNGIQYTNVFDANFDTLVSALKGVGLGD  258

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + + VGE+GWPTDG++ A AS A +FY G +K L +  GTP RP   +EVY+F L DED 
Sbjct  259   LPIIVGEVGWPTDGDKNAKASYAQRFYDGLLKRLVANHGTPLRPNQYIEVYLFSLIDEDA  318

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN--AKF  1259
             KS+ PG+FERHWG+L YDGQPK+ +DLSG G+ K L    ++EYLPKKWC    N     
Sbjct  319   KSIEPGNFERHWGVLKYDGQPKYNMDLSGQGQAKTLVPTKDVEYLPKKWCVFDPNGGGNV  378

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             + +   I++AC  +DCTA   GS+C+ L      S+ FN Y+Q    +  SC+F GL   
Sbjct  379   STLGDQITFACTWSDCTALGYGSTCNGLDGNGNASFAFNMYYQVQNHQELSCNFQGLATE  438

Query  1440  TTTNLSTSTCNFNIGI  1487
             TT + ST+ CNF I I
Sbjct  439   TTQDPSTAGCNFTIQI  454



>ref|XP_006826313.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
 gb|ERM93550.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
Length=481

 Score =   456 bits (1174),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 294/439 (67%), Gaps = 7/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DG+GVNWG ++   LPP +VV++LK NG +KVKLF++ +  +++LAG+GIEVM+  PN 
Sbjct  23    IDGIGVNWGTMAIRRLPPDTVVQLLKDNGFQKVKLFDADQSTMSSLAGSGIEVMVAIPNN  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L+ M +Y+ A+ +V  N+T Y      GV I  V +GNEPFLK Y    L   T+PAL 
Sbjct  83    QLEAMNDYETAKRWVDRNITLYNFDG--GVNIKYVAVGNEPFLKSYNGSFL-NTTFPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG G T KATVP NADVY SP D  VPSAG FR DI   + QI++ L+ +++
Sbjct  140   NIQNALNEAGAGDTIKATVPLNADVYDSPKDNSVPSAGRFRSDINDLMVQIVQFLNNSNA  199

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YP+LSLY  N  FP D+AFFDG  KP+DDNG  Y NVFDAN+DT V++L   G 
Sbjct  200   PFTVNIYPYLSLY-GNTGFPIDYAFFDGTSKPVDDNGVMYDNVFDANFDTLVSSLRAAGF  258

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
               + + +GE+GWPTDG+ FA +  A +FY G +K LA  KG+P RPG  L VY+FGL DE
Sbjct  259   PDLPILIGEVGWPTDGDMFATSLYAQRFYNGLLKRLAQNKGSPLRPGH-LVVYLFGLIDE  317

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KS+ PG+FERHWGI  YDGQPKF +DLSG G+     G   ++YLP +WC + +NAK 
Sbjct  318   DAKSIAPGNFERHWGIFSYDGQPKFPMDLSGQGQSSLPIGANNVKYLPAQWCVLNTNAKD  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I+YAC  +DCT+   GS+C+ L      SY FN Y+Q    +  SCDFGGL  
Sbjct  378   MSTLPDNINYACTYSDCTSLGYGSTCNKLDAQGNASYAFNMYYQVQGHKDESCDFGGLAV  437

Query  1437  VTTTNLSTSTCNFNIGIKV  1493
             VTT N S   C F I I+V
Sbjct  438   VTTQNASQDPCKFPIQIEV  456



>gb|KHN46790.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=436

 Score =   454 bits (1168),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/414 (55%), Positives = 286/414 (69%), Gaps = 7/414 (2%)
 Frame = +3

Query  252   MLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMVNYDVAEAFVKENVTRYK  431
             MLK NGIKKVKLF+S +  ++ALAGTGIEVM+  PN  L EM +Y  A+ +VK+NVTRY 
Sbjct  1     MLKDNGIKKVKLFDSDDSTMSALAGTGIEVMVAIPNNQLAEMNDYGRAKQWVKKNVTRYN  60

Query  432   PTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGIGKTTKATVPFNA  611
                  GV +  V +GNEPFLK Y    L  +T PAL N+Q ALNEAG+G   KATVP NA
Sbjct  61    FNG--GVNVKYVAVGNEPFLKSYNNSFL-NITLPALQNIQNALNEAGLGDKIKATVPLNA  117

Query  612   DVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFLSLYFANGSFPFDF  791
             DVY SP   PVPSAG+FRPDI   + QI++ L +N +PF +N+YPFLSLY  N  FPF++
Sbjct  118   DVYQSPESNPVPSAGIFRPDISGLMTQIVQFLSKNGAPFTVNIYPFLSLY-GNDDFPFNY  176

Query  792   AFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGEIGWPTDGNEFANAS  971
             AFFDGVD P++DNG  YTNVFDAN+DT VAAL   G G + + VGE+GWPT+G++ ANA 
Sbjct  177   AFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFGDLPILVGEVGWPTEGDKNANAG  236

Query  972   LAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGDFERHWGILGYDGQP  1151
              A +FY G +  LA+ +GTP RPG  +EVY+FGL DED KS+ PG+FERHWGI  YDGQP
Sbjct  237   NALRFYNGLLPRLAANRGTPRRPGY-IEVYLFGLIDEDAKSIAPGNFERHWGIFRYDGQP  295

Query  1152  KFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTNMKATISYACDRADCTATSNG  1325
             KF +DLSG  + K L G   ++YL  +WC    +AK  + +   I+YAC   DCTA   G
Sbjct  296   KFPMDLSGQNQNKFLIGAQNVKYLAPRWCMFNPDAKDLSKLPDNINYACTFGDCTALGYG  355

Query  1326  SSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
             SSC++L      SY FN YFQ   Q   +C+F GL ++TT N+ST TCNF + I
Sbjct  356   SSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAKLTTDNISTPTCNFIVQI  409



>ref|XP_010672072.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=478

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 226/438 (52%), Positives = 297/438 (68%), Gaps = 9/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  ++H LP  +VV+MLK N I+KVKLF++ E IL+AL+GTGIEVM+  PN 
Sbjct  23    VEGIGVNWGTQANHKLPLNTVVQMLKDNRIQKVKLFDADESILSALSGTGIEVMVAIPNG  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VTYPAL  539
              L  M++ + A  +V+ NV RY      GV I  V +GNEPFL+ Y   G F+  T PAL
Sbjct  83    DLVTMLDSNQARRWVERNVVRYNFRG--GVNIKYVAVGNEPFLRSYN--GTFENATLPAL  138

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALNEAG+G T KATVP NADVY SPP  PVPSAG FR D+   + Q+++ + +N+
Sbjct  139   VNIQNALNEAGVGNTVKATVPLNADVYGSPPSNPVPSAGRFRADVAVLMTQMVQFMSQNN  198

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  + +FP ++AFFDG   PLDDNG  YTNVFDAN+DT V+AL   G
Sbjct  199   APFTVNIYPFLSLY-EDPNFPVNYAFFDGGATPLDDNGLQYTNVFDANFDTLVSALNAAG  257

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             +G M + VGE+GWPTDG+  AN + A +FY   +  +A+  GTP RPG+ +++Y+FGL D
Sbjct  258   YGNMPIIVGEVGWPTDGDINANINNAFRFYRSLLPRIAANTGTPLRPGN-IDMYLFGLLD  316

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KS+ PG FERHWGI  YDGQPKF +DLSG  +   L G   ++YL  +WC    NA+
Sbjct  317   EDAKSIGPGSFERHWGIFQYDGQPKFPMDLSGQNQDIYLVGAKNVQYLENEWCEFNPNAR  376

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +  +I++AC  ADCT    GSSC  L   +  SY FN Y+QT  Q   +CDFGGL 
Sbjct  377   DLSRLGDSINFACSAADCTPLGYGSSCQGLDVYQNASYAFNVYYQTQYQNLQACDFGGLA  436

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              +T  N+S  TCNF I I
Sbjct  437   RLTLQNISIGTCNFTIQI  454



>gb|KDP35276.1| hypothetical protein JCGZ_09435 [Jatropha curcas]
Length=468

 Score =   455 bits (1171),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/438 (52%), Positives = 302/438 (69%), Gaps = 13/438 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG+I+SHPL P  VV+MLK NGIK+VKLF+     LN LAG+GIEVM+  PN LL
Sbjct  10    GLGVNWGNIASHPLNPNIVVQMLKDNGIKRVKLFDFDSWTLNCLAGSGIEVMVAIPNKLL  69

Query  369   KEM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             ++M  +YD A+ +VK+NV  Y      GV I  V +GNEPFLK Y+ + L K T+PAL N
Sbjct  70    EDMATSYDHAKDWVKDNVAEYL-KDKGGVDIRYVAVGNEPFLKAYDGEYL-KTTFPALKN  127

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKALNE  +G   KAT+PFNADVY    D   PS G FR D++  +++I+K L ++ +P
Sbjct  128   IQKALNEHKLGDKIKATIPFNADVY----DGNKPSEGNFRSDVRDVMQKIVKFLHQHKAP  183

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPF+S+Y ++G FP D+AFF+G  + + D   +Y+NVFDANYDT V +L + G  
Sbjct  184   FVVNIYPFISVYQSSG-FPLDYAFFEGSSRKVSDKNVSYSNVFDANYDTLVWSLEKAGVP  242

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGEIGWPTDG+ +AN   A +FY G ++ LASKKGTP RPG  + VY+FGL DED
Sbjct  243   NLEILVGEIGWPTDGSPYANTQYAGRFYDGLLRRLASKKGTPLRPGIII-VYLFGLLDED  301

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KS+ PG+FERHWGI  YDGQPKF +DLSG GK K L     ++YLPK+WC +  +    
Sbjct  302   MKSIEPGNFERHWGIYRYDGQPKFPIDLSGQGKNKMLVAAKGVQYLPKQWCVLSEDVIDA  361

Query  1263  N---MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
             N   + A ++YAC R+DCT+ + GSSC S+     +SY FN YFQ ++Q+  +CDF GLG
Sbjct  362   NNNLIPAGLTYACSRSDCTSLTYGSSCGSMQLRSNVSYAFNMYFQMNDQDVAACDFNGLG  421

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              + T N S  TC F I I
Sbjct  422   TIVTRNASQGTCLFPIQI  439



>dbj|BAJ94415.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 291/442 (66%), Gaps = 12/442 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG  +SHPLPPK VV++LK NGI KVKLF +    + ALAG+G+EVM+  PN +
Sbjct  23    EGLGVNWGTQASHPLPPKVVVQLLKDNGINKVKLFETNLEAMKALAGSGVEVMLAIPNNM  82

Query  366   LKEMVNYDVAEA--FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
             L  +     A A  +VK NV R+      GV I  V +GNEPFL+ Y K    KVT PAL
Sbjct  83    LHHIAGDSGAAARDWVKRNVKRFDFDG--GVVIKYVAVGNEPFLEAY-KGSFIKVTLPAL  139

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALN+AG+G   KATVP NADVY SP   PVPSAG FR +I   +  I++ L +N 
Sbjct  140   ENIQNALNDAGVGDRIKATVPLNADVYNSPARNPVPSAGRFRAEISGVMTDIVRFLAKNK  199

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  + +FP +FAFFDG   P++D G  Y+NV+DAN+DT VAALA  G
Sbjct  200   APFTVNIYPFLSLYL-DDNFPLNFAFFDGGATPVNDKGVMYSNVYDANFDTLVAALAAVG  258

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
             HG M + VGE+GWPTDG+  A AS A +FY G ++ LA+ +GTPARP   +E Y+FGL D
Sbjct  259   HGDMPIIVGEVGWPTDGDRHAKASHARRFYDGLLRRLAANRGTPARPNRHIETYLFGLVD  318

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNA  1253
             ED+KSV PG FERHWGI  YDGQPKF +DLSG   +  T VP   ++YL + WC V   A
Sbjct  319   EDRKSVQPGSFERHWGIFRYDGQPKFAMDLSGQGRRDATLVPAKGVQYLSRTWCAVNPKA  378

Query  1254  KFTN----MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
                +    + A I YAC  ADCT    GS+C+ +      SY FNAY+Q   Q+  +CDF
Sbjct  379   SRDDLGKLLGAKIDYACSNADCTTLGYGSTCNGMDAMGNASYAFNAYYQAQSQKDEACDF  438

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL   T T+ ST+TCNF I I
Sbjct  439   QGLALPTQTDPSTTTCNFTIQI  460



>ref|XP_010086599.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB22055.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=488

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 288/417 (69%), Gaps = 9/417 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPPK+VV+MLK NGI+KVKLF++ +  ++ALAG+GIEV +  PN 
Sbjct  30    VEGLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDTDDSTMSALAGSGIEVFVAIPND  89

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M ++  A+ +VK NVTRY  +   GV I  V +GNEPFL  Y    L  VT+PAL 
Sbjct  90    QLSAMNSFKRAQDWVKRNVTRYNFSG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQ  146

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q+ALNEAG+G + KATVP NADVY SP   P PSAG FR DI + + QI++ L+EN +
Sbjct  147   NIQRALNEAGVGDSIKATVPLNADVYNSPESNPFPSAGRFRTDINQLMTQIVQFLNENKA  206

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY  N  FPFD+AFFDGV   + D   G  YTNVFDAN+DT VAAL   
Sbjct  207   PFTVNIYPFLSLY-GNDHFPFDYAFFDGVSNTILDPSTGIQYTNVFDANFDTLVAALRAA  265

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G+G MT+ VGE+GWPTDG++ AN   A +FY G +  LAS +GTP RPG  +EVY+FGL 
Sbjct  266   GYGDMTILVGEVGWPTDGDKNANTGYAYRFYNGLLPRLASNRGTPLRPG-YIEVYLFGLI  324

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KSV PG+FERHWGI  YDGQPKF +DLSG G+ K L     +EYLP KWC    NA
Sbjct  325   DEDAKSVAPGNFERHWGIFRYDGQPKFPVDLSGQGQNKLLVPAKNVEYLPNKWCMFNPNA  384

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
             K  + +   I YAC  +DCTA   GSSC++L      SY FN YFQ   Q+  +C+F
Sbjct  385   KDLSKLADNIDYACTFSDCTALGYGSSCNNLDSNGNASYAFNMYFQVQNQDDMACNF  441



>gb|KDO55075.1| hypothetical protein CISIN_1g011532mg [Citrus sinensis]
Length=483

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 300/439 (68%), Gaps = 10/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPPK++V+MLK NGI KVKLF++ +  + ALAG+ IEVM+  PN 
Sbjct  20    VNGLGVNWGTQTTHQLPPKTIVQMLKDNGISKVKLFDAHQGTMIALAGSDIEVMVAIPNK  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L +M +YD A+ +VK NVTRY      GV I  V +GNEPFLK Y        T+PAL 
Sbjct  80    DLLDMNSYDRAKQWVKRNVTRYNFKG--GVSIKYVAVGNEPFLKAYNGS-FLNTTFPALQ  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP + P PS G FR DI  Q+ QI++ L +N++
Sbjct  137   NIQNALNEAGVGDSIKATVPLNADVYESPENNPYPSFGRFRTDILGQMTQIVEFLAKNNA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY  N  FPF++AFFDG   P+ D+G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSLY-GNDDFPFNYAFFDG-GTPIVDSGTGIQYTNVFDANFDTLVSALKAV  254

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             GHG M + VGE+GWPTDG++ AN   A +FY G +  LA+ KGTP RPG  +EVY+FGL 
Sbjct  255   GHGDMPMIVGEVGWPTDGDKNANNGNAYRFYNGLLPKLAANKGTPLRPGY-IEVYLFGLV  313

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG FERHWGI  YDGQPKF +DLSG G+ K L G   ++Y+P +WC +  +A
Sbjct  314   DEDAKSIDPGYFERHWGIFRYDGQPKFAMDLSGQGQNKMLIGASGVKYMPSQWCMLNPDA  373

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  + +   I YAC  +DCTA   GSSC++L      SY FN Y+Q   Q+  +C F GL
Sbjct  374   KDMSKLVDNIKYACTWSDCTALGYGSSCNNLDANGNASYAFNMYYQIKNQDELACGFQGL  433

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
             G+VTT NLS   C+F I +
Sbjct  434   GKVTTQNLSQGQCSFIIQL  452



>ref|XP_006443393.1| hypothetical protein CICLE_v10019922mg [Citrus clementina]
 ref|XP_006479087.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
 gb|ESR56633.1| hypothetical protein CICLE_v10019922mg [Citrus clementina]
Length=483

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 300/439 (68%), Gaps = 10/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPPK++V+MLK NGI KVKLF++ +  + ALAG+ IEVM+  PN 
Sbjct  20    VNGLGVNWGTQTTHQLPPKTIVQMLKDNGISKVKLFDAHQGTMIALAGSDIEVMVAIPNK  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L +M +YD A+ +VK NVTRY      GV I  V +GNEPFLK Y        T+PAL 
Sbjct  80    DLLDMNSYDRAKQWVKRNVTRYNFKG--GVSIKYVAVGNEPFLKAYNGS-FLNTTFPALQ  136

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALNEAG+G + KATVP NADVY SP + P PS G FR DI  Q+ QI++ L +N++
Sbjct  137   NIQNALNEAGVGDSIKATVPLNADVYESPENNPYPSFGRFRTDILGQMTQIVEFLAKNNA  196

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY  N  FPF++AFFDG   P+ D+G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSLY-GNDDFPFNYAFFDG-GTPIVDSGTGIQYTNVFDANFDTLVSALKAV  254

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             GHG M + VGE+GWPTDG++ AN   A +FY G +  LA+ KGTP RPG  +EVY+FGL 
Sbjct  255   GHGDMPMIVGEVGWPTDGDKNANNGNAYRFYNGLLPKLAANKGTPLRPGY-IEVYLFGLV  313

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG FERHWGI  YDGQPKF +DLSG G+ K L G   ++Y+P +WC +  +A
Sbjct  314   DEDAKSIDPGYFERHWGIFRYDGQPKFAMDLSGQGQNKMLIGASGVKYMPSQWCMLNPDA  373

Query  1254  K-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  + +   I YAC  +DCTA   GSSC++L      SY FN Y+Q   Q+  +C F GL
Sbjct  374   KDMSKLVDNIKYACTWSDCTALGYGSSCNNLDANGNASYAFNMYYQIKNQDELACGFQGL  433

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
             G+VTT NLS   C+F I +
Sbjct  434   GKVTTQNLSQGQCSFIIQL  452



>ref|XP_006657484.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=480

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 230/438 (53%), Positives = 297/438 (68%), Gaps = 11/438 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLG+NWG  ++HPLPPK VV+ML+ NGI KVKLF++    ++ALAG+GIEVM+  PN  
Sbjct  21    EGLGMNWGTQATHPLPPKVVVQMLRDNGITKVKLFDTDFAAMSALAGSGIEVMVAIPNKD  80

Query  366   LKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             L  M  +Y  A+++VK+NV RY      GV I  V +GNEPFLK Y       +T PAL 
Sbjct  81    LNTMASDYSNAQSWVKKNVKRYDFDG--GVTIKYVAVGNEPFLKTYNGS-FINITLPALQ  137

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AGIG   KATVP NADVY    D  +PSAG FRP+I   +  I+K L +N++
Sbjct  138   NIQNALNDAGIGDRIKATVPLNADVY----DGQLPSAGRFRPEISGLMTDIVKFLAKNNA  193

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  + +FP ++AFFDG   P++D G  YTNVFDAN+DT VAAL   GH
Sbjct  194   PFTVNIYPFLSLYL-DDNFPVNYAFFDGGSTPVNDGGVLYTNVFDANFDTLVAALKGVGH  252

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ A  +LA +FY G +K LA+  GTPARP   +E+Y+FGL DE
Sbjct  253   GDMPIIVGEVGWPTDGDKNAKVALAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDE  312

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L YDGQPKF +DL+G G+   L     ++YL K WC + +NAK 
Sbjct  313   DAKSVAPGSFERHWGVLRYDGQPKFAMDLTGQGRNTMLVPARGVQYLSKTWCVINTNAKD  372

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +N+   I++AC  ADCT    GSSC+ +      SY FNAYFQ   Q+  +C+F GL  
Sbjct  373   LSNLGDKINFACTFADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLAV  432

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              T T+ ST+ CNF I IK
Sbjct  433   PTQTDPSTNACNFTIQIK  450



>ref|XP_010528719.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=493

 Score =   455 bits (1171),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/434 (53%), Positives = 294/434 (68%), Gaps = 9/434 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++H LPPK+VV+MLK N I KVKLF++ E  + ALAG+GIEVM+  PN  
Sbjct  28    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMRALAGSGIEVMVAIPNDQ  87

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L+ M +YD A+ +V+ NV+RY      GV IT V +GNEPFL  Y       +T+PAL N
Sbjct  88    LRVMGSYDRAKEWVQRNVSRYNFDG--GVNITYVAVGNEPFLTSYNG-SFVNLTFPALQN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALNEA +G   KATVP NADVY SP +  VPSAG FRPDI  Q+ +I+  L +N++P
Sbjct  145   VQNALNEARLGH-VKATVPLNADVYDSPANNQVPSAGRFRPDIISQMTEIVDFLGKNNAP  203

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F IN+YPFLSLY  +  FPFD+AFFDG  + + DNG  Y NVFDAN+DT V+AL   GHG
Sbjct  204   FTINIYPFLSLY-GSSDFPFDYAFFDGPTQ-IVDNGIQYNNVFDANFDTLVSALKAIGHG  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG++ AN   A ++Y G +  LA+ KGTP RPG  +EVY+FGL DED
Sbjct  262   DMPIIVGEVGWPTDGDKNANTGNALRYYNGLLPRLAANKGTPLRPGY-IEVYLFGLLDED  320

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG+FERHWGI+ +DGQPKF LDL G G+ K L G   ++YL  KWC     AK  
Sbjct  321   AKSIAPGNFERHWGIVRFDGQPKFPLDLLGQGQNKFLIGAQNVKYLQNKWCMFNPEAKDI  380

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             + +   + YAC  +DCTA   GSSC+SL      SY FN YFQ   QE  +C F GL  +
Sbjct  381   SKLAENVDYACTHSDCTALGFGSSCNSLDAHGNASYAFNMYFQVRNQEEDACFFQGLATI  440

Query  1440  TTTNLSTSTCNFNI  1481
             TT N+S   C+F I
Sbjct  441   TTQNISQGQCDFPI  454



>ref|XP_008386810.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=488

 Score =   454 bits (1169),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 229/431 (53%), Positives = 289/431 (67%), Gaps = 9/431 (2%)
 Frame = +3

Query  201   NWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV  380
             NWG +++H LPP +V+++LK NGI KVKLF++ E  ++AL G+G+EVM+  PN  L  M 
Sbjct  29    NWGTMATHELPPDTVIQILKDNGIPKVKLFDADESTMSALTGSGLEVMVAIPNDQLAVMT  88

Query  381   NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKAL  560
             +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT+PAL N+Q AL
Sbjct  89    SYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQNIQNAL  145

Query  561   NEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINV  740
             NEAG+G + KATVP NADVY SP D PVPSAG FR DI + + +I++ LD+N +PF IN+
Sbjct  146   NEAGVGDSVKATVPLNADVYDSPVDNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINI  205

Query  741   YPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALAREGHGKMT  914
             YPFLSLY  N  FPF++AFFDG   P+ D G    YTNVFDAN+DT V++L   G G M 
Sbjct  206   YPFLSLY-GNDGFPFNYAFFDGDTTPIVDTGTGIQYTNVFDANFDTLVSSLKAVGFGNMP  264

Query  915   VTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKS  1094
             + VGE+GWPTDG++ AN   A +FY G +  L + KGTP R G  +EVY+FGL DED KS
Sbjct  265   IVVGEVGWPTDGDKNANVGNAFRFYNGLLTRLGTNKGTPLRTG-YIEVYLFGLIDEDAKS  323

Query  1095  VLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTNM  1268
             + PG FERHWGI  YDGQPKF +DLSG G+ K L     + YL KKWC    NAK  +N+
Sbjct  324   IAPGSFERHWGIFSYDGQPKFPVDLSGQGQNKLLVPAKNVLYLSKKWCMXNPNAKDVSNL  383

Query  1269  KATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTT  1448
                I+YAC  ADCTA   GSSC++L      SY FN Y+Q  +Q+  SC F GL  +TT 
Sbjct  384   ADKINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQDQDDQSCSFQGLATLTTQ  443

Query  1449  NLSTSTCNFNI  1481
             N+S   CNF I
Sbjct  444   NISQGNCNFII  454



>ref|XP_002325410.1| hypothetical protein POPTR_0019s04850g [Populus trichocarpa]
 gb|EEE99791.1| hypothetical protein POPTR_0019s04850g [Populus trichocarpa]
Length=508

 Score =   455 bits (1170),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 235/465 (51%), Positives = 300/465 (65%), Gaps = 33/465 (7%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG ++   LPP++VV+MLK NGI KVKLF++ ++ + +LAGTGIEVM+  PN 
Sbjct  20    VDGLGVNWGTMAIRKLPPETVVQMLKDNGILKVKLFDADQNTMTSLAGTGIEVMVAIPND  79

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPD-----GVKITL---------------------  464
              L  M +Y+ A+ +VK NVTRY     +     G KI L                     
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYDFDGGEFVVFVGGKICLPFLNKLVIMTSQGIINAVEKY  139

Query  465   VGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPV  644
             V +GNEPFLK Y    L   T+PAL N+Q ALN+AG+G + KATVPFNADVY SP D+  
Sbjct  140   VAVGNEPFLKSYNGSFL-NTTFPALRNIQNALNDAGVGDSIKATVPFNADVYNSPDDQAY  198

Query  645   PSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLD  824
             PS+G FR DI   + ++++ L +N++PF +N+YPFLSLY  N  FPFD+AFFDG  +P+ 
Sbjct  199   PSSGRFRSDINDIMTEMVQFLGQNNAPFTVNIYPFLSLY-GNDDFPFDYAFFDGAPQPVV  257

Query  825   DNGK--TYTNVFDANYDTAVAALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGF  998
             D G    YTNVFDAN+DT V+AL   GHG M + VGE+GWPTDG++ AN   A +FY G 
Sbjct  258   DRGTGIQYTNVFDANFDTLVSALKAAGHGDMPIIVGEVGWPTDGDKNANIGNAIRFYNGL  317

Query  999   IKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG  1178
             +  LA  +GTP RPG  +EVY+FGL DED KS+ PG+FERHWGI  YDGQPKF +DLSG 
Sbjct  318   LPRLAGNRGTPLRPGY-IEVYLFGLLDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQ  376

Query  1179  -KGKALTGVPEIEYLPKKWCTVKSNAK-FTNMKATISYACDRADCTATSNGSSCHSLTEP  1352
                K L G   ++YLP KWC    NAK  + +   I+YAC R+DCTA   GSSC+ L   
Sbjct  377   VANKWLVGAQNVQYLPSKWCMFNPNAKDLSKLADNINYACSRSDCTALGYGSSCNGLDTN  436

Query  1353  EKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
                SY FN Y+Q   Q+  +C+F GL  VT  N+S   CNF I I
Sbjct  437   GNASYAFNMYYQVQNQDEFACNFEGLAMVTEQNISQGNCNFTIQI  481



>ref|XP_003557824.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=493

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 294/437 (67%), Gaps = 9/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             + LG+NWG  ++HPL PK VV+MLK NGIKKVKLF++ +  L ALAGT IEVM+  PN L
Sbjct  28    EALGMNWGTQATHPLSPKIVVQMLKDNGIKKVKLFDADQGTLGALAGTDIEVMVAIPNVL  87

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  M + D A  +V+ NV+RY      GV I  V +GNEPFL  Y   G F KVT PAL 
Sbjct  88    LDLMTDSDNARDWVRHNVSRYHFDG--GVNIKYVAVGNEPFLASY--NGTFDKVTLPALK  143

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+    KATVP NADVY SP DKPVPSAG FRPDI   + +++  L +N +
Sbjct  144   NIQNALNDAGLSDV-KATVPLNADVYNSPKDKPVPSAGTFRPDITDLMTEMVDFLAKNGA  202

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YP+LSLY ++  FP +FAFFDG   P+ DNG +YTNVFDAN+DT V+AL   GH
Sbjct  203   PFTVNIYPYLSLYLSD-DFPVNFAFFDGGADPVVDNGNSYTNVFDANFDTLVSALKAVGH  261

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + +GE+GWPTDG++ A    A +FY G +K LA+  GTP RP   +EVY+FGL DE
Sbjct  262   GDLPIVIGEVGWPTDGDKHATYVYAQRFYTGLLKRLAANVGTPLRPNKYMEVYLFGLLDE  321

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             D KSV PG FERHWG+L +DGQPKF +DL+G G+   L    +++YLPK WC   +NAK 
Sbjct  322   DIKSVAPGAFERHWGVLRFDGQPKFPMDLTGQGQNTMLAPAKDVQYLPKTWCVYNANAKD  381

Query  1260  TN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
             T+ +   +++AC  ADCTA   GSSC  +      SY FN YFQ   Q+  +CDF  L  
Sbjct  382   TSKLAENVNFACTFADCTALGFGSSCAGMDAIGNASYAFNMYFQVQNQKDEACDFQALAV  441

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST TC+F I I
Sbjct  442   PTQTDPSTDTCHFPIQI  458



>dbj|BAD31779.1| putative 3-glucanase [Oryza sativa Japonica Group]
 gb|EAZ02906.1| hypothetical protein OsI_25042 [Oryza sativa Indica Group]
 gb|EAZ38824.1| hypothetical protein OsJ_23232 [Oryza sativa Japonica Group]
 dbj|BAG97331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 295/438 (67%), Gaps = 11/438 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLG+NWG  ++HPLPPK+VV++LK NGI KVKLF++    ++ALAG+G+EVM+  PN  
Sbjct  23    EGLGINWGTQATHPLPPKAVVQLLKDNGIAKVKLFDTDFAAMSALAGSGVEVMVAIPNKD  82

Query  366   LKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             L  M  +Y  A+ +VK+NV R+      GV I  V +GNEPFLK Y       +T PAL 
Sbjct  83    LATMASDYGNAKDWVKKNVKRFDFDG--GVTIKYVAVGNEPFLKAYNGS-FINITLPALQ  139

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AGIG   KATVP NADVY S     VPSAG FRP+I   +  I+K L +N++
Sbjct  140   NVQNALNDAGIGDRIKATVPLNADVYEST----VPSAGRFRPEIAGLMTDIVKFLAKNNA  195

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  +  FP +FAFFDG   P++D G  YTNVFDAN+DT VAAL   GH
Sbjct  196   PFTVNIYPFLSLYL-DEHFPINFAFFDGGSTPVNDGGIMYTNVFDANFDTLVAALKAVGH  254

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ A   LA +FY G +K LA+  GTPARP   +E+Y+FGL DE
Sbjct  255   GDMPIIVGEVGWPTDGDKNARVDLAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDE  314

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L YDGQPKF +DL+G G+   L     IEYLPK WC + +NAK 
Sbjct  315   DMKSVAPGSFERHWGVLRYDGQPKFAMDLAGQGRNTMLVPAKGIEYLPKTWCVINTNAKD  374

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I++AC  ADCT    GSSC+ +      SY FNAYFQ   Q+  +C+F GL  
Sbjct  375   VSKLGDNINFACTYADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLAV  434

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              T T+ +T+ CNF I IK
Sbjct  435   PTETDPTTAQCNFTIQIK  452



>gb|AAT42176.1| putative 3-glucanase [Zea mays]
 gb|ACN27628.1| unknown [Zea mays]
 gb|AFW68098.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=492

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 299/441 (68%), Gaps = 6/441 (1%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G+     LGVNWG +++H LPP +VV+ML+ NGI+KVKLF++    ++ALAGT +EVM+ 
Sbjct  27    GLPAAGALGVNWGTMATHQLPPATVVRMLEDNGIRKVKLFDADAGPMDALAGTSVEVMVA  86

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN +L  M +Y  A  +V++NV+RY      GV I  V +GNEPFL  +       VT 
Sbjct  87    IPNNMLDMMTDYGTARDWVRQNVSRYNFDG--GVNIKYVAVGNEPFLSSFNGT-FLNVTL  143

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q+ALN+AG G T KATVP NADVY SP D  VPSAG FRPDI   + +I++ L+
Sbjct  144   PALQNIQRALNDAGFGDTIKATVPLNADVYNSPKDNLVPSAGRFRPDIAGLMTEIVQFLN  203

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             ++ +PF +N+YPFLSLY  N  FP D+AFFDG   P+ DNG  YTNVFDAN+DT V+ALA
Sbjct  204   QSGAPFTVNIYPFLSLY-DNDDFPLDYAFFDGTGSPVVDNGIQYTNVFDANFDTLVSALA  262

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G + V VGE+GWPTDG++ A A+ A KFY G ++ LA+  GTP RPG  +EVY+F 
Sbjct  263   AAGVGGLPVVVGEVGWPTDGDKHATAAFAQKFYAGLLRKLAASAGTPLRPGQYIEVYLFS  322

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KSV PG+FERHWGI+ YDGQPK+ +DLSG G+  AL     ++YLP++WC V  
Sbjct  323   LIDEDAKSVAPGNFERHWGIMRYDGQPKYAMDLSGQGRNTALVAARGVQYLPRQWCVVNP  382

Query  1248  NAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NA+ T+ +  +++YAC  +DCT+   GSSC+ L      SY FN YFQ   Q  GSC F 
Sbjct  383   NAQDTSKIGDSVTYACTFSDCTSLGYGSSCNGLDAAGNASYAFNMYFQVQNQVEGSCYFQ  442

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL   T+ N ST  CNF I I
Sbjct  443   GLAVPTSQNPSTDACNFTIQI  463



>ref|XP_007204344.1| hypothetical protein PRUPE_ppa005641mg [Prunus persica]
 gb|EMJ05543.1| hypothetical protein PRUPE_ppa005641mg [Prunus persica]
Length=450

 Score =   451 bits (1159),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 230/429 (54%), Positives = 288/429 (67%), Gaps = 9/429 (2%)
 Frame = +3

Query  213   ISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMVNYDV  392
             +++H LPP++VV+MLK NGI+KVKLF++ E  ++ALAG+G+EVM+  PN  L  M  Y  
Sbjct  1     MATHKLPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPNDQLAVMATYKR  60

Query  393   AEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEAG  572
             A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT+PAL N+Q ALNEAG
Sbjct  61    AKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTFPALQNIQNALNEAG  117

Query  573   IGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFL  752
             +G + KATVP NADVY SP   PVPSAG FR DI   +  I++ L +N +PF IN+YPFL
Sbjct  118   VGDSIKATVPLNADVYNSPDSNPVPSAGRFRSDISPLMIAIVQFLAKNKAPFTINIYPFL  177

Query  753   SLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAREGHGKMTVTVG  926
             SLY  N  FPF++AFFDG   P+ D   G  YTNVFDAN+DT V++L  EG G MT+ VG
Sbjct  178   SLY-GNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAEGFGDMTIVVG  236

Query  927   EIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPG  1106
             E+GWPTDG++ ANA  A +FY G +  L + +GTP RPG  +EVY+FGL DED KS+ PG
Sbjct  237   EVGWPTDGDKNANAGNAYRFYNGLLPKLGTNRGTPLRPGY-IEVYLFGLIDEDAKSIAPG  295

Query  1107  DFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTNMKATI  1280
              FERHWGI  YDGQPKF +DLSG  + K L     ++YL KKWC    NAK  T +   I
Sbjct  296   SFERHWGIFSYDGQPKFLVDLSGQSQNKLLVPAKNVQYLSKKWCMFNPNAKDVTKLADNI  355

Query  1281  SYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLST  1460
             +YAC  ADCTA   GSSC++L      SY FN Y+Q   Q+  SC+F GL  +TT N+S 
Sbjct  356   NYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEGLATLTTQNISQ  415

Query  1461  STCNFNIGI  1487
               CNF I I
Sbjct  416   GNCNFIIQI  424



>ref|XP_006656196.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=481

 Score =   451 bits (1161),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 294/434 (68%), Gaps = 11/434 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P SVV MLK NGI KVKLF++    + AL  +GIEVM+G PN +L+
Sbjct  31    VGVNWGSQLSHPLLPSSVVHMLKENGISKVKLFDADPWPIGALIDSGIEVMLGIPNNMLE  90

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  A+ +VKENVT Y     D + I  V +GNEPFLK Y      K T+PAL N+Q
Sbjct  91    TMNSYGNAKDWVKENVTSYG----DKLNIKYVAVGNEPFLKAYNGS-FMKTTFPALKNIQ  145

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KALNEAGIG   KATVP NADVY+SP +KP  S+G+FRPDI+  +  ++K L +  +PF+
Sbjct  146   KALNEAGIGGKVKATVPLNADVYVSPDNKP--SSGVFRPDIEDLMTGMVKFLHDQGAPFV  203

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++  FPF+FAF DG     D  G +Y+NVFDAN+DT V A+ + G   +
Sbjct  204   VNIYPFLSLYQSD-DFPFEFAFIDGGKTIQDKGGISYSNVFDANFDTLVTAMKKAGVPNI  262

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGE+GWPTDG++ AN  LA ++Y G +K LA ++GTP RPG  ++VYMFGLFDED K
Sbjct  263   KVVVGEVGWPTDGDKNANIKLARRYYDGLLKKLAKEEGTPLRPGK-MDVYMFGLFDEDMK  321

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTN  1265
             S+LPG+FERHWGI  YDG+PKF +DL+G G  K L  VP ++YLPK+WC     AK  + 
Sbjct  322   SILPGNFERHWGIFTYDGKPKFPMDLTGHGNDKLLAAVPAVQYLPKQWCVFDDEAKDKSK  381

Query  1266  MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTT  1445
             +   I YAC   DCTA   G SC+SL E   +SY FN YFQ  +Q+  +CDF GL ++T 
Sbjct  382   LPGNIEYACASGDCTAIGYGCSCNSLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKITE  441

Query  1446  TNLSTSTCNFNIGI  1487
              N S   C F I +
Sbjct  442   KNASAHGCLFPIQV  455



>ref|XP_009366428.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Pyrus x bretschneideri]
Length=487

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/433 (52%), Positives = 290/433 (67%), Gaps = 9/433 (2%)
 Frame = +3

Query  201   NWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV  380
             NWG +++H LPP +VV+MLK NGI KVKLF++ E  ++AL  +G+EVM+  PN  L  + 
Sbjct  29    NWGTMATHELPPATVVQMLKDNGIPKVKLFDAEESTMSALLDSGLEVMVAIPNDQLAVLT  88

Query  381   NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKAL  560
             +Y  A+ +V+ NVTRY      GV I  V +GNEPFL  Y    L  VT+PAL N+Q AL
Sbjct  89    SYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQNIQNAL  145

Query  561   NEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINV  740
             NEAG+G + KATVP NADVY SP + PVPSAG FR DI + + +I++ LD+N +PF IN+
Sbjct  146   NEAGVGDSVKATVPLNADVYDSPENNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINI  205

Query  741   YPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAREGHGKMT  914
             YPFLSLY  N  FPF++AFFDG   P+ D   G  YTNVFDAN+DT V++L   G G M 
Sbjct  206   YPFLSLY-GNDGFPFNYAFFDGDTTPIVDTTTGIQYTNVFDANFDTLVSSLKAVGFGNMP  264

Query  915   VTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKS  1094
             + VGE+GWPTDG++ AN   A +FY G +  L + +GTP R G  +EVY+FGL DED KS
Sbjct  265   IVVGEVGWPTDGDKNANVGNAFRFYNGLLTKLGTNRGTPLRTGY-IEVYLFGLIDEDAKS  323

Query  1095  VLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTNM  1268
             + PG FERHWGI  YDGQPKF +DLSG G+ K L     ++YL KKWC    NAK  +N+
Sbjct  324   IAPGSFERHWGIFSYDGQPKFPVDLSGQGQNKLLVPAKNVQYLSKKWCMFNPNAKDVSNL  383

Query  1269  KATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTT  1448
                I+YAC  ADCTA   GSSC++L      SY FN Y+Q   Q+  SC+F GL  +TT 
Sbjct  384   ADKINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDQSCNFQGLATLTTQ  443

Query  1449  NLSTSTCNFNIGI  1487
             N+S   CNF I +
Sbjct  444   NVSQGNCNFIIQM  456



>gb|AES75227.2| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=437

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/419 (53%), Positives = 290/419 (69%), Gaps = 8/419 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++HPL P +VV+MLK NGI+KVKLF++ E  ++AL G+GIEVM+  PN 
Sbjct  23    VEGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNN  82

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L EM +YD A  +V++NVTRY   S  GV I  V +GNEPFLK Y    L  VT+PAL 
Sbjct  83    QLAEMSDYDRALQWVRKNVTRYNFKS-GGVNIKYVAVGNEPFLKAYNNSFL-NVTFPALM  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSP-PDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
             N+Q ALN+ G+G + KATVP NADVY SP  +  VPSAG+FRPD+ + + QI++ L +N+
Sbjct  141   NIQNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNN  200

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  N +FPFD+AFFDGV  P++DNG  YTNVFDAN+DT V+AL   G
Sbjct  201   APFTVNIYPFLSLY-GNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIG  259

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G M + VGE+GWPTDG++ AN   A +FY G +  LAS KGTP R G  +EVY+FGL D
Sbjct  260   FGNMPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQG-YIEVYLFGLID  318

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG--GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             ED KS+ PG+FERHWGI  +DG+PKF + +S   G+ K L G  ++ YL  KWC    NA
Sbjct  319   EDAKSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNA  378

Query  1254  -KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
                +N+   I+YAC  ADCT    GSSC++L      SY FN Y+Q   Q   +C+F G
Sbjct  379   NNLSNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEG  437



>ref|XP_008232375.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=478

 Score =   449 bits (1156),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 303/437 (69%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG + SH LPPK+VV+MLK NGIKKVKLF++    ++ALAG+G++VM+G PN  L
Sbjct  24    GLGVNWGSMGSHSLPPKNVVQMLKDNGIKKVKLFDAEPDTMDALAGSGMQVMVGIPNEKL  83

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +++ + Y  A+ +VK+NVT+Y      GV I  V +GNEP+L  Y      K TYPAL N
Sbjct  84    EKLADSYKEAQEWVKQNVTKY--LRDGGVNIRYVAVGNEPYLTSYNGT-YVKTTYPALKN  140

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+EAG G   KATVPFNADVY SP +KP  S G FR DI+  + +I++VL++N +P
Sbjct  141   IQKALDEAGSGGKVKATVPFNADVYESPSNKP--SDGRFRKDIKNNIVEILRVLNDNRTP  198

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  +  FP +FAFF+G  +P+ DN   Y NVFDAN DT ++AL + G G
Sbjct  199   FVVNIYPFLSLY-QSSDFPKEFAFFEGGSEPVKDNNIEYKNVFDANCDTLISALKKVGFG  257

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + +GE+GWPTDG++ AN  LA KFY G +K LA++ GTP R    LEVY+FGLFDE+
Sbjct  258   NLDIIIGEVGWPTDGDKNANGKLAKKFYDGLLKKLATEDGTPLRK-KKLEVYLFGLFDEN  316

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             QKS+ PGDFERHWGI  YDGQPKF +DLSG G+G   L GV  ++YL ++WC +KS+ + 
Sbjct  317   QKSIAPGDFERHWGIFRYDGQPKFTMDLSGKGQGNNLLKGVQGVQYLDQQWCVLKSDVRN  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +N +  + YAC  +DCT+   G SC  L +   +SY FNAYFQ  +Q+  +CDF G+  
Sbjct  377   LSNTQPEVGYACSMSDCTSLGVGRSC-DLDQHGNVSYAFNAYFQNKDQDVRACDFNGMAN  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +   N S   C F I I
Sbjct  436   IVKQNASMGDCLFPIQI  452



>ref|NP_001147672.1| glucan endo-1,3-beta-glucosidase 5 [Zea mays]
 gb|ACG28332.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=492

 Score =   450 bits (1157),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 297/441 (67%), Gaps = 6/441 (1%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G+     LGVNWG +++H LP  +VV+ML+ NGI+KVKLF++    ++ALAGT +EVM+ 
Sbjct  27    GLPAAGALGVNWGTMATHQLPTATVVRMLEDNGIRKVKLFDADAGPMDALAGTSVEVMVA  86

Query  351   TPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
              PN +L  M +Y  A  +V++NV+RY      GV I  V +GNEPFL  +       VT 
Sbjct  87    IPNNMLDMMTDYGTARDWVRQNVSRYNFDG--GVNIKYVAVGNEPFLSSFNGT-FLNVTL  143

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q+ALN+AG G T KATVP NADVY SP D  VPSAG FRPDI   + +I++ L+
Sbjct  144   PALQNIQRALNDAGFGDTIKATVPLNADVYNSPKDNLVPSAGRFRPDIAGLMTEIVQFLN  203

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
             ++ +PF +N+YPFLSLY  N  FP D+AFFDG   P+ DNG  YTNVFDAN+DT V+ALA
Sbjct  204   QSGAPFTVNIYPFLSLY-DNDDFPLDYAFFDGTGSPVVDNGIQYTNVFDANFDTLVSALA  262

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
               G G + V VGE+GWPTDG++ A A+ A KFY G ++ LA+  GTP RPG  +EVY+F 
Sbjct  263   AAGVGGLPVVVGEVGWPTDGDKHATAAFAQKFYAGLLRKLAASAGTPLRPGQYIEVYLFS  322

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKS  1247
             L DED KSV PG+FERHWGI+ YDGQPK+ +DLSG G+  AL     ++YLP++WC V  
Sbjct  323   LIDEDAKSVAPGNFERHWGIMRYDGQPKYAMDLSGQGRNTALVAARGVQYLPRQWCVVNP  382

Query  1248  NAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             NA+ T+ +  +++YAC  +DCT+   GSSC+ L      SY FN YFQ   Q  GSC F 
Sbjct  383   NAQDTSKIGDSVTYACTFSDCTSLGYGSSCNGLDAAGNASYAFNMYFQVQNQVEGSCYFQ  442

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL   T  N ST  CNF I I
Sbjct  443   GLAVPTAQNPSTDACNFTIQI  463



>ref|NP_001058984.2| Os07g0168600 [Oryza sativa Japonica Group]
 dbj|BAF20898.2| Os07g0168600, partial [Oryza sativa Japonica Group]
Length=558

 Score =   452 bits (1163),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 230/438 (53%), Positives = 295/438 (67%), Gaps = 11/438 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLG+NWG  ++HPLPPK+VV++LK NGI KVKLF++    ++ALAG+G+EVM+  PN  
Sbjct  102   EGLGINWGTQATHPLPPKAVVQLLKDNGIAKVKLFDTDFAAMSALAGSGVEVMVAIPNKD  161

Query  366   LKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             L  M  +Y  A+ +VK+NV R+      GV I  V +GNEPFLK Y       +T PAL 
Sbjct  162   LATMASDYGNAKDWVKKNVKRFDFDG--GVTIKYVAVGNEPFLKAYNGS-FINITLPALQ  218

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AGIG   KATVP NADVY    +  VPSAG FRP+I   +  I+K L +N++
Sbjct  219   NVQNALNDAGIGDRIKATVPLNADVY----ESTVPSAGRFRPEIAGLMTDIVKFLAKNNA  274

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  +  FP +FAFFDG   P++D G  YTNVFDAN+DT VAAL   GH
Sbjct  275   PFTVNIYPFLSLYL-DEHFPINFAFFDGGSTPVNDGGIMYTNVFDANFDTLVAALKAVGH  333

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++ A   LA +FY G +K LA+  GTPARP   +E+Y+FGL DE
Sbjct  334   GDMPIIVGEVGWPTDGDKNARVDLAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDE  393

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L YDGQPKF +DL+G G+   L     IEYLPK WC + +NAK 
Sbjct  394   DMKSVAPGSFERHWGVLRYDGQPKFAMDLAGQGRNTMLVPAKGIEYLPKTWCVINTNAKD  453

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   I++AC  ADCT    GSSC+ +      SY FNAYFQ   Q+  +C+F GL  
Sbjct  454   VSKLGDNINFACTYADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLAV  513

Query  1437  VTTTNLSTSTCNFNIGIK  1490
              T T+ +T+ CNF I IK
Sbjct  514   PTETDPTTAQCNFTIQIK  531



>dbj|BAJ90806.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   449 bits (1156),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 291/437 (67%), Gaps = 9/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV+MLK NGIKKVKLF++ +  L+ALAGT IEVM+  PN L
Sbjct  26    DALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNL  85

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  M   D A  +V+ N++RY      GV I  V +GNEPFL  Y   G F KVT+PAL 
Sbjct  86    LDLMNEKDNAREWVRHNISRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG  +  KATVP NADVY SP   PVPSAG FR D+ + + Q+++ L  N +
Sbjct  142   NIQNALNDAGFSEI-KATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YP+LSLY +   FP DFAFFDG+  P+ D   TYTNVFDAN+DT V+ALA  GH
Sbjct  201   PFTVNIYPYLSLYLS-ADFPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGH  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + +GE+GWPTDG++ AN +LA +FY G +  LA+  GTP RP   +EVY+FGL DE
Sbjct  260   GDLPIIIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDE  319

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L +DGQPKF +DL+G G+   L     + YLP+ WC    NA+ 
Sbjct  320   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGKGQNTMLVPAKGVRYLPRTWCVYNPNAED  379

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   ++YAC  ADCTA   GS+C+ +      SY FN YFQ   Q+  +CDF  L  
Sbjct  380   KSKLVENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALAV  439

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST+ CNF I I
Sbjct  440   PTQTDPSTAACNFPIQI  456



>dbj|BAJ98060.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   449 bits (1156),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 291/437 (67%), Gaps = 9/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV+MLK NGIKKVKLF++ +  L+ALAGT IEVM+  PN L
Sbjct  26    DALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNL  85

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  M   D A  +V+ N++RY      GV I  V +GNEPFL  Y   G F KVT+PAL 
Sbjct  86    LDLMNEKDNAREWVRHNISRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG  +  KATVP NADVY SP   PVPSAG FR D+ + + Q+++ L  N +
Sbjct  142   NIQNALNDAGFSEI-KATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YP+LSLY +   FP DFAFFDG+  P+ D   TYTNVFDAN+DT V+ALA  GH
Sbjct  201   PFTVNIYPYLSLYLS-ADFPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGH  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + +GE+GWPTDG++ AN +LA +FY G +  LA+  GTP RP   +EVY+FGL DE
Sbjct  260   GDLPIIIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDE  319

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L +DGQPKF +DL+G G+   L     + YLP+ WC    NA+ 
Sbjct  320   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGKGQNTMLVPAKGVRYLPRTWCVYNPNAED  379

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   ++YAC  ADCTA   GS+C+ +      SY FN YFQ   Q+  +CDF  L  
Sbjct  380   KSKLVENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALAV  439

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST+ CNF I I
Sbjct  440   PTQTDPSTAACNFPIQI  456



>ref|XP_009336373.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=479

 Score =   449 bits (1154),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 232/437 (53%), Positives = 302/437 (69%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSH LPPK VV+MLK NGIKKVKLF++    LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPSTLNALAGSGIQVMVGIPNDKL  82

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +++ + +  A+ +VKENVT++      GV I+ VG+GNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSFSEAQEWVKENVTKW--LHDGGVSISNVGVGNEPYLTSYNGT-YVKTTYPALKN  139

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+E+G G   KATVPFNADVY S  +KP  S G FR DI+  + +I+  L ++ +P
Sbjct  140   IQKALDESGAGDKVKATVPFNADVYESSSNKP--SDGCFRKDIKNNMVEILCHLRDSKAP  197

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  N +FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +EG G
Sbjct  198   FVVNIYPFLSLY-QNANFPQEFAFFEGSSKPVRDNNIEYKNVFDANCDTLINALKKEGFG  256

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + +GE+GWPTDG++ AN   A KFY G +K L  ++GTP R G  +EVY+FGLFDED
Sbjct  257   NMEILIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRRGK-IEVYLFGLFDED  315

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             QKSV PGDFERHWGI  YDGQPKF +DLSG G G + L  V  +EYL K+WC + S+ K 
Sbjct  316   QKSVAPGDFERHWGIFRYDGQPKFPMDLSGKGSGNQMLKAVQGVEYLDKQWCVLNSHVKN  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +  +A ++YAC  +DCT+   G SC+ L +    SY FN YFQT +Q+  +CDF G+  
Sbjct  376   LSQTQAELNYACAESDCTSLGTGRSCN-LDQQGNASYAFNIYFQTRDQDVRACDFNGMAT  434

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +T +N S   C F + I
Sbjct  435   ITKSNPSVGDCLFPVQI  451



>ref|XP_010549610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=488

 Score =   449 bits (1155),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 224/440 (51%), Positives = 290/440 (66%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G + LGVNWG ++SH LPPK+VV+MLK N I+KVKLF++    + A+AG+G+EVM+  PN
Sbjct  25    GGEALGVNWGTMASHQLPPKTVVQMLKGNNIQKVKLFDADGSTMGAIAGSGMEVMVAIPN  84

Query  360   ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
               LK M ++  A+ +V+ NVT Y      GV +  V +GNEPFL  Y       +TYPAL
Sbjct  85    DQLKAMGSFSRAKDWVRRNVTSYNFNG--GVNVKYVAVGNEPFLTSYNGT-FINLTYPAL  141

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q ALN+AG+G + KATVP NADVY SPP+KP PS+G FR DI  Q+  I+  L +N 
Sbjct  142   VNIQNALNQAGLGDSIKATVPLNADVYNSPPEKPFPSSGRFRQDILDQMSLIVNFLAQNK  201

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLD-DNGKTYTNVFDANYDTAVAALARE  896
             +PF +N+YPFLSLY ++  FP ++AFF+G +   D DNG  YTNVFDAN+DT VA+L   
Sbjct  202   APFTVNIYPFLSLYLSS-DFPVNYAFFEGQNTVNDPDNGVVYTNVFDANFDTLVASLKAL  260

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
              HG M + VGE+GWPTDG++ AN + A +FY G +  LA+ +GTP RPG  +EVY+FGL 
Sbjct  261   NHGDMPIIVGEVGWPTDGDKNANVANAERFYAGLLPRLAANRGTPMRPGY-IEVYLFGLL  319

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV--KS  1247
             DED KS+ PG FERHWGI  YDGQPKF +D SG G  K L G   ++YLP +WC      
Sbjct  320   DEDAKSIAPGSFERHWGIFKYDGQPKFPMDFSGQGLKKFLVGAQNVDYLPARWCMYNPNG  379

Query  1248  NAKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             N   + +   I YAC  +DCTA   GSSC +L      SY FN YFQ   Q+  +C F G
Sbjct  380   NGDISKLGENIDYACRFSDCTALGYGSSCGNLDVNGNASYAFNMYFQVQNQQEEACYFQG  439

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  +T+ NLS   CNF + I
Sbjct  440   LATITSQNLSQGQCNFPVQI  459



>ref|XP_010928419.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=485

 Score =   449 bits (1154),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 228/441 (52%), Positives = 299/441 (68%), Gaps = 11/441 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DG+GVNWG + SHP+ P  VV+MLK N I +VKLF++   I+NALAGTGIEVM+  PN 
Sbjct  27    IDGIGVNWGTLMSHPMDPAMVVQMLKGNRINQVKLFDADPWIVNALAGTGIEVMLAIPND  86

Query  363   LLKEM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
              L +M  NY+ A+ +VK+NV +Y     DGV I  V +GNEPFLK Y K      T+PAL
Sbjct  87    HLGDMGSNYENAKEWVKQNVIKYD--HKDGVHIKYVAVGNEPFLKSY-KGSFTSTTFPAL  143

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+QKAL+EAG+G   KAT+P NAD+Y SP +  VPSAG FR DI+  + +I++ L    
Sbjct  144   KNIQKALDEAGVGNRIKATIPQNADIYSSPVNNSVPSAGNFRKDIRALMTKIVRYLHSKG  203

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNG-KTYTNVFDANYDTAVAALARE  896
             SPF++N+YP+LSLY  + +FP DFAFFDG  +P+ D G   YTNVFDANYDT V +L + 
Sbjct  204   SPFVVNIYPYLSLY-QDPNFPVDFAFFDGKSQPVVDEGLHNYTNVFDANYDTLVWSLRKA  262

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   M + VGE+GWPTDG+E AN  LA +FY GF+K +A + GTP RPG  +EVY+FGL 
Sbjct  263   GVPNMKIIVGEVGWPTDGDENANTKLAKRFYDGFLKKMAGQVGTPLRPGK-MEVYLFGLI  321

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKS--  1247
             DED KSV+PG+FERHWGI  YDG+PKF  D +G    + L G   ++YL ++WC +    
Sbjct  322   DEDMKSVVPGNFERHWGIFTYDGRPKFATDFTGKVTERYLIGATGVQYLAERWCVLDEKA  381

Query  1248  -NAKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                K   + ++++YAC   DCT    GSSC  L+    +SY FNAYFQT +Q+  +CDF 
Sbjct  382   AKKKLKLIPSSVNYACSTGDCTPLGYGSSCEGLSLWGNISYAFNAYFQTMDQDVRACDFQ  441

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GLG++TT NLS   C F + I
Sbjct  442   GLGKITTANLSQGRCLFPVQI  462



>ref|XP_004982257.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
Length=495

 Score =   449 bits (1154),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 302/450 (67%), Gaps = 15/450 (3%)
 Frame = +3

Query  174   VAGL---DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             VAGL     LGVNWG +++H LP  +VV+ML+ NGI+KVKLF++    ++ALAG+GIEVM
Sbjct  20    VAGLPAAGALGVNWGTMATHRLPSGTVVRMLQDNGIRKVKLFDADPGPMDALAGSGIEVM  79

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +G PN +L  M +Y  A  +V ENV+RY      GV I  V +GNEPFL  +       V
Sbjct  80    VGIPNNMLDMMTDYGTARDWVHENVSRYNFDG--GVTIKYVAVGNEPFLSAFNGT-FLNV  136

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T PAL N+Q+AL++AG+G++ KATVP NADVY SP   PVPSAG FR DI   + +I++ 
Sbjct  137   TLPALQNIQRALDDAGLGESIKATVPLNADVYNSPVSNPVPSAGRFRSDIADLMTEIVQF  196

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L+++ +PF +N+YPFLSLY ++G FP D+AFFDG   P+ D  +G TYTNVFDAN+DT V
Sbjct  197   LNQSGAPFTVNIYPFLSLYGSDG-FPLDYAFFDGTSSPVVDAGSGITYTNVFDANFDTLV  255

Query  879   AALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEV  1058
             +ALA  G G + V VGE+GWPTDG+  A A+ A KFY G ++ LA+  GTP RP   +EV
Sbjct  256   SALAAAGAGGLPVVVGEVGWPTDGDTHATAAYAQKFYAGLLRKLAANAGTPLRPSQYIEV  315

Query  1059  YMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG-----KALTGVPEIEYLP  1223
             Y+F L DED KSV PG+FERHWGI+ YDGQPK+ +DLSGG+G      AL     ++YLP
Sbjct  316   YLFSLIDEDAKSVAPGNFERHWGIVRYDGQPKYPMDLSGGQGGNAAPAALVAARGVQYLP  375

Query  1224  KKWCTVKSNAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQ  1400
             ++WC    NA  T+ +   ++YAC  +DCTA   GSSC+ L      SY FN YFQ   Q
Sbjct  376   RQWCVANPNAPDTSRISDGVAYACSLSDCTALGYGSSCNGLDAAGNASYAFNMYFQVQNQ  435

Query  1401  EAGSCDFGGLGEVTTTNLSTSTCNFNIGIK  1490
               GSCDF GL   T  N ST  CNF I I+
Sbjct  436   AEGSCDFQGLAVTTAQNPSTDACNFTIQIE  465



>ref|XP_008338651.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=479

 Score =   448 bits (1152),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 301/437 (69%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSH LPPK VV+MLK NGIKKVKLF++    LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPXTLNALAGSGIQVMVGIPNEKL  82

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +++ + Y  A+ +VKENVT +      GV I+ VG+GNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSYSEAQEWVKENVTEW--LRDGGVSISNVGVGNEPYLTSYNGT-YVKTTYPALKN  139

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+E+G G   KATVPFNADVY S  +KP  S G FR DI+  + +I++ L ++ +P
Sbjct  140   IQKALDESGAGGKVKATVPFNADVYESXSNKP--SDGCFRKDIKNNMVEILRHLRDSKAP  197

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  N  FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +EG G
Sbjct  198   FVVNIYPFLSLY-QNADFPQEFAFFEGGSKPVRDNNIEYKNVFDANCDTLINALKKEGFG  256

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + +GE+GWPTDG++ AN   A KFY G +K L  ++GTP R G  +EVY+FGLFDED
Sbjct  257   NMEIVIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRKGK-IEVYLFGLFDED  315

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             +KSV PGDFERHWGI  YDGQPK  +DLSG G G + L  V  +EYL K+WC + S+ K 
Sbjct  316   ZKSVAPGDFERHWGIFRYDGQPKXPMDLSGKGSGNQMLKAVQGVEYLDKQWCVLNSSVKN  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +  +A ++YAC  +DCT+  +G SC+ L +   +SY FN YFQT +Q+  +CDF G   
Sbjct  376   LSQTQAELNYACAESDCTSLGSGRSCN-LDQQGNVSYAFNXYFQTRDQDVRACDFNGTAT  434

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +T +N S   C F + I
Sbjct  435   ITKSNPSVGDCLFPVQI  451



>ref|XP_008361509.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=479

 Score =   448 bits (1152),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/437 (53%), Positives = 301/437 (69%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSH LPPK VV+MLK NGIKKVKLF++    LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPXTLNALAGSGIQVMVGIPNEKL  82

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +++ + Y  A+ +VKENVT +      GV I+ VG+GNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSYSEAQEWVKENVTEW--LRDGGVSISNVGVGNEPYLTSYNGT-YVKTTYPALKN  139

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+E+G G   KATVPFNADVY S  +KP  S G FR DI+  + +I++ L ++ +P
Sbjct  140   IQKALDESGAGGKVKATVPFNADVYESTSNKP--SDGCFRKDIKNNMVEILRHLRDSKAP  197

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  N  FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +EG G
Sbjct  198   FVVNIYPFLSLY-QNADFPQEFAFFEGGSKPVRDNNIEYKNVFDANCDTLINALKKEGFG  256

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + +GE+GWPTDG++ AN   A KFY G +K L  ++GTP R G  +EVY+FGLFDED
Sbjct  257   NMEIVIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRKGK-IEVYLFGLFDED  315

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             +KSV PGDFERHWGI  YDGQPK  +DLSG G G + L  V  +EYL K+WC + S+ K 
Sbjct  316   ZKSVAPGDFERHWGIFRYDGQPKXPMDLSGKGSGNQMLKAVQGVEYLDKQWCVLNSSVKN  375

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +  +A ++YAC  +DCT+  +G SC+ L +   +SY FN YFQT +Q+  +CDF G   
Sbjct  376   LSQTQAELNYACAESDCTSLGSGRSCN-LDQQGNVSYAFNXYFQTRDQDVRACDFNGTAT  434

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +T +N S   C F + I
Sbjct  435   ITKSNPSVGDCLFPVQI  451



>dbj|BAK05853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   448 bits (1153),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 290/437 (66%), Gaps = 9/437 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV+MLK NGIKKVKLF++ +  L+ALAGT IEVM+  PN L
Sbjct  26    DALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNL  85

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  M   D A  +V+ N++RY      GV I  V +GNEPFL  Y   G F KVT+PAL 
Sbjct  86    LDLMNEKDNAREWVRHNISRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG  +  KATVP NADVY SP   PVPSAG FR D+ + + Q+++ L  N +
Sbjct  142   NIQNALNDAGFSEI-KATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YP+LSLY +   FP DFAFFDG+  P+ D   TYTNVFDAN+DT V+ALA  GH
Sbjct  201   PFTVNIYPYLSLYLS-ADFPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGH  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G +   +GE+GWPTDG++ AN +LA +FY G +  LA+  GTP RP   +EVY+FGL DE
Sbjct  260   GDLPTIIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDE  319

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L +DGQPKF +DL+G G+   L     + YLP+ WC    NA+ 
Sbjct  320   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGKGQNTMLVPAKGVRYLPRTWCVYNPNAED  379

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   ++YAC  ADCTA   GS+C+ +      SY FN YFQ   Q+  +CDF  L  
Sbjct  380   KSKLVENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALAV  439

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST+ CNF I I
Sbjct  440   PTQTDPSTAACNFPIQI  456



>ref|XP_003561381.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=494

 Score =   448 bits (1152),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 287/442 (65%), Gaps = 12/442 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG  +SHPLP K VV++L+ NGIKKVKLF +    ++ALAG+GIEVM   PN +
Sbjct  25    EGLGVNWGTQASHPLPAKVVVQLLRDNGIKKVKLFETNLDAMSALAGSGIEVMAAIPNNM  84

Query  366   LKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
             L +M  +   A  +VK NV R+      GV I  V +GNEPFL+ Y      K T PAL 
Sbjct  85    LHDMAADPKAARDWVKRNVKRFDFDG--GVIIKYVAVGNEPFLEAYNGS-FIKATLPALE  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG G   KATVP NADVY SP   PVPSAG FR DI   +  I+K L +N +
Sbjct  142   NIQNALNDAGAGDRIKATVPLNADVYNSPAKNPVPSAGRFRSDISGVMTDIVKFLAKNKA  201

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALARE  896
             PF +N+YPFLSLY ++  FP DFAFFD    P+ D  NG TYTNVFDAN+DT VAAL   
Sbjct  202   PFTVNIYPFLSLYLSD-DFPLDFAFFDDGGPPVHDGGNGVTYTNVFDANFDTLVAALRAA  260

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALE-VYMFGL  1073
             GHG M V VGE+GWPTDG+  A A+LA +FYGG +K LA+  G+PARPG  +E VY+FGL
Sbjct  261   GHGDMPVIVGEVGWPTDGDRRATAALAERFYGGLLKRLATTHGSPARPGQRIEAVYLFGL  320

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKA---LTGVPEIEYLPKKWCTVK  1244
              DED+KSV PG FERHWGI  YDGQPK+ +DL+G   +A   L     +EYL + WC + 
Sbjct  321   VDEDRKSVAPGSFERHWGIFRYDGQPKYGMDLAGQGRRANARLVPAKGVEYLSRTWCALN  380

Query  1245  SNA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
               A     +   I YAC  ADCT    GS+C+ +      SY FNAY+QT  Q+  +CDF
Sbjct  381   PKAGDLGKLGEKIDYACSNADCTTLGYGSTCNGMDARGNASYAFNAYYQTQSQKDEACDF  440

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL   T T+ ST  CNF I I
Sbjct  441   QGLALPTQTDPSTHACNFTIQI  462



>ref|XP_007207576.1| hypothetical protein PRUPE_ppa018453mg, partial [Prunus persica]
 gb|EMJ08775.1| hypothetical protein PRUPE_ppa018453mg, partial [Prunus persica]
Length=456

 Score =   446 bits (1147),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 301/437 (69%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG + SH LPPK+VV+MLK NGIKKVKLF++    ++ALAG+GI+VM+G PN  L
Sbjct  24    GLGVNWGSMGSHSLPPKNVVQMLKENGIKKVKLFDAEPDTMDALAGSGIQVMVGIPNEKL  83

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
              ++ + Y  A+ +VK+NVT Y      GV I  V +GNEP+L  Y      K TYPAL N
Sbjct  84    AKLADSYKEAQEWVKQNVTSY--LRDGGVNIRYVAVGNEPYLTSYNGT-YVKTTYPALKN  140

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+EAG G   KATVPFNADVY SP +KP  S G FR DI+  + +I+++L++N +P
Sbjct  141   IQKALDEAGSGGKIKATVPFNADVYESPSNKP--SDGRFRKDIKNNIVEILRILNDNRTP  198

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  +  FP +FAFF+G  +P+ DN   Y NVFDAN DT ++AL + G G
Sbjct  199   FVVNIYPFLSLY-QSSDFPKEFAFFEGGSEPVKDNNIDYKNVFDANCDTLISALKKVGFG  257

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + +GE+GWPTDG++ AN  +A KFY G +K LA++ GTP R    LEVY+FGLFDE+
Sbjct  258   NLDIIIGEVGWPTDGDKNANGKMAKKFYDGLLKKLATEDGTPLRK-KKLEVYLFGLFDEN  316

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             QKS+ PGDFERHWGI  YDG+PKF +DLSG G+G   L GV  ++YL ++WC +KS+ + 
Sbjct  317   QKSIAPGDFERHWGIFRYDGKPKFPMDLSGKGQGNNLLKGVQGVQYLDQQWCMLKSDVRN  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +N +  +SYAC  +DCT+   G SC  L +   +SY FN YFQ  +Q+  +CDF G+  
Sbjct  377   LSNTQPEVSYACSMSDCTSLGVGRSC-DLDQHGNVSYAFNMYFQNKDQDVRACDFNGMAN  435

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +   N S   C F I I
Sbjct  436   IVKQNASRGDCLFPIQI  452



>ref|XP_004966001.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=479

 Score =   447 bits (1149),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 293/434 (68%), Gaps = 11/434 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P SVVKMLKANGI +VKLF++    + AL  +GIEVM+G PN +L+
Sbjct  29    VGVNWGSQLSHPLLPTSVVKMLKANGISRVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  88

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  A+ +V ENVT Y     D +K+  V +GNEPFLK Y      + T+PAL N+Q
Sbjct  89    MMNSYGNAKDWVSENVTAYG----DKLKLKYVAVGNEPFLKAYNGS-FMRTTFPALKNIQ  143

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KALNEAG+G   KA VP NADVY+SP DKP  S+G FRPDI   +  ++K L ++ +PF+
Sbjct  144   KALNEAGVGDKVKAVVPLNADVYVSPDDKP--SSGSFRPDINDLMTDMVKFLHDHGAPFV  201

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++  FPF+FAFFDG     D  G +Y+NVFDANYDT V AL + G   +
Sbjct  202   VNIYPFLSLYQSD-DFPFEFAFFDGGRNIQDKGGISYSNVFDANYDTLVNALEKAGVPNL  260

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGE GWPTDGN+ AN  LA +FY G ++ L+  +GTP RPG  +EVY+FGLFDED K
Sbjct  261   KVIVGEAGWPTDGNKNANLKLARRFYDGLLEKLSKNEGTPVRPGK-MEVYLFGLFDEDMK  319

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSGGK-GKALTGVPEIEYLPKKWCTVKSNAK-FTN  1265
             S+ PG+FERHWGI  YDG+PKF +DL+G +  K L+ VP++EYLP +WC     AK  + 
Sbjct  320   SIAPGNFERHWGIFTYDGKPKFPIDLTGQRHDKLLSPVPDVEYLPHQWCVFDDGAKDKSK  379

Query  1266  MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTT  1445
             +   I YAC   DCTA   G SC+ L E   +SY FN YFQ  +Q+  +CDF GL +++ 
Sbjct  380   LPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKISD  439

Query  1446  TNLSTSTCNFNIGI  1487
              N ST  C F I +
Sbjct  440   KNASTRGCLFPIQV  453



>gb|ACG41694.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=485

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 287/440 (65%), Gaps = 12/440 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LGVNWG +S+  LPPK + + L  NG  KVK+F++ E  +  LAGT IE M+  PN +
Sbjct  26    DALGVNWGTMSARRLPPKVMARXLTDNGFTKVKIFDADERTMKGLAGTSIETMVAVPNDM  85

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +YD A  +V++NVT+Y  T   GV I  V +GNEPFL+ Y   G F  VT PAL 
Sbjct  86    LAAVADYDRARRWVRDNVTKY--TFDGGVNIKFVAVGNEPFLRAY--NGSFDHVTVPALR  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q+AL+EAG G   KATVP NADVY SP   PVPSAG FR D+ + +  +++VL+ + +
Sbjct  142   NIQRALDEAGHGAAVKATVPVNADVYDSPASNPVPSAGRFRSDVARVMADMVRVLNRSGA  201

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDG-VDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             P  +N+YPFLSLY  N  FP D+AFFDG    P+ D    YTNVFDAN+DT V+AL R G
Sbjct  202   PLTVNIYPFLSLY-GNDDFPLDYAFFDGGAGAPVVDGRAVYTNVFDANFDTLVSALKRVG  260

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G + V +GE+GWPTDG+  A A+LA +FY G ++ LA+++GTP RPG+ +E Y+FGL D
Sbjct  261   LGHLPVIIGEVGWPTDGDRHATAALAERFYAGLLQRLAARRGTPLRPGARIEAYLFGLVD  320

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVK--S  1247
             ED KSV PG+FERHWGI  +DG+PKF LDL  G G+    VP   +EYLP++WC +   S
Sbjct  321   EDAKSVAPGNFERHWGIFTFDGRPKFPLDLR-GDGRPAMPVPARGVEYLPRRWCVLNPIS  379

Query  1248  NAKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
              A    +   ++YAC RADCTA   G SC +L      SY FNAY+Q   Q   +CDF G
Sbjct  380   MAGDGRLPDNVAYACSRADCTALGYGCSCRALDARGNASYAFNAYYQAQGQVESACDFQG  439

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  V   + S   CNF++ +
Sbjct  440   LAVVVDEDASQGACNFSVQL  459



>ref|XP_008457953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=487

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/435 (51%), Positives = 286/435 (66%), Gaps = 9/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG ++SHPL P  VV +LK NGIKKVKLF+S    +NAL+G+ IE ++G PN  L+
Sbjct  30    LGVNWGSMASHPLNPNIVVNLLKDNGIKKVKLFDSDSWTVNALSGSKIETIVGIPNDQLE  89

Query  372   EM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              +  NY+ A+ +VKEN+T +      GV I  V +GNEPFL  Y    + K+T+PA+ N+
Sbjct  90    SLATNYNHAKDWVKENITAH--IYDGGVNIRYVAVGNEPFLTAYNGTYV-KLTFPAMQNI  146

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKALNEAG  K  K T P NADVY S  + P  S G FR DI  ++K+I++ LD N++ F
Sbjct  147   QKALNEAGYNKKIKVTCPLNADVYESASNHP--SDGQFRSDILDEMKEIVQFLDRNNAAF  204

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             M+N+YPFLSLY  N  FP DFAF D   + ++D GKTYTNV DANYDT V +L + GHG 
Sbjct  205   MVNIYPFLSLYL-NPDFPVDFAFMDENGRSINDKGKTYTNVLDANYDTLVWSLKKIGHGD  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDGN+FA   LA +FY G +K LASKKGTP RP   LEVY+FGLFDED 
Sbjct  264   MKIIVGEVGWPTDGNKFATVGLAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLFDEDT  323

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG FERHWG+  YDG+PKF +D +G    K L     ++YL  KWC VK++ K   
Sbjct  324   KSIQPGFFERHWGLFRYDGKPKFPIDFTGKDNDKMLVAAKGVQYLEHKWCVVKNSVKDLR  383

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
              + + + YAC  +DCT    GSSC++L     +SY +N YFQ  +Q   +C FG   E+ 
Sbjct  384   TISSQVDYACSMSDCTTLGYGSSCNNLNAKGNISYAYNMYFQMQDQSVEACVFGDSAEIV  443

Query  1443  TTNLSTSTCNFNIGI  1487
             T N S   C F I I
Sbjct  444   TKNASVGNCLFPIQI  458



>ref|XP_002449743.1| hypothetical protein SORBIDRAFT_05g022490 [Sorghum bicolor]
 gb|EES08731.1| hypothetical protein SORBIDRAFT_05g022490 [Sorghum bicolor]
Length=497

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 226/449 (50%), Positives = 290/449 (65%), Gaps = 22/449 (5%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG +S+  LPPK + ++L  NG +KVK+F++ E  +  LAGTGIE MI  PN +L 
Sbjct  26    LGVNWGTMSTRRLPPKVIARLLTDNGFRKVKIFDADERTMKGLAGTGIETMIAVPNDMLA  85

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALANM  548
              + +YD A  +VK+NVT+Y  T   GV I  V +GNEPFLK Y   G F  VT PAL N+
Sbjct  86    AVADYDRARQWVKDNVTKY--TFDGGVNIKFVAVGNEPFLKAY--NGSFDHVTVPALKNI  141

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL+EAG G   KATVP NADVY SP   PVPSAG FR D+   +  +++ L+ + +P 
Sbjct  142   QRALDEAGHGAAVKATVPVNADVYDSPASNPVPSAGRFRGDVAGVMTNMVRFLNRSGAPL  201

Query  729   MINVYPFLSLYFANGSFPFDFAFFDG---VDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
              +N+YPFLSLY  +  FP DFAFFDG     KP+ D    YTNVFDAN+DT V+AL R G
Sbjct  202   TVNIYPFLSLY-GDADFPLDFAFFDGGGGSAKPVVDGRVVYTNVFDANFDTLVSALRRVG  260

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G + V +GE+GWPTDG+  A A+LA +FY G +K LA+++GTP RPG+ +EVY+FGL D
Sbjct  261   LGHLPVMIGEVGWPTDGDRHATAALAERFYAGLLKRLAARRGTPLRPGARIEVYLFGLID  320

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLS-GGKGKALTGVPE--IEYLPKKWCTVK--  1244
             ED KSV PG+FERHWGI  +DG+PKF LDL  GG G+    VP   +EYLP++WC +   
Sbjct  321   EDAKSVAPGNFERHWGIFTFDGRPKFPLDLRGGGDGRPAMPVPARGVEYLPRRWCVLNHI  380

Query  1245  SNAKFTNMKAT--------ISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQ  1400
             S     +  AT        + YAC RADCTA   G SC +L      SY FNAY+Q   Q
Sbjct  381   SAGGGDDDDATAGGRVADNVGYACSRADCTALGYGCSCGALDARGTASYAFNAYYQAQGQ  440

Query  1401  EAGSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
                +CDF GL  V   + S   CNF++ +
Sbjct  441   VESACDFQGLAVVVHDDASQGACNFSVQV  469



>ref|XP_006299509.1| hypothetical protein CARUB_v10015679mg [Capsella rubella]
 gb|EOA32407.1| hypothetical protein CARUB_v10015679mg [Capsella rubella]
Length=498

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 287/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP+ VVKML+ NG  K+KLF + ++IL+AL G+ IEVMIG PN  LK
Sbjct  37    VGVNWGTMASHQLPPEKVVKMLQDNGFTKLKLFEADQNILDALVGSDIEVMIGIPNRFLK  96

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             E+  +  VA ++V+ENVT Y  +   GV I  + +GNEPFL+ Y    + + T PAL N+
Sbjct  97    EVAQDTSVAASWVEENVTAY--SYHGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNI  153

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL EA + K  K TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF
Sbjct  154   QRALEEADL-KNVKVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPF  212

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +KPL D    YTNVFDAN DT + A+ R     
Sbjct  213   TVNIYPFLSLY-GNAYFPLDFAFFDGTNKPLRDGSLVYTNVFDANLDTLICAMERYSFLG  271

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +F  G +KH  S  GTPAR G  ++VY+F L DED 
Sbjct  272   MKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVVMDVYLFSLVDEDA  331

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI G+DG+PK++LDLSG G    L  V +++YLPK WC +  NA    
Sbjct  332   KSIAPGTFERHWGIFGFDGRPKYELDLSGKGNDNPLVPVEDVKYLPKTWCVLDPNASNLD  391

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   I YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+QE   CDF GLG +T
Sbjct  392   DLPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQETWDCDFLGLGLIT  451

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  452   DEDPSDELCEFPVMI  466



>ref|NP_001050810.1| Os03g0656800 [Oryza sativa Japonica Group]
 gb|AAP50997.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF97974.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12724.1| Os03g0656800 [Oryza sativa Japonica Group]
 gb|EAY91247.1| hypothetical protein OsI_12861 [Oryza sativa Indica Group]
 gb|EAZ27997.1| hypothetical protein OsJ_11963 [Oryza sativa Japonica Group]
 dbj|BAG91465.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 297/441 (67%), Gaps = 11/441 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG ++SHPLPP++VV+ML+ NGI KVKLF++    + ALAG+G+EVM+  PN L
Sbjct  25    EGLGVNWGTMASHPLPPRAVVRMLQDNGISKVKLFDADAGTMEALAGSGVEVMVAIPNNL  84

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +YD A  +V ENV+RY  +   GV I  V +GNEPFL      G F  VT+PAL 
Sbjct  85    LDLLTDYDAARDWVHENVSRY--SFDGGVNIKYVAVGNEPFLS--SLNGTFLNVTFPALQ  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q+AL +AG G T KATVP NADVY SP +  VPSAG FRPDI   + +I++ L+++ +
Sbjct  141   NIQRALYDAGHGDTIKATVPLNADVYNSPENMQVPSAGRFRPDIAGLMTEIVQFLNQSGA  200

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALAREG  899
             PF +N+YPFLSLY  N +FP D+AFFDG   P+ D NG  YTNVFDAN+DT V+AL   G
Sbjct  201   PFTVNIYPFLSLY-GNDNFPLDYAFFDGTTSPVVDTNGIQYTNVFDANFDTLVSALVAAG  259

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G + V VGE+GWPTDG++ A A LA +FY G ++ LAS  GTP RP   +EVY+F L D
Sbjct  260   VGGLPVVVGEVGWPTDGDKHARADLAQRFYAGLLRKLASNAGTPLRPNQYVEVYLFSLVD  319

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-  1253
             ED KSV PG+FERHWGIL YDGQPK+ +DL+G G+  AL     + YLP+ WC +  +A 
Sbjct  320   EDAKSVAPGNFERHWGILRYDGQPKYSMDLAGQGRDTALVAARGVAYLPRAWCVLNPSAT  379

Query  1254  --KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
                 + +   ++YAC  ADCT+   GS+C+ +      SY FNAYFQ   Q   SC F G
Sbjct  380   PDAMSRVGDNVNYACTYADCTSLGYGSTCNGMDAAGNASYAFNAYFQVQNQVEESCGFQG  439

Query  1428  LGEVTTTNLSTSTCNFNIGIK  1490
             L   T  + ST+ CNF I I+
Sbjct  440   LAVQTQQDPSTNACNFTIQIE  460



>ref|XP_009393986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Musa acuminata 
subsp. malaccensis]
Length=417

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/395 (55%), Positives = 268/395 (68%), Gaps = 8/395 (2%)
 Frame = +3

Query  309   LNALAGTGIEVMIGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPF  488
             + ALAGTGIEVMI  PN +L  M +YD A+ +VK+NVTRY      GV I  V +GNEPF
Sbjct  1     MKALAGTGIEVMIAIPNDMLAMMNDYDAAKEWVKKNVTRYN--FEKGVNIKYVAVGNEPF  58

Query  489   LKFYEKQGLFKVTYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRP  668
             LK Y       +T+PAL N+Q ALNEAG+G T KAT+P NADVY SP   PVPSAG FRP
Sbjct  59    LKSY-NDSFTNITFPALKNIQNALNEAGVGDTIKATIPLNADVYDSPRSNPVPSAGKFRP  117

Query  669   DIQKQVKQIIKVLDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTN  848
             DI   + QI++   +N +PF++N+YPFLSLY  N  FP D+AFFDG   P+ D G  YTN
Sbjct  118   DIADLMAQIVEFFSQNGAPFIVNIYPFLSLY-GNSDFPIDYAFFDGTSNPVLDEGVEYTN  176

Query  849   VFDANYDTAVAALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGT  1028
             VFDAN+DT V+AL + G G + + VGE+GWPTDG+  AN ++A +FY G +K LA+  GT
Sbjct  177   VFDANFDTLVSALKKVGFGDLPIVVGEVGWPTDGDVNANVTMAERFYAGLLKRLAA--GT  234

Query  1029  PARPGSALEVYMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVP  1205
             P RP S +EVY+FGL DED KSV PG+FERHWG+  YDGQPKF +DLSG G+ + L G  
Sbjct  235   PLRPNSTIEVYLFGLMDEDAKSVAPGNFERHWGLFTYDGQPKFPVDLSGQGQNQLLVGAK  294

Query  1206  EIEYLPKKWCTVKSNA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAY  1382
             ++EYLP+KWC V  +A   + +   + YAC  ADCT+   G SC+ L      SY FN Y
Sbjct  295   DVEYLPRKWCAVNPSATDLSKLADNVKYACAHADCTSLGYGCSCNGLDARANASYAFNVY  354

Query  1383  FQTHEQEAGSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
             FQT   +  SCDF GL  VTT N+S  TCNF I I
Sbjct  355   FQTQNHKDESCDFQGLAAVTTQNMSNGTCNFTIQI  389



>ref|XP_008778100.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=466

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/429 (53%), Positives = 293/429 (68%), Gaps = 12/429 (3%)
 Frame = +3

Query  219   SHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV-NYDVA  395
             SHP+ P  VV+MLKANGI KVKLF++    +NALAGT IEVM+  PN  L +M  NY+ A
Sbjct  2     SHPMDPAMVVRMLKANGINKVKLFDADPWTVNALAGTRIEVMLAIPNDHLGDMSSNYENA  61

Query  396   EAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVT-YPALANMQKALNEAG  572
             + +VK+NV ++     DGV I  V +GNEPFL+ Y  +G F  T +PAL N+Q+AL+EAG
Sbjct  62    KDWVKQNVVKHD--RKDGVNIKYVAVGNEPFLRSY--KGSFASTAFPALKNIQRALDEAG  117

Query  573   IGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFL  752
             +G   KAT+P NAD+Y SP +  VPSAG FR DI+  + +I++ LD   SPF++N+YP+L
Sbjct  118   VGDRIKATIPQNADIYSSPVNDSVPSAGNFRRDIRALMTKIVRYLDSKGSPFVVNIYPYL  177

Query  753   SLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGEI  932
             SLY  + +FP DFAFFDG  +P+ D G  YTNVFDANYDT V +L + G   M + VGEI
Sbjct  178   SLY-QDPNFPVDFAFFDGKSQPVVDEGLRYTNVFDANYDTLVWSLRKAGVPNMKILVGEI  236

Query  933   GWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGDF  1112
             GWPTDG++ AN   A +FY G +K +A + GTP RPG  +EVY+FGL DED KSV PG+F
Sbjct  237   GWPTDGDKNANTKHAKRFYDGLLKKVAKEVGTPLRPGK-MEVYLFGLIDEDMKSVEPGNF  295

Query  1113  ERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA---KFTNMKATI  1280
             ERHWGI  YDG+PKF  D +G GK + L G   + YLPK+WC +   A   K   + +++
Sbjct  296   ERHWGIFSYDGRPKFPTDFTGKGKDRYLVGATGVRYLPKRWCALDETAAKKKLKMIPSSV  355

Query  1281  SYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLST  1460
             +YAC   DCT    GSSC  L+    +SY FNAYFQT +Q+  +CDF GLG+V TTNLS 
Sbjct  356   NYACSTGDCTPLGYGSSCQGLSLSGNISYAFNAYFQTMDQDVRACDFEGLGKVATTNLSQ  415

Query  1461  STCNFNIGI  1487
              TC F + I
Sbjct  416   GTCLFPVQI  424



>ref|NP_001183732.1| uncharacterized protein LOC100502325 precursor [Zea mays]
 gb|ACR38156.1| unknown [Zea mays]
 gb|AFW87159.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=488

 Score =   442 bits (1138),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/435 (52%), Positives = 295/435 (68%), Gaps = 12/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P SVVKMLKAN I +VK+F++    + AL  +GIEVM+G PN +L+
Sbjct  38    VGVNWGSQLSHPLLPGSVVKMLKANRIARVKMFDADSWPVGALVDSGIEVMLGIPNDMLE  97

Query  372   EMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M + Y  A+ +VKENVT Y     D +K+  V +GNEPFLK Y      K T+PAL N+
Sbjct  98    TMSSSYGNAQDWVKENVTAYG----DKLKLKYVAVGNEPFLKAYNGS-FMKTTFPALKNI  152

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL+EAG+G T KA VP NADVY+SP DKP  S+G FRPDI   +  ++K L ++ +PF
Sbjct  153   QKALDEAGVGNTVKAVVPLNADVYVSPDDKP--SSGAFRPDINGLMTDMVKFLHDHGAPF  210

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY ++ +FPF+FAFFDG     D  G TY+NVFDANYDT V AL + G   
Sbjct  211   VVNIYPFLSLYQSD-NFPFEFAFFDGGKNIQDKGGVTYSNVFDANYDTLVHALKKAGVPD  269

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + V VGE GWPTDGN++AN  LA +FY G ++ LA  +GTP R G  +EVY+FGLFDED 
Sbjct  270   LKVIVGEAGWPTDGNKYANFKLARRFYDGLLRKLAKNEGTPVRKGK-MEVYLFGLFDEDM  328

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG+FERHWGI  YDG+PKF +DL+G G  K L+ V +++YLP +WC     A+  +
Sbjct  329   KSIAPGNFERHWGIFTYDGKPKFPIDLTGQGHEKLLSPVTDVKYLPNQWCVFDDGAEDKS  388

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
              + + + YAC   DCTA   G SC+ L E   +SY FN YFQ  +Q+  +CDF GL ++T
Sbjct  389   KLPSNVQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFEGLAKIT  448

Query  1443  TTNLSTSTCNFNIGI  1487
               N ST  C F + I
Sbjct  449   DKNASTRGCLFPVQI  463



>ref|XP_010513396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=498

 Score =   442 bits (1138),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/435 (52%), Positives = 289/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP++VVKML+ NG  K+KLF + ++IL+AL G+ IEVMIG PN  LK
Sbjct  37    VGVNWGTMASHQLPPENVVKMLQDNGFTKLKLFEADQNILDALIGSDIEVMIGIPNRFLK  96

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM  +  VA ++V+ENVT Y  +   GVKI  + +GNEPFL+ Y    + + T PAL N+
Sbjct  97    EMAQDTAVAASWVEENVTAY--SYHGGVKIKYIAVGNEPFLQTYNGTYV-EFTLPALINI  153

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL EA + KT K TVPFNAD+Y SP   PVPS G FRP+++    +II  L  +DSPF
Sbjct  154   QRALEEADL-KTVKVTVPFNADIYFSPEANPVPSTGDFRPELRDATIEIINFLYSHDSPF  212

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +KPL D    YTNVFDAN DT + AL R     
Sbjct  213   TVNIYPFLSLY-GNAYFPLDFAFFDGTNKPLRDGNLVYTNVFDANLDTLICALERYSFLG  271

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +F  G +KH  S  GTPAR G  ++VY+F L +ED 
Sbjct  272   MKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLINEDA  331

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI  +DG+PK++LDLSG G  K L  V +++YLPK WC +  NA    
Sbjct  332   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGNDKPLVPVEDVKYLPKTWCVLDPNAYNLD  391

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   I YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF GLG VT
Sbjct  392   DLPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLGLGLVT  451

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  452   DEDPSDELCEFPVMI  466



>ref|XP_004982258.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X2 
[Setaria italica]
Length=493

 Score =   442 bits (1137),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 230/450 (51%), Positives = 300/450 (67%), Gaps = 17/450 (4%)
 Frame = +3

Query  174   VAGL---DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVM  344
             VAGL     LGVNWG +++H LP  +VV+ML+ NGI+KVKLF++    ++ALAG+GIEVM
Sbjct  20    VAGLPAAGALGVNWGTMATHRLPSGTVVRMLQDNGIRKVKLFDADPGPMDALAGSGIEVM  79

Query  345   IGTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKV  524
             +G PN +L  M +Y  A  +V ENV+ Y       +++  V +GNEPFL  +       V
Sbjct  80    VGIPNNMLDMMTDYGTARDWVHENVSCYDCR----LRLPYVAVGNEPFLSAFNGT-FLNV  134

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T PAL N+Q+AL++AG+G++ KATVP NADVY SP   PVPSAG FR DI   + +I++ 
Sbjct  135   TLPALQNIQRALDDAGLGESIKATVPLNADVYNSPVSNPVPSAGRFRSDIADLMTEIVQF  194

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAV  878
             L+++ +PF +N+YPFLSLY ++G FP D+AFFDG   P+ D G   TYTNVFDAN+DT V
Sbjct  195   LNQSGAPFTVNIYPFLSLYGSDG-FPLDYAFFDGTSSPVVDAGSGITYTNVFDANFDTLV  253

Query  879   AALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEV  1058
             +ALA  G G + V VGE+GWPTDG+  A A+ A KFY G ++ LA+  GTP RP   +EV
Sbjct  254   SALAAAGAGGLPVVVGEVGWPTDGDTHATAAYAQKFYAGLLRKLAANAGTPLRPSQYIEV  313

Query  1059  YMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG-----KALTGVPEIEYLP  1223
             Y+F L DED KSV PG+FERHWGI+ YDGQPK+ +DLSGG+G      AL     ++YLP
Sbjct  314   YLFSLIDEDAKSVAPGNFERHWGIVRYDGQPKYPMDLSGGQGGNAAPAALVAARGVQYLP  373

Query  1224  KKWCTVKSNAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQ  1400
             ++WC    NA  T+ +   ++YAC  +DCTA   GSSC+ L      SY FN YFQ   Q
Sbjct  374   RQWCVANPNAPDTSRISDGVAYACSLSDCTALGYGSSCNGLDAAGNASYAFNMYFQVQNQ  433

Query  1401  EAGSCDFGGLGEVTTTNLSTSTCNFNIGIK  1490
               GSCDF GL   T  N ST  CNF I I+
Sbjct  434   AEGSCDFQGLAVTTAQNPSTDACNFTIQIE  463



>ref|XP_008440124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=484

 Score =   442 bits (1136),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 227/436 (52%), Positives = 285/436 (65%), Gaps = 9/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+G NWG +SSHPL P  VVK+LK NGIKKVKLF+S    ++AL+G+ IE +IG PN  L
Sbjct  28    GIGANWGIMSSHPLRPNIVVKLLKDNGIKKVKLFDSDSWTVSALSGSKIETVIGIPNDQL  87

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             K+   +YD A+ +VKENVT +      GV +  V +GNE FL  Y      KVTYPA+ N
Sbjct  88    KKFAESYDDAKDWVKENVTTH--MFEGGVDLRYVSVGNEAFLSAYNGT-YVKVTYPAMQN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+ AG GK  K T   NADVY S  +  +PS G FRPDI K +K I+  LD N +P
Sbjct  145   IQKALDAAGHGKKVKVTTALNADVYESSTN--LPSDGQFRPDIYKTMKDIVHFLDRNKAP  202

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             FM+N+YPFLSLY  N +FP D+AFF G  K  +D GK+YTNVFDANYDT + +L + G  
Sbjct  203   FMVNIYPFLSLY-QNPNFPLDYAFFGGGAKATNDKGKSYTNVFDANYDTLIWSLKKIGVT  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDGN+FAN  LA +FY G  K LAS  GTP RP    EVY+FGL DED
Sbjct  262   DMKIIVGEVGWPTDGNKFANVELAKRFYDGLFKKLASGNGTPMRPKEKFEVYLFGLLDED  321

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KSVLPG FERHWGI  +DG+PKF +D+SG G  K L     ++YL KKWC +K N K F
Sbjct  322   MKSVLPGFFERHWGIFQFDGKPKFPMDMSGKGNDKMLVAAKGVQYLEKKWCVLKENVKNF  381

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   + YAC  +DCT+   GSSC++L +   +SY FN Y+Q  +Q   +CDF G   +
Sbjct  382   DKISKEVDYACGLSDCTSLGYGSSCNNLDKRGNISYAFNMYYQMQDQSVEACDFSGSAHI  441

Query  1440  TTTNLSTSTCNFNIGI  1487
                N S  +C F I I
Sbjct  442   VKKNASVGSCLFPIQI  457



>ref|NP_001140660.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF79768.1| unknown [Zea mays]
 gb|ACF84308.1| unknown [Zea mays]
 tpg|DAA42175.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=484

 Score =   442 bits (1136),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 218/438 (50%), Positives = 286/438 (65%), Gaps = 12/438 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG +S+  LPPK + ++L  NG  KVK+F++ E  +  LAGT IE MI  PN +L 
Sbjct  27    LGVNWGTMSARRLPPKVMARLLTDNGFTKVKIFDADERTMKGLAGTSIETMIAVPNDMLA  86

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALANM  548
              + +YD A  +V++NVT+Y  T   GV I  V +GNEPFL+ Y   G F  VT PAL N+
Sbjct  87    AVADYDRARRWVRDNVTKY--TFDGGVNIKFVAVGNEPFLRAY--NGSFDHVTVPALRNI  142

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL+EAG G   KATVP NADVY SP   PVPSAG FR D+ + +  +++ L+ + +P 
Sbjct  143   QRALDEAGHGAAVKATVPVNADVYDSPASNPVPSAGRFRSDVARVMADMVRFLNRSGAPL  202

Query  729   MINVYPFLSLYFANGSFPFDFAFFDG-VDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
              +N+YPFLSLY  N  FP D+AFFDG    P+ D    YTNVFDAN+DT V+AL R G G
Sbjct  203   TVNIYPFLSLY-GNDDFPLDYAFFDGGAGAPVVDGRAVYTNVFDANFDTLVSALKRVGLG  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + V +GE+GWPTDG+  A A+LA +FY G ++ LA+++GTP RPG+ +E Y+FGL DED
Sbjct  262   HLPVMIGEVGWPTDGDRHATAALAERFYAGLLQRLAARRGTPLRPGARIEAYLFGLVDED  321

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVK--SNA  1253
              KSV PG+FERHWGI  +DG+PKF LDL  G G+    VP   +EYLP++WC +   S A
Sbjct  322   AKSVAPGNFERHWGIFTFDGRPKFPLDLR-GDGRPAMPVPARGVEYLPRRWCVLNPISIA  380

Query  1254  KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
                 +   ++YAC RADCTA   G SC +L      SY FNAY+Q   Q   +CDF GL 
Sbjct  381   GDGRLADNVAYACSRADCTALGYGCSCGALDPRGNASYAFNAYYQAQGQVESACDFQGLA  440

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              V   + S   CNF++ +
Sbjct  441   VVVDEDASQGACNFSVQL  458



>ref|XP_008392630.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=477

 Score =   441 bits (1135),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 296/437 (68%), Gaps = 14/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SH LPPK+VV+MLK NGIKKVKLF++    LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGAMASHQLPPKNVVQMLKDNGIKKVKLFDAEPSTLNALAGSGIQVMVGIPNEKL  82

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +++ + Y  A+ +VKENVT++  +    V I+ V +GNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSYSEAQQWVKENVTKWLGS----VSISYVAVGNEPYLTSYNGS-YVKTTYPALKN  137

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKA+ E G G   KATVPFNADVY S   KP  S G FR DI+  + +I++ L +N SP
Sbjct  138   IQKAIREXGAGDKVKATVPFNADVYESSSSKP--SDGRFRKDIKNNMVEILRHLRDNKSP  195

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  +  FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +EG G
Sbjct  196   FVVNIYPFLSLY-QSPDFPKEFAFFEGGSKPVSDNNIEYKNVFDANCDTLINALKKEGFG  254

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + +GE GWPTDG++ AN   A KFY G +K L   +GTP R G  LEVY+FGLFDED
Sbjct  255   NMEIIIGEAGWPTDGDKNANIKNAKKFYDGLLKKLGKXEGTPLRKGK-LEVYLFGLFDED  313

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKG-KALTGVPEIEYLPKKWCTVKSNAK-  1256
             QKS+ PGDFERHWGI  YDGQPKF +DLSG G G + L  V  +EYL K+WC + S+ K 
Sbjct  314   QKSIAPGDFERHWGIFRYDGQPKFPMDLSGKGNGDQMLKAVKGVEYLEKQWCVLNSDVKN  373

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +   A ++YAC  +DCT+   G SC  L +  K+SY FN+YFQ  +Q+  +C+F G+  
Sbjct  374   MSQTDAELNYACAGSDCTSLGTGRSC-DLDQHGKVSYAFNSYFQNRDQDVRTCNFNGMAT  432

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +T  N S   C F + I
Sbjct  433   ITKNNPSVGDCLFPVQI  449



>ref|XP_009102513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=494

 Score =   441 bits (1134),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 288/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP++VVKMLK NG  K+KLF + ++ILNAL G+ IEVMIG PN LLK
Sbjct  37    VGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRLLK  96

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             E+  +  +A ++V+ENVT Y      GV I  + +GNEPFL+ Y    + + T PAL N+
Sbjct  97    EVAQDPALAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNI  153

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL EAG+ K  + TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF
Sbjct  154   QKALEEAGL-KNVRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSPF  212

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +  L D    Y NVFDAN DT V A+ R     
Sbjct  213   TVNIYPFLSLY-GNAYFPVDFAFFDGSNNSLRDGDLVYNNVFDANLDTLVCAMERYSFLG  271

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ ANA  A +F  G +KH  S  GTPAR G  ++VY+F L DED 
Sbjct  272   MKIIVGEVGWPTDGDKNANAKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDA  331

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI  +DG+PK++LDLSG G  K L  V +++YLPK WC + +NA    
Sbjct  332   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGDDKTLVPVQDVKYLPKTWCVLDTNAFNLD  391

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   + YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF GLG +T
Sbjct  392   DLADNVDYACSLSDCTALGYGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGLIT  451

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  452   DEDPSDDLCEFPVMI  466



>ref|XP_002530257.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32127.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=481

 Score =   441 bits (1133),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/440 (52%), Positives = 297/440 (68%), Gaps = 11/440 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             A L G+GVNWG+I+SHPLPP  VVKMLK N I +VKLF++    +NALAG+GIEVM+  P
Sbjct  24    AVLPGIGVNWGNIASHPLPPDIVVKMLKDNNINRVKLFDADAWTVNALAGSGIEVMVAIP  83

Query  357   NALLKEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             N +L+ + +  D A+ +VKENVT Y      GV I  V +GNEPFL  Y      K T+P
Sbjct  84    NNMLQYIADSVDNAKDWVKENVTEYL-RGQGGVDIRYVAVGNEPFLASYNGS-YDKTTFP  141

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+QKAL+E G+G   KA+VP NADVY    +  +PS G FR D++  + +I+  L +
Sbjct  142   ALQNVQKALDEEGVGDKIKASVPLNADVY----EGNLPSQGNFRKDVRDVMTKIVHHLHD  197

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             + +PF++N+YPF+SLY  + SFPF++AFFDG  K + D   TYTNVF+ANYDT V +L +
Sbjct  198   HKAPFIVNIYPFISLY-QSSSFPFEYAFFDGGGKKIQDKNVTYTNVFEANYDTLVWSLKK  256

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G   + + VGE+GWPTDG+ +ANA+LA KFY G +K LA+KKGTP RPG  L+VY+FGL
Sbjct  257   AGVPDLKILVGEVGWPTDGHVYANANLAKKFYDGLLKTLAAKKGTPLRPG-VLDVYLFGL  315

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DED KS LPG+FERHWGI  +DG+PKF +D SG G  K L     ++YLP KWC +   
Sbjct  316   LDEDMKSNLPGNFERHWGIFRFDGRPKFAMDFSGQGNDKMLIEAKGVQYLPAKWCVLNKE  375

Query  1251  AKFTNM-KATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
              +  +M  A ISYAC  ADC++ + GSSC+ L     +SY FN YFQ + Q+  +CDF G
Sbjct  376   VESKSMIPAEISYACSLADCSSLAYGSSCNKLDSDGNVSYAFNMYFQMNNQDVQACDFSG  435

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  + T N S  TC F I I
Sbjct  436   LATIVTQNASRGTCLFPIQI  455



>dbj|BAJ85378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   441 bits (1134),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/439 (51%), Positives = 292/439 (67%), Gaps = 10/439 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
              LGVNWG ++SH LPP +VV+ML+ NGI+KVKLF++    L ALAG+GIEVM+  PN +L
Sbjct  26    ALGVNWGTMASHQLPPSTVVRMLQDNGIRKVKLFDADAEPLGALAGSGIEVMVAIPNNML  85

Query  369   KEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALAN  545
               M +YD A  +V +NV+ Y      GV I  V +GNEPFL      G F  VT+PAL N
Sbjct  86    DMMTDYDTAREWVHKNVSAYNFDG--GVNIRYVAVGNEPFLS--SLNGTFLNVTFPALRN  141

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+AL+EAG+G T KATVP NADVY SP D  VPSAG FRP+I   + +I++ L+++ +P
Sbjct  142   IQQALDEAGVGDTVKATVPLNADVYESPKDNSVPSAGRFRPEIAGLMTEIVQFLNQSGAP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YP+LSLY  N  FP DFAFFDG   P+ D    YTNVFDAN+DT V+ALA+ G G
Sbjct  202   FTVNIYPYLSLY-GNDDFPLDFAFFDGASSPVVDGSIQYTNVFDANFDTLVSALAKAGVG  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + V VGE+GWPTDG + A A+ A +FY G  + LA   GTP RP   +E+Y+F L DED
Sbjct  261   GLPVVVGEVGWPTDGEKHATAAYAQRFYAGLFRKLAGNAGTPLRPNQYMEIYLFSLIDED  320

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KS+ PG+FERHWG++ YDGQPK+ +D +G G+  ALTG   ++YLP+ WC + +N+   
Sbjct  321   MKSIAPGNFERHWGVMRYDGQPKYAMDPTGQGRNTALTGARGVDYLPRAWCVLNTNSPPE  380

Query  1263  NMKA---TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
             NM      + YAC  ADCT+ S GS+C  +      SY FN YFQ  +Q   +C F GL 
Sbjct  381   NMSRLGDNVGYACTNADCTSLSYGSTCSGMDAAGNASYAFNTYFQMQDQVEEACGFDGLA  440

Query  1434  EVTTTNLSTSTCNFNIGIK  1490
               T  + ST TCNF I ++
Sbjct  441   VRTRQDPSTGTCNFTIQLE  459



>ref|XP_009336372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=480

 Score =   440 bits (1132),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 228/442 (52%), Positives = 300/442 (68%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + GLGVNWG +SSHPLPP  VVKMLK NGIKKVKLF++    + AL+GTGI+VM+G PN 
Sbjct  21    VQGLGVNWGQMSSHPLPPNDVVKMLKDNGIKKVKLFDADPTTMKALSGTGIDVMVGIPNE  80

Query  363   LLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPA  536
              L ++  +Y  A  +VK+NVT Y      GV I+ V +GNEPFL  Y   G F K  YP+
Sbjct  81    KLNKIAHDYATARKWVKQNVTAY--LHDGGVTISYVAVGNEPFLTSY--NGTFVKDVYPS  136

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             + N+QKAL+EAG+G   K  VPFNADVY SP +KP  S G FR DI+K + +I++ L  +
Sbjct  137   VKNVQKALDEAGVGGKIKCVVPFNADVYESPSNKP--SDGRFRKDIKKSMMEILEYLRTH  194

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              SPF++N+YPFLSL  ++G FP +FAFFDG  KP+ DNG  Y+NVFDANYDT + AL + 
Sbjct  195   KSPFVVNIYPFLSLSQSSG-FPKEFAFFDGGGKPVRDNGARYSNVFDANYDTLLWALKKA  253

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   + + +GE+GWPTDG++F N+ LA KFY G +K LAS+ GTP R G  LEVY+FGLF
Sbjct  254   GVPNLDIVIGEVGWPTDGHDFGNSRLAKKFYDGLLKKLASEVGTPLRKG-YLEVYLFGLF  312

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG--KALTGVPEIEYLPKKWCTVKSN  1250
             DED+KS+ PGDFERHWGI  YDG+PKF +DLSG     + L GV  ++YL KKWC + S+
Sbjct  313   DEDEKSIAPGDFERHWGIFRYDGKPKFPMDLSGQASGHQMLKGVEGVKYLEKKWCVLNSD  372

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
              +  +   A  +YAC +ADCT+     SC  L   +++SY FN ++Q  +Q+   CDF G
Sbjct  373   VRNLSRALAEFNYACSQADCTSLGGKRSC-DLEMHDRISYAFNEFYQKGDQDYRKCDFSG  431

Query  1428  LGEVTTTNLSTSTCNFNIGIKV  1493
             +G   T + S   C F + I +
Sbjct  432   MGTKVTRDPSKGDCLFRVQIDL  453



>ref|XP_006418767.1| hypothetical protein EUTSA_v10002822mg [Eutrema salsugineum]
 gb|ESQ37203.1| hypothetical protein EUTSA_v10002822mg [Eutrema salsugineum]
Length=545

 Score =   442 bits (1137),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 288/432 (67%), Gaps = 8/432 (2%)
 Frame = +3

Query  201   NWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV  380
             NWG ++SH LPP++VVKMLK NG  K+KLF + ++IL+AL G+ IEVMIG PN LLKE+ 
Sbjct  87    NWGTMASHQLPPQNVVKMLKDNGFTKLKLFEADQNILDALIGSEIEVMIGIPNRLLKEVA  146

Query  381   -NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKA  557
              + DVA ++V+ENVT Y      GV I  + +GNEPFL+ Y    + + T PAL N+Q+A
Sbjct  147   QDPDVAASWVEENVTAYYYHG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNIQRA  203

Query  558   LNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMIN  737
             L EA + KT K TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF +N
Sbjct  204   LEEADL-KTVKVTVPFNADIYFSPESNPVPSAGDFRPELRDATIEIINFLYTHDSPFTVN  262

Query  738   VYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTV  917
             +YPFLSLY  N  FP DFAFFDG +KPL D    YTNVFDAN DT V A+ R     M +
Sbjct  263   IYPFLSLY-GNAYFPLDFAFFDGTNKPLRDGDLVYTNVFDANLDTLVCAMERYSFLGMKI  321

Query  918   TVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSV  1097
              VGE+GWPTDG++ AN+  A +F  G +KH  S  GTPAR G  ++VY+F L DED KS+
Sbjct  322   IVGEVGWPTDGDKNANSKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDAKSI  381

Query  1098  LPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFTNMK  1271
              PG FERHWGI G+DG+PK++LDLSG GK   L  V +++YLPK WC +  NA    ++ 
Sbjct  382   APGTFERHWGIFGFDGRPKYELDLSGQGKDYPLVPVEDVKYLPKTWCVLDPNAFNLDDLA  441

Query  1272  ATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTN  1451
               + YAC  +DCT+   GSSC+ LT     SY FN Y+Q H+Q    CDF GLG +T  +
Sbjct  442   DNVDYACSLSDCTSLGYGSSCNHLTNIGNASYAFNMYYQMHDQNTWECDFLGLGLITDED  501

Query  1452  LSTSTCNFNIGI  1487
              S   C F + I
Sbjct  502   PSDELCEFPVMI  513



>ref|XP_008793474.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=476

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 292/441 (66%), Gaps = 15/441 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             A  + +GVNWG  +SHP+PPK VV+MLK NGI+KVKLF++   +++ALA TGIEVM+  P
Sbjct  22    ASTEAIGVNWGTQTSHPMPPKIVVQMLKDNGIQKVKLFDAESSVMSALANTGIEVMVAIP  81

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  L++M  Y  A+A+V ENVT Y+      V I  V +GNEPFLK Y    L K T+PA
Sbjct  82    NDQLEQMGTYSNAKAWVHENVTGYR-----DVNIKYVAVGNEPFLKSYNGTFL-KATFPA  135

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+QKAL+E G  K  KATVP NAD+Y SP D  VPSAG FR +I+  + +I + L  N
Sbjct  136   LKNIQKALDEMG-SKQIKATVPMNADIYSSPEDNSVPSAGDFRSEIRDLMVEIARFLSSN  194

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              SPF+IN+YPFLSLY  N +FP DFAFFDG  + ++D G  YTNVFDAN+DT V AL + 
Sbjct  195   GSPFVINIYPFLSLY-ENPNFPADFAFFDGGGRSINDKGTKYTNVFDANFDTLVWALKKA  253

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   M + VGE+GWPTDG++ A+ + A +FY G +K +AS  GTP RPG  ++VY+F   
Sbjct  254   GISSMKIIVGEVGWPTDGSKNADVAGAKRFYDGLMKKMASNTGTPVRPG-PMDVYLFAFI  312

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG FERHWGI  YDG+PKF +DLSG G GK L G   +EYL  +WC    +A
Sbjct  313   DEDMKSIQPGYFERHWGIFTYDGKPKFPMDLSGKGNGKYLAGASGVEYLSDEWCVYDPSA  372

Query  1254  KFTNMKA---TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             +  N +A   ++ +AC   DCTA    S C  L    ++SY FN YFQ  +Q+  +CDF 
Sbjct  373   R--NQEAVPRSMDFACSNGDCTALMGSSPCSKLDRSGRVSYAFNMYFQMKDQDVRACDFQ  430

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL ++T+ N S   C F I I
Sbjct  431   GLAKITSRNASRDGCLFPIQI  451



>emb|CDX77431.1| BnaA07g05690D [Brassica napus]
Length=494

 Score =   440 bits (1131),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 288/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP++VVKMLK NG  K+KLF + ++ILNAL G+ IEVMIG PN LLK
Sbjct  37    VGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRLLK  96

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             E+  +  +A ++V+ENVT Y      GV I  + +GNEPFL+ Y    + + T PAL N+
Sbjct  97    EVAQDPALAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNI  153

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL EAG+ K  + TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF
Sbjct  154   QKALEEAGL-KNVRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSPF  212

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +  L D    Y NVFDAN DT V A+ R     
Sbjct  213   TVNIYPFLSLY-GNAYFPVDFAFFDGSNNSLRDGDLVYNNVFDANLDTLVCAMERYSFLG  271

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ ANA  A +F  G +KH  S  GTPAR G  ++VY+F L DED 
Sbjct  272   MKIIVGEVGWPTDGDKNANAKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLIDEDA  331

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI  +DG+PK++LDLSG G  K L  V +++YLPK WC + +NA    
Sbjct  332   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGDDKTLVPVQDVKYLPKTWCVLDTNAFNQD  391

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   + YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF GLG +T
Sbjct  392   DLADNVDYACSLSDCTALGYGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGLIT  451

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  452   DEDPSDDLCEFPVMI  466



>ref|NP_001068140.2| Os11g0577800 [Oryza sativa Japonica Group]
 gb|ABA94484.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28503.2| Os11g0577800 [Oryza sativa Japonica Group]
Length=492

 Score =   439 bits (1130),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 289/441 (66%), Gaps = 14/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++H LPPK + ++LK NG KKVK+F++    ++ LAGTGIE MI  PN +
Sbjct  25    DGLGVNWGTMATHRLPPKVMARLLKDNGFKKVKIFDADATTMSGLAGTGIEAMIAVPNDM  84

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L  + +Y  A  +VKENVTRY  +   GV I  V +GNEPFLK Y  Q   + T PAL N
Sbjct  85    LAAVGDYGRAREWVKENVTRY--SFDGGVDIRYVAVGNEPFLKAYNGQ-FDRATVPALRN  141

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+AL+EAG GK  KATVP NADVY SP   PVPSAG FR D+   +  +++ L+ + +P
Sbjct  142   IQRALDEAGYGKRIKATVPVNADVYDSPASNPVPSAGRFRDDVAGTMADMVRFLNRSGAP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDG--VDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
               +N+YPFLSLY  N  FP D+AFFDG    +P+ DNG  YTNVFDAN+DT V+AL R G
Sbjct  202   LTVNIYPFLSLY-GNDDFPLDYAFFDGGPPPRPVVDNGINYTNVFDANFDTLVSALKRIG  260

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G + + +GE+GWPTDG++ A    A +FY G +K LA+++GTP RP + +EVY+FGL D
Sbjct  261   FGSLPIVIGEVGWPTDGDKHATVPYAQRFYSGLLKRLAARRGTPLRPRARIEVYLFGLMD  320

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNA  1253
             ED KSV PG+FERHWGI  +DG+PKF LDL G  G+    VP   ++YLP++WC +  N 
Sbjct  321   EDTKSVAPGNFERHWGIFTFDGRPKFPLDLRGA-GRPAMPVPAKGVKYLPRRWCVLNPNV  379

Query  1254  KFTN---MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                +   +   + YAC  +DCTA   G SC +L      SY FN Y+Q   Q   +CDF 
Sbjct  380   TDDDAGRLADNVGYACSHSDCTALGYGCSCGALDARGNASYAFNVYYQAQGQADAACDFQ  439

Query  1425  GLGEVTT--TNLSTSTCNFNI  1481
             GL  VT    +++   CNF++
Sbjct  440   GLAVVTEDDRDVAQGACNFSV  460



>ref|XP_004149714.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN61959.1| hypothetical protein Csa_2G277010 [Cucumis sativus]
Length=487

 Score =   439 bits (1129),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 221/435 (51%), Positives = 287/435 (66%), Gaps = 9/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LG NWG ++SHPL P  VV +L+ NGIKKVKLF+S    ++ALAG+ IE ++G PN  L+
Sbjct  30    LGANWGTMASHPLNPNIVVNLLEDNGIKKVKLFDSDSWTVSALAGSKIETIVGIPNDQLE  89

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              +  +Y+ A+ +VKENVT +      GV I  + +GNEPFL  Y    + K+T+PA+ N+
Sbjct  90    SLASDYNHAKDWVKENVTAH--IYDGGVNIRYIAVGNEPFLTAYNGTYI-KLTFPAMQNI  146

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL+EAG  K  K T P NADVY S  ++P  S G FR DI  ++K I++ L  ND+ F
Sbjct  147   QKALDEAGYSKKIKVTCPLNADVYESATNQP--SDGQFRSDILDEMKDIVRFLSRNDAAF  204

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             M+N+YPFLSLY  N  FP DFAFFD   K ++D GK YTNVFDAN+DT V +L + G G 
Sbjct  205   MVNIYPFLSLYL-NSDFPVDFAFFDENGKSINDKGKKYTNVFDANFDTLVWSLKKIGLGD  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + + VGE+GWPTDGN+FA   LA +FY G +K LASKKGTP RP   LEVY+FGL DED 
Sbjct  264   LKIIVGEVGWPTDGNKFATVELAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLLDEDL  323

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG FERHWG+  YDG+PKF LDL+G G  K L     ++YL  KWC VK++ K   
Sbjct  324   KSIQPGFFERHWGLFRYDGKPKFSLDLTGKGNDKRLVAAKGVQYLEHKWCVVKNSVKDLG  383

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
              + + I YAC  +DCT+   GSSC++L     +SY +N YFQ  +Q   +C FG   E+ 
Sbjct  384   TISSQIDYACSMSDCTSLGYGSSCNNLNSRGNISYAYNMYFQMQDQSVEACVFGESAEIV  443

Query  1443  TTNLSTSTCNFNIGI  1487
             T N S  +C F I I
Sbjct  444   TRNASVGSCLFPIQI  458



>ref|XP_004170594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
Length=487

 Score =   439 bits (1129),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 286/435 (66%), Gaps = 9/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LG NWG ++SHPL P  VV +L+ NGIKKVKLF+S    ++ALAG+ IE ++G PN  L+
Sbjct  30    LGANWGTMASHPLNPNIVVNLLEDNGIKKVKLFDSDSWTVSALAGSKIETIVGIPNDQLE  89

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              +  +Y+ A+ +VKENVT +      GV I  V +GNEPFL  Y    + K+T+PA+ N+
Sbjct  90    SLASDYNHAKDWVKENVTAH--IYDGGVNIRYVAVGNEPFLTAYNGTYI-KLTFPAMQNI  146

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL+EAG  K  K T P NADVY S  ++P  S G FR DI  ++K I++ L  ND+ F
Sbjct  147   QKALDEAGYSKKIKVTCPLNADVYESATNQP--SDGQFRSDILDEMKDIVRFLSRNDAAF  204

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             M+N+YPFLSLY  N  FP DFAFFD   K ++D GK YTNVFDAN+DT V +L + G G 
Sbjct  205   MVNIYPFLSLYL-NSDFPVDFAFFDENGKSINDKGKKYTNVFDANFDTLVWSLKKIGLGD  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + + VGE+GWPTDGN+FA   LA +FY G +K LASKKGTP RP   LEVY+FGL DED 
Sbjct  264   LKIIVGEVGWPTDGNKFATVELAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLLDEDL  323

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG FERHWG+  YDG+PKF LDL+G G  K L     ++YL  KWC VK++ K   
Sbjct  324   KSIQPGFFERHWGLFRYDGKPKFSLDLTGKGNDKRLVAAKGVQYLEHKWCVVKNSVKDLG  383

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
              + + I YAC  +DCT+   GSSC++L     +SY +N YFQ  +Q   +C FG   E+ 
Sbjct  384   TISSQIDYACSMSDCTSLGYGSSCNNLNSRGNISYAYNMYFQMQDQSVEACVFGESAEIV  443

Query  1443  TTNLSTSTCNFNIGI  1487
             T N S   C F I I
Sbjct  444   TRNASVGNCLFPIQI  458



>emb|CDY66442.1| BnaCnng50870D [Brassica napus]
Length=493

 Score =   439 bits (1129),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 225/435 (52%), Positives = 289/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP++VVKMLK NG  K+KLF + ++ILNAL G+ IEVMIG PN LLK
Sbjct  36    VGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRLLK  95

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             E+  +  +A ++V+ENVT Y      GV I  + +GNEPFL+ Y    + + T PAL N+
Sbjct  96    EVAQDPALAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNI  152

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL EAG+ K  + TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF
Sbjct  153   QKALEEAGL-KNVRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSPF  211

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +  L D    YTNVFDAN DT V A+ R     
Sbjct  212   TVNIYPFLSLY-GNAYFPVDFAFFDGSNNSLRDGDLVYTNVFDANLDTLVCAMERYSFLG  270

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ ANA  A +F  G +KH  S  GTPAR G  ++VY+F L DED 
Sbjct  271   MKIIVGEVGWPTDGDKNANAKSAKRFNEGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDA  330

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI  +DG+PK++LDLSG G  K L  V +++YLPK WC + +NA    
Sbjct  331   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGDDKTLVPVQDVKYLPKTWCVLDTNAFNQD  390

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   + YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF GLG +T
Sbjct  391   DLADNVDYACSLSDCTALGFGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGLIT  450

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  451   DEDPSDDFCEFPVMI  465



>dbj|BAK06743.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 289/436 (66%), Gaps = 15/436 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG   +HPL P +VVKMLK NGI KVKLF++    + AL  +GIEVM+G PN +L+
Sbjct  33    LGVNWGSQCTHPLDPSAVVKMLKENGIMKVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  92

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  AE +V EN T Y     D +K+  V +GNEPFLK Y      + T PAL N+Q
Sbjct  93    TMTSYGNAEDWVAENATSYG----DRLKLRYVAVGNEPFLKSYNGS-FMETTVPALKNIQ  147

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KAL+EAG+G   KATVP NADVY+   DKP  S G FRPDI   +  ++K + ++ +PF+
Sbjct  148   KALDEAGLGDKVKATVPLNADVYVG--DKP--SEGKFRPDIDDVMTDMVKFMHDHGAPFV  203

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++  FPF+FAFFDG     D+ G +Y+NVFDANYDT V+AL + G   +
Sbjct  204   VNIYPFLSLYQSD-DFPFEFAFFDGGHSIQDNGGVSYSNVFDANYDTLVSALKKAGVANL  262

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGE+GWPTDGN+  NA LA +FY G +K LA  +GT  R G  ++VY+FGLFDED K
Sbjct  263   KVIVGEVGWPTDGNKNGNAKLARRFYDGLLKKLAKNEGTHLRQGK-MDVYLFGLFDEDMK  321

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT--  1262
             S+ PG+FERHWGIL YDG+PKF +DLSG G  + L  VP +EYLPK+WC    +A     
Sbjct  322   SIAPGNFERHWGILTYDGKPKFAMDLSGQGNDRLLAAVPGVEYLPKQWCVFDEDAAKDGK  381

Query  1263  -NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   I YAC   DCTA   G SC+ L E   +SY FN YFQ  +Q+  +CDF GL ++
Sbjct  382   GKLPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKI  441

Query  1440  TTTNLSTSTCNFNIGI  1487
             +  N ST TC F + I
Sbjct  442   SDKNASTKTCLFPVQI  457



>ref|XP_004142041.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN48417.1| hypothetical protein Csa_6G486900 [Cucumis sativus]
Length=483

 Score =   439 bits (1128),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 285/436 (65%), Gaps = 9/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG +SSHPL P  VVK+LK NGIKKVKLF+S    +++L+G+ IE +IG PN  L
Sbjct  28    GIGVNWGILSSHPLRPNIVVKLLKDNGIKKVKLFDSDAWTVSSLSGSKIETIIGIPNDQL  87

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             K+   +YD A+ +VKENVT +      GV +  V +GNE FL  Y      KVT+PA+ N
Sbjct  88    KKFAKSYDDAKDWVKENVTSH--MFEGGVDLRYVSVGNEAFLTAYNGS-FVKVTFPAMQN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKA++ AG GK  K T   NADVY S  +  +PS G FRPDI   +K I+  LD N +P
Sbjct  145   IQKAIDAAGHGKKIKVTTALNADVYESSTN--LPSDGEFRPDIYSTMKDIVHFLDRNKAP  202

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             FM+N+YPFLSLY  N +FP D+AFFDG  K  +D  K+YTNVFDANYDT + +L + G  
Sbjct  203   FMVNIYPFLSLY-QNPNFPLDYAFFDGGGKATNDKDKSYTNVFDANYDTLIWSLKKLGVS  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDGN+FAN +LA +FY G  K LAS  GTP RP    EVY+FGL DED
Sbjct  262   DMKIIVGEVGWPTDGNKFANVNLAKRFYDGLFKKLASGDGTPMRPKEKFEVYLFGLLDED  321

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KSVLPG FERHWGI  +DG+PKF +D SG G  K L     ++YL KKWC +K N K F
Sbjct  322   MKSVLPGFFERHWGIFQFDGKPKFPMDSSGKGNDKMLVAAKGVQYLEKKWCVLKKNVKVF  381

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              N+   + YAC  +DCT+   GSSC++L     +SY FN Y+Q  +Q   +C F G  E+
Sbjct  382   DNISPQVDYACSLSDCTSLGYGSSCNNLDRRGNISYAFNMYYQMQDQSVEACVFNGSAEI  441

Query  1440  TTTNLSTSTCNFNIGI  1487
                N S  +C F I I
Sbjct  442   VKNNASVGSCLFPIQI  457



>gb|EAZ18823.1| hypothetical protein OsJ_34360 [Oryza sativa Japonica Group]
Length=492

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 288/441 (65%), Gaps = 14/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++H LPPK + ++LK NG KKVK+F++    ++ LAGTGIE MI  PN +
Sbjct  25    DGLGVNWGTMATHRLPPKVMARLLKDNGFKKVKIFDADATTMSGLAGTGIEAMIAVPNDM  84

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L  + +Y  A  +VKENVTRY  +   GV I  V +GNEPFLK Y  Q   + T PAL N
Sbjct  85    LAAVGDYGRAREWVKENVTRY--SFDGGVDIRYVAVGNEPFLKAYNGQ-FDRATVPALRN  141

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+AL+EAG GK  KATVP NADVY SP   PVPSAG FR D+   +  +++ L+ + +P
Sbjct  142   IQRALDEAGYGKRIKATVPVNADVYDSPASNPVPSAGRFRDDVAGTMADMVRFLNRSGAP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDG--VDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
               +N+YPFLSLY  N  FP D+AFFDG    +P+ DNG  YTNVFDAN+DT V+AL R G
Sbjct  202   LTVNIYPFLSLY-GNDDFPLDYAFFDGGPPPRPVVDNGINYTNVFDANFDTLVSALKRIG  260

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G + + +GE+GWPTDG++ A    A +FY G +K LA+++GTP RP + +EVY+FGL D
Sbjct  261   FGSLPIVIGEVGWPTDGDKHATVPYAQRFYSGLLKRLAARRGTPLRPRARIEVYLFGLMD  320

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNA  1253
             ED KSV PG+FERHWGI  +DG+PKF LDL G  G+    VP   ++YLP++WC +  N 
Sbjct  321   EDTKSVAPGNFERHWGIFTFDGRPKFPLDLRGA-GRPAMPVPAKGVKYLPRRWCVLNPNV  379

Query  1254  ---KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                    +   + YAC  +DCTA   G SC +L      SY FN Y+Q   Q   +CDF 
Sbjct  380   TDYDAGRLADNVGYACSHSDCTALGYGCSCGALDARGNASYAFNVYYQAQGQADAACDFQ  439

Query  1425  GLGEVTT--TNLSTSTCNFNI  1481
             GL  VT    +++   CNF++
Sbjct  440   GLAVVTEDDRDVAQGACNFSV  460



>ref|XP_010242326.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=480

 Score =   438 bits (1127),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 296/437 (68%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG+I S PL P +VV+MLK NGIKKVKLF+S    +++LAG+GI+VM+  PN  L
Sbjct  25    GIGVNWGNIMSQPLHPTTVVRMLKDNGIKKVKLFDSDYRTVSSLAGSGIQVMVAIPNDQL  84

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             +   N YD A+ +V+EN+T +      GV I  V IGNEPFLK Y   G+F + T+P L 
Sbjct  85    QLFSNDYDSAKYWVEENITSH--LYKGGVDIKYVAIGNEPFLKSY--HGVFTRHTFPTLK  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q+AL+EAG+G   KAT+P NADVY S   KP  S G FR DI++ + +I+K L++N +
Sbjct  141   NIQRALDEAGVGNKIKATIPLNADVYDSSTGKP--SGGSFRKDIREVMTKIVKHLNKNKA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF++N+YPFLSLY AN +FP +FAFF+G  KP+ DNG  YTNV DAN+DT V +L + G 
Sbjct  199   PFVVNIYPFLSLY-ANDNFPMEFAFFEGGSKPIYDNGVKYTNVLDANHDTLVWSLRKAGV  257

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
              K+ + +GEIGWPTDG++ AN   A +FY G  K LAS KGTP R G  +++Y+F LFDE
Sbjct  258   PKLKIIIGEIGWPTDGDKNANVRYAKRFYDGLFKRLASDKGTPLRAGR-MDIYLFSLFDE  316

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             +QKSVLPG FERHWGI  YDG+PKF++D SG G  K L     ++YLP++WC      K 
Sbjct  317   NQKSVLPGFFERHWGIFRYDGKPKFRMDFSGEGHDKLLVAAKGVKYLPRQWCVFDREIKN  376

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + + A + +AC+ ADCT   NG SC  L    K SY FN YFQ   Q   +CDF GL  
Sbjct  377   MSRVPANMDFACNYADCTPLVNGGSCSGLDIKWKTSYAFNIYFQMQNQAMDACDFQGLAI  436

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +TT N+S  +C F + I
Sbjct  437   LTTKNVSRGSCLFPVQI  453



>ref|XP_008338633.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
 ref|XP_008361504.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=480

 Score =   438 bits (1127),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 300/442 (68%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + G GVNWG +SSHPLPP +VVKMLK NGIKKVKLF++    + AL+GTGI+VM+G PN 
Sbjct  21    VQGFGVNWGQMSSHPLPPNNVVKMLKDNGIKKVKLFDADPTTMKALSGTGIDVMVGIPNE  80

Query  363   LLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPA  536
              L ++  +Y  A  +VK+NVT Y      GV I+ V +GNEPFL  Y   G F K  YP+
Sbjct  81    KLNKIAHDYATARKWVKQNVTAY--LHDGGVTISYVAVGNEPFLTGY--NGTFVKDVYPS  136

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             + N+QKAL+EAG+G   K  VPFNADVY SP +KP  S G FR DI+K + QI++ L  +
Sbjct  137   VKNVQKALDEAGVGGKIKCVVPFNADVYESPSNKP--SDGRFRKDIKKSMSQILEFLRTH  194

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              SPF++N+YPFLSL  ++G FP +FAFFDG  KP+ DNG  Y+NVFDANYDT + AL + 
Sbjct  195   KSPFVVNIYPFLSLSLSSG-FPKEFAFFDGGGKPVRDNGAQYSNVFDANYDTLLWALKKA  253

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   + + +GE+GWPTDG+++ N+ LA KFY G +K LAS+ GTP R G  LEVY+FGLF
Sbjct  254   GVPNLDIVIGEVGWPTDGHDYGNSRLAKKFYDGLLKKLASQVGTPLRKG-YLEVYLFGLF  312

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG--KALTGVPEIEYLPKKWCTVKSN  1250
             DED+KS+ PGDFERHWGI  YDG+PKF +DLSG     + L GV  ++YL K+WC + S+
Sbjct  313   DEDEKSIAPGDFERHWGIFRYDGKPKFPMDLSGQASGHQMLKGVEGVKYLQKQWCVLNSD  372

Query  1251  AK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
              +  +   A  +YAC +ADCT+     SC  L   +++S+ FN ++Q  +Q+   CDF G
Sbjct  373   VRNLSRALAEFNYACSQADCTSLGGKRSC-DLEMHDRISFAFNEFYQKGDQDYRKCDFSG  431

Query  1428  LGEVTTTNLSTSTCNFNIGIKV  1493
             +G   T + S   C F I I +
Sbjct  432   MGTKVTRDPSKGDCLFRIQIDL  453



>ref|NP_001152213.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 gb|ACG46412.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 gb|ACN35266.1| unknown [Zea mays]
 gb|AFW78871.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=481

 Score =   438 bits (1126),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/434 (49%), Positives = 289/434 (67%), Gaps = 9/434 (2%)
 Frame = +3

Query  195   GVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKE  374
             GVNWG + SHP+ P +VV+ML+ANG+ +VKLF++    ++ALAG+G++ M+  PN  L  
Sbjct  31    GVNWGTMMSHPIHPSAVVEMLRANGVDRVKLFDADPWTVSALAGSGVQAMLAAPNDQLAS  90

Query  375   MV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
             +  +   A  +V++NVT        GV +  V +GNEPFLK Y       +T+PAL NMQ
Sbjct  91    LARDPRRARDWVRQNVTA---NINAGVDVRYVAVGNEPFLKSYNGS-FINITFPALKNMQ  146

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             +A++EAG G+  K  VP NAD+Y SP +KPVPSAG FR DI   +  I+  L  ND+PF+
Sbjct  147   RAIDEAGFGQHIKVVVPLNADIYSSPENKPVPSAGTFRKDINTLMVDIVNYLHANDAPFV  206

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L + G   M
Sbjct  207   VNIYPFLSLY-QNPNFPLNFSFFDGATKPVYDQGMVYTNVFDANFDTLVWSLRKAGVPDM  265

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              + VGE+GWP+DG++ AN   A +FY GF+K +    GTP RPG  +EVY+F L DE+QK
Sbjct  266   RIIVGEVGWPSDGDKNANTKYAQRFYNGFLKKMTKNVGTPLRPGR-MEVYLFALIDENQK  324

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNA--KFTN  1265
             SVLPG FERHWG+  YDG+PKF +DLSG    ++  V  ++YLP +WC    +   K+ +
Sbjct  325   SVLPGRFERHWGLFTYDGKPKFSMDLSGNGKGSVAEVKGVQYLPPQWCVFNKDTKDKYKD  384

Query  1266  MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTT  1445
             + A+++YAC  ADCT    GSSC+ L+    +SY FN YFQT +Q+  +C FGGL ++TT
Sbjct  385   LPASVNYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAKITT  444

Query  1446  TNLSTSTCNFNIGI  1487
             TN S   C F + I
Sbjct  445   TNASQGGCLFPVQI  458



>ref|XP_007204529.1| hypothetical protein PRUPE_ppa017632mg [Prunus persica]
 gb|EMJ05728.1| hypothetical protein PRUPE_ppa017632mg [Prunus persica]
Length=486

 Score =   437 bits (1125),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 286/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VVKMLK NG  K+KLF + E IL AL GT IEVM+  PN +L+
Sbjct  26    FGVNWGTMATHQLPPEKVVKMLKDNGFNKLKLFEAEEKILAALMGTQIEVMLAVPNVMLQ  85

Query  372   EMVNYDVAEA-FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM    VA A +V  NVT Y   S  GV I  V +GNEPFLK Y    L K T PAL N+
Sbjct  86    EMSQDPVAAATWVDANVTSY--CSNGGVNIKYVSVGNEPFLKTYNGTYL-KTTLPALKNI  142

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG+G   KATVPFNAD+Y SP   PVPS G FRP+I+  + +II+ L  ND+PF
Sbjct  143   QEALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSLIEIIQYLHTNDAPF  202

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FPF FAFFDG  KP+ D    YTNVFDAN+DT V +L + G  +
Sbjct  203   TVNIYPFLSLY-GNTYFPFGFAFFDGTTKPMKDGDLLYTNVFDANFDTLVWSLTKAGFPE  261

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+  AN   A +F  G I+H  S  GTPAR G  ++VY+F L DED 
Sbjct  262   MKIMVGEVGWPTDGDINANIRNARRFNQGMIQHSLSGNGTPARKGK-IDVYLFSLIDEDA  320

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG+FERHWG+  YDG+PK+ LDL+G  + K L  V +++Y+ K+WC +  +AK   
Sbjct  321   KSIAPGNFERHWGLFEYDGKPKYNLDLTGSLENKGLAAVEDVDYMLKRWCVLDKDAKDLE  380

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
              +  +I YAC  +DCTA   G SC++L+     SY FN Y+Q + Q++ +CDF GL  VT
Sbjct  381   VLVKSIDYACTLSDCTALGYGCSCNNLSLRGNASYAFNMYYQVNSQKSWTCDFSGLAVVT  440

Query  1443  TTNLSTSTCNFNIGI  1487
               N S   C F + I
Sbjct  441   DENPSVGDCQFPVMI  455



>ref|XP_002466725.1| hypothetical protein SORBIDRAFT_01g012900 [Sorghum bicolor]
 gb|AAL73976.1|AF466201_5 3-glucanase [Sorghum bicolor]
 gb|EER93723.1| hypothetical protein SORBIDRAFT_01g012900 [Sorghum bicolor]
Length=493

 Score =   437 bits (1125),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 226/438 (52%), Positives = 296/438 (68%), Gaps = 11/438 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG +++H LPP +VV+ML+ NGI+KVKLF++    ++ALAGT +EVM+  PN +L 
Sbjct  31    LGVNWGTMATHRLPPGTVVRMLEDNGIRKVKLFDADAGPMDALAGTSVEVMVAIPNNMLD  90

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  A  +V +NV+RY      GV I  V +GNEPFL  +       VT PAL N+Q
Sbjct  91    MMTDYGTARDWVHQNVSRYNFDG--GVNIKYVAVGNEPFLSSFNGT-FLNVTLPALQNIQ  147

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             +ALN+AG+G + KATVP NADVY SP + P PSAG FR DI   + +I++ L+++ +PF 
Sbjct  148   RALNDAGLGDSIKATVPLNADVYNSPTESPYPSAGRFRSDIADLMTEIVQFLNQSGAPFT  207

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALAREGHG  905
             +N+YPFLSLY ++  FP D+AFFDG   P+ D  NG  YTNVFDAN+DT V+ALA  G G
Sbjct  208   VNIYPFLSLYDSD-DFPLDYAFFDGTSSPVVDAGNGIRYTNVFDANFDTLVSALAAAGVG  266

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + V VGE+GWPTDG++ A A+ A KFY G ++ LA+  GTP RPG  +EVY+F L DED
Sbjct  267   GLPVVVGEVGWPTDGDKHATAAYAQKFYAGLLRKLAANAGTPLRPGQYIEVYLFSLVDED  326

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGK---ALTGVPEIEYLPKKWCTVKSNAK  1256
              KSV PG+FERHWGI+ YDGQPK+ +DLS G+G+   AL     ++YLP++WC V  NA+
Sbjct  327   AKSVAPGNFERHWGIMRYDGQPKYGMDLS-GQGRTNTALVAARGVQYLPRQWCVVNPNAQ  385

Query  1257  -FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
               + +   ++YAC  +DCT+   GSSC+ L      SY FN YFQ   Q  GSCDF GL 
Sbjct  386   DMSKIGDGVTYACTFSDCTSLGYGSSCNGLDAGGNASYAFNMYFQVQNQVEGSCDFQGLA  445

Query  1434  EVTTTNLSTSTCNFNIGI  1487
               T  N ST  CNF I I
Sbjct  446   VPTAQNPSTDACNFTIQI  463



>gb|KFK39737.1| hypothetical protein AALP_AA3G281400 [Arabis alpina]
Length=455

 Score =   436 bits (1120),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 286/428 (67%), Gaps = 8/428 (2%)
 Frame = +3

Query  213   ISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV-NYD  389
             ++SH LPP++VVKMLK NG  K+KLF + ++IL+AL G+ IEVMIG PN LLKE+  +  
Sbjct  1     MASHQLPPENVVKMLKDNGFTKLKLFEADQNILDALIGSQIEVMIGIPNRLLKEVAQDPS  60

Query  390   VAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEA  569
             VA ++V+ENVT Y  +   GV I  + +GNEPFL+ Y    + + T PAL N+Q+AL EA
Sbjct  61    VAGSWVEENVTAY--SYQGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALINIQRALEEA  117

Query  570   GIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPF  749
              + KT K TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF +N+YPF
Sbjct  118   NL-KTVKVTVPFNADIYFSPESNPVPSAGDFRPELRDATIEIINFLYSHDSPFTVNIYPF  176

Query  750   LSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGE  929
             LSLY  N  FP DFAFFDG +KPL D    YTNVFDAN DT + A+ R    +M + VGE
Sbjct  177   LSLY-GNAYFPLDFAFFDGTNKPLRDGDLVYTNVFDANLDTLICAMERYSFLEMKIIVGE  235

Query  930   IGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGD  1109
             +GWPTDG++ AN   A +F  G +KH  S  GTPAR G  ++VY+F L DED KS+ PG 
Sbjct  236   VGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDTKSIAPGT  295

Query  1110  FERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFTNMKATIS  1283
             FERHWGI  +DG+PK++LDLSG G G AL  V +++YLPK WC +  NA    ++   I 
Sbjct  296   FERHWGIFEFDGRPKYELDLSGKGNGGALVPVEDVKYLPKTWCVLDPNAYNLDDLADNID  355

Query  1284  YACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTS  1463
             YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF GLG +T  N S  
Sbjct  356   YACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLGLGLITDENPSDD  415

Query  1464  TCNFNIGI  1487
              C F + I
Sbjct  416   LCEFPVMI  423



>ref|XP_010088872.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB37069.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=490

 Score =   437 bits (1123),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 290/442 (66%), Gaps = 9/442 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             V     +GVNWG I+SH LPP  VVKM+K NG  KVKLF + E IL AL GT IEVM+G 
Sbjct  30    VCSCSSVGVNWGTIASHKLPPGKVVKMMKENGFTKVKLFEADEWILEALMGTNIEVMVGI  89

Query  354   PNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
             PN +L+E+  N  VA  +V+ NVT Y  T   GV I  V +GNEPFL+ Y        T+
Sbjct  90    PNIMLQEISENPKVAADWVEANVTDYLYTG--GVHIKYVAVGNEPFLEAYNGS-YTHTTF  146

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q+ALN+ G+G   KATVPFNADVY SP   PVPSAG FRP ++    +II+ L 
Sbjct  147   PALKNIQQALNDQGVGSKVKATVPFNADVYFSPDSNPVPSAGDFRPQVRDITIEIIQYLH  206

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAAL  887
              ND+PF +N+YPFLSLY +N  FP DFAFFDG + KP+ D  + Y NVFDAN+DT V A+
Sbjct  207   ANDAPFTVNIYPFLSLY-SNDYFPLDFAFFDGTNYKPVRDGDRVYNNVFDANFDTLVEAI  265

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
              + G   M + VGE+GWPTDG+  AN   A +F  G ++H  S  GTPA+ G  +EVY+F
Sbjct  266   NKAGFPDMKIIVGEVGWPTDGDRHANVKNAKRFNQGMLQHALSGNGTPAQKGK-IEVYLF  324

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGK-GKALTGVPEIEYLPKKWCTVK  1244
              L DED KS+ PG+FERHWGI  YDG+PK++LDLSG K  K L  V  +EY+ K+WC + 
Sbjct  325   SLIDEDAKSIEPGNFERHWGIYEYDGKPKYELDLSGSKRNKGLVAVDGVEYMLKRWCVLN  384

Query  1245  SNAKFT-NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
              +A++  ++  +I YAC  +DCTA   GSSC++L+     SY FN Y+Q + Q + SCDF
Sbjct  385   PDAEYLDDLPDSIDYACSLSDCTALGFGSSCNNLSAQGNASYAFNMYYQVNGQNSRSCDF  444

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL  V+  + S   C F + I
Sbjct  445   SGLAVVSDKDPSVGDCQFPVMI  466



>ref|XP_004164948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
Length=483

 Score =   436 bits (1122),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/436 (51%), Positives = 285/436 (65%), Gaps = 9/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG +SSHPL P  VVK+LK NGIKKVKLF+S    +++L+G+ IE +IG PN  L
Sbjct  28    GIGVNWGILSSHPLRPNIVVKLLKDNGIKKVKLFDSDAWTVSSLSGSKIETIIGIPNDQL  87

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             K+   +YD A+ +VKENVT +      GV +  V +GNE FL  Y      KVT+PA+ N
Sbjct  88    KKFAKSYDDAKDWVKENVTSH--MFEGGVDLRYVSVGNEAFLTAYNGS-FVKVTFPAMQN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKA++ AG GK  K T   NADVY S  +  +PS G FRPDI   +K I+  LD N +P
Sbjct  145   IQKAIDAAGHGKKIKVTTALNADVYESSTN--LPSDGEFRPDIYSTMKDIVHFLDRNKAP  202

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             FM+N+YPFLSLY  N +FP D+AFFDG  K  +D  K+YTNVFDANYDT + +L + G  
Sbjct  203   FMVNIYPFLSLY-QNPNFPLDYAFFDGGGKATNDKDKSYTNVFDANYDTLIWSLKKLGVS  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDGN+FAN +LA +FY G  K LAS  GTP RP    EVY+FGL DED
Sbjct  262   DMKIIVGEVGWPTDGNKFANVNLAKRFYDGLFKKLASGDGTPMRPKEKFEVYLFGLLDED  321

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KSVLPG FERHWGI  +DG+PKF +D SG G  K L     ++YL KKWC +K N K F
Sbjct  322   MKSVLPGFFERHWGIFLFDGKPKFPMDSSGKGNDKMLVAAKGVQYLEKKWCVLKKNVKVF  381

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              ++   + YAC  +DCT+   GSSC++L     +SY FN Y+Q  +Q   +C F G  E+
Sbjct  382   DDISPQVDYACSLSDCTSLGYGSSCNNLDRRGNISYAFNMYYQMQDQSVEACVFNGSAEI  441

Query  1440  TTTNLSTSTCNFNIGI  1487
                N S  +C F I I
Sbjct  442   VKNNASVGSCLFPIQI  457



>ref|NP_001056153.1| Os05g0535100 [Oryza sativa Japonica Group]
 gb|AAT39206.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF18067.1| Os05g0535100 [Oryza sativa Japonica Group]
Length=488

 Score =   436 bits (1121),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 220/439 (50%), Positives = 290/439 (66%), Gaps = 10/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G   +GVNWG ++SHP+ P  VV+ML ANG+ +VK+F++       LA TGI+VM+  PN
Sbjct  29    GRAAVGVNWGTMTSHPILPCEVVRMLAANGVARVKMFDADPWTAAPLAHTGIQVMLAVPN  88

Query  360   ALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
               L  +  +   A  + ++NV+ Y      GV +  V +GNEPFLK Y    L  VT+PA
Sbjct  89    DQLARLAGDPRRAYRWAEQNVSAYLEA---GVDVRYVAVGNEPFLKSYNGS-LINVTFPA  144

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L NMQ+AL++ G+G   KA VP NADVY SP +KPVPSAG FR DI   +  I+  L+ N
Sbjct  145   LKNMQRALDKLGLGDHVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLNMN  204

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
             ++PF++N+YPFLSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L + 
Sbjct  205   NAPFVVNIYPFLSLY-QNPNFPLNFSFFDGGSKPVYDKGVVYTNVFDANFDTLVWSLRKA  263

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   M + VGE+GWPTDG++ AN   A KFY GF+K +    GTP RPG  +EVY+F L 
Sbjct  264   GVPDMKIIVGEVGWPTDGDKHANVRYAQKFYDGFLKKMVRNIGTPLRPG-WMEVYLFALI  322

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNA-  1253
             DE+QKSVLPG FERHWG+L YDG+PKF +DLSG     L GV E+EYLP +WC    +A 
Sbjct  323   DENQKSVLPGRFERHWGLLTYDGKPKFSMDLSGDGLDNLVGV-EVEYLPAQWCVFNKDAK  381

Query  1254  -KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
              KF ++ A ++YAC  ADCT    GSSC++L+    +SY FN YFQT +Q+  +C F GL
Sbjct  382   DKFKDLPAAVNYACSNADCTPLGYGSSCNNLSHDGNISYAFNIYFQTMDQDVRACSFEGL  441

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
              ++TT N S   C F + I
Sbjct  442   AKITTINASQGGCLFPVQI  460



>ref|XP_007208233.1| hypothetical protein PRUPE_ppa017706mg [Prunus persica]
 gb|EMJ09432.1| hypothetical protein PRUPE_ppa017706mg [Prunus persica]
Length=462

 Score =   435 bits (1119),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/438 (50%), Positives = 299/438 (68%), Gaps = 13/438 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG +SSHPLPP +VVKMLK NGI KVKLF++    + ALAG+G++VM+G PN  L 
Sbjct  5     LGVNWGQMSSHPLPPTNVVKMLKVNGIMKVKLFDADPKTMKALAGSGLDVMVGIPNEKLD  64

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             ++  +Y++A+ +VKENVT Y      GV I+ V +GNEPFL  Y    + K  +P++ N+
Sbjct  65    KLSHDYELAQKWVKENVTEY--LYKGGVSISSVAVGNEPFLSSYNGSYV-KTLFPSVKNI  121

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL+EAG+G   K  VPFNADVY SP +KP  S G FR +I K++ +I+  L    +PF
Sbjct  122   QRALDEAGVGGKIKCVVPFNADVYESPSNKP--SDGRFRKNIMKEMMEILHFLRAKKAPF  179

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY ++G FP +FAFFD    P+ D G  Y+NVFDANYDT + AL + G   
Sbjct  180   VVNIYPFLSLYQSSG-FPQEFAFFDN-GSPIRDKGAQYSNVFDANYDTLLWALKKVGFAN  237

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + + +GE+GWPTDGN + N  LA KFY G +K LASK+GTP R G  LEVY+FGLFDEDQ
Sbjct  238   LDIVIGEVGWPTDGNGYCNNRLAKKFYDGLLKKLASKEGTPLRKG-YLEVYLFGLFDEDQ  296

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGGKG--KALTGVPEIEYLPKKWCTVKSNAK-F  1259
             KS+ PGDFERHWGI  YDG+PKF +DL+G K   + L GV  ++YL ++WC + S+ +  
Sbjct  297   KSIAPGDFERHWGIFRYDGKPKFPMDLAGQKSGHQMLKGVEGVKYLERQWCVLNSDVRNL  356

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             +N +  ++YAC  ADCT+     SC  L   +++SY FN ++Q  +Q+  +CDF G+G  
Sbjct  357   SNAQVELNYACSMADCTSLGKQRSC-DLELHDRISYAFNEFYQNRDQDVRACDFSGMGTK  415

Query  1440  TTTNLSTSTCNFNIGIKV  1493
              T + ST  C F + + +
Sbjct  416   VTQDPSTGDCIFPVQVAL  433



>ref|NP_189076.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB02933.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAY78755.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76890.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=500

 Score =   436 bits (1122),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 284/435 (65%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP+ VVKML  N   K+KLF + ++IL+AL G+ IEVMIG PN  LK
Sbjct  39    VGVNWGIMASHQLPPEKVVKMLMDNSFTKLKLFEADQNILDALIGSDIEVMIGIPNRFLK  98

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM  +  VA ++V+ENVT Y      GV I  + +GNEPFL+ Y    + + T PAL N+
Sbjct  99    EMAQDTSVAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALINI  155

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL EA + K  K TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF
Sbjct  156   QRALEEADL-KNVKVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPF  214

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +K L D    YTNVFDAN DT + A+ R     
Sbjct  215   TVNIYPFLSLY-GNAYFPLDFAFFDGTNKSLRDGNLVYTNVFDANLDTLICAMERYSFLG  273

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +F  G +KH  S  GTPAR G  ++VY+F L DED 
Sbjct  274   MKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDA  333

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI  +DG+PK++LDLSG G  K L  V +++YLPK WC +  NA    
Sbjct  334   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGNDKPLVPVEDVKYLPKTWCILDPNAYNLD  393

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   I YAC  +DCTA   GSSC+ LT    +SY FN Y+Q H+Q+   CDF GLG +T
Sbjct  394   DLPDNIDYACSLSDCTALGYGSSCNHLTATGNVSYAFNMYYQMHDQKTWDCDFLGLGLIT  453

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  454   DEDPSDELCEFPVMI  468



>ref|XP_002440138.1| hypothetical protein SORBIDRAFT_09g026690 [Sorghum bicolor]
 gb|EES18568.1| hypothetical protein SORBIDRAFT_09g026690 [Sorghum bicolor]
Length=486

 Score =   436 bits (1121),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 211/435 (49%), Positives = 286/435 (66%), Gaps = 9/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG + SHP+ P +VV+ML+ANG+ +VKLF++    + ALAG+G++ M+  PN  L 
Sbjct  31    VGVNWGTMMSHPIHPSAVVEMLRANGVDRVKLFDADPWTVAALAGSGVQAMLAAPNDQLA  90

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              +  +   A  +V+ NVT        GV +  V +GNEPFLK Y       +T+PAL NM
Sbjct  91    SLARDPRRAREWVRHNVTA---NVNAGVDVRYVAVGNEPFLKSYNGS-FINITFPALKNM  146

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL+EAG G+  K  VP NAD+Y SP +KPVPSAG FR DI   +  I+  L  ND+PF
Sbjct  147   QRALDEAGFGQRIKVVVPLNADIYSSPENKPVPSAGSFRKDINTLMVDIVNYLHANDAPF  206

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L + G   
Sbjct  207   VVNIYPFLSLY-QNPNFPLNFSFFDGATKPVFDQGMVYTNVFDANFDTLVWSLRKAGVPD  265

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +FY GF++ +A   GTP RPG  +EVY+F L DE+Q
Sbjct  266   MRIIVGEVGWPTDGDKNANIKYAQRFYNGFLRKVAKNIGTPLRPGR-MEVYLFALIDENQ  324

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNA--KFT  1262
             KSVLPG FERHWG+  YDG+PKF +DLSG     L  +  ++YLP +WC    +   K+ 
Sbjct  325   KSVLPGRFERHWGLFTYDGKPKFSMDLSGNGKGNLAEIKGVQYLPSQWCVFNKDTKDKYK  384

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++ A+++YAC  ADCT    G+SC+ L+    +SY FN YFQT +Q+  +C FGGL  +T
Sbjct  385   DLPASVNYACSNADCTPLGYGASCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAMIT  444

Query  1443  TTNLSTSTCNFNIGI  1487
              TN S   C F + I
Sbjct  445   ATNASQGGCLFPVQI  459



>ref|XP_007048158.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOX92315.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=478

 Score =   436 bits (1120),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 291/439 (66%), Gaps = 13/439 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D +GVNWG +SSHPL P  VV++LK NG+KKVKLF++    +  LAGTGIEVM+G PN  
Sbjct  23    DNIGVNWGLMSSHPLHPSIVVRLLKDNGMKKVKLFDADPWAVGYLAGTGIEVMLGIPNDQ  82

Query  366   LKEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPAL  539
             LK M N Y  AE +VKEN+TR+      GV I  V +GNEPFL  Y   G F + T+PAL
Sbjct  83    LKTMANDYGAAEDWVKENLTRH--LHDGGVNIKYVAVGNEPFLSSY--NGSFTEYTFPAL  138

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+QKALN+AGIG   KATVP NADVY S  +  +PS G FR DI+  + QI+    E  
Sbjct  139   RNVQKALNDAGIGDKIKATVPLNADVYESGSN--IPSEGAFRSDIKDPLTQIVHFYKEQG  196

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
              PF+IN+YPFLSLY  N +FP DFAFFDG   PL+D    Y NVFDAN+DT V AL + G
Sbjct  197   CPFVINIYPFLSLY-QNTNFPRDFAFFDG-GHPLNDKNVQYDNVFDANHDTLVWALKKAG  254

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
                + + VGE+GWPTDGN+FA    A KFY G  K LAS KGTP RPG  +EVY+F LFD
Sbjct  255   VPDLKIIVGEVGWPTDGNKFATKDNAKKFYDGLFKKLASNKGTPLRPGK-MEVYVFSLFD  313

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             ED KSV PG+FERHWGI  +DG+PKF +D SG G  K L     ++YLPK+WC    +A 
Sbjct  314   EDMKSVQPGNFERHWGIFTFDGKPKFPMDFSGNGTDKPLVAAKGVQYLPKQWCVYDEDAM  373

Query  1257  FTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
                 + + +S+AC  ADCT    GSSC +     K+SY FN+Y+QT++Q+  +C+F GLG
Sbjct  374   NQQALPSQMSWACSHADCTCLQEGSSCFTGNTNFKISYAFNSYYQTNDQDVEACNFEGLG  433

Query  1434  EVTTTNLSTSTCNFNIGIK  1490
             ++   + S  TC F I IK
Sbjct  434   KIVNEDPSKGTCQFPIRIK  452



>ref|XP_008232612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=469

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 295/439 (67%), Gaps = 13/439 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSHPLPP  VVKMLK NGIKKVKLF++    + ALAG+G++VM+G PN  L
Sbjct  11    GLGVNWGQMSSHPLPPTDVVKMLKVNGIKKVKLFDADPKTMKALAGSGLDVMVGIPNDKL  70

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
              ++  +Y+ A+ +VKENVT Y      GV I+ V +GNEPFL  Y    + K  +P++ N
Sbjct  71    DKLSHDYEFAQKWVKENVTEY--LYEGGVSISYVAVGNEPFLSSYNGSYV-KTLFPSMKN  127

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+AL+EAG+G+  K  VPFNADVY SP +KP  S G FR DI K + +I+       +P
Sbjct  128   IQRALDEAGVGQKIKCVVPFNADVYESPSNKP--SDGRFRKDIMKHMLEILHFFRAKKAP  185

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY + G FP +FAFFD    P+ DNG  Y+NVFDANYDT + AL + G  
Sbjct  186   FVVNIYPFLSLYQSTG-FPQEFAFFDN-GSPIRDNGAQYSNVFDANYDTLLWALKKVGVA  243

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + +GE+GWPTDGN + N  LA KFY G +K LASK+GTP R G  LEVY+FGLFDED
Sbjct  244   NLDIVIGEVGWPTDGNGYCNNRLAKKFYDGLLKKLASKEGTPLRKG-YLEVYLFGLFDED  302

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG--KALTGVPEIEYLPKKWCTVKSNAK-  1256
             QKS+ PGDFERHWGI  YDG+PKF +DL+G     + L  V  ++YL ++WC + S+ + 
Sbjct  303   QKSIAPGDFERHWGIFRYDGKPKFPMDLAGQNSGHQMLKDVEGVKYLERQWCVLNSDVRN  362

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              +  +  ++YAC  ADCT+     SC  L   +++SY FN ++Q+ +Q+  +CDF G+G 
Sbjct  363   LSKAQVELNYACSLADCTSLGKQRSC-DLELHDRISYAFNEFYQSRDQDVRACDFNGMGT  421

Query  1437  VTTTNLSTSTCNFNIGIKV  1493
               T + S   C F + + +
Sbjct  422   KMTQDPSIGDCIFRVQVAL  440



>ref|XP_004250551.2| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Solanum lycopersicum]
Length=493

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 290/443 (65%), Gaps = 13/443 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP SVVKML  NG  KVKLF + E ILNAL GT IEVM+  PN +L+
Sbjct  30    VGVNWGTMATHQLPPNSVVKMLIENGFDKVKLFEADEVILNALIGTEIEVMLAIPNYMLE  89

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             ++  N  +A+++V+ NV+ Y    P GVKI  V +GNEPFL+ Y    L +   PAL N+
Sbjct  90    DLSSNPIIADSWVEANVSVY--AYPHGVKIRYVAVGNEPFLRTYNGTYL-QYILPALKNV  146

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+A+N+AG+G   KAT+PFNAD+Y SP    VPSAG FRP+++    QI++ L  ND+PF
Sbjct  147   QEAINKAGLGAKVKATIPFNADIYFSPESNQVPSAGDFRPEVRDLTLQIVQYLYSNDAPF  206

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY  N  FP DFAFFDG +KP+ D    YTNVFDAN+DT V +L + G   
Sbjct  207   VVNIYPFLSLY-GNIYFPLDFAFFDGSNKPVRDGDNVYTNVFDANFDTLVWSLKKAGFTD  265

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +F  G IKH  S++GTPAR G  +EVY+F L DE+ 
Sbjct  266   MKIVVGEVGWPTDGDKNANIENAMRFNQGLIKHCLSEQGTPARKGKKIEVYLFSLIDENA  325

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG--GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
             KS+ PG+FERHWG+  +DG+PK++LDLSG   K K L  V  + Y+ K+WC +K     T
Sbjct  326   KSIAPGNFERHWGMFEFDGKPKYELDLSGRMQKDKGLVAVEGVNYMHKRWCILKPENAVT  385

Query  1263  ------NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                   ++   I YAC  +DCTA   GSSC+ L+     SY FN Y+Q   Q +  CDF 
Sbjct  386   DADNAEDLPKNIDYACSLSDCTALGYGSSCNHLSTEGNASYAFNMYYQLKNQNSWDCDFD  445

Query  1425  GLGEVTTTNLSTSTCNFNIGIKV  1493
             GL  VT  + S   C F + I V
Sbjct  446   GLAVVTDEDPSDDKCRFPLMIAV  468



>emb|CDM86682.1| unnamed protein product [Triticum aestivum]
Length=498

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 222/441 (50%), Positives = 290/441 (66%), Gaps = 13/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++  LPPK + ++LK NG KKVK+F++ E  +  LAGTGIE MI  PN +
Sbjct  22    EGLGVNWGTLATRRLPPKVMARLLKDNGFKKVKIFDADEATMMGLAGTGIETMIAVPNDM  81

Query  366   LKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPAL  539
             L  +  +Y  A+ +VK NVT+Y      GV I  V IGNEPFL  Y   G +  VT PAL
Sbjct  82    LAAVAADYRRAKEWVKMNVTKYDYHG--GVNIKFVAIGNEPFLTAY--NGTYDNVTVPAL  137

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+Q+AL+EAG G   KATVP NADVY SP   PVPSAG FR D+   +  ++K L+ + 
Sbjct  138   KNIQRALDEAGHGSAIKATVPVNADVYDSPASNPVPSAGKFRDDVAAIITDMVKFLNHSG  197

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAALARE  896
             +PF +N+YPFLSLY  N +FP D+AFFDG    P+ DNG  YTNVFDAN+DT V+AL + 
Sbjct  198   APFSVNIYPFLSLY-GNDNFPIDYAFFDGAPPTPVIDNGVNYTNVFDANFDTLVSALDKI  256

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G G M V +GE+GWPTDG++ A    A +FY G +K LA+++GTP RP ++++VY+FGL 
Sbjct  257   GFGSMPVVIGEVGWPTDGDKHATVPYAERFYNGLLKRLAARQGTPLRPRASIDVYLFGLM  316

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KSV PG+FERHWGI  +DG+PKF LDL G G+     G   ++YLP++WC +  NA
Sbjct  317   DEDAKSVAPGNFERHWGIFTFDGRPKFPLDLRGNGRPAMPAGARGVQYLPRRWCVLNPNA  376

Query  1254  KFTNMKAT---ISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
               TN  A    ++YAC RADCT      SC +L      SY FNAY+Q   Q   +CDF 
Sbjct  377   S-TNATAVAENVAYACSRADCTPLGYACSCGALDAAGNASYAFNAYYQAQGQVPLACDFQ  435

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VT  ++S   CNF + +
Sbjct  436   GLAVVTDKDVSRPPCNFTVQV  456



>ref|XP_002438620.1| hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
 gb|EER89987.1| hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
Length=492

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/435 (52%), Positives = 288/435 (66%), Gaps = 12/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P SVVKMLK NGI +VKLF++    + AL  +GIEVM+G PN +L+
Sbjct  41    VGVNWGSQLSHPLLPDSVVKMLKKNGIARVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  100

Query  372   EMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M + Y  A+ +V ENVT Y     D +K+  V +GNEPFLK Y      K T+PAL N+
Sbjct  101   TMSSSYGNAQDWVNENVTSYG----DKLKLKYVAVGNEPFLKAYNGS-FMKTTFPALKNI  155

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             QKAL+EAG+G   KA VP NADVY+SP DKP  S+G FRPDI   +  ++K L ++ +PF
Sbjct  156   QKALDEAGVGDKVKAVVPLNADVYVSPDDKP--SSGAFRPDIDDLMTDMVKFLHDHGAPF  213

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY  + +FPF+FAFFDG     D  G  Y NVFDANYDT V AL + G   
Sbjct  214   VVNIYPFLSLY-QSSNFPFEFAFFDGGKNINDKGGVNYDNVFDANYDTLVHALKKAGVPN  272

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + V VGE GWPTDGN+ AN  LA +FY G +K LA  +GTP R G  +EVY+FGLFDED 
Sbjct  273   LKVIVGEAGWPTDGNKNANLKLARRFYDGLLKKLAKNEGTPVRKGK-MEVYLFGLFDEDM  331

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG+FERHWGI  YDG+PKF +DL+G G  K L+ V +++YLP +WC     AK  +
Sbjct  332   KSIAPGNFERHWGIFTYDGKPKFPIDLTGQGHDKLLSPVTDVKYLPSQWCVFDDGAKDKS  391

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
              +   + YAC   DCTA   G SC+ L E   +SY FN YFQ  +Q+  +C+F GL ++T
Sbjct  392   KLPGNLQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACEFDGLAKIT  451

Query  1443  TTNLSTSTCNFNIGI  1487
               N ST  C F + I
Sbjct  452   DKNASTRGCLFPVQI  466



>ref|XP_003565994.2| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=477

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/441 (50%), Positives = 294/441 (67%), Gaps = 12/441 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             A   G+GVNWG + SHP+ P +VV+ML ANG+ +VK+F++    ++ALAG+G++ M+  P
Sbjct  18    AAASGVGVNWGTMMSHPMHPAAVVRMLAANGVDRVKMFDADPWTVSALAGSGVQAMLAVP  77

Query  357   N-ALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             N  L     +   A  +V++NVTR      DGV I  V +GNEPFLK Y       +T+P
Sbjct  78    NDHLASVARDRRRARDWVRDNVTR---NLHDGVDIRYVAVGNEPFLKSYNGS-FINITFP  133

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q+AL+EAG+    KA VP NADVY SP + PVPSAG FR DI   +  I+  L  
Sbjct  134   ALKNIQRALDEAGL--LVKAVVPLNADVYNSPENNPVPSAGNFRRDINALMVDIVNFLHR  191

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             ND+PF++N+YP+LSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L +
Sbjct  192   NDAPFVVNIYPYLSLY-QNANFPLNFSFFDGGSKPVYDKGMVYTNVFDANFDTLVWSLRK  250

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G   M + VGEIGWPTDG++ AN   A KFY GF+K ++   GTP RPG  +E Y+F L
Sbjct  251   AGVPDMKIIVGEIGWPTDGDKNANVKYAQKFYDGFLKKISKNVGTPLRPGR-MEAYLFAL  309

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN  1250
              DE+QKSVLPG FERHWG+  YDG+PKF +DLSG G+ K L GV  ++YLP +WC    +
Sbjct  310   IDENQKSVLPGRFERHWGLFTYDGKPKFSMDLSGNGQNKFLFGVEGVQYLPSQWCVFNKD  369

Query  1251  A--KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             A  K+ ++ A+++YAC  ADCT    GSSC+ L+    +SY FN YFQT +Q+  +C FG
Sbjct  370   AKDKYRDLPASVNYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFG  429

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL ++ TTN S   C F + I
Sbjct  430   GLAKIVTTNASQGGCVFPVQI  450



>gb|EAY81406.1| hypothetical protein OsI_36575 [Oryza sativa Indica Group]
Length=494

 Score =   435 bits (1119),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/441 (49%), Positives = 289/441 (66%), Gaps = 14/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++H LPPK + ++L+ NG KKVK+F++    ++ LAGTGIE MI  PN +
Sbjct  27    DGLGVNWGTMATHRLPPKVMARLLQDNGFKKVKIFDADATTMSGLAGTGIEAMIAVPNDM  86

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L  + +Y  A  +VKE+VTRY  +   GV I  V +GNEPFLK Y  +   + T PAL N
Sbjct  87    LAAVGDYGRAREWVKESVTRY--SFDGGVDIRYVAVGNEPFLKAYNGE-FDRATVPALRN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+AL+EAG GK  KATVP NADVY SP   PVPSAG FR D+   +  +++ L+ + +P
Sbjct  144   IQRALDEAGYGKRIKATVPVNADVYDSPASNPVPSAGRFRDDVAGTMADMVRFLNRSGAP  203

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDG--VDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
               +N+YPFLSLY  N  FP D+AFFDG    +P+ DNG  YTNVFDAN+DT V+AL R G
Sbjct  204   LTVNIYPFLSLY-GNDDFPLDYAFFDGGPPPRPVVDNGINYTNVFDANFDTLVSALKRIG  262

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
              G + + +GE+GWPTDG++ A    A +FY G +K LA+++GTP RP + +EVY+FGL D
Sbjct  263   FGSLPIVIGEVGWPTDGDKHATVPYAQRFYSGLLKRLAARRGTPLRPRARIEVYLFGLMD  322

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNA  1253
             ED KSV PG+FERHWGI  +DG+PKF LDL G  G+    VP   ++YLP++WC +  N 
Sbjct  323   EDTKSVAPGNFERHWGIFTFDGRPKFPLDLRGA-GRPAMPVPAKGVKYLPRRWCVLNPNV  381

Query  1254  KFTN---MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                +   +   + YAC  +DCTA   G SC +L      SY FN Y+Q   Q   +CDF 
Sbjct  382   TDDDAGRLADNVGYACSHSDCTALGYGCSCGALDARGNASYAFNVYYQAQGQADAACDFQ  441

Query  1425  GLGEVTT--TNLSTSTCNFNI  1481
             GL  VT    +++   CNF++
Sbjct  442   GLAVVTEDDRDVAQGACNFSV  462



>ref|XP_006352469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=489

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/443 (50%), Positives = 290/443 (65%), Gaps = 13/443 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP SVVKML  NG  KVKLF + E ILNAL GT IEVM+  PN +L+
Sbjct  25    VGVNWGTMATHQLPPNSVVKMLIENGFDKVKLFEADEVILNALIGTEIEVMLAIPNYMLE  84

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             ++  N  +A+++V+ NV+ Y    P GVKI  V +GNEPFL+ Y    L +   PAL N+
Sbjct  85    DLSSNSIIADSWVEANVSAY--AYPHGVKIRYVAVGNEPFLRTYNGTYL-QYILPALKNV  141

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+A+N+AG+G   KAT+PFNAD+Y SP    VPSAG FRP+++    QI++ L  ND+PF
Sbjct  142   QEAINKAGLGAKVKATIPFNADIYFSPESNQVPSAGDFRPEVRDLTLQIVQYLYLNDAPF  201

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY  N  FP DFAFFDG +KP+ D    YTNVFDAN+DT V +L + G   
Sbjct  202   VVNIYPFLSLY-GNIYFPLDFAFFDGSNKPVRDGDYVYTNVFDANFDTLVWSLKKAGFTD  260

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +F  G IKH  S++GTPAR G  +EVY+F L DE+ 
Sbjct  261   MKIVVGEVGWPTDGDKNANNENAMRFNQGLIKHCLSEQGTPARKGKKIEVYLFSLIDENA  320

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG--GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
             KS+ PG+FERHWG+  +DG+PK++LDLSG   K K L  V  + Y+ K+WC +K     T
Sbjct  321   KSIAPGNFERHWGMFEFDGKPKYELDLSGRMQKDKGLVAVEGVNYMHKRWCILKPENAVT  380

Query  1263  ------NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                   ++   I YAC  +DCTA   GSSC+ L+     SY FN Y+Q   Q +  CDF 
Sbjct  381   DVDNAEDLPKNIDYACSLSDCTALGYGSSCNHLSTEGNASYAFNMYYQLKNQNSWDCDFD  440

Query  1425  GLGEVTTTNLSTSTCNFNIGIKV  1493
             GL  VT  + S   C F + I V
Sbjct  441   GLAVVTDEDPSDDKCRFPLMIAV  463



>ref|XP_004961391.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=450

 Score =   433 bits (1114),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 213/429 (50%), Positives = 287/429 (67%), Gaps = 10/429 (2%)
 Frame = +3

Query  213   ISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV-NYD  389
             + SHP+ P +VV ML+ANG+ +VKLF++    + ALAG+G++ M+  PN  L+ +  +  
Sbjct  1     MMSHPIHPSAVVGMLRANGVDRVKLFDADPWTVAALAGSGVQAMLAAPNDQLESLARDPR  60

Query  390   VAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEA  569
              A  +V+ NVT        GV +  V +GNEPFLK Y       +T+PAL NMQ+AL+EA
Sbjct  61    RARDWVRHNVT---ANLNAGVDVRYVAVGNEPFLKSYNGS-FINITFPALKNMQRALDEA  116

Query  570   GIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPF  749
             G G+  K  VP NAD+Y SP +KPVPSAG FR DI   +  I+  L  ND+PF++N+YPF
Sbjct  117   GFGQRIKVVVPLNADIYSSPENKPVPSAGSFRKDINALMVDIVNFLHVNDAPFVVNIYPF  176

Query  750   LSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGE  929
             LSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L + G   M + VGE
Sbjct  177   LSLY-QNPNFPLNFSFFDGATKPVYDQGMVYTNVFDANFDTLVWSLRKAGVPDMRIIVGE  235

Query  930   IGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGD  1109
             +GWPTDG++ AN   A +FY GF+K++A   GTP RPG  ++VY+F L DE+QKSVLPG 
Sbjct  236   VGWPTDGDKNANVKYAQRFYSGFLKNMAKNVGTPLRPGH-MDVYLFALIDENQKSVLPGR  294

Query  1110  FERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA--KFTNMKATI  1280
             FERHWG+  YDG+PKF +DLSG GK   L  V  ++YLP +WC    +A  K+ ++ A++
Sbjct  295   FERHWGLFTYDGKPKFSMDLSGNGKDNYLAEVKGVQYLPSQWCVFNKDAKDKYKDLPASV  354

Query  1281  SYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLST  1460
             +YAC  ADCT    GSSC+ L+  E +SY FN YFQT +Q+  +C FGGL ++TTTN S 
Sbjct  355   NYACSNADCTPLGYGSSCNGLSHDENISYAFNIYFQTMDQDVRACSFGGLAKITTTNASQ  414

Query  1461  STCNFNIGI  1487
               C F + I
Sbjct  415   GGCMFPVQI  423



>ref|XP_010488537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=499

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 287/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP++VVKML+ NG  K+KLF + ++IL+AL G+ IEVMIG PN  LK
Sbjct  38    VGVNWGTMASHQLPPENVVKMLQDNGFTKLKLFEADQNILDALIGSDIEVMIGIPNRFLK  97

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM  +  VA ++V+ENVT Y  +   GV I  + +GNEPFL+ Y    + + T PAL N+
Sbjct  98    EMAQDTAVAASWVEENVTAY--SYHGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALINI  154

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+AL EA + K+ + TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF
Sbjct  155   QRALEEADL-KSVEVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPF  213

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FP DFAFFDG +KPL D    YTNVFDAN DT + AL R     
Sbjct  214   TVNIYPFLSLY-GNAYFPLDFAFFDGTNKPLRDGNLVYTNVFDANLDTLICALERYSFLG  272

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG++ AN   A +F  G +KH  S  GTPAR G  ++VY+F L +ED 
Sbjct  273   MKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLINEDA  332

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFT  1262
             KS+ PG FERHWGI  +DG+PK++LDLSG G  K L  V +++YLPK WC +  NA    
Sbjct  333   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGNDKPLVPVEDVKYLPKTWCVLDPNAYNLD  392

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   I YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF  LG V 
Sbjct  393   DLPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLVLGLVI  452

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  453   DEDPSDELCEFPVMI  467



>ref|XP_004979540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=490

 Score =   434 bits (1117),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 287/441 (65%), Gaps = 18/441 (4%)
 Frame = +3

Query  201   NWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV  380
             NWG +S+  LPPK + ++L  NG +KVK+F++ E  +  LAGTGIE M+  PN LL  + 
Sbjct  28    NWGTMSTRRLPPKVMARLLADNGFRKVKIFDADERTMEGLAGTGIETMVAVPNDLLAAVA  87

Query  381   NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALANMQKA  557
             +Y  A  +VKENVTRY      GV I  V +GNEPFL+ Y   G F +VT PAL N+Q+A
Sbjct  88    DYARAREWVKENVTRY--AFDGGVNIRFVAVGNEPFLRAY--NGSFDRVTVPALRNIQRA  143

Query  558   LNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMIN  737
             L+EAG G   KATVP NADVY SPP  PVPSAG FR D+   + +++++L+ + +P  +N
Sbjct  144   LDEAGHGGAVKATVPVNADVYDSPPGNPVPSAGRFRADVAGVMTEMVRLLNRSGAPLTVN  203

Query  738   VYPFLSLYFANGSFPFDFAFFD----GVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             +YPFLSLY  N  FP D+AFFD    G  KP+ D    YTNVFDAN+DT V+AL R G G
Sbjct  204   IYPFLSLY-GNDDFPLDYAFFDDAGAGKAKPVVDGRVNYTNVFDANFDTLVSALKRVGFG  262

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
             ++ V +GE+GWPTDG++ A A+LA +FY G ++ LA++KGTP RP + +EVY+FGL DED
Sbjct  263   RLPVMIGEVGWPTDGDKHATAALAERFYKGLLRRLAARKGTPLRPNARIEVYLFGLMDED  322

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSNAKF  1259
              KSV PG+FERHWG+   DG+PKF LDL GG G+    VP   +EYLP++WC +  +A  
Sbjct  323   AKSVAPGNFERHWGLFTSDGRPKFPLDLRGG-GRPAMPVPARGVEYLPRRWCVLNPDAAA  381

Query  1260  ---TNMKATISYACDRADCTATSNGSSC--HSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
                  +   + YAC RADCT    G SC   +L      SY FNAY+Q+  Q   +CDF 
Sbjct  382   GGDDRLAGNVGYACGRADCTPLGYGCSCGGGALDARGNASYAFNAYYQSQGQAESACDFQ  441

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  V   + S   C F++G 
Sbjct  442   GLAVVVDKDPSLGACKFSVGF  462



>ref|XP_006394112.1| hypothetical protein EUTSA_v10004092mg [Eutrema salsugineum]
 gb|ESQ31398.1| hypothetical protein EUTSA_v10004092mg [Eutrema salsugineum]
Length=485

 Score =   434 bits (1116),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 280/436 (64%), Gaps = 10/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAGTG+EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPDIVVRMLKDNKINKVKLFDADSWTMNALAGTGMEVMVGIPNNLL  86

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + +  +YD A+ +VKEN+T Y     DGV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ETLAEDYDNAKDWVKENITAY--MRKDGVNIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + +AL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+K   +ND P
Sbjct  144   IHRALKEAGHTDKMKATIPQNAEVYQSANDKP--SEGDFRSDVKQTMLDIVKFFKDNDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FPF+FAF DG  + + DNGK Y NVFDANYDT V AL + G  
Sbjct  202   FTVNIYPFLSLYL-NQHFPFEFAFLDGDGQTIPDNGKNYDNVFDANYDTLVYALRKAGIK  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG+++A   LA KFY G +K LA   GTP RP   LEVY+FGL DED
Sbjct  261   DMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDGGTPLRP-ERLEVYLFGLLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV-KSNAKF  1259
              KS+LPG FERHWGI  YDG PKF LD +G G+     G   ++Y+ K+WC V K     
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRKIVPVGAKGVQYMDKQWCVVNKDTINL  379

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   + YAC   DCTA   GS+C  L + + +SY FN YFQ   Q+  +CDF G   +
Sbjct  380   EEVGPDLDYACYHGDCTAMEGGSTCSKLDKIQNISYAFNMYFQIQGQDVRACDFKGAAMI  439

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  N S  +C F + I
Sbjct  440   TKNNASVGSCLFPVQI  455



>ref|XP_010086919.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB24800.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=483

 Score =   434 bits (1116),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 296/439 (67%), Gaps = 14/439 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SHPL P  VV +LK NGIKKVKLF++ +  +++LAG+GIEVM+  PN  L
Sbjct  28    GLGVNWGTMASHPLHPTIVVNLLKDNGIKKVKLFDADDWTVSSLAGSGIEVMVAIPNDQL  87

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
              ++ + Y+ A+ +VKENVT++   +  GV I  VG+GNEPFL  Y    L K T+PAL N
Sbjct  88    NKLASSYNHAKDWVKENVTKHLRDN-GGVDIRYVGVGNEPFLSSYNGSFL-KPTFPALKN  145

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKALN+AG+G   KAT+P NAD+Y S  +   PS G FR DI+  + QI++ L++N SP
Sbjct  146   VQKALNKAGVGDKIKATIPLNADIYDSSSN--TPSDGNFRDDIRDLMIQIVRFLNDNKSP  203

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             FM+N+YPFLSLY  N +FP +FAFFDG  K ++D    Y NVFDAN+DT V +L + G  
Sbjct  204   FMVNIYPFLSLY-QNSNFPQEFAFFDG-SKTINDKNTQYDNVFDANHDTLVWSLRKAGVP  261

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPTDG++ AN  LA KFY G +K LA  KGTP RPG  +E Y+F L DED
Sbjct  262   DLKILVGEVGWPTDGDKNANVGLAKKFYDGLLKKLAKNKGTPLRPGR-IETYLFSLLDED  320

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KSV PG FERHWGI  YDGQPKF +D +G G+ K L     ++YL KKWC + S+ K  
Sbjct  321   IKSVAPGHFERHWGIFRYDGQPKFAMDFTGQGQDKMLVVAKGVQYLEKKWCVLGSDVK--  378

Query  1263  NMKAT---ISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
             NM A    ++YAC  +DCT+   G+SC  L E +  SY FN YFQ ++Q   +CDF G+ 
Sbjct  379   NMSAVGSEVNYACSMSDCTSLGPGTSCGELNEKQTASYAFNMYFQMNDQSVEACDFSGMA  438

Query  1434  EVTTTNLSTSTCNFNIGIK  1490
             ++ T N S   C F I I+
Sbjct  439   KIVTQNASHGNCLFPIQIE  457



>gb|KFK28168.1| hypothetical protein AALP_AA8G481200 [Arabis alpina]
Length=485

 Score =   434 bits (1116),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 224/436 (51%), Positives = 281/436 (64%), Gaps = 10/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAGTG+EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPDIVVRMLKENKINKVKLFDADSWTMNALAGTGMEVMVGIPNNLL  86

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + +  +YD A+ +VKENVT Y      GV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ETLAEDYDNAKDWVKENVTAY--LRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + KAL EAG     KAT+P NA+VY S  DKP  S G FR D++K +  I+    +ND P
Sbjct  144   IHKALKEAGHTNILKATIPQNAEVYQSANDKP--SEGDFRSDVKKTMLDIVNFFHDNDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP +FAF DG  K + DNGK Y NVFDANYDT V +L + G  
Sbjct  202   FTVNIYPFLSLYL-NEHFPVEFAFLDGDGKTITDNGKNYDNVFDANYDTLVYSLRKAGIK  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG+++A+  LA KFY G +K LA   GTP+RP   LEVY+FGL DED
Sbjct  261   DMKIIVGEVGWPTDGHKYASPKLAEKFYAGLMKRLAEDGGTPSRP-ERLEVYLFGLLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV-KSNAKF  1259
              KS+LPG FERHWGI  YDG PKF LD +G G+         ++YL K+WC V K     
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRKMVPVAAKGVQYLEKQWCVVNKDTVNL  379

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   + YAC   DCTA   GS+C +L + + +SY FN YFQ  +Q+  +CDF G   +
Sbjct  380   DEVGPDLDYACYHGDCTAMQGGSTCSNLDKIQNISYAFNMYFQIQDQDVRACDFKGAAMI  439

Query  1440  TTTNLSTSTCNFNIGI  1487
             T TN S  +C F + I
Sbjct  440   TKTNASVGSCLFPVQI  455



>gb|KHG25475.1| hypothetical protein F383_09937 [Gossypium arboreum]
Length=432

 Score =   432 bits (1110),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 219/414 (53%), Positives = 281/414 (68%), Gaps = 8/414 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPP++VV+MLK NGI KVKLF++    ++AL+G+ +EVM+  PN 
Sbjct  25    VDGLGVNWGTMATHKLPPETVVQMLKDNGITKVKLFDADSKTMDALSGSDLEVMVAIPND  84

Query  363   LLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALA  542
              L  M +YD A+ +VK+N+T Y      GV I  V +GNEPFLK Y        T PAL 
Sbjct  85    QLLAMNSYDRAKQWVKKNITTYNFKG--GVNIKYVAVGNEPFLKSYNGS-FINTTVPALQ  141

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG+G T KATVP NADVY SP   PVPSAG FR DI   + Q+++ L +N +
Sbjct  142   NIQNALNDAGVGDTIKATVPLNADVYNSPESNPVPSAGRFRTDISGPMTQMVEFLAKNGA  201

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPFLSLY  N  FPF++AFFDG   P+ DNG  YTNVFDAN+DT V+AL   GH
Sbjct  202   PFTVNIYPFLSLY-GNDDFPFNYAFFDG-GNPITDNGIKYTNVFDANFDTLVSALKAVGH  259

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGE+GWPTDG++  N + A +FY G +  LA+  GTP RPG  +EVY+FGL DE
Sbjct  260   GDMPIIVGEVGWPTDGDKNGNMANAQRFYNGLLPRLAANTGTPLRPGY-IEVYLFGLIDE  318

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG+FERHWGI  YDGQPKF LDLSG  + K L G  +++YL ++WC    NAK 
Sbjct  319   DAKSVAPGNFERHWGIFRYDGQPKFPLDLSGQNQNKFLIGAKDVKYLQQQWCMFNPNAKD  378

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
                +   I+YAC  +DCTA   GSSC++L      SY FN Y+Q   Q+  + D
Sbjct  379   IGKLTDNINYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQKDMAYD  432



>ref|XP_008242583.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Prunus mume]
Length=489

 Score =   434 bits (1115),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 223/435 (51%), Positives = 285/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VVKMLK N   K+KLF + E IL AL GT IEVM+  PN +L+
Sbjct  29    FGVNWGTMATHQLPPEKVVKMLKDNEFNKLKLFEAEEKILAALMGTQIEVMLAVPNVMLQ  88

Query  372   EMVNYDVAEA-FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM    VA A +V  NVT Y      GV I  V +GNEPFLK Y    L K T PAL N+
Sbjct  89    EMSQDPVAAATWVDANVTSY--CDNGGVNIKYVAVGNEPFLKTYNGTYL-KTTLPALKNI  145

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG+G   KATVPFNAD+Y SP   PVPS G FRP+I+  + +II+ L  ND+PF
Sbjct  146   QEALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSLIEIIQYLHTNDAPF  205

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FPF FAFFDG  KP+ D    YTNVFDAN+DT V +L + G  +
Sbjct  206   TVNIYPFLSLY-GNTYFPFGFAFFDGTTKPIKDGDLLYTNVFDANFDTLVWSLTKAGFPE  264

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+  AN   A +F  G I+H  S  GTPAR G  ++VY+F L DED 
Sbjct  265   MKIMVGEVGWPTDGDINANIRNAKRFNQGMIQHSLSGNGTPARKGK-IDVYLFSLIDEDA  323

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAKFTN  1265
             KS+ PG+FERHWG+  YDG+PK+ LDL+G  + K L  V +++Y+ K+WC +  +AK   
Sbjct  324   KSIAPGNFERHWGLFEYDGKPKYNLDLTGSLENKGLAAVEDVDYMLKRWCVLDKDAKDLE  383

Query  1266  MKA-TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             + A +I YAC  +DCTA   G SC++L+     SY FN Y+Q + Q++ +CDF GL  VT
Sbjct  384   VLAKSIDYACTLSDCTALGYGCSCNNLSLQGNASYAFNMYYQMNSQKSWTCDFSGLAVVT  443

Query  1443  TTNLSTSTCNFNIGI  1487
               N S   C F + I
Sbjct  444   DENPSVGDCQFPVMI  458



>ref|XP_009336879.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=489

 Score =   433 bits (1114),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 219/435 (50%), Positives = 288/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VV++L+ NG+ KVKLF + E IL AL GT IEVM+  PN +L+
Sbjct  28    FGVNWGTMATHQLPPEKVVRILEDNGLDKVKLFEADERILAALTGTKIEVMLAIPNVMLQ  87

Query  372   EMVNYDVAEA-FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM    VA A +V  NVT Y  +   GV I  V +GNEPFLK Y    L + T PAL N+
Sbjct  88    EMSQDPVAAATWVDANVTSYCYSG--GVVIKYVAVGNEPFLKTYNGTYL-RTTLPALKNI  144

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG+G   KATVPFNAD+Y SP   PVPS G FRP+++  + +II+ L   ++PF
Sbjct  145   QEALNNAGLGSKVKATVPFNADIYFSPDSDPVPSTGDFRPEVRDSIIEIIQYLYTYEAPF  204

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FPF FAFFDG  KP+ D    YTNVFDAN+DT V +L + G  +
Sbjct  205   TVNIYPFLSLY-GNSYFPFGFAFFDGKSKPIKDGDLLYTNVFDANFDTLVWSLTKAGFPE  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+  AN   A +F  G I+H  S  GTPAR G  L+VY+F L DE+ 
Sbjct  264   MKIIVGEVGWPTDGDINANIRNAKRFNQGMIQHAMSGNGTPARTGK-LDVYLFSLIDENT  322

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAKFT-  1262
             KS+ PG+FERHWGI  YDG+PK+ LDLSG  + K L    ++EY+ + WC +  +AK+  
Sbjct  323   KSIAPGNFERHWGIFEYDGKPKYDLDLSGAMRNKGLAAAEDVEYMQRSWCVLDPDAKYLD  382

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             N+  +I YAC  +DCT+   GSSC++LT     SY FN Y+Q + Q++G+CDF GL  VT
Sbjct  383   NLAKSIDYACTLSDCTSLGYGSSCNNLTLQGNASYAFNMYYQANSQKSGTCDFSGLAVVT  442

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C + + I
Sbjct  443   DEDPSVGDCKYPVMI  457



>ref|XP_003560627.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=484

 Score =   433 bits (1113),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 232/434 (53%), Positives = 293/434 (68%), Gaps = 11/434 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG   +HPL P SVVKMLK NGI KVKLF++    + AL  +GIEVM+G PN +L+
Sbjct  30    VGVNWGSQLTHPLLPSSVVKMLKDNGIMKVKLFDADPWPVEALLDSGIEVMLGIPNDMLE  89

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  A+ +VKENVT Y     D +K+  V +GNEPFLK Y      K T PAL N+Q
Sbjct  90    IMSSYGSAQDWVKENVTAYG----DKLKLKYVAVGNEPFLKSYNGT-FMKTTVPALKNIQ  144

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KAL+ AG+G   KATVP NADVY+SP DKP  S+G FRPDI   +  ++K L ++ +PF+
Sbjct  145   KALDAAGLGDKVKATVPLNADVYVSPDDKP--SSGQFRPDIDDVMTDMVKFLHDHGAPFV  202

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++  FPF+FAFFDG     D +G +Y+NVFDANYDT V+AL + G G +
Sbjct  203   VNIYPFLSLYQSD-DFPFEFAFFDGGRNIQDKDGVSYSNVFDANYDTLVSALKKAGVGGL  261

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGE+GWPTDGN+ AN  LA +FY G +K LA  +GT  RPG  L+VY+FGLFDED K
Sbjct  262   KVVVGEVGWPTDGNKNANMKLARRFYDGLMKKLAKNEGTHLRPGK-LDVYLFGLFDEDLK  320

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFTN-  1265
             S+ PG+FERHWGIL YDG+PKF +DLSG G  K L GV  ++YLP +WC +   AK  + 
Sbjct  321   SIAPGNFERHWGILTYDGKPKFPMDLSGQGHDKLLAGVSGVQYLPHQWCVLDDEAKAQDK  380

Query  1266  MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTT  1445
             +   I YAC   DCTA   G SC  L E   +SY FN YFQ  +Q+  +CDF GL  +T 
Sbjct  381   LPGNIQYACAGGDCTALGYGCSCDGLDEKSNISYAFNMYFQMQDQDVRACDFDGLANITD  440

Query  1446  TNLSTSTCNFNIGI  1487
              N ST  C F + I
Sbjct  441   KNASTKGCLFPVQI  454



>ref|XP_010257791.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nelumbo nucifera]
Length=481

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/440 (49%), Positives = 289/440 (66%), Gaps = 7/440 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             V  + G+GVNWG +++H LPP+ VV+ML+ NG  KVKLF + E IL AL GT IEVM+  
Sbjct  17    VLNVGGVGVNWGTMATHHLPPEMVVEMLRVNGFDKVKLFEAHEGILRALIGTDIEVMLAI  76

Query  354   PNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
             PN +L++MV+ D+A  +++ENVT Y   +  GV I  V +GNEPFL+ Y    L KVT P
Sbjct  77    PNNMLQDMVDPDLAANWIEENVTSY--LNNGGVNIKYVAVGNEPFLRSYNGTFL-KVTLP  133

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL N+Q+AL++AG+G   KATVPFNAD+Y SP   PVPSAG FR +I+  V ++++ L  
Sbjct  134   ALRNIQRALDDAGLGSRIKATVPFNADIYNSPASNPVPSAGDFRREIRDIVLEVVEFLYN  193

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             N++PF +N+YPFLSLY  +  FP D+AFFDG  KP+ D    YTNVFDAN DT + +L R
Sbjct  194   NNAPFTVNIYPFLSLY-GDPYFPVDYAFFDGTKKPIKDGDVAYTNVFDANLDTLLWSLKR  252

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G+  M + VGE+GWPTDG++ AN   A +F  G ++H+ S KGTP + G  + VY+F L
Sbjct  253   AGYPSMQIMVGEVGWPTDGDKHANIKNAKRFNQGLLRHVLSGKGTPMKRGR-INVYLFSL  311

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSN  1250
              DE+ KS+ PG+FERHWGI  +DG+PK++ DLSG  + K L G   +EY P +WC +  N
Sbjct  312   LDENAKSIAPGNFERHWGIFEFDGKPKYEFDLSGHEENKGLIGAENVEYFPMRWCVMNPN  371

Query  1251  A-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
             A   T + +   YAC  +DCTA   GSSC+ L      SY FN ++Q + Q    CDF G
Sbjct  372   ADDLTELSSNFQYACSFSDCTALGYGSSCNHLDVRGNASYSFNMFYQWNNQRNWDCDFSG  431

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L  VT  + S   C F I I
Sbjct  432   LAVVTDVDPSVGECRFPIMI  451



>ref|XP_003575938.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=499

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 286/449 (64%), Gaps = 20/449 (4%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++  LPPK++ ++L+ NG  KVK+F++ E  ++ LAGTGIE MI  PN L
Sbjct  18    EGLGVNWGTMATRRLPPKTMARLLRDNGFSKVKIFDADESTMSGLAGTGIEAMIAVPNDL  77

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + ++D A  +V+ NVT+Y      GV I  V +GNEPFLK Y   G +  VT PAL 
Sbjct  78    LAAVSDFDGARKWVRANVTKYAFRG--GVNIKFVAVGNEPFLKAY--NGTYDNVTVPALK  133

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q+ALNEAG G + KATVP NADVY SPPD PVPSAG FR DI   +  ++  L+ + +
Sbjct  134   NIQRALNEAGHGASVKATVPVNADVYDSPPDNPVPSAGAFRADIAGVMADMVAFLNHSGA  193

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDG------VDKPLDD--NGKTYTNVFDANYDTAV  878
             PF +N+YPFLSLY  N  FP D+AFFD          P+ D  NG  YTNVFDAN+DT V
Sbjct  194   PFSVNIYPFLSLY-GNDDFPLDYAFFDPGNGTGPAPNPVVDAANGINYTNVFDANFDTLV  252

Query  879   AALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEV  1058
             +AL R G G + V +GE+GWPTDG++ A    A +FY G +K +AS +GTP RP + +EV
Sbjct  253   SALKRIGFGDLPVVIGEVGWPTDGDKHATVPYAERFYAGLLKRIASGRGTPLRPKARIEV  312

Query  1059  YMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKW  1232
             Y+FGL DED KSV PG+FERHWGI  +DG+PKF LDL    G      P   + YLP++W
Sbjct  313   YLFGLMDEDAKSVAPGNFERHWGIFTFDGRPKFPLDLGLHGGTPAMPKPARGVHYLPRRW  372

Query  1233  CTVKSN----AKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQ  1400
             C + +N    +  T +   + YAC RADCTA   G SC +L      SY FN Y+Q   Q
Sbjct  373   CVLNTNSTNVSNETALADNVGYACSRADCTALGFGCSCGTLDAAGNASYAFNVYYQAQGQ  432

Query  1401  EAGSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
                +CDF GL  VT  + S   CNF + +
Sbjct  433   VDSACDFQGLAVVTHEDASRGACNFTVQV  461



>ref|XP_010915073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=468

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/439 (51%), Positives = 284/439 (65%), Gaps = 11/439 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTP  356
             A  + +GVNWG  +SHPLPPK VV+ML  NGIKKVKLF++    ++ALA TGIEVM+G P
Sbjct  14    ASTEAIGVNWGTQASHPLPPKIVVRMLTDNGIKKVKLFDTESSAMSALANTGIEVMVGIP  73

Query  357   NALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
             N  L+ M  +  A+A+V ENVT YK      V I  V +GNEPFL+ Y    L K T+PA
Sbjct  74    NDQLEHMGTFSNAKAWVHENVTGYK-----DVNIKYVAVGNEPFLQSYNGTFL-KTTFPA  127

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+QKAL+E G  K  KAT+P NAD+Y SP D  VPSAG FR DI   + +I + LD +
Sbjct  128   LKNIQKALDEMG-HKEIKATIPMNADIYSSPDDNAVPSAGKFRSDIHDLMVEIARFLDSH  186

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              SPF+IN+YPFLSLY  N +FP DFAFF G    ++D G  Y NVFDAN+DT V AL + 
Sbjct  187   GSPFVINIYPFLSLY-ENPNFPVDFAFFGGGGPSINDEGTQYNNVFDANFDTLVWALKKV  245

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   M + +GE+GWPTDG++ AN + A +FY G +K + S  GTP RPG  ++VY+F   
Sbjct  246   GLSNMKIIIGEVGWPTDGSKHANVADAKRFYDGLLKKMGSNTGTPLRPG-PMDVYLFAFI  304

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DED KS+ PG FERHWGI  YDG+PKF +DLSG G  K L G   +EYL  +WC    NA
Sbjct  305   DEDMKSIQPGFFERHWGIFAYDGKPKFPMDLSGKGNDKYLVGASGVEYLEDEWCVFDPNA  364

Query  1254  KFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K    + +++ +AC   DCTA    S C  L   +++SY FN YFQ  +Q+  +CDF GL
Sbjct  365   KNQEKVPSSMDFACFHGDCTALMGSSPCSKLDRNDRISYAFNMYFQMTDQDVRACDFQGL  424

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
              ++T  N S   C F I I
Sbjct  425   AKITNKNASRDGCLFPIQI  443



>ref|XP_009769717.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nicotiana sylvestris]
Length=470

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 220/440 (50%), Positives = 294/440 (67%), Gaps = 11/440 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++  LPPKSVVKMLK NG  KVKLF + E+ILNAL GT I+VM+  PN +L 
Sbjct  11    VGVNWGTMATQQLPPKSVVKMLKDNGFDKVKLFEADENILNALVGTDIQVMLAIPNFMLH  70

Query  372   EM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             +M  +  +A A+V+ENV+ Y  T   GVKI  V +GNEPFL+ Y    L  +  PAL N+
Sbjct  71    DMSADPLMAAAWVQENVSAYAYTG--GVKIRYVAVGNEPFLRTYNGTYLPYIL-PALKNI  127

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+A+N+AG+G   KAT+PFNAD+Y SP   PVPSAG FRP+++    QI++ L  ND+PF
Sbjct  128   QEAINKAGLGSEVKATIPFNADIYFSPESNPVPSAGDFRPEVRDLTIQIVQYLYSNDAPF  187

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YP+LSLY  N  FP DFAFFDG +KP+ D    YTNVFDAN+DT V +L + G  +
Sbjct  188   VVNIYPYLSLY-GNIYFPLDFAFFDGSNKPVRDGDYVYTNVFDANFDTLVWSLKKAGFPE  246

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + + VGE+GWPTDG++ AN   A +F  G I+H  + +GTPAR G  +EVY+F L DE+ 
Sbjct  247   VKIVVGEVGWPTDGDKNANIENAMRFNQGLIQHCLTGQGTPARKGR-IEVYLFSLIDENA  305

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG--GKGKALTGVPEIEYLPKKWCTVKSNA---  1253
             KS+ PG+FERHWGI  +DG+PK++LDLSG   K K L  V  + Y+ K+WC +K +A   
Sbjct  306   KSIAPGNFERHWGIFEFDGKPKYELDLSGKMQKDKGLVAVEGVNYMHKRWCVLKPDAVDN  365

Query  1254  KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
                ++   I YAC  +DCTA   GSSC+ L+     SY FN Y+Q   Q +  CDF GL 
Sbjct  366   AEEDLPKNIDYACSLSDCTALGYGSSCNHLSAKGNASYAFNMYYQFKNQNSWDCDFDGLA  425

Query  1434  EVTTTNLSTSTCNFNIGIKV  1493
              VT  + S   C+F + I V
Sbjct  426   VVTNDDPSDDKCHFLVMISV  445



>gb|EEE64491.1| hypothetical protein OsJ_19341 [Oryza sativa Japonica Group]
Length=488

 Score =   431 bits (1109),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/439 (50%), Positives = 289/439 (66%), Gaps = 10/439 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G   +GVNWG ++SHP+ P  VV++L ANG+ +VK+F++        A TGI+VM+  PN
Sbjct  29    GRAAVGVNWGTMTSHPIIPCEVVRILAANGVARVKMFDADPWTAAPFAQTGIQVMLAVPN  88

Query  360   ALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
               L  +  +   A  + ++NV+ Y      GV +  V +GNEPFLK Y    L  VT+PA
Sbjct  89    DQLAGLAGDPRRAYRWAEQNVSAYLEA---GVDVRYVAVGNEPFLKSYNGS-LINVTFPA  144

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L NMQ+AL++ G+G   KA VP NADVY SP +KPVPSAG FR DI   +  I+  L+ N
Sbjct  145   LKNMQRALDKLGLGDHVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLNMN  204

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
             ++PF++N+YPFLSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L + 
Sbjct  205   NAPFVVNIYPFLSLY-QNPNFPLNFSFFDGGSKPVYDKGVVYTNVFDANFDTLVWSLRKA  263

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G   M + VGE+GWPTDG++ AN   A KFY GF+K +    GTP RPG  +EVY+F L 
Sbjct  264   GVPDMKIIVGEVGWPTDGDKHANVRYAQKFYDGFLKKMVRNIGTPLRPG-WMEVYLFALI  322

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNA-  1253
             DE+QKSVLPG FERHWG+L YDG+PKF +DLSG     L GV E+EYLP +WC    +A 
Sbjct  323   DENQKSVLPGRFERHWGLLTYDGKPKFSMDLSGDGLDNLVGV-EVEYLPAQWCVFNKDAK  381

Query  1254  -KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
              KF ++ A ++YAC  ADCT    GSSC++L+    +SY FN YFQT +Q+  +C F GL
Sbjct  382   DKFKDLPAAVNYACSNADCTPLGYGSSCNNLSHDGNISYAFNIYFQTMDQDVRACSFEGL  441

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
              ++TT N S   C F + I
Sbjct  442   AKITTINASQGGCLFPVQI  460



>ref|XP_009402192.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   430 bits (1105),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 217/426 (51%), Positives = 283/426 (66%), Gaps = 8/426 (2%)
 Frame = +3

Query  219   SHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV-NYDVA  395
             SHPL P +VV+M+K+NGI KVKLF++    ++A AGTGIE+M+  PN +LK +  +Y  A
Sbjct  2     SHPLLPTTVVQMIKSNGITKVKLFDADSWTVSAFAGTGIELMLAIPNDMLKRISSDYSHA  61

Query  396   EAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGI  575
             + +VKENVT++      GV I  V +GNEPFL  Y      K T+PAL N+QKAL+EAG+
Sbjct  62    QDWVKENVTKHDYDG--GVNIKYVAVGNEPFLSSYNGS-FMKTTFPALKNIQKALDEAGV  118

Query  576   GKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPFLS  755
             G   KATVP NADVY SP   PVPSAG FR DI   +  +++ +  N +PF++N+YPFLS
Sbjct  119   GNRIKATVPLNADVYNSPESNPVPSAGDFRGDIHSLMVDMVRFMHSNGAPFVVNIYPFLS  178

Query  756   LYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGEIG  935
             LY  N  FP DFAFFDG  + L+D G  YTNVFDANYDT V +L + G   M + VGE+G
Sbjct  179   LY-QNPDFPIDFAFFDGGGRNLNDKGHQYTNVFDANYDTLVWSLKKAGVSDMKIIVGEVG  237

Query  936   WPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGDFE  1115
             WPTDG++ AN   A +FY GF+K +   +GTP RPG  ++VY+FGL DED KSVLPG+FE
Sbjct  238   WPTDGDKNANTENAKRFYDGFLKKMGQNEGTPMRPGH-MDVYLFGLIDEDMKSVLPGNFE  296

Query  1116  RHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FTNMKATISYA  1289
             RHWGI  YD +PKF +DLSG G  K L     ++YLP++WC +  + K  + M   + YA
Sbjct  297   RHWGIFTYDCRPKFPMDLSGKGNDKYLKRATGVQYLPEQWCVLNPDVKQLSAMGPNLDYA  356

Query  1290  CDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTSTC  1469
             C  +DCTA   GSSC+ L      SY FN YFQ  +Q+  +C+F GL  +TT N S + C
Sbjct  357   CSLSDCTALGYGSSCNDLDRGGNASYAFNMYFQMQDQDVRACNFEGLAVITTKNASRNGC  416

Query  1470  NFNIGI  1487
              F + I
Sbjct  417   LFPVQI  422



>ref|NP_201284.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAA97291.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AED97951.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=485

 Score =   431 bits (1107),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 281/437 (64%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAGTG+EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGTGMEVMVGIPNNLL  86

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + + + YD A+ +VKENVT+Y      GV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ESLADDYDNAKDWVKENVTQY--IRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + KAL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+    END P
Sbjct  144   IHKALKEAGHTNIMKATIPQNAEVYQSANDKP--SEGDFRKDVKQTMLDIVNFFHENDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP +FAF DG  + + D GK Y NVFDANYDT V AL + G  
Sbjct  202   FTVNIYPFLSLYL-NEHFPVEFAFLDGDGQTMTDKGKNYDNVFDANYDTLVYALKKAGIH  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG+++A+  LA KFY G +K LA   GTP RP   LEVY+FG  DED
Sbjct  261   DMKIIVGEVGWPTDGHKYASPKLAEKFYAGLMKRLAKDGGTPTRP-ERLEVYLFGFLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTV-KSNAK  1256
              KS+LPG FERHWGI  YDG PKF LD + G+G+ +  V    ++YL K+WC V K    
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFT-GQGRQMVPVAAKGVQYLEKQWCVVNKDTVN  378

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +   + YAC   DCTA   GS+C  LT+ + +SY FN YFQ  +Q+  +CDF G   
Sbjct  379   LDEVGPDLDYACYHGDCTAMEAGSTCSKLTKVQNISYAFNMYFQIQDQDVRACDFKGAAM  438

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +T  N S  +C F + I
Sbjct  439   ITKVNASVGSCLFPVQI  455



>gb|KHN10411.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   430 bits (1106),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 220/436 (50%), Positives = 286/436 (66%), Gaps = 8/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LPP  VVKML+ N I K+KLF++ E I+ AL GT IEVM+  PN +L
Sbjct  7     GVGVNWGTMATHKLPPNKVVKMLQENRIDKLKLFDAEEWIMAALMGTDIEVMLAIPNNML  66

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +EM  N  VA+++V ENVT Y    P G+ I  + +GNEPFLK Y    L + T PAL N
Sbjct  67    EEMSRNPQVADSWVYENVTGY--MYPGGLNIKYIAVGNEPFLKEYNGAYL-QSTLPALKN  123

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALN  G G   K TVPFNADVY SP    VPSAG FRP+++ Q  +I++ L  N++P
Sbjct  124   IQTALNSWGFGSQIKVTVPFNADVYYSPDSNQVPSAGDFRPEVRDQTIEIVQFLYANNAP  183

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FPFDFAFFDG ++PL D    YTNVFDAN DT + AL + G+ 
Sbjct  184   FTVNIYPFLSLY-GNDHFPFDFAFFDGSNRPLIDGNSAYTNVFDANLDTLLWALEKSGYP  242

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + V VGE+GWPTDG++ AN   A +F  G +KH  S  GTP R G  +++Y+F L DE+
Sbjct  243   DIEVIVGEVGWPTDGDKNANVQNAKRFNMGLLKHALSGNGTPKRKG-IIDIYLFSLVDEN  301

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG+FERHWGI  +DG+PK++LDL G  +   L  V  I Y+ K+WC + SN K  
Sbjct  302   AKSIAPGNFERHWGIFEFDGKPKYELDLRGLEENNGLVPVEGIRYMEKQWCILDSNVKDL  361

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              N+  +I YAC ++DCTA   GSSC+SL+     SY FN Y+Q + Q+   CDF GL  V
Sbjct  362   HNLAESIDYACSKSDCTALGYGSSCNSLSLQGNASYAFNMYYQVNNQKDWDCDFSGLATV  421

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  + S   C F I I
Sbjct  422   TDEDPSEKGCQFPIMI  437



>ref|XP_006655526.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like, partial [Oryza 
brachyantha]
Length=492

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 288/440 (65%), Gaps = 12/440 (3%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPN  359
             G   +GVNWG + SHP+ P  VV ML ANG+ +VK+F++      ALA TGI+VM   PN
Sbjct  33    GRAAVGVNWGTMMSHPISPCQVVAMLVANGVDRVKMFDADPWTALALADTGIQVMFAVPN  92

Query  360   ALLKEMVNYDVAEAFV--KENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYP  533
               L+ +   D   A++  ++NV+ Y      GV +  V +GNEPFLK Y    L  VT+P
Sbjct  93    DQLEYLAG-DPRRAYLWAEQNVSAYLEA---GVDVRYVAVGNEPFLKSYNGS-LINVTFP  147

Query  534   ALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDE  713
             AL NMQ+AL++  + +  KA VP NADVY SP +KPVPSAG FR DI   +  I+  L  
Sbjct  148   ALKNMQRALDKLRLSEQVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLHM  207

Query  714   NDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAR  893
             ND+PF++N+YPFLSLY  N +FP +F+FFDG  KP+ D G  YTNVFDAN+DT V +L +
Sbjct  208   NDAPFVVNIYPFLSLY-QNPNFPLNFSFFDGGSKPVYDKGMVYTNVFDANFDTLVWSLRK  266

Query  894   EGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGL  1073
              G   M V VGE+GWPTDG++ AN   A +FY GF+K +    GTP RPG  +EVY+F L
Sbjct  267   AGVPDMKVVVGEVGWPTDGDKNANVRYAQRFYDGFLKKMVGNIGTPLRPG-WMEVYLFAL  325

Query  1074  FDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNA  1253
              DE+QKSVLPG FERHWG+L YDG+PKF +DLSG     L G+ E++YLP +WC    +A
Sbjct  326   IDENQKSVLPGRFERHWGLLTYDGKPKFSMDLSGDGLDNLVGI-EVDYLPAQWCVFNKDA  384

Query  1254  --KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGG  1427
               K+ ++ A++ YAC  ADCT    GSSC+ L+    +SY FN YFQT +Q+  +C FGG
Sbjct  385   KDKYKDLAASVDYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFGG  444

Query  1428  LGEVTTTNLSTSTCNFNIGI  1487
             L ++TT N S   C F + I
Sbjct  445   LAKITTINASQGGCLFPVQI  464



>ref|XP_006355982.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Solanum tuberosum]
Length=492

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 217/437 (50%), Positives = 293/437 (67%), Gaps = 14/437 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH L  +SVVKMLK NG  KVKLF + + IL+AL G+ IEVM+  PN +L+
Sbjct  33    VGVNWGTMASHQLAAESVVKMLKENGFDKVKLFEADDKILSALIGSDIEVMLAIPNYMLQ  92

Query  372   EM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             +M  N ++A +++  NV+ Y  T   GVKI  V +GNEPFL+ Y    L   T+PAL N+
Sbjct  93    DMSTNPEMAASWIDANVSTYAYTH--GVKIRYVAVGNEPFLQTYNGTYLHS-TFPALRNV  149

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+A+N AG+G   KA VP NAD+Y SP   PVPSAG FRP+I+    QI++ LD ND+PF
Sbjct  150   QEAINHAGLGPEVKAVVPLNADIYYSPDSNPVPSAGDFRPEIRDLAIQIVQYLDSNDAPF  209

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY AN  FPF++AFF+G +KP+ D    YTNVFDAN+DT   +L + G   
Sbjct  210   VVNIYPFLSLY-ANNYFPFEYAFFNGSNKPMKDGDNLYTNVFDANFDTLAWSLKKAGFPN  268

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDGN++AN   A +F  G ++H  S +GTPAR G  ++VY+F L DE+ 
Sbjct  269   MKIIVGEVGWPTDGNKYANIENAKRFNQGLVQHALSGEGTPARKGK-IDVYLFSLIDENT  327

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVK----SNAK  1256
             KS+ PG+FERHWGI  +DGQPK++LDLS    K L  V  + Y+ KKWC +K     +A+
Sbjct  328   KSIAPGNFERHWGIFEFDGQPKYELDLS---EKPLAAVEGVTYMHKKWCVLKPHLPKDAQ  384

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +  ++ YAC R+DCTA   GSSC+ L+E    SY FN Y+Q + Q +  CDF GL  
Sbjct  385   IY-LAKSVDYACSRSDCTALGYGSSCNHLSERGNTSYAFNMYYQFNNQNSLDCDFQGLAM  443

Query  1437  VTTTNLSTSTCNFNIGI  1487
             VT  + S   C+F + I
Sbjct  444   VTHNDPSNDKCHFPLMI  460



>gb|EPS65796.1| hypothetical protein M569_08979 [Genlisea aurea]
Length=480

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/435 (49%), Positives = 288/435 (66%), Gaps = 12/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +G+NWG +S+HPLPP +VV MLK NG K+VKLF + + I+ AL+GTGIEVM+  PNA+L+
Sbjct  23    VGINWGTMSTHPLPPINVVNMLKQNGFKRVKLFEADKSIMEALSGTGIEVMLAIPNAMLR  82

Query  372   EM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M ++   A A+V+ NVT Y      G+ I  V +GNEPFLK Y    L + T PAL N+
Sbjct  83    RMSLDSGAAAAWVEANVTGYG----GGLDIRYVAVGNEPFLKTYNGSYL-QYTLPALRNI  137

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG+G   KATVPFNAD+Y SP   PVPSAG FRP+I+    QI++ L  N +PF
Sbjct  138   QEALNRAGLGSRIKATVPFNADIYNSPESNPVPSAGDFRPEIRDLTLQIVQFLHSNAAPF  197

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YPFLSLY  N  FP DFAFFDG +  L D  + YTNVFDAN+DT V +LAR G   
Sbjct  198   VVNIYPFLSLY-QNPFFPVDFAFFDGGNSSLRDGDRVYTNVFDANFDTLVWSLARYGFPD  256

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+  AN   A +F  G ++H A+  GTPAR  S LE+++F L DE+ 
Sbjct  257   MKIIVGEVGWPTDGDLHANVDYARRFNQGLLRHAATAGGTPARK-SELEIFLFSLIDENS  315

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAKFTNM  1268
             KS+ PG FERHWGI  YDG+PK++LDL   +G  L  V  ++Y+ ++WC +  +   +++
Sbjct  316   KSIEPGSFERHWGIFEYDGRPKYELDLGANRG--LAAVEGVQYMVRRWCILNPSTPDSDV  373

Query  1269  K--ATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             +  A + YAC ++DCTA   GSSC+ L      SY FN Y+Q   Q+   CDF GL  +T
Sbjct  374   EIPANVDYACKQSDCTAMGYGSSCNHLNFQGNASYAFNMYYQMKSQKGWDCDFSGLATIT  433

Query  1443  TTNLSTSTCNFNIGI  1487
               + S  +C F + I
Sbjct  434   YEDPSDGSCRFPVMI  448



>ref|XP_003550844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=487

 Score =   430 bits (1106),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 220/436 (50%), Positives = 286/436 (66%), Gaps = 8/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LPP  VVKML+ N I K+KLF++ E I+ AL GT IEVM+  PN +L
Sbjct  28    GVGVNWGTMATHKLPPNKVVKMLQENRIDKLKLFDAEEWIMAALMGTDIEVMLAIPNNML  87

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +EM  N  VA+++V ENVT Y    P G+ I  + +GNEPFLK Y    L + T PAL N
Sbjct  88    EEMSRNPQVADSWVYENVTGY--MYPGGLNIKYIAVGNEPFLKEYNGAYL-QSTLPALKN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q ALN  G G   K TVPFNADVY SP    VPSAG FRP+++ Q  +I++ L  N++P
Sbjct  145   IQTALNSWGFGSQIKVTVPFNADVYYSPDSNQVPSAGDFRPEVRDQTIEIVQFLYANNAP  204

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FPFDFAFFDG ++PL D    YTNVFDAN DT + AL + G+ 
Sbjct  205   FTVNIYPFLSLY-GNDHFPFDFAFFDGSNRPLIDGNSAYTNVFDANLDTLLWALEKSGYP  263

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + V VGE+GWPTDG++ AN   A +F  G +KH  S  GTP R G  +++Y+F L DE+
Sbjct  264   DIEVIVGEVGWPTDGDKNANVQNAKRFNMGLLKHALSGNGTPKRKG-IIDIYLFSLVDEN  322

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG+FERHWGI  +DG+PK++LDL G  +   L  V  I Y+ K+WC + SN K  
Sbjct  323   AKSIAPGNFERHWGIFEFDGKPKYELDLRGLEENNGLVPVEGIRYMEKQWCILDSNVKDL  382

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              N+  +I YAC ++DCTA   GSSC+SL+     SY FN Y+Q + Q+   CDF GL  V
Sbjct  383   HNLAESIDYACSKSDCTALGYGSSCNSLSLQGNASYAFNMYYQVNNQKDWDCDFSGLATV  442

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  + S   C F I I
Sbjct  443   TDEDPSEKGCQFPIMI  458



>ref|XP_010049931.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
Length=489

 Score =   430 bits (1106),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/431 (50%), Positives = 285/431 (66%), Gaps = 8/431 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG  S+H LPP+ VVKMLK NGIKK+KLF   E IL ALAG+ IEVM+  PN +L+
Sbjct  30    VGVNWGTQSNHQLPPEKVVKMLKENGIKKLKLFEYDEKILGALAGSKIEVMLAVPNYMLE  89

Query  372   EM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M V+   A ++V  NVT Y+ T   GV I  + +GNEPFL+ Y  + + +V  PAL N+
Sbjct  90    IMSVDPSFAASWVDTNVTSYRYTG--GVNIKYIAVGNEPFLQSYNHKYVRQVL-PALRNI  146

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
              +AL+ A +    K TVPFNADVY SPP    PS+G FRP+++    +II  L  NDSPF
Sbjct  147   HEALHRARLSSKVKVTVPFNADVYYSPPPNEYPSSGDFRPEVRDAAIEIIHFLYINDSPF  206

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N +FP DFAFFDG  +P+ D  + YTNVFDAN+D  V+AL + G+  
Sbjct  207   TVNIYPFLSLY-QNQNFPVDFAFFDGTTEPVKDGDRVYTNVFDANFDILVSALTKAGYSD  265

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGEIGWPTDG++FAN   A +F  G +KH  S  GTPAR G  ++VY+F L DED 
Sbjct  266   MEILVGEIGWPTDGDKFANIKNAQRFNQGLLKHALSGDGTPARKG-VIDVYLFSLIDEDT  324

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             K++ PG+FERHWG+  YDG+PK++LDLSG  K   L  V  + Y+P++WC +       T
Sbjct  325   KNIDPGNFERHWGLFEYDGKPKYELDLSGSEKDTRLVPVMGVSYMPRRWCILNPELNDLT  384

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++   I YAC  +DCTA   GSSC++L+     SY FN Y+Q ++Q   +CDF GL EVT
Sbjct  385   DLGENIDYACKSSDCTALGYGSSCNNLSSQGNASYAFNRYYQMNDQRIMACDFQGLAEVT  444

Query  1443  TTNLSTSTCNF  1475
               + ST  C F
Sbjct  445   ENDPSTEECQF  455



>ref|XP_010027756.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
Length=478

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 286/438 (65%), Gaps = 14/438 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG + SHPL P  VV MLK N I KVKLF++    ++ALAGT +EV++G PN  L
Sbjct  24    GIGVNWGAMMSHPLSPSIVVGMLKDNHINKVKLFDADSWTVSALAGTNMEVIVGIPNDQL  83

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             K++ + YD A+ +VKENVT++      GV I  V +GNEPFLK Y      K T PAL N
Sbjct  84    KKLADSYDHAKDWVKENVTKH--LYDGGVDIRYVAVGNEPFLKSYNGSNT-KTTLPALEN  140

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+ AG+G   KATVP NADVY SP +KP  S  +FR DI+  +  ++K L +N +P
Sbjct  141   IQKALDAAGLGDKIKATVPNNADVYESPSNKP--SDAVFRKDIRGIMIDMVKFLRDNKAP  198

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             FM+N+YPFLSLY  N  FPFDFAF DG  K + D G  YTNVFDANYDT V AL + G  
Sbjct  199   FMVNIYPFLSLYL-NSDFPFDFAFCDGNAKSIHDKGTEYTNVFDANYDTLVWALKKAGAP  257

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPTDG + A+A LA +FY GF+K +A+ KGTP RPG  L+VY+FGL DED
Sbjct  258   DLKIIVGEVGWPTDGGKNADAKLAQRFYDGFMKKMAANKGTPLRPGH-LDVYLFGLLDED  316

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KS+ PG FERHWGI  YDGQPKF +D +G G  K       ++YLP +WC    N   T
Sbjct  317   TKSIEPGMFERHWGIFRYDGQPKFPVDFTGKGNDKMPVAAKGVQYLPSQWCVFNGNN--T  374

Query  1263  NMKATI---SYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
             +  A +   SYAC  ADC+    G+SC++L     +SY FN YFQ  +Q+  SC F G  
Sbjct  375   DKDAVVNELSYACANADCSILGYGASCNNLDANGNVSYAFNMYFQVRDQDVESCTFNGFA  434

Query  1434  EVTTTNLSTSTCNFNIGI  1487
             E+ T N S  +C F + I
Sbjct  435   EIVTRNFSKGSCLFPVQI  452



>gb|KCW82758.1| hypothetical protein EUGRSUZ_C04137 [Eucalyptus grandis]
Length=558

 Score =   430 bits (1105),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 217/432 (50%), Positives = 285/432 (66%), Gaps = 8/432 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
              +GVNWG  S+H LPP+ VVKMLK NGIKK+KLF   E IL ALAG+ IEVM+  PN +L
Sbjct  98    SVGVNWGTQSNHQLPPEKVVKMLKENGIKKLKLFEYDEKILGALAGSKIEVMLAVPNYML  157

Query  369   KEM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + M V+   A ++V  NVT Y+ T   GV I  + +GNEPFL+ Y  + + +V  PAL N
Sbjct  158   EIMSVDPSFAASWVDTNVTSYRYTG--GVNIKYIAVGNEPFLQSYNHKYVRQVL-PALRN  214

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + +AL+ A +    K TVPFNADVY SPP    PS+G FRP+++    +II  L  NDSP
Sbjct  215   IHEALHRARLSSKVKVTVPFNADVYYSPPPNEYPSSGDFRPEVRDAAIEIIHFLYINDSP  274

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N +FP DFAFFDG  +P+ D  + YTNVFDAN+D  V+AL + G+ 
Sbjct  275   FTVNIYPFLSLY-QNQNFPVDFAFFDGTTEPVKDGDRVYTNVFDANFDILVSALTKAGYS  333

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGEIGWPTDG++FAN   A +F  G +KH  S  GTPAR G  ++VY+F L DED
Sbjct  334   DMEILVGEIGWPTDGDKFANIKNAQRFNQGLLKHALSGDGTPARKG-VIDVYLFSLIDED  392

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              K++ PG+FERHWG+  YDG+PK++LDLSG  K   L  V  + Y+P++WC +       
Sbjct  393   TKNIDPGNFERHWGLFEYDGKPKYELDLSGSEKDTRLVPVMGVSYMPRRWCILNPELNDL  452

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             T++   I YAC  +DCTA   GSSC++L+     SY FN Y+Q ++Q   +CDF GL EV
Sbjct  453   TDLGENIDYACKSSDCTALGYGSSCNNLSSQGNASYAFNRYYQMNDQRIMACDFQGLAEV  512

Query  1440  TTTNLSTSTCNF  1475
             T  + ST  C F
Sbjct  513   TENDPSTEECQF  524



>gb|KCW54346.1| hypothetical protein EUGRSUZ_I00311, partial [Eucalyptus grandis]
Length=449

 Score =   426 bits (1094),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 284/434 (65%), Gaps = 14/434 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG + SHPL P  VV MLK N I KVKLF++    ++ALAGT +EV++G PN  L
Sbjct  24    GIGVNWGAMMSHPLSPSIVVGMLKDNHINKVKLFDADSWTVSALAGTNMEVIVGIPNDQL  83

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             K++ + YD A+ +VKENVT++      GV I  V +GNEPFLK Y      K T PAL N
Sbjct  84    KKLADSYDHAKDWVKENVTKH--LYDGGVDIRYVAVGNEPFLKSYNGSNT-KTTLPALEN  140

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+ AG+G   KATVP NADVY SP +KP  S  +FR DI+  +  ++K L +N +P
Sbjct  141   IQKALDAAGLGDKIKATVPNNADVYESPSNKP--SDAVFRKDIRGIMIDMVKFLRDNKAP  198

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             FM+N+YPFLSLY  N  FPFDFAF DG  K + D G  YTNVFDANYDT V AL + G  
Sbjct  199   FMVNIYPFLSLYL-NSDFPFDFAFCDGNAKSIHDKGTEYTNVFDANYDTLVWALKKAGAP  257

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPTDG + A+A LA +FY GF+K +A+ KGTP RPG  L+VY+FGL DED
Sbjct  258   DLKIIVGEVGWPTDGGKNADAKLAQRFYDGFMKKMAANKGTPLRPGH-LDVYLFGLLDED  316

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KS+ PG FERHWGI  YDGQPKF +D +G G  K       ++YLP +WC    N   T
Sbjct  317   TKSIEPGMFERHWGIFRYDGQPKFPVDFTGKGNDKMPVAAKGVQYLPSQWCVFNGNN--T  374

Query  1263  NMKATI---SYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
             +  A +   SYAC  ADC+    G+SC++L     +SY FN YFQ  +Q+  SC F G  
Sbjct  375   DKDAVVNELSYACANADCSILGYGASCNNLDANGNVSYAFNMYFQVRDQDVESCTFNGFA  434

Query  1434  EVTTTNLSTSTCNF  1475
             E+ T N S  +C F
Sbjct  435   EIVTRNFSKGSCLF  448



>emb|CDP03371.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 289/441 (66%), Gaps = 8/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             V+ +  LGVNWG ++SH LPP++VV+M+  NG  KVKLF + E IL AL GT +EVM+G 
Sbjct  2     VSRVSSLGVNWGTMASHQLPPENVVQMMLDNGFDKVKLFEADEKILGALIGTDLEVMLGI  61

Query  354   PNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
             PN +L+E+  + + A ++V  NVT Y      GV I  V +GNEPFLK Y    L   T 
Sbjct  62    PNNMLREISQDPEAAASWVDANVTAY--CFKGGVNIRYVAVGNEPFLKSYNNSFL-PYTL  118

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
              AL N+Q+A+N AG+G   KAT+PFNADVY SP   PVPSAG FRP+I+    QII+ L 
Sbjct  119   SALKNIQEAINHAGLGTVVKATIPFNADVYNSPESNPVPSAGDFRPEIRDLTVQIIQYLH  178

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
              ND+PF++N+YPFLSLY  N  FP D+AFFDG +KP+ D    YTNVFDAN+DT V++L+
Sbjct  179   SNDAPFVVNIYPFLSLY-GNIYFPLDYAFFDGSNKPIKDGDYLYTNVFDANFDTLVSSLS  237

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
             R G+ +M + +GE+GWPTDG++ AN   A +F  G I+H++   GTPAR GS ++VY+F 
Sbjct  238   RAGYPEMKIIIGEVGWPTDGDKNANIQNAKRFNQGLIQHVSGGVGTPARNGS-IDVYLFS  296

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGK-GKALTGVPEIEYLPKKWCTVKS  1247
             L DE+ KS+ PG FERHWG+  +DG+PK++LDLSG +  K L  V  + Y+ ++WC +  
Sbjct  297   LIDENAKSIEPGSFERHWGLFEFDGKPKYELDLSGSREEKGLVAVEGVRYMLRRWCILDP  356

Query  1248  NAK-FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
              AK    +   I YAC  +DCT+   GSSC+ L+     SY FN Y+Q   Q    CDF 
Sbjct  357   RAKELEELPKNIDYACSLSDCTSLGYGSSCNHLSAKGNASYAFNMYYQFKNQNGWDCDFS  416

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VT  + S   C F + I
Sbjct  417   GLAVVTDEDPSDDECQFPVMI  437



>ref|XP_002864921.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41180.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   426 bits (1096),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 220/437 (50%), Positives = 281/437 (64%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAGTG+EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGTGMEVMVGIPNNLL  86

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + + + YD A+ +VKENVT+Y      GV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ETLADDYDNAKDWVKENVTQY--MRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + +AL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+    +ND P
Sbjct  144   IHRALKEAGHTDKMKATIPQNAEVYQSANDKP--SEGDFRKDVKQTMLDIVNFFHDNDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP +FAF DG  + + D GK Y NVFDANYDT V AL + G  
Sbjct  202   FTVNIYPFLSLYL-NEHFPVEFAFLDGNGQTMTDKGKNYDNVFDANYDTLVYALKKAGIH  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG+++A   LA KFY G +K LA   GTP RP   LEVY+FG  DED
Sbjct  261   DMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDGGTPTRP-ERLEVYLFGFLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTVKSN-AK  1256
              KS+LPG FERHWGI  YDG PKF LD + G+G+ +  V    ++YL K+WC V ++   
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFT-GQGRQMVPVAAKGVQYLEKQWCVVNNDTVN  378

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +   + YAC   DCTA   GS+C  LT+ + +SY FN YFQ  +Q+  +CDF G   
Sbjct  379   LDEVGPDLDYACYHGDCTAMEAGSTCSKLTKVQNISYAFNMYFQIQDQDVRACDFKGAAM  438

Query  1437  VTTTNLSTSTCNFNIGI  1487
             +T  N S  +C F + I
Sbjct  439   ITKVNASVGSCLFPVQI  455



>ref|XP_008362938.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=489

 Score =   426 bits (1096),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/435 (50%), Positives = 283/435 (65%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VV++L+ NG  KVKLF + E IL AL GT IEVM+  PN +L+
Sbjct  28    FGVNWGTMATHQLPPEKVVRILEDNGFDKVKLFEADERILAALTGTKIEVMLAIPNVMLQ  87

Query  372   EMVNYDVAEA-FVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM    VA A +V  NVT Y  +   GV I  V +GNEPFLK Y    L + T PAL N+
Sbjct  88    EMSQDXVAAATWVDANVTSYCYSG--GVVIKYVAVGNEPFLKTYNGTYL-QTTLPALKNI  144

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG+G   KATVPFNAD Y SP   PVPS G FRP+++  + +II+ L  N++PF
Sbjct  145   QEALNNAGLGSQVKATVPFNADXYFSPDSDPVPSTGDFRPEVRDSIIKIIQYLXTNEAPF  204

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FPF FAFFDG  KP+ D    YTNVFDAN+DT V +L + G  +
Sbjct  205   TVNIYPFLSLY-GNSYFPFGFAFFDGKSKPIKDGDLLYTNVFDANFDTLVWSLTKAGFPE  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+  AN   A  F  G I+H  S  GTPAR G  L+ Y+F L DE+ 
Sbjct  264   MKIIVGEVGWPTDGDINANIRNAKXFNQGMIQHAMSGNGTPARTGK-LDGYLFSLIDENM  322

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KS+ PG+FERHWGI  YDG+PK+ LDLSG  + K L    ++EY+ + WC +  +AK   
Sbjct  323   KSIAPGNFERHWGIFEYDGKPKYDLDLSGAMRNKGLAAAEDVEYMQRSWCVLDPDAKSLD  382

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++  +I YAC  +DCT+   GSSC++LT     SY FN Y+Q + Q++ +CDF GL  VT
Sbjct  383   DLAKSIDYACTLSDCTSLGYGSSCNNLTLQGNASYAFNMYYQVNSQKSWTCDFSGLAVVT  442

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  443   DEDPSVGDCEFPVMI  457



>ref|XP_004498612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cicer arietinum]
Length=481

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 220/438 (50%), Positives = 289/438 (66%), Gaps = 13/438 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG  S+HPLPP +VVKMLK NGI+KVKLF++   ILNAL  +GI+VM+G PN LL
Sbjct  30    GIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPDILNALKKSGIQVMVGIPNDLL  89

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VTYPALA  542
               M N    AE +V +NV+ +   S  GV I  V +GNEPFL  Y   G F+  T PAL 
Sbjct  90    YTMANSLQAAEKWVSKNVSAH--VSSGGVDIRYVAVGNEPFLSTYN--GTFEATTLPALK  145

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q AL +AG+G + + TVP NADVY S  DKP  S G FR DI   + QI+K L +N++
Sbjct  146   NIQSALVKAGLGNSVRVTVPLNADVYQSSSDKP--SDGDFRTDIHDLMLQIVKFLSQNNA  203

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPF+SLY A+ +FP D+AFF+G   PL DNG  Y NVFDANYDT V AL + G 
Sbjct  204   PFAVNIYPFISLY-ADPNFPVDYAFFNGFGSPLTDNGNIYDNVFDANYDTLVWALQKNGF  262

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + VGEIGWPTDG+  AN  LA +F  GF+    + KGTP RPG  ++ Y+F L DE
Sbjct  263   GNLPIIVGEIGWPTDGDRNANVLLAQRFNQGFMSRFVAGKGTPMRPG-PIDAYLFSLVDE  321

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
             D KS+ PG+FERHWG+  +DG+PK++L+L G +   L G   + +LPKKWC +K +A   
Sbjct  322   DDKSIQPGNFERHWGLFYFDGRPKYQLNL-GLRSSGLVGATGVAHLPKKWCILKPSANLN  380

Query  1263  N--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
             +  +  ++SYAC  ADCT+   G+SC  L     +SY FN+Y+Q ++Q   +C F GL  
Sbjct  381   SDQLAESVSYACQNADCTSLGYGTSCSGLDVRGNISYAFNSYYQVNDQIDSACKFPGLSV  440

Query  1437  VTTTNLSTSTCNFNIGIK  1490
             VT  + ST  C F I I+
Sbjct  441   VTDKDPSTPDCIFKIMIQ  458



>ref|XP_009112157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brassica 
rapa]
Length=485

 Score =   425 bits (1092),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 284/439 (65%), Gaps = 12/439 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAG+G+EVM+G PN 
Sbjct  25    VEGFGVNWGNIASHPLNPDIVVRMLKENKINKVKLFDADSWTMNALAGSGMEVMVGIPNN  84

Query  363   LLKEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
             LL+ + + Y  A+ +VKEN+T Y     DGV I  V +GNEPFL  Y    L K T+PAL
Sbjct  85    LLETLADDYGNAKDWVKENITAY--MRKDGVNIKYVAVGNEPFLSAYNGSYL-KTTFPAL  141

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+ +AL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+K   +ND
Sbjct  142   KNIHRALKEAGHTDVMKATIPQNAEVYESANDKP--SEGDFRSDVKQIMLDIVKFFHDND  199

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
              PF +N+YPFLSLY  N  FP ++AFFDG  + + DNGK Y NVFDANYDT V AL + G
Sbjct  200   LPFTVNIYPFLSLYL-NQHFPVEYAFFDGNGQTIPDNGKNYDNVFDANYDTLVYALNKAG  258

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
                M + VGE+GWPTDG+++A   LA KFY G +K LA   GTP RP   LEVY+FGL D
Sbjct  259   IKDMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDVGTPLRP-EKLEVYLFGLLD  317

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTV-KSN  1250
             ED KS+LPG FERHWGI  YDG PKF LD + G+G+ +  V    ++YL K+WC V K  
Sbjct  318   EDMKSILPGPFERHWGIFRYDGTPKFMLDFT-GQGRKIVPVAAKGVQYLDKQWCVVNKDT  376

Query  1251  AKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
                  +   + YAC   DCTA   GS+C +L + + +SY FN +FQ   Q+  +CDF G 
Sbjct  377   INLDEVGPDLDYACYHGDCTAMLYGSTCSNLDKIQNISYAFNMFFQIQGQDVRACDFRGS  436

Query  1431  GEVTTTNLSTSTCNFNIGI  1487
               +T  N S  +C F I I
Sbjct  437   AMITKNNASVGSCLFPIQI  455



>ref|XP_010444426.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=485

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 220/437 (50%), Positives = 280/437 (64%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAGT +EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPSIVVQMLKDNKINKVKLFDADSWTMNALAGTNMEVMVGIPNNLL  86

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + + + YD A+ +VKENVT Y      GV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ESLADDYDNAKDWVKENVTHY--MRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + KAL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+    +ND P
Sbjct  144   IHKALKEAGHTDKIKATIPQNAEVYQSANDKP--SEGDFRKDVKQTMVDIVTYFHDNDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP +FAF DG  + ++D GK Y NVFDANYDT V AL + G  
Sbjct  202   FTVNIYPFLSLYL-NEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVYALKKAGIH  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPT+G+++A   LA KFY G +K LA   GTP RP   LEVY+FG  DED
Sbjct  261   DMKIIVGEVGWPTEGHKYATPKLAEKFYAGLMKRLAKDGGTPTRP-ERLEVYLFGFLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTV-KSNAK  1256
              KS+LPG FERHWGI  YDG PKF LD + G+G+ +  V    ++YL K+WC V K  A 
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFT-GQGRQILPVAAKGVQYLEKQWCVVNKDTAN  378

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +   + YAC   DCTA   GS+C  LT+ + +SY FN YFQ  +Q+  +CDF G   
Sbjct  379   LDEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYFQIQDQDVRACDFKGAAM  438

Query  1437  VTTTNLSTSTCNFNIGI  1487
             ++  N S  +C F + I
Sbjct  439   ISKVNASVGSCLFPVQI  455



>ref|XP_009626950.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=513

 Score =   425 bits (1093),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 220/441 (50%), Positives = 293/441 (66%), Gaps = 13/441 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++  LPPKSVVKMLK NG  KVKLF + + ILNAL GT I+VM+  PN +L 
Sbjct  11    VGVNWGTMATQQLPPKSVVKMLKDNGFDKVKLFEADDSILNALVGTDIQVMLAIPNYMLH  70

Query  372   EM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             +M  +  +A A+V+ENV+ Y  T    VKI  V +GNEPFL+ Y    L  +  PAL N+
Sbjct  71    DMSADPLMATAWVQENVSAYVYTGV--VKIRYVAVGNEPFLRTYNGTYLPYIL-PALKNI  127

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+A+N+AG+G   KAT+PFNAD+Y SP   PVPSAG FRP+++    QI++ L  ND+PF
Sbjct  128   QEAINKAGLGSEVKATIPFNADIYFSPESTPVPSAGDFRPEVRDLTIQIVQYLYSNDAPF  187

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
             ++N+YP+LSLY  N  FP DFAFFDG +KP+ D    YTNVFDAN+DT V +L + G  +
Sbjct  188   VVNIYPYLSLY-GNIYFPLDFAFFDGSNKPVRDGEYVYTNVFDANFDTLVWSLKKAGFPE  246

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             + + VGE+GWPTDG++ AN   A +F  G I+H  S +GTPAR G  +EVY+F L DE+ 
Sbjct  247   VKIVVGEVGWPTDGDKNANIENAMRFNQGLIQHCLSGQGTPARKGK-IEVYLFSLIDENA  305

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG--GKGKALTGVPEIEYLPKKWCTVK----SN  1250
             KS+ PG+FERHWGI  +DG+PK++LDLSG   K K L  V  + Y+ K+WC +K     N
Sbjct  306   KSIAPGNFERHWGIFEFDGKPKYELDLSGKMQKDKGLVAVEGVNYMHKRWCVLKPEGVDN  365

Query  1251  AKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             A+  ++   I YAC  +DCTA   GSSC+ L+     SY FN Y+Q   Q +  CDF GL
Sbjct  366   AE-EDLPKNIDYACSLSDCTALGYGSSCNHLSAKGNASYAFNMYYQFKNQNSWDCDFDGL  424

Query  1431  GEVTTTNLSTSTCNFNIGIKV  1493
               VT  + S   C+F + I V
Sbjct  425   AVVTNDDPSDDKCHFPLMISV  445



>ref|XP_002991155.1| hypothetical protein SELMODRAFT_132967 [Selaginella moellendorffii]
 gb|EFJ07801.1| hypothetical protein SELMODRAFT_132967 [Selaginella moellendorffii]
Length=503

 Score =   425 bits (1092),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 291/436 (67%), Gaps = 9/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG ++SH LP K+VV+ML+ANGI KVKLF++   ++ +L GT +E+MI  PN +L
Sbjct  13    GIGVNWGTMASHRLPNKTVVQMLRANGISKVKLFDADPGVMESLRGTDMELMIAIPNEML  72

Query  369   KEMVNY-DVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + +      A  +V++NVTRY+ T+ +GVKI  V +GNEPFLK Y       + YPAL N
Sbjct  73    ELVATLPAAARNWVRKNVTRYR-TAKNGVKIKYVAVGNEPFLKAYNGS-YDNLAYPALKN  130

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q AL  AG+G++ KAT+P N DV LS  D  +PS G+FRPDI  QV ++++ L E+++P
Sbjct  131   VQDALVSAGLGESIKATIPLNGDV-LSNGDSTLPSGGIFRPDIAPQVLKVVEALGEHNAP  189

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F+INVYPFLSL   +  FP DFAFFDG D PL D   +YTNVFDA+YD  VAAL + G+ 
Sbjct  190   FVINVYPFLSLQ-QDPHFPRDFAFFDGTDFPLVDGNLSYTNVFDASYDLLVAALTKAGYS  248

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              MT+ +GEIGWPTDG+  AN + A +F   FI+H+  + GTP R    LE Y+F L DED
Sbjct  249   NMTIIIGEIGWPTDGDINANVANAVRFNQAFIRHVL-QSGTPLR-RPPLEAYLFSLLDED  306

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDL--SGGKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             QK++LPG+FERHWGI GYDG+ K++LDL  SG     L     ++YLP++WC +  +   
Sbjct  307   QKTILPGNFERHWGIFGYDGKAKYRLDLQGSGNVTANLVNASSVKYLPRQWCVLDPSGDI  366

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   + YAC  +DCT+   GSSC  +    K SY FN+Y+Q ++Q   SC F GL  +
Sbjct  367   ARLGNNMDYACSHSDCTSIVPGSSCDGMGSDAKASYAFNSYYQLYDQLNTSCYFDGLATI  426

Query  1440  TTTNLSTSTCNFNIGI  1487
             T T+ S+ TC F I I
Sbjct  427   TKTSPSSGTCQFKIQI  442



>ref|XP_006281667.1| hypothetical protein CARUB_v10027803mg [Capsella rubella]
 gb|EOA14565.1| hypothetical protein CARUB_v10027803mg [Capsella rubella]
Length=485

 Score =   424 bits (1091),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 278/436 (64%), Gaps = 10/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG I+SHPL P  VV+MLK N I KVKLF++    +NALAG+G+EVM+G PN LL
Sbjct  27    GFGVNWGSIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGSGMEVMVGIPNNLL  86

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + + + YD A+ +VKENVT Y      GV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ESLADDYDNAKDWVKENVTHY--MRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + KAL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+    +ND P
Sbjct  144   IHKALKEAGHTDKIKATIPQNAEVYQSANDKP--SEGDFRKDVKQTMVDIVTYFHDNDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP +FAF DG  + ++D GK Y NVFDANYDT V AL + G  
Sbjct  202   FTVNIYPFLSLYL-NEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVFALKKAGIH  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG+++A   LA KFY G +K LA   GTP+RP   LEVY+FG  DED
Sbjct  261   DMKIIVGEVGWPTDGHKYATPKLAEKFYAGLMKRLAKDGGTPSRP-ERLEVYLFGFLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSN-AKF  1259
              KS+LPG FERHWGI  YDG PKF LD +G G+         ++YL K+WC V ++    
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFVLDFTGQGRKMVPVAAKGVQYLEKQWCVVNNDTVNL  379

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   + YAC   DCTA   GS+C  LT+ + +SY FN YFQ  +Q+  +CDF G   +
Sbjct  380   DEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYFQIQDQDVRACDFKGAAMI  439

Query  1440  TTTNLSTSTCNFNIGI  1487
             +  N S  +C F + I
Sbjct  440   SKVNASVGSCLFPVQI  455



>ref|XP_010261306.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=481

 Score =   424 bits (1090),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 221/436 (51%), Positives = 286/436 (66%), Gaps = 10/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG I SHPL P +VV+MLK NGIKKVKLF+S    +N+LAG+GI+VM+  PN  L
Sbjct  25    GIGVNWGIIMSHPLLPATVVRMLKDNGIKKVKLFDSDSWTVNSLAGSGIQVMVAIPNDQL  84

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             +   + YD A+ +V +N+T +      GV I  V IGNEPFLK Y  +     T+PAL N
Sbjct  85    ERFSDDYDNAKDWVHDNITSH--LYKGGVDIKYVAIGNEPFLKSYNGR-FTNHTFPALKN  141

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+AL+EAG+G   KAT P NADVY S      PS G FR DI++ + +I+K L+ N++P
Sbjct  142   IQRALDEAGLGDKIKATTPLNADVYDS--STGTPSGGNFRKDIRELMIKIVKFLNANNAP  199

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  N  FP +FAFFD    P+ DNG  YTNV DAN+DT V +L + G  
Sbjct  200   FVVNIYPFLSLY-QNDDFPMEFAFFDSDSSPIVDNGIKYTNVLDANHDTLVWSLKKAGVP  258

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + +GEIGWPTDG++ AN   A +FY G  K LAS KGTP RPG  ++VY+FGLFDE+
Sbjct  259   NLKIIIGEIGWPTDGHKKANVHYAKRFYDGLFKKLASDKGTPLRPGK-MDVYLFGLFDEN  317

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
              KS+LPG FERHWGI  YDG+PKF +D SG G  K   G   ++YLP +WC +    K  
Sbjct  318   MKSILPGFFERHWGIFRYDGKPKFPMDFSGQGHDKLPVGAKGVQYLPAQWCILDRKIKNV  377

Query  1263  NM-KATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
             N+  A + YAC  ADC+A   G SC+ +     +SY FN YFQ   Q+  +CDF GL  +
Sbjct  378   NLVPANMDYACTYADCSALVYGGSCNGMDIYGNVSYAFNMYFQMQNQDVQACDFQGLAVL  437

Query  1440  TTTNLSTSTCNFNIGI  1487
             TT N S  +C F I I
Sbjct  438   TTKNASRGSCLFPIEI  453



>ref|XP_008458070.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=496

 Score =   424 bits (1091),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 217/436 (50%), Positives = 290/436 (67%), Gaps = 9/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP+ VVKML+ NG  K+KLF + + IL AL GT IEVM+  PN++L 
Sbjct  27    VGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGTDIEVMLAIPNSMLF  86

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M  +   A ++V  NVT Y  T   GVKI  V +GNEPFLK Y    L ++T PAL N+
Sbjct  87    LMSQDPQAAASWVDSNVTAY--TYHGGVKIKYVAVGNEPFLKSYNGTYL-QLTLPALRNI  143

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN+AG+G   KAT+PFNAD+Y SP   PVPSAG FRPD++    +I+  L  N++PF
Sbjct  144   QQALNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLAIEILHYLSINNAPF  203

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
              +N+YPFLSLY  N  FP DFAFFDG   KP+ D   TYTNVFDAN+DT V+ALA+ G+ 
Sbjct  204   TVNIYPFLSLY-GNDYFPIDFAFFDGTAYKPIKDRDLTYTNVFDANFDTLVSALAKAGYP  262

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG++ AN   A +F  G ++H  S +GTPAR G  +++Y+F L DE+
Sbjct  263   DMKIIVGEVGWPTDGDKHANIQNAKRFNQGLLRHALSGEGTPARVG-IIDIYLFSLIDEN  321

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG FERHWGI  +DG+PK++LDL+G  + K L  V  + Y+ K+WC +  N   +
Sbjct  322   AKSIEPGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCVLNPNVNDW  381

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +  ++ YAC  +DCTA   GSSC+ LT     SY FN Y+Q + Q++ +CDF GL  V
Sbjct  382   EGLADSVDYACSLSDCTALEYGSSCNQLTAQGNASYAFNMYYQVNNQKSWNCDFDGLAVV  441

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  + S   C F I I
Sbjct  442   TQQDPSYGNCLFPIMI  457



>ref|XP_002275701.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
Length=481

 Score =   424 bits (1089),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 288/433 (67%), Gaps = 10/433 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LGVNWG  +SH L P  VV++LK NGI KVKLF++    +NALAG+GIEVM+G PN  
Sbjct  25    DALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVNALAGSGIEVMVGIPNKD  84

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L+   +Y  A+ +V++NVT++      GV I  V +GNEPFL  Y    L   T+PAL+N
Sbjct  85    LQRYNSYKKAKHWVEKNVTKH--LYDGGVDIRYVAVGNEPFLTSYNGSFL-NTTFPALSN  141

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+EAG G   KAT+P NADVY S  +KP  S G FR DI+  + +I+K+L E  S 
Sbjct  142   IQKALDEAGHGDKIKATIPLNADVYESATNKP--SDGQFRKDIKDLMIKIVKLLHEKKSA  199

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  N  FP DFAFF+G   P +D G  YTNVFDAN+DT V AL + G  
Sbjct  200   FVVNIYPFLSLY-QNPDFPLDFAFFNGGGNPTEDKGVQYTNVFDANHDTLVWALRKAGVP  258

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGEIGWPTDG++ AN  LA +FY G +K LA  KGTP RPG  L+VY+FGL DE+
Sbjct  259   DLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGR-LDVYLFGLIDEN  317

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA--K  1256
              KSV PG FERHWGI  +DG+PKF +D SG G  K L     + YL  KWC +  +A   
Sbjct  318   MKSVAPGSFERHWGIFFFDGKPKFPMDFSGKGLDKFLEPAKGVIYLEPKWCVLNRDAVKN  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T ++  ++YAC  +DCT+   GSSC++L +   +SY FN YFQ   Q+  +C+F G+G+
Sbjct  378   MTQVEPFVNYACSNSDCTSLGYGSSCNNLDQNGNVSYAFNMYFQMQNQDVEACNFNGMGK  437

Query  1437  VTTTNLSTSTCNF  1475
             +TT N ST TC F
Sbjct  438   ITTKNASTGTCLF  450



>ref|XP_010688142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   424 bits (1090),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/435 (49%), Positives = 290/435 (67%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG I++H LPP+ VV+MLK NG  K+KLF + + IL+AL GT IEVM+  PN +L+
Sbjct  28    VGVNWGTIATHQLPPEMVVQMLKNNGFDKLKLFEADDRILSALIGTQIEVMLAIPNNMLE  87

Query  372   EMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM +  D A ++V+ NVT Y  +   GV I  V +GNEP L+ Y    L K   PAL N+
Sbjct  88    EMSSSVDAAVSWVEANVTTYYYSG--GVNINYVAVGNEPTLQTYNGTYL-KYMLPALKNI  144

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG G   KAT+PFNADVY SP   PVPSAG FR +++    +I++ L EN++PF
Sbjct  145   QEALNHAGYGDQIKATIPFNADVYYSPDSNPVPSAGDFRAEVRDLTLEILQFLHENNAPF  204

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N +FP D+AFF+G + P+ D G  YTNVFDAN+DT V+AL + G+  
Sbjct  205   TVNIYPFLSLY-GNKNFPIDYAFFEGSNVPIRDQGVVYTNVFDANFDTLVSALNKAGYPD  263

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+ +AN   A +F  G ++H+ S +GTP R G  ++VY+F L DE+ 
Sbjct  264   MDIIVGEVGWPTDGDIYANVENAKRFNQGLLQHILSGEGTPLRKGK-IDVYLFSLIDENA  322

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-FT  1262
             KSV PG+FERHWGI  +DG PK++LDL+G  + + L  V  ++Y+ K+WC +  +A    
Sbjct  323   KSVAPGNFERHWGIFEFDGMPKYELDLAGMQEDRVLIPVEGVQYMVKRWCVLNPDATGLG  382

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             N+   I+YAC  +DCT+   G SC+ L+     SY FN Y+Q   Q+  +CDF GL  +T
Sbjct  383   NLADNINYACSLSDCTSLGYGCSCNHLSVQGNASYAFNMYYQIKSQDTWNCDFDGLAMIT  442

Query  1443  TTNLSTSTCNFNIGI  1487
               + S STC F I I
Sbjct  443   DQDPSDSTCQFPIMI  457



>ref|XP_009352686.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=470

 Score =   423 bits (1088),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 214/435 (49%), Positives = 286/435 (66%), Gaps = 8/435 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VV+ML+ NG  K+KLF +   IL+AL GT IEVM+  PN +L+
Sbjct  8     FGVNWGTMATHQLPPEKVVRMLEDNGFNKLKLFEADGRILSALIGTKIEVMLAVPNFMLQ  67

Query  372   EMVNYDVA-EAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
             EM    VA + +V  NVT Y  +   GV I  V +GNEPFLK Y    L + T PAL N+
Sbjct  68    EMSQDPVAADTWVDANVTSYCYSG--GVNIKYVAVGNEPFLKTYNGTYL-QTTLPALKNI  124

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q+ALN AG+G   KATVPFNAD+Y SP   PVPS G FRP+I+  +  I+  L+ N++PF
Sbjct  125   QEALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSIIAILHYLNTNEAPF  184

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGK  908
              +N+YPFLSLY  N  FPF FAFFDG  KP+ D    YTNVFDAN+DT + +L + G  +
Sbjct  185   TVNIYPFLSLY-GNTYFPFGFAFFDGTSKPIKDGNLLYTNVFDANFDTLLWSLTKAGFPE  243

Query  909   MTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQ  1088
             M + VGE+GWPTDG+  AN   A +F  G I+H  S  GTPAR G  L+VY+F L DE+ 
Sbjct  244   MKIIVGEVGWPTDGDINANIRNAKRFNQGMIQHALSGDGTPARKGK-LDVYIFSLIDENM  302

Query  1089  KSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAKFT-  1262
             KS+ PG+FERHWGI  YDG+PK+ LDLSG  + +AL  V ++EY+ + WC +    K+  
Sbjct  303   KSIAPGNFERHWGIFEYDGKPKYNLDLSGTMQNEALEAVEDVEYMQRSWCILDPKVKYLD  362

Query  1263  NMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVT  1442
             ++  +I YAC  +DCT+   GSSC++L+     SY FN Y+Q + Q++ +C+F GL  VT
Sbjct  363   DLAKSIDYACTLSDCTSLGYGSSCNNLSLQGNASYAFNMYYQVNSQKSWTCNFSGLAVVT  422

Query  1443  TTNLSTSTCNFNIGI  1487
               + S   C F + I
Sbjct  423   DEDPSVGDCEFPVMI  437



>ref|XP_002310612.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE91062.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=485

 Score =   424 bits (1089),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 226/435 (52%), Positives = 284/435 (65%), Gaps = 13/435 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             L G+GVNWG ++S+PLP   VV MLK NGI KVKLF+S    L ALAGTGIEVM+G PN 
Sbjct  29    LPGIGVNWGTMASNPLPRNIVVNMLKDNGITKVKLFDSDSPTLKALAGTGIEVMVGIPNN  88

Query  363   LLKEMVNYDV--AEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPA  536
              +  +V  D+  AE +VKEN+T Y      GV I  V +GNEPFL  Y       +T+PA
Sbjct  89    QM-SIVAGDIEDAEDWVKENITAYLHNG--GVDIKYVAVGNEPFLSSYNNT-YDNITFPA  144

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+QKAL++AG+G   KATV  NADVY S  DKP  S G FR DI+  + QIIK L +N
Sbjct  145   LQNVQKALDKAGVGDKIKATVALNADVYESLSDKP--SGGDFRKDIKDIMIQIIKFLHQN  202

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              +PF++N+YPFLSLY  N  FPFD+AFFDG  K + D   +Y+NVFDANYDT V  L + 
Sbjct  203   KAPFVVNIYPFLSLY-QNAGFPFDYAFFDG-GKTISDKNVSYSNVFDANYDTLVWTLKKN  260

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G G + + +GE+GWPTDGN  AN  LA KFY G +K L ++KGTP RPG  L++Y+FGL 
Sbjct  261   GVGDLKIIIGEVGWPTDGNFNANNKLAKKFYDGLLKKLVAEKGTPLRPGQ-LDLYLFGLI  319

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA  1253
             DE+QKS+ PG FERHWG+  YDG+PKF +DLSG G  K L     ++Y+  +WC +    
Sbjct  320   DENQKSIAPGHFERHWGLFYYDGKPKFPIDLSGKGNDKMLIAAKGVQYMSPRWCVLNEEN  379

Query  1254  KFTNMKA-TISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
             K  +M A  ISYAC  ADCT+   GSSC  +     +SY FN YFQ  +Q   +C+F GL
Sbjct  380   KNLSMIADEISYACSSADCTSLGYGSSCSKMDIDGNVSYAFNMYFQMQDQGDYACNFNGL  439

Query  1431  GEVTTTNLSTSTCNF  1475
               +  TN S   C F
Sbjct  440   AMIVKTNASRGNCLF  454



>emb|CCH47219.1| similar to glucan endo-1,3-beta-glucosidase [Lupinus angustifolius]
Length=485

 Score =   423 bits (1088),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 215/443 (49%), Positives = 291/443 (66%), Gaps = 13/443 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             +  + G+GVNWG  S+H LPP +VVKMLK NGI+KVKLF++   IL+AL  +GI+VM+G 
Sbjct  23    LGSVSGIGVNWGTQSTHLLPPSTVVKMLKDNGIQKVKLFDADSSILDALKKSGIQVMVGI  82

Query  354   PNALLKEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VT  527
             PN +L  + N    AE +V +N++ +   S  GV I  V +GNEPFL  Y   G F+  T
Sbjct  83    PNDMLYMLANSVQAAEKWVSKNISAH--VSSGGVDIRYVAVGNEPFLSTYN--GTFESTT  138

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
              PAL N+Q AL ++G+G   K TVP NADVYLS  DKP  S G FRPDI   + QI+K L
Sbjct  139   LPALQNIQSALVKSGLGNQVKVTVPMNADVYLSASDKP--SDGNFRPDIHDLMLQIVKFL  196

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
              +N++PF +N+YPF+SLY ++ +FP DFAFF+G   P++DNG+ Y NV DAN+DT V AL
Sbjct  197   SQNNAPFTVNIYPFISLY-SDANFPVDFAFFNGFQSPINDNGRIYDNVLDANHDTLVWAL  255

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
              + G G + + VGEIGWPTDG+  AN   A +F  GF+    + KGTP RPG  ++ Y+F
Sbjct  256   QKNGFGNLPIVVGEIGWPTDGDHNANLQYAQRFNQGFMSRFVAGKGTPMRPG-PIDAYLF  314

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKS  1247
              L DED KS+ PG+FERHWG+  YDG+PK+ L+L G +   L G   + YLPKKWC ++ 
Sbjct  315   SLIDEDDKSIQPGNFERHWGLFYYDGKPKYPLNL-GTRTNGLVGASGVAYLPKKWCILQP  373

Query  1248  NAKFTN--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
             +A   +  +  ++SYAC  ADCT+   G+SC  L     LSY FN+Y+Q ++Q   +C F
Sbjct  374   SANLNSDQVAPSVSYACQNADCTSLGYGTSCGGLDVRGNLSYAFNSYYQVNDQMDSACKF  433

Query  1422  GGLGEVTTTNLSTSTCNFNIGIK  1490
              GL  VT  + ST +C F I I+
Sbjct  434   PGLSVVTDKDPSTPSCKFIIMIQ  456



>emb|CAN62816.1| hypothetical protein VITISV_031885 [Vitis vinifera]
Length=481

 Score =   423 bits (1087),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 287/433 (66%), Gaps = 10/433 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LGVNWG  +SH L P  VV++LK NGI KVKLF++    +NALAG+GIEVM+G PN  
Sbjct  25    DALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVNALAGSGIEVMVGIPNKD  84

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             L+   +Y  A+ +V++NVT++      GV I  V +GNEPFL  Y    L   T+PAL+N
Sbjct  85    LQRYNSYKKAKHWVEKNVTKH--LYDGGVDIRYVAVGNEPFLTSYNGSFL-NTTFPALSN  141

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +QKAL+EAG G   KAT+P NADVY S  +KP  S G FR DI+  + +I+K+L E  S 
Sbjct  142   IQKALDEAGHGDKIKATIPLNADVYESATNKP--SDGQFRKDIKDLMIKIVKLLHEKKSA  199

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F++N+YPFLSLY  N  FP DFAFF+G   P +D G  YTNVFDAN+DT V AL + G  
Sbjct  200   FVVNIYPFLSLY-QNPDFPLDFAFFNGGGNPTEDKGVQYTNVFDANHDTLVWALRKAGVP  258

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGEIGWPTDG++ AN  LA +FY G +K LA  KGTP RPG  L+VY+FGL DE+
Sbjct  259   DLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGR-LDVYLFGLIDEN  317

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA--K  1256
              KSV PG FERHWGI  +DG+PKF +D SG G  K L     + YL  KWC +  +A   
Sbjct  318   MKSVAPGSFERHWGIFFFDGKPKFPMDFSGKGLDKFLEPAKGVIYLEPKWCVLNRDAVKN  377

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              T +   ++YAC  +DCT+   GSSC++L +   +SY FN YFQ   Q+  +C+F G+G+
Sbjct  378   MTQVXPFVNYACSNSDCTSLGYGSSCNNLDQNGNVSYAFNMYFQMQNQDVEACNFNGMGK  437

Query  1437  VTTTNLSTSTCNF  1475
             +TT N ST TC F
Sbjct  438   ITTKNASTGTCLF  450



>ref|XP_010520102.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Tarenaya hassleriana]
Length=483

 Score =   423 bits (1087),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 219/438 (50%), Positives = 282/438 (64%), Gaps = 10/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             + G GVNWG+I+SHPL P  VV MLK N I KVKLF++    +  LAGTGIEVM+G PN 
Sbjct  24    VQGFGVNWGNIASHPLNPNFVVGMLKDNNINKVKLFDADPWTMETLAGTGIEVMVGIPNN  83

Query  363   LLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPAL  539
             +L+++  +Y  AE +VKENVT+Y      GV I  V +GNEPFL  Y    L K T+PA 
Sbjct  84    MLEDLAKDYGYAEDWVKENVTKY--MRDGGVNIKYVAVGNEPFLSAYNGSFL-KTTFPAF  140

Query  540   ANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEND  719
              N+ KAL +AG G   +AT+P NA+VY S  DKP  S G FR D+++ +  I+    +N 
Sbjct  141   KNIHKALRKAGHGDKMQATIPQNAEVYHSDSDKP--SDGDFRSDVKELMLDIVNFFKDNG  198

Query  720   SPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREG  899
             +PF +N+YPFLSLY  N  FP +FAFF+G  + + D G+TY +VFDANYDT V AL + G
Sbjct  199   NPFTVNIYPFLSLY-QNQHFPVEFAFFNGNGQAITDKGRTYDSVFDANYDTLVWALKKAG  257

Query  900   HGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFD  1079
                M + +GE+GWPTDG+ +A+ SLA KFY G +K LA+ +GTP RPG  L+VY+FGL D
Sbjct  258   ISNMKIIIGEVGWPTDGHIYASPSLAEKFYSGLMKKLANDEGTPLRPGK-LDVYLFGLLD  316

Query  1080  EDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKAL-TGVPEIEYLPKKWCTV-KSNA  1253
             ED KS+LPG FERHWGI  YDGQPKF LD +G   K +  G   +EY+ K+WC V K   
Sbjct  317   EDMKSILPGPFERHWGIFRYDGQPKFVLDFTGQGRKIMPVGAKGVEYMEKQWCVVNKETI  376

Query  1254  KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLG  1433
                N+   + YAC   DCTA   GS+C+ L     +SY FN YFQ   Q+  +CDF G  
Sbjct  377   NLDNVGPDLDYACYHGDCTALLYGSTCNKLDSIGNISYAFNMYFQMQSQDVRACDFRGAA  436

Query  1434  EVTTTNLSTSTCNFNIGI  1487
              +  TN S  TC F + I
Sbjct  437   SIVKTNASVGTCLFPVQI  454



>gb|KDO80436.1| hypothetical protein CISIN_1g047337mg [Citrus sinensis]
Length=490

 Score =   423 bits (1088),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 292/441 (66%), Gaps = 8/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             V+  DG+GVNWG +S+H LP  +VV+ML+ N   K+KLF + + IL+AL G+ IEVM+  
Sbjct  24    VSSGDGVGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAI  83

Query  354   PNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
             PN +L EM  +   A ++V  NV+ Y  T   GV I  V +GNEPFL+ Y     + +T 
Sbjct  84    PNYMLLEMSEDPGAAASWVYANVSSYFYTG--GVNIKYVAVGNEPFLRTYNDTYRY-ITL  140

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q+ALN+AG+G   KATVPFNAD+Y SP   PVPSAG FR +++     II+ L 
Sbjct  141   PALKNIQQALNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLH  200

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
              N++PF +N+YPFLSLY  N  FP DFAFF+G +KP+ D    YTNVFDAN+DT V +L 
Sbjct  201   LNNAPFTVNIYPFLSLY-GNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLD  259

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
             + G+  M + VGE+GWPTDG++ AN   A KF  G +KH+ S  GTPAR G+ ++VY+F 
Sbjct  260   KAGYPDMHIIVGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGT-IDVYLFS  318

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKS  1247
             L DE+ KS+ PG+FERHWGI  YDG+PK++LDLSG  K K L  V  + Y+P++WC +  
Sbjct  319   LLDENAKSIAPGNFERHWGIFEYDGKPKYELDLSGKMKNKGLAPVEGVAYMPRRWCVLNP  378

Query  1248  NA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             +A  F  +  +I YAC  +DCTA   GSSC+ LT     SY FN Y+Q + QE+ +CDF 
Sbjct  379   HADDFEELPDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDFS  438

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VT  + S   C F + I
Sbjct  439   GLAMVTDGDPSDDHCQFPVMI  459



>gb|EMS57429.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=473

 Score =   422 bits (1086),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 222/437 (51%), Positives = 281/437 (64%), Gaps = 25/437 (6%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             LGVNWG   +H L P  VVKMLKANGI KVKLF++    + AL  +GIEVM+G PN +L+
Sbjct  29    LGVNWGSQCTHQLDPSEVVKMLKANGIMKVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  88

Query  372   EMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQ  551
              M +Y  AE +V EN T Y     D +K+  V +GNEPFLK Y      + T PAL N+Q
Sbjct  89    AMTSYGNAEDWVAENATSYG----DRLKLRYVAVGNEPFLKSYNGS-FMENTVPALKNIQ  143

Query  552   KALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFM  731
             KAL+EAGIG   KATVP NADVY+   DKP  S G FRPDI   +  ++K + ++ +PF+
Sbjct  144   KALDEAGIGDKVKATVPLNADVYVG--DKP--SEGKFRPDIDDVMTDMVKFMHDHGAPFV  199

Query  732   INVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKM  911
             +N+YPFLSLY ++ +FPFD           D  G +Y+NVFDANYDT V+AL + G   +
Sbjct  200   VNIYPFLSLYQSD-NFPFDIQ---------DTGGVSYSNVFDANYDTLVSALKKAGVPSL  249

Query  912   TVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQK  1091
              V VGEIGWPTDGN+ AN  LA +FY G +K LA  +GT  RPG  ++VY+FGLFDED K
Sbjct  250   KVVVGEIGWPTDGNKNANPKLARRFYDGLLKKLAKNEGTHLRPGK-MDVYLFGLFDEDMK  308

Query  1092  SVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA----K  1256
             S+ PG+FERHWGIL YDG+PKF +DLSG G  + L  V  +EYLPK+WC     A     
Sbjct  309   SIAPGNFERHWGILTYDGKPKFSMDLSGQGNDRRLAAVSGVEYLPKQWCVFDDEAAKDED  368

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +   I YAC   DCTA   G SC+ L E   +SY FN YFQ  +Q+  +CDF GL +
Sbjct  369   MDKLGGNIQYACASGDCTALGYGCSCNGLDEMSNISYAFNMYFQMQDQDVRACDFDGLAK  428

Query  1437  VTTTNLSTSTCNFNIGI  1487
             ++  N ST TC F + I
Sbjct  429   ISDKNASTKTCLFPVQI  445



>gb|EMS60021.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=616

 Score =   427 bits (1098),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 282/449 (63%), Gaps = 22/449 (5%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKSVV------KMLKANGIKKVKLFNSPEHILNALAGTGIE  338
             AGL  + V        PL  + V+      ++LK NGI KVKLF +    + ALAG+G+E
Sbjct  121   AGLTSMNVR------RPLSAERVLLGGEGFRLLKDNGINKVKLFETNPEAMKALAGSGVE  174

Query  339   VMIGTPNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGL  515
             VM+  PN +L  +  +   A  +VK NV R+      GV I  V +GNEPFL  Y K   
Sbjct  175   VMLAIPNDMLHRIAGDSAAARDWVKRNVKRFDFDG--GVVIKYVAVGNEPFLAAY-KGSF  231

Query  516   FKVTYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQI  695
              KVT PAL N+Q ALN+AGIG   KATVP NADVY SP   PVPSAG FR +I   +  +
Sbjct  232   MKVTLPALENIQNALNDAGIGDRIKATVPLNADVYNSPARNPVPSAGRFRAEISGVMTDM  291

Query  696   IKVLDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTA  875
             +K L +N +PF +N+YPFLSLY  + +FP DFAFFDG   P++DNG  YTNV+DAN+DT 
Sbjct  292   VKFLAKNKAPFTVNIYPFLSLYL-DDNFPLDFAFFDGGATPVNDNGVMYTNVYDANFDTL  350

Query  876   VAALAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALE  1055
             VAALA  GHG M + VGE+GWPTDG+  A AS A +FY G +K LA+ +GTPARP   +E
Sbjct  351   VAALAAVGHGDMPIIVGEVGWPTDGDRHAKASYARRFYDGLLKRLAANRGTPARPNRQIE  410

Query  1056  VYMFGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKW  1232
              Y+FG+ DE ++SV PG FERHWGI  YDGQPKF +DLSG G+   L     ++YL + W
Sbjct  411   TYLFGVGDEGRESVQPGSFERHWGIFRYDGQPKFAMDLSGQGRNTMLVPAKGVQYLSRTW  470

Query  1233  CTVKSNAKFTNMK----ATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQ  1400
             C +   A   ++     A I YAC  ADCT    GSSC+ +      SY FNAY+QT  Q
Sbjct  471   CALNPKASRDDLNKLLGAKIDYACSNADCTTLGYGSSCNGMDARGNASYAFNAYYQTQSQ  530

Query  1401  EAGSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
             E  +CDF GL   T T+ ST+TCNF I I
Sbjct  531   EDEACDFQGLALPTQTDPSTATCNFTIQI  559



>ref|XP_002883518.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59777.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score =   422 bits (1084),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/428 (50%), Positives = 278/428 (65%), Gaps = 8/428 (2%)
 Frame = +3

Query  213   ISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLKEMV-NYD  389
             ++SH LPP+ VVKML+ NG  K+KLF + ++IL+AL G+ IEVMIG PN  LKE+  +  
Sbjct  1     MASHQLPPEKVVKMLQDNGFTKLKLFEADQNILDALIGSQIEVMIGIPNRFLKELAQDTS  60

Query  390   VAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANMQKALNEA  569
             VA ++V+ENVT Y      GV I  + +GNEPFL+ Y    + + T PAL N+Q+AL EA
Sbjct  61    VAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALINIQRALEEA  117

Query  570   GIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPFMINVYPF  749
              + K    TVPFNAD+Y SP   PVPSAG FRP+++    +II  L  +DSPF +N+YPF
Sbjct  118   DL-KGVTVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPFTVNIYPF  176

Query  750   LSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHGKMTVTVGE  929
             LSLY  N  FP DFAFFDG +K L D    YTNVFDAN DT + A+ +     M + VGE
Sbjct  177   LSLY-GNAYFPLDFAFFDGTNKSLRDGNLVYTNVFDANLDTLICAMEKYSFLGMKIIVGE  235

Query  930   IGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDEDQKSVLPGD  1109
             +GWPTDG++ AN   A +F  G +KH  S  GTPAR G  ++VY+F L DED KS+ PG 
Sbjct  236   VGWPTDGDKNANLKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDAKSIAPGT  295

Query  1110  FERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNA-KFTNMKATIS  1283
             FERHWGI G+DG+PK++LDLSG G  K L  V ++ YLPK WC +  NA    ++   I 
Sbjct  296   FERHWGIFGFDGRPKYELDLSGKGNDKPLVPVEDVNYLPKTWCVLDPNAYNLDDLPDNID  355

Query  1284  YACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEVTTTNLSTS  1463
             YAC  +DCTA   GSSC+ LT     SY FN Y+Q H+Q+   CDF GLG +T  + S  
Sbjct  356   YACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLGLGLITDEDPSDE  415

Query  1464  TCNFNIGI  1487
              C F + I
Sbjct  416   LCEFPVMI  423



>ref|XP_002281500.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
Length=485

 Score =   422 bits (1085),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 287/436 (66%), Gaps = 9/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LPP+ VV+MLK NG +K+KLF + E IL AL GT IEVM+  PN +L
Sbjct  28    GVGVNWGTMATHQLPPEKVVRMLKDNGFRKLKLFEADERILEALTGTHIEVMLAIPNYML  87

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
              EM  +  VA ++V+ NV+ Y  +   GV I  V +GNEPFL+ Y    L K T PAL N
Sbjct  88    PEMSEDPSVATSWVQANVSSY--SYAGGVNIKYVAVGNEPFLQTYNGTFL-KYTLPALKN  144

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q+ALN   + ++ KATVPFNAD+Y SP   PVPSAG FR +++    +II+ L  ND+P
Sbjct  145   IQQALNNEAL-ESVKATVPFNADIYYSPDSNPVPSAGDFRAEVRDLTIEIIQYLHSNDAP  203

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP D+AFFDG +KP+ D    YTNVFDAN+DT V AL R G+ 
Sbjct  204   FTVNIYPFLSLY-GNAYFPMDYAFFDGSNKPIKDGNNVYTNVFDANFDTLVWALDRAGYP  262

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              + + VGE+GWPTDG++ AN   A +F  G I H+ S KGTPAR G  +E Y+F L DE+
Sbjct  263   DVKIIVGEVGWPTDGDKNANVKNAKRFNQGLIHHVLSGKGTPARKGK-IEAYLFSLIDEN  321

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGK-GKALTGVPEIEYLPKKWCTVKSNA-KF  1259
              KS+ PG FERHWGI  YDG+PK++LD+SG +  K L     ++Y+ ++WC +  N    
Sbjct  322   AKSIAPGCFERHWGIFEYDGKPKYELDVSGSRENKGLVAAEGVKYMVRRWCVLNPNTDDL  381

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
              ++  +I+YAC  +DCTA   GSSC+ L+     SY FN Y+Q + Q++  CDF GLG  
Sbjct  382   EDLPDSINYACSMSDCTALGYGSSCNHLSVAGNASYAFNMYYQVNNQQSWDCDFSGLGIE  441

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  + S   C F + I
Sbjct  442   TEEDPSDDECLFPVMI  457



>gb|KEH39797.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=476

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 218/438 (50%), Positives = 288/438 (66%), Gaps = 13/438 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG  S+HPLPP +VVKMLK NGI+KVKLF++  +IL+AL  +GI+VM+G PN LL
Sbjct  25    GIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPNILDALKKSGIQVMVGIPNDLL  84

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VTYPALA  542
               M N    AE +V +NV+ +   S  GV I  + +GNEPFL  Y   G F+  T PAL 
Sbjct  85    YTMANSRQAAEKWVAKNVSAH--VSSGGVDIRYIAVGNEPFLSTYN--GTFEATTLPALV  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q AL +AG+G + K TVP NADVY S    P  S G FR DI   + QI+K L +N++
Sbjct  141   NIQNALIKAGLGSSIKVTVPSNADVYQSSSGNP--SDGDFRTDIHDLMVQIVKFLSQNNA  198

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YPF+SLY  + +FP D+AFF+G   PL+DNGK Y NVFDANYDT V AL + G 
Sbjct  199   PFTVNIYPFISLY-EDPNFPVDYAFFNGFSDPLNDNGKIYDNVFDANYDTLVWALNKNGF  257

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G M + VGEIGWPTDG+   N  LA +F  GF+    + KGTP RPG  ++ Y+F L DE
Sbjct  258   GNMPIIVGEIGWPTDGDRNGNLQLAQRFNQGFMTRFIAGKGTPLRPG-PMDAYLFSLVDE  316

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAKFT  1262
             D KS+ PG+FERHWG+  YDG+PK++L + G +   L G   + +LPKKWC +K +A   
Sbjct  317   DNKSIQPGNFERHWGLFYYDGRPKYQLTI-GSRTNGLVGATGVAHLPKKWCILKPSANLN  375

Query  1263  N--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
             +  +  ++SYAC  ADCT+   G+SC  L     +SY FN+Y+Q ++Q  G+C F GL  
Sbjct  376   SDQVAPSVSYACQNADCTSLGYGTSCGGLDIRGNISYAFNSYYQVNDQVDGACKFPGLST  435

Query  1437  VTTTNLSTSTCNFNIGIK  1490
             VT  + ST  C F I I+
Sbjct  436   VTDRDPSTQDCTFQIMIQ  453



>ref|XP_006476105.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
Length=490

 Score =   422 bits (1085),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 291/441 (66%), Gaps = 8/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             V+  DG+GVNWG +S+H LP  +VV+ML+ N   K+KLF + + IL+AL G+ IEVM+  
Sbjct  24    VSSGDGVGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAI  83

Query  354   PNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
             PN +L EM  +   A ++V  NV+ Y      GV I  V +GNEPFL+ Y     + +T 
Sbjct  84    PNYMLLEMSEDPGAAASWVYANVSSYFYNG--GVNIKYVAVGNEPFLRTYNDTYRY-ITL  140

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q+ALN+AG+G   KATVPFNAD+Y SP   PVPSAG FR +++     II+ L 
Sbjct  141   PALKNIQQALNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLH  200

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
              N++PF +N+YPFLSLY  N  FP DFAFF+G +KP+ D    YTNVFDAN+DT V +L 
Sbjct  201   LNNAPFTVNIYPFLSLY-GNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLD  259

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
             + G+  M + VGE+GWPTDG++ AN   A KF  G +KH+ S  GTPAR G+ ++VY+F 
Sbjct  260   KAGYPDMHIIVGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGT-IDVYLFS  318

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKS  1247
             L DE+ KS+ PG+FERHWGI  YDG+PK++LDLSG  K K L  V  + Y+P++WC +  
Sbjct  319   LLDENAKSIAPGNFERHWGIFEYDGKPKYELDLSGKMKNKGLAPVEGVAYMPRRWCVLNP  378

Query  1248  NA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             +A  F  +  +I YAC  +DCTA   GSSC+ LT     SY FN Y+Q + QE+ +CDF 
Sbjct  379   HADDFEELPDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDFS  438

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  VT  + S   C F + I
Sbjct  439   GLAMVTDEDPSDDHCQFPVMI  459



>gb|KGN60639.1| hypothetical protein Csa_2G005360 [Cucumis sativus]
Length=478

 Score =   421 bits (1083),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 289/436 (66%), Gaps = 9/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP+ VVKML+ NG  K+KLF + + IL AL G+ IEVM+  PN++L 
Sbjct  9     VGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGSDIEVMLAIPNSMLF  68

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M  +   A ++V  NVT Y  T   GVKI  V +GNEPFLK Y    L  +T PAL N+
Sbjct  69    LMSQDPHAAASWVDSNVTAY--TYHGGVKIKYVAVGNEPFLKSYNGTYL-PLTLPALRNI  125

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q++LN+AG+G   KAT+PFNAD+Y SP   PVPSAG FRPD++    +I+  L  N++PF
Sbjct  126   QQSLNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLTIEILHYLSINNAPF  185

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
              +N+YPFLSLY  N  FP DFAFFDG   +P+ D   TYTNVFDAN+DT V+ALA+ G+ 
Sbjct  186   TVNIYPFLSLY-GNDYFPIDFAFFDGTAYRPIKDRDLTYTNVFDANFDTLVSALAKAGYP  244

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG++ AN   A +F  G ++H  S +GTPAR G  ++VY+F L DE+
Sbjct  245   DMKIIVGEVGWPTDGDKHANVQNAKRFNQGLLRHALSGQGTPARVG-IIDVYLFSLIDEN  303

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG FERHWGI  +DG+PK++LDL+G  + K L  V  + Y+ K+WC +  N   +
Sbjct  304   AKSIEPGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCVLNPNVNDW  363

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +  ++ YAC  +DCTA   GSSC+ L+     SY FN Y+Q + Q++ +CDF GL  V
Sbjct  364   EGLADSVDYACSLSDCTALEYGSSCNQLSAQGNASYAFNMYYQVNSQKSWNCDFDGLAVV  423

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  + S   C F I I
Sbjct  424   TQQDPSYGNCQFPIMI  439



>ref|XP_002970933.1| hypothetical protein SELMODRAFT_267465 [Selaginella moellendorffii]
 gb|EFJ28259.1| hypothetical protein SELMODRAFT_267465 [Selaginella moellendorffii]
Length=476

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/436 (49%), Positives = 288/436 (66%), Gaps = 9/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+GVNWG ++SH LP K+VV+ML+ANGI KVKLF++   ++ +  GT +E+MI  PN +L
Sbjct  13    GIGVNWGTMASHRLPNKTVVQMLRANGISKVKLFDADPGVMESFRGTDMELMIAIPNEML  72

Query  369   KEMVNY-DVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + +      A  +V+ NVTRY+ T+ +GVKI  V +GNEPFLK Y       + YPAL N
Sbjct  73    ELVATLPAAARNWVRRNVTRYR-TAKNGVKIKYVAVGNEPFLKAYNGS-YDNLAYPALKN  130

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q AL  AG+G++ KAT+P N DV LS  D  +PS G+FRPDI  QV ++++ L E+++P
Sbjct  131   VQDALVSAGLGESIKATIPLNGDV-LSNGDSTLPSGGIFRPDIAPQVLKVVEALAEHNAP  189

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F+INVYPFLSL   +  FP DFAFFDG D PL D   +YTNVFDA+YD  VAAL + G+ 
Sbjct  190   FVINVYPFLSLQ-QDPHFPRDFAFFDGTDFPLVDGNLSYTNVFDASYDLLVAALTKAGYS  248

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              MT+ +GEIGWPTDG+  AN + A +F   FI+H+  + GTP R    LE Y+F L DED
Sbjct  249   NMTIIIGEIGWPTDGDINANVANAVRFNQAFIRHVL-QSGTPLR-RPPLEAYLFSLLDED  306

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDL--SGGKGKALTGVPEIEYLPKKWCTVKSNAKF  1259
             QK++ PG+FERHWGI GYDG+ K++LDL  SG     L     ++YLP++WC +  +   
Sbjct  307   QKTISPGNFERHWGIFGYDGKAKYRLDLQGSGNATANLVNASSVKYLPRQWCVLDPSGDI  366

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +   + YAC  +DCT+   GSSC  +    K SY FN+Y+Q ++Q   SC F GL  +
Sbjct  367   ARLGNNMDYACSHSDCTSIVPGSSCDGMGSDAKASYAFNSYYQLYDQLNTSCYFDGLATI  426

Query  1440  TTTNLSTSTCNFNIGI  1487
             T T+ S+ TC F I I
Sbjct  427   TKTSPSSGTCQFKIQI  442



>ref|XP_011082117.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Sesamum indicum]
Length=484

 Score =   421 bits (1083),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 283/443 (64%), Gaps = 14/443 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             V  +  +G NWG  ++HPL P  VVK+LK NGI+KVKLF++   +LNAL+G+GIEVM+G 
Sbjct  21    VNTVQSIGANWGTQATHPLHPSIVVKLLKDNGIQKVKLFDAEATVLNALSGSGIEVMVGI  80

Query  354   PNALLKEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VT  527
             PN +L  + N  D AE +V+ NV+ +   S + V I  V +GNEPFL  Y   G F+  T
Sbjct  81    PNDMLSTLANSVDAAERWVERNVSAH--VSSNSVDIRYVAVGNEPFLSTYN--GTFQATT  136

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
              PAL N+Q AL +AG+G   K TVP NADVY S  ++P  S G FR +I   + QI+  L
Sbjct  137   LPALQNIQAALIKAGLGNRVKVTVPLNADVYQSSTEQP--STGDFRANIHDLMVQIVSFL  194

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
               N +PF +N+YPF+SLY  + +FP D+AFFDG   P+ DNG+TYTNVFDANYDT V AL
Sbjct  195   SLNGAPFTVNIYPFISLY-NDPNFPVDYAFFDGYSSPIVDNGRTYTNVFDANYDTLVWAL  253

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
              + G G MT+ VGEIGWPTDG+  AN   A +F  GF+ H+    GTP RPG  ++ Y+F
Sbjct  254   QKNGFGNMTIIVGEIGWPTDGDRNANIGYAQRFNQGFMSHM--NAGTPMRPG-PIDAYLF  310

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKS  1247
              L DED KS+ PG+FERHWGI  YDG PK+ L L      +L     + YLP++WC +  
Sbjct  311   SLIDEDAKSIQPGNFERHWGIFNYDGTPKYNLSLGSSNSHSLVPASNVHYLPRRWCVLSP  370

Query  1248  NAKFTN--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
             +A   +  +  ++SYAC   DCT+   G+SC +L     +SY FN+Y+Q + Q   +C F
Sbjct  371   SANLEDPQVALSVSYACANGDCTSLGYGTSCGNLDAQRNISYAFNSYYQINNQLESACRF  430

Query  1422  GGLGEVTTTNLSTSTCNFNIGIK  1490
               L  +TTT+ S  TC FNI I+
Sbjct  431   PNLSVITTTDPSVGTCRFNIMIQ  453



>ref|XP_006283637.1| hypothetical protein CARUB_v10004695mg [Capsella rubella]
 gb|EOA16535.1| hypothetical protein CARUB_v10004695mg [Capsella rubella]
Length=484

 Score =   421 bits (1082),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/440 (48%), Positives = 290/440 (66%), Gaps = 14/440 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  + HPLPP +VV++L+ NGI+KVKLF +   IL AL+ TGI+VM+G PN 
Sbjct  24    VEGIGVNWGSQARHPLPPATVVRLLRENGIQKVKLFEADSSILKALSRTGIQVMVGIPND  83

Query  363   LLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VTYPA  536
             LL  +  +   AE +V +NV+ +   S +GV I  V +GNEPFLK +   G F+ +T PA
Sbjct  84    LLAPIAGSVAAAERWVSQNVSAH--VSSNGVDIRYVAVGNEPFLKAFN--GTFESITLPA  139

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+Q A+ +AG+    K TVP NADVY S  +  +PS G FRP+I+  +  I+K L +N
Sbjct  140   LQNIQSAIIKAGLATQVKVTVPLNADVYQSASN--LPSDGDFRPEIRDLMLNIVKFLSDN  197

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              +PF IN+YPF+SLY  + +FP +FAFFDG   P++DNG+ Y NV DANYDT V +L + 
Sbjct  198   QAPFTINIYPFISLY-NDPNFPVEFAFFDGTGTPINDNGRIYDNVLDANYDTLVWSLQKN  256

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G G +T+ VGE+GWPTDG++ AN   A ++  GF+    + KGTP RPG A++ Y+FGL 
Sbjct  257   GFGNLTIIVGEVGWPTDGDKSANMLYARRYNQGFMNRQKANKGTPMRPG-AMDAYLFGLI  315

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             DED KS+ PG+FERHWGI   DGQPK++L L  G G  L    ++ YL KKWC +  NA 
Sbjct  316   DEDAKSIQPGNFERHWGIFFIDGQPKYQLSL--GNGNGLIPAKDVHYLAKKWCILAPNAN  373

Query  1257  FTN--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
               +  +  ++SYACD ADCT+   GSSC SL   + +SY FN+Y+Q   Q   +C F GL
Sbjct  374   LQDPQLGPSVSYACDHADCTSLGYGSSCGSLNLAQNVSYAFNSYYQVSNQLDSACKFPGL  433

Query  1431  GEVTTTNLSTSTCNFNIGIK  1490
               +T  + S  +C F I IK
Sbjct  434   SIITNRDPSVGSCKFKIMIK  453



>ref|XP_006580871.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=462

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 219/441 (50%), Positives = 286/441 (65%), Gaps = 9/441 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIG  350
             G   + G+GVNWG I+SHP+ P  VV +LK NGIKKVKLF++    ++A +GT IEVM+G
Sbjct  15    GAEAVSGIGVNWGAIASHPMDPPIVVNLLKDNGIKKVKLFDADSWTVSAFSGTDIEVMVG  74

Query  351   TPNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVT  527
              PN  LKE+  + D AE +VK+NV+++      GV I  V +GNEPFLK Y       +T
Sbjct  75    IPNDQLKELSKDQDNAEDWVKQNVSKH--VHDGGVNIRYVSVGNEPFLKSYNGS-FVGIT  131

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
             +PA+ N+QKA+++AG+G   K T   NADVY S  +KP  S G FR DI   +KQI+K L
Sbjct  132   FPAMENVQKAIDKAGLGDKIKVTTALNADVYESNSNKP--SDGNFRKDIYGVMKQIVKFL  189

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             DE  SPF++N+YPFLSLY  N  FP D+AFF+G  K  DD    YTN+FDAN DT V +L
Sbjct  190   DEKKSPFLVNIYPFLSLY-QNEDFPEDYAFFEGHGKSTDDKNAHYTNMFDANLDTLVWSL  248

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
              + GH  +++ VGEIGWPTDG++ AN   A +FY GF+K +ASKKGTP  PG  +  Y+F
Sbjct  249   KKIGHPNVSICVGEIGWPTDGDKNANDKNANRFYQGFLKKMASKKGTPLHPG-PVNTYLF  307

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVK  1244
              LFDE+ KSV PGDFERHWGI  YDG+PKF +D SG G+ K   G   + Y   KWC +K
Sbjct  308   SLFDENMKSVAPGDFERHWGIFRYDGKPKFPIDFSGKGEDKMPIGAKGVRYQEHKWCVLK  367

Query  1245  SNAKFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFG  1424
             +NA  + +  ++SYAC   DCT+   G SC +L      SY FN YFQ ++Q   +CDF 
Sbjct  368   NNANKSALGGSLSYACAGGDCTSLCPGCSCGNLDASGNASYAFNQYFQINDQSVEACDFE  427

Query  1425  GLGEVTTTNLSTSTCNFNIGI  1487
             GL  + + + S   C F I I
Sbjct  428   GLATIVSKDPSKGDCYFPIAI  448



>ref|NP_194843.1| glucan endo-1,3-beta-glucosidase 5 [Arabidopsis thaliana]
 sp|Q9M088.1|E135_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 5; AltName: Full=(1->3)-beta-glucan 
endohydrolase 5; Short=(1->3)-beta-glucanase 
5; AltName: Full=Beta-1,3-endoglucanase 5; Short=Beta-1,3-glucanase 
5; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB79832.1| 1, 3-beta-glucanase-like protein [Arabidopsis thaliana]
 dbj|BAF01260.1| beta-1,3-glucanase 5 [Arabidopsis thaliana]
 gb|AEE85864.1| glucan endo-1,3-beta-glucosidase 5 [Arabidopsis thaliana]
Length=484

 Score =   421 bits (1082),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/440 (48%), Positives = 291/440 (66%), Gaps = 14/440 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  + HPLPP +VV++L+ NGI+KVKLF +   IL AL+ TGI+VM+G PN 
Sbjct  24    VEGIGVNWGSQARHPLPPATVVRLLRENGIQKVKLFEADSAILKALSRTGIQVMVGIPND  83

Query  363   LLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VTYPA  536
             LL  +  +   AE +V +NV+ +   S +GV I  V +GNEPFLK +   G F+ +T PA
Sbjct  84    LLAPLAGSVAAAERWVSQNVSAH--VSSNGVDIRYVAVGNEPFLKAFN--GTFEGITLPA  139

Query  537   LANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDEN  716
             L N+Q A+ +AG+    K TVP NADVY S  +  +PS G FRP+I+  +  I+K L +N
Sbjct  140   LQNIQSAIIKAGLATQVKVTVPLNADVYQSASN--LPSDGDFRPEIRDLMLNIVKFLSDN  197

Query  717   DSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALARE  896
              +PF IN+YPF+SLY  + +FP +FAFFDG   P++DNG+ Y NV DANYDT V +L + 
Sbjct  198   GAPFTINIYPFISLY-NDPNFPVEFAFFDGTGTPINDNGRIYDNVLDANYDTLVWSLQKN  256

Query  897   GHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLF  1076
             G G +T+ VGE+GWPTDG++ AN   A ++  GF+    + KGTP RPG A++ Y+FGL 
Sbjct  257   GFGNLTIIVGEVGWPTDGDKNANLMYARRYNQGFMNRQKANKGTPMRPG-AMDAYLFGLI  315

Query  1077  DEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPEIEYLPKKWCTVKSNAK  1256
             DED KS+ PG+FERHWGI   DGQPK++L L  G G  L    ++ YL KKWC +  NA 
Sbjct  316   DEDAKSIQPGNFERHWGIFYIDGQPKYQLSL--GSGNGLIPAKDVHYLAKKWCILAPNAN  373

Query  1257  FTN--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGL  1430
               +  +  ++SYACD ADCT+   GSSC +L   + +SY FN+Y+Q   Q   +C F GL
Sbjct  374   LQDPQLGPSVSYACDHADCTSLGYGSSCGNLNLAQNVSYAFNSYYQVSNQLDSACKFPGL  433

Query  1431  GEVTTTNLSTSTCNFNIGIK  1490
               V+T + S  +C F I IK
Sbjct  434   SIVSTRDPSVGSCKFKIMIK  453



>ref|XP_010462737.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=485

 Score =   421 bits (1082),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 218/437 (50%), Positives = 279/437 (64%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF++    +NALAGT +EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPNIVVQMLKDNKISKVKLFDADSWTMNALAGTNMEVMVGIPNNLL  86

Query  369   KEMVN-YDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
             + + + Y  A+ +VKENVT Y      GV I  V +GNEPFL  Y    L K T+PAL N
Sbjct  87    ESLADDYGNAKDWVKENVTHY--MRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             + KAL EAG     KAT+P NA+VY S  DKP  S G FR D+++ +  I+    +ND P
Sbjct  144   IHKALKEAGHTDKIKATIPQNAEVYQSANDKP--SEGDFRKDVKQTMVDIVTYFHDNDLP  201

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F +N+YPFLSLY  N  FP +FAF DG  + ++D GK Y NVFDANYDT V AL + G  
Sbjct  202   FTVNIYPFLSLYL-NEHFPVEFAFLDGDGQTINDKGKNYDNVFDANYDTLVYALKKAGIH  260

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPT+G+++A   LA KFY G +K LA   GTP RP   LEVY+FG  DED
Sbjct  261   DMKIIVGEVGWPTEGHKYATPKLAEKFYAGLMKRLAKDGGTPTRP-ERLEVYLFGFLDED  319

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALTGVPE--IEYLPKKWCTV-KSNAK  1256
              KS+LPG FERHWGI  YDG PKF LD + G+G+ +  V    ++YL K+WC V K  A 
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFT-GQGRQIVPVAAKGVQYLEKQWCVVNKDTAN  378

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
                +   + YAC   DCTA   GS+C  LT+ + +SY FN Y+Q  +Q+  +CDF G   
Sbjct  379   LDEIGPDLDYACYHGDCTAMEAGSTCSKLTKIQNISYAFNMYYQIQDQDVRACDFKGAAM  438

Query  1437  VTTTNLSTSTCNFNIGI  1487
             ++  N S  +C F + I
Sbjct  439   ISKVNASVGSCLFPVQI  455



>ref|XP_004163604.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
8-like [Cucumis sativus]
Length=478

 Score =   421 bits (1081),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 289/436 (66%), Gaps = 9/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP+ VVKML+ NG  K+KLF + + IL AL G+ IEVM+  PN++L 
Sbjct  9     VGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGSDIEVMLAIPNSMLF  68

Query  372   EMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALANM  548
              M  +   A ++V  NVT Y  T   GVKI  V +GNEPFLK Y    L  +T PAL N+
Sbjct  69    LMSQDPHAAASWVDSNVTAY--TYHGGVKIKYVAVGNEPFLKSYNGTYL-PLTLPALRNI  125

Query  549   QKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSPF  728
             Q++LN+AG+G   KAT+PFNAD+Y SP   PVPSAG FRPD++    +I+  L  N++PF
Sbjct  126   QQSLNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLTIEILHYLSINNAPF  185

Query  729   MINVYPFLSLYFANGSFPFDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
              +N+YPFLSLY  N  FP DFAFFDG   +P+ D   TYTNVFDAN+DT V+ALA+ G+ 
Sbjct  186   TVNIYPFLSLY-GNDYFPIDFAFFDGTAYRPIKDRDLTYTNVFDANFDTLVSALAKAGYP  244

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              M + VGE+GWPTDG++ AN   A +F  G ++H  S +GTPAR G  ++VY+F L DE+
Sbjct  245   DMKIIVGEVGWPTDGDKHANVQNAKRFNQGLLRHALSGQGTPARVG-IIDVYLFSLIDEN  303

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSGG-KGKALTGVPEIEYLPKKWCTVKSNAK-F  1259
              KS+ PG FERHWGI  +DG+PK++LDL+G  + K L  V  + Y+ K+WC +  N   +
Sbjct  304   AKSIEPGSFERHWGIFEFDGKPKYELDLAGTEEEKGLIPVEGVRYMGKRWCXLNPNVNDW  363

Query  1260  TNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGEV  1439
               +  ++ YAC  +DCTA   GSSC+ L+     SY FN Y+Q + Q++ +CDF GL  V
Sbjct  364   EGLADSVDYACSLSDCTALEYGSSCNQLSAQGNASYAFNMYYQVNSQKSWNCDFDGLAVV  423

Query  1440  TTTNLSTSTCNFNIGI  1487
             T  + S   C F I I
Sbjct  424   TQQDPSYGNCQFPIMI  439



>ref|XP_010681060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   421 bits (1081),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 225/443 (51%), Positives = 291/443 (66%), Gaps = 12/443 (3%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMI  347
             NG      +GVNWG I+SHPLPP +VV MLK NG+KKVKLF++    L ALAGTGI+VM+
Sbjct  20    NGADNSYSIGVNWGSIASHPLPPSNVVGMLKDNGLKKVKLFDADASTLEALAGTGIDVMV  79

Query  348   GTPNALLKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-V  524
               PN +L+ M  Y  A+ +VK+NVT++      GV I  V +GNEPFL  Y     FK  
Sbjct  80    AIPNDMLERMNKYKHAKDWVKKNVTKH--LYDGGVNIKYVAVGNEPFLASYNDS--FKYT  135

Query  525   TYPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKV  704
             T+PAL N+ KAL EAG G   KA++P NADVY        PS+G FR DI+  +  I+  
Sbjct  136   TFPALQNIVKALEEAGHGDI-KASIPLNADVY--ESSSTSPSSGDFRGDIKDLMLDIVAF  192

Query  705   LDENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L +  +PF++N+YPFLSLY  N  FP +FAFFDG  K ++DN  +Y NVFDAN+DT V A
Sbjct  193   LKDKGAPFIVNIYPFLSLY-QNPDFPENFAFFDGGGKSINDNSHSYNNVFDANFDTLVWA  251

Query  885   LAREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYM  1064
             L + G+G + + VGEIGWPTDG+  AN   A KFY G +K LA+ KGTP R G  LEVY+
Sbjct  252   LKKNGYGDLKIIVGEIGWPTDGHIQANTKNAKKFYDGLLKKLAANKGTPMRSGQ-LEVYL  310

Query  1065  FGLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTV  1241
             FGL DE+ KS+ PG+FERHWGI  YDGQPKF++DLSG G  K   G   ++YL  KWC  
Sbjct  311   FGLLDENMKSIAPGNFERHWGIFRYDGQPKFQMDLSGKGNDKMPIGAKGVQYLESKWCIY  370

Query  1242  KSNAKFTN-MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCD  1418
               +AK  + ++ +I YAC R+DCTA   GSSC++L     +SY FN +FQ ++Q   +C 
Sbjct  371   NQDAKNQDKVQGSIEYACSRSDCTALEYGSSCNNLDVKGNISYAFNMFFQMNDQSVEACQ  430

Query  1419  FGGLGEVTTTNLSTSTCNFNIGI  1487
             F GLG +++TN S   C F I +
Sbjct  431   FDGLGMISSTNASQQGCLFPIEV  453



>ref|XP_009418582.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   421 bits (1082),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 289/446 (65%), Gaps = 21/446 (5%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNALL  368
             G+G NWG  +SHPLPP +VV++LK NGI+K KLF++ + +L+ALA +GI+VM+G PN +L
Sbjct  22    GIGANWGTQASHPLPPSTVVQLLKDNGIQKAKLFDADDRVLSALANSGIQVMVGIPNDML  81

Query  369   KEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTYPALAN  545
               +  ++  AE +V +NV+ Y     DGV I  V +GNEPFL+ Y    L + TYPAL N
Sbjct  82    ASLASDHKAAERWVAKNVSDY---VHDGVDIRFVAVGNEPFLETYNGSFL-QTTYPALQN  137

Query  546   MQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDSP  725
             +Q AL+ AG+    K TVP NADVY S   KP  S G FR +I   +  I+K L +N +P
Sbjct  138   IQAALDAAGLSNQVKTTVPLNADVYRSVTGKP--SDGDFRSNIHDLMLSIVKFLSDNGAP  195

Query  726   FMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGHG  905
             F  N+YPF+SLY  + +FP D+AFFDG   P+ D   TYTNVFDAN+DT VAAL R G G
Sbjct  196   FTANIYPFISLY-EDPNFPVDYAFFDGYSSPIVDGSFTYTNVFDANHDTLVAALQRNGFG  254

Query  906   KMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDED  1085
              +++ VGEIGWPTDGN  AN  LA +F  GF+ H++S  GTP RPG  ++ Y+F L DED
Sbjct  255   NVSIIVGEIGWPTDGNMNANQQLAQRFNQGFMNHVSSGNGTPLRPG-PIDAYLFSLVDED  313

Query  1086  QKSVLPGDFERHWGILGYDGQPKFKLDLSG----------GKGKALTGVPEIEYLPKKWC  1235
             +KS+ PG+FERHWG+  YDG PK++LDL                +L G   I+YL +KWC
Sbjct  314   EKSIQPGNFERHWGVFAYDGSPKYELDLRSTTEAAAAAAVANSSSLVGAKNIKYLERKWC  373

Query  1236  TVKSNAKFTN--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAG  1409
              +K +    +  +  ++SYAC+ ADC++    ++C  L     +SY FN+Y+Q ++Q+  
Sbjct  374   VLKPSVSLDDAEIAPSVSYACENADCSSLGYKTACSDLDAQGNISYAFNSYYQKNDQDNR  433

Query  1410  SCDFGGLGEVTTTNLSTSTCNFNIGI  1487
             +C F GL  VT  + STSTC F+I I
Sbjct  434   ACGFSGLATVTEKDPSTSTCKFDIMI  459



>ref|XP_002968123.1| hypothetical protein SELMODRAFT_231117 [Selaginella moellendorffii]
 gb|EFJ30377.1| hypothetical protein SELMODRAFT_231117 [Selaginella moellendorffii]
Length=469

 Score =   420 bits (1079),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 205/447 (46%), Positives = 289/447 (65%), Gaps = 13/447 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             + G+D +GVNWG ++SH LP K +VK+L+ + I KVKLF++   ++ A AGT +E+M+  
Sbjct  1     MTGVDSVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAV  60

Query  354   PNALLKEMV-NYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFK-VT  527
             PN LL++M  +   A  FV+ N+T++  +  DGV I  + +GNEPFLK Y   G ++ VT
Sbjct  61    PNDLLEDMAFSEKAARRFVRRNITKFL-SHQDGVNIRYIAVGNEPFLKAY--NGSYEDVT  117

Query  528   YPALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVL  707
              PA+ NMQ+A+ +AGI       VP NAD+  S  +   PS G  RPDI++ ++ I++ L
Sbjct  118   IPAIRNMQQAIEQAGIQHKVTLVVPLNADILTSSGNSGKPSQGAIRPDIRRLMRTILEFL  177

Query  708   DENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             D++ +PF+IN+YPFLSL   +  FP DFAFFDG    L D    Y+NVFDA+YD  V+AL
Sbjct  178   DKHKAPFVINMYPFLSLQ-QDSHFPSDFAFFDGTAHVLSDGRNIYSNVFDASYDLLVSAL  236

Query  888   AREGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMF  1067
             AREG   M + VGE+GWPTDG+ +AN   A +F    I+H+ S +GTP RPG  +E+Y+F
Sbjct  237   AREGFPDMEIVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGIPIEIYIF  296

Query  1068  GLFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKGKALT------GVPEIEYLPKK  1229
             GL DED+KSVLPG+FERHWG+  YDG+PK+ LD+SG  G  L+       V  + YLP +
Sbjct  297   GLVDEDRKSVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSR  356

Query  1230  WCTVKSNA-KFTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEA  1406
             WC +       + + ATISYAC  ADC+  + G SC+ +      SY FN+++Q + Q  
Sbjct  357   WCVLNPEVDDLSKLPATISYACSYADCSTLAYGGSCNHIGRTGNASYAFNSFYQMNNQRT  416

Query  1407  GSCDFGGLGEVTTTNLSTSTCNFNIGI  1487
              SC FGGLG +T T+ S+  C F + I
Sbjct  417   ESCHFGGLGMITETDPSSGNCQFRVEI  443



>gb|EMS47593.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=473

 Score =   420 bits (1080),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 218/437 (50%), Positives = 281/437 (64%), Gaps = 26/437 (6%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV++L+ NGIKKVKLF++ +  LNALAGT IEVM+  PN L
Sbjct  25    DALGMNWGTQATHPLSPRIVVQLLRDNGIKKVKLFDADQGTLNALAGTDIEVMVAIPNNL  84

Query  366   LKEMVNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLF-KVTYPALA  542
             L  M + D A  +V+ NV+RY      GV I  V +GNEPFL  Y   G F KVT+PAL 
Sbjct  85    LDIMNDKDNARDWVRHNVSRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  140

Query  543   NMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLDENDS  722
             N+Q ALN+AG  +  KATVP NADVY SP                    Q+++ L  N +
Sbjct  141   NIQNALNDAGFSEI-KATVPLNADVYNSPAHN-----------------QMVQFLANNSA  182

Query  723   PFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALAREGH  902
             PF +N+YP+LSLY +   FP DFAFFDG+ KPL D   TYTNVFDAN+DT V+ALA  GH
Sbjct  183   PFTVNIYPYLSLYLSE-DFPVDFAFFDGLAKPLVDGVNTYTNVFDANFDTLVSALAAVGH  241

Query  903   GKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFGLFDE  1082
             G + + +GE+GWPTDG++ A  +LA +FY G +  LA+  GTP RP   +EVY+FGL DE
Sbjct  242   GDLPIVIGEVGWPTDGDKHATNALAKRFYDGLLPRLAANTGTPLRPKQYMEVYLFGLLDE  301

Query  1083  DQKSVLPGDFERHWGILGYDGQPKFKLDLSG-GKGKALTGVPEIEYLPKKWCTVKSNAK-  1256
             D KSV PG FERHWG+L +DGQPKF +DL+G G+   L     ++YLP+ WC    NA+ 
Sbjct  302   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGNGQNTMLVPAKGVQYLPRTWCVYNPNAED  361

Query  1257  FTNMKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDFGGLGE  1436
              + +   ++YAC  ADCTA   GS+C+ +      SY FN YFQ   Q+  +CDF  L  
Sbjct  362   KSKLVENVNYACTFADCTALGLGSTCYGMDANGNASYAFNMYFQVQNQKDEACDFQALAV  421

Query  1437  VTTTNLSTSTCNFNIGI  1487
              T T+ ST+ CNF I I
Sbjct  422   PTQTDPSTAACNFPIQI  438



>ref|XP_011078347.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=494

 Score =   421 bits (1082),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 212/442 (48%), Positives = 285/442 (64%), Gaps = 9/442 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKSVVKMLKANGIKKVKLFNSPEHILNALAGTGIEVMIGT  353
             +     +GVNWG ++SH LP ++VV MLK NG  KVKLF + E IL AL GT IEVM+  
Sbjct  26    IMATSSVGVNWGTMASHQLPARNVVDMLKDNGFDKVKLFEADEGILEALCGTDIEVMLAV  85

Query  354   PNALLKEM-VNYDVAEAFVKENVTRYKPTSPDGVKITLVGIGNEPFLKFYEKQGLFKVTY  530
             PN +L+EM ++   A ++V+ N+T Y    P GV I  V +GNEPFLK Y    L + T 
Sbjct  86    PNYMLEEMSLDPGAAASWVEANLTAY--AYPGGVNIRYVAVGNEPFLKTYNGTYL-QHTL  142

Query  531   PALANMQKALNEAGIGKTTKATVPFNADVYLSPPDKPVPSAGMFRPDIQKQVKQIIKVLD  710
             PAL N+Q+A+N AG+G   KA VPFNAD+Y SP    VPSAG FRP+I+    QI++ L 
Sbjct  143   PALRNIQEAINRAGLGSEIKAIVPFNADIYYSPESNQVPSAGDFRPEIRDLTVQIVQYLY  202

Query  711   ENDSPFMINVYPFLSLYFANGSFPFDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALA  890
              N +PF++N+YPFLSLY  N  FP DFAFFDG ++P  D    YTNVFDAN+DT V AL 
Sbjct  203   SNAAPFVVNIYPFLSLY-QNTYFPLDFAFFDGSNRPFRDGNYVYTNVFDANFDTLVWALT  261

Query  891   REGHGKMTVTVGEIGWPTDGNEFANASLAAKFYGGFIKHLASKKGTPARPGSALEVYMFG  1070
             + G+  + + VGE+GWPTDG++ AN   A +F  G ++H  S +GTPAR G  ++VY+F 
Sbjct  262   KAGYPDIKIIVGEVGWPTDGDKHANIENAKRFNQGLVRHALSGEGTPARKGE-IDVYLFS  320

Query  1071  LFDEDQKSVLPGDFERHWGILGYDGQPKFKLDLSGGKG-KALTGVPEIEYLPKKWCTVKS  1247
             L DE+ KS+ PG FERHWGI  +DG+PK++LDLSG +  K L  V  + Y+ ++WC +  
Sbjct  321   LVDENAKSIDPGSFERHWGIFEFDGKPKYELDLSGVQANKGLVAVQGVRYMVRRWCILNP  380

Query  1248  NAKFTN--MKATISYACDRADCTATSNGSSCHSLTEPEKLSYYFNAYFQTHEQEAGSCDF  1421
             + K T+  ++  I YAC  +DCT+   GSSC+ L+     SY FN Y+Q   Q    CDF
Sbjct  381   HVKDTDQELRGNIDYACSLSDCTSLGYGSSCNHLSVRGNASYAFNMYYQFRNQNEWDCDF  440

Query  1422  GGLGEVTTTNLSTSTCNFNIGI  1487
              GL  +T  + S   C+F + I
Sbjct  441   SGLAMITEKDPSDDRCHFPVMI  462



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5498035240778