BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24707_g1_i1 len=1785 path=[1:0-219 3793:220-239 241:240-292
3602:293-322 324:323-363 365:364-430 432:431-468 470:469-472
474:473-567 569:568-585 587:586-631 633:632-636 638:637-663
665:664-719 721:720-758 760:759-784 786:785-870 872:871-1605
1607:1606-1784]

Length=1785
                                                                      Score     E

ref|XP_009773016.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    520   1e-175   
ref|XP_009597565.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    514   1e-173   
ref|XP_004234774.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    505   5e-170   
ref|XP_006349582.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    503   3e-169   
emb|CDP18693.1|  unnamed protein product                                490   4e-164   
ref|XP_002277003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      479   3e-160   Vitis vinifera
ref|XP_009610199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    479   5e-160   
ref|XP_009605785.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    479   5e-160   
ref|XP_011078775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      476   8e-159   
ref|XP_004981482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    476   9e-159   
ref|XP_009786014.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    475   2e-158   
ref|XP_009793269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    473   1e-157   
gb|AAO37977.1|  putative beta-1,3 glucanase                             473   2e-157   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010314012.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    472   3e-157   
gb|AFU52646.1|  beta-1,3-glucanase 11                                   471   3e-157   
ref|XP_004955566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    472   3e-157   
ref|XP_003624610.1|  Glucan endo-1,3-beta-glucosidase                   471   5e-157   
ref|XP_006348032.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    471   5e-157   
ref|XP_006409040.1|  hypothetical protein EUTSA_v10022665mg             471   9e-157   
ref|XP_007161926.1|  hypothetical protein PHAVU_001G109400g             470   1e-156   
ref|XP_003548760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    470   1e-156   
ref|XP_008806060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    469   1e-156   
ref|NP_179534.1|  O-Glycosyl hydrolases family 17 protein               469   2e-156   Arabidopsis thaliana [mouse-ear cress]
emb|CDP18694.1|  unnamed protein product                                469   2e-156   
ref|XP_010054473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      468   6e-156   
ref|XP_008812061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      468   1e-155   
gb|EPS74227.1|  beta-1,3-glucanase, acidic                              466   1e-155   
ref|XP_010909077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    468   1e-155   
ref|XP_002459388.1|  hypothetical protein SORBIDRAFT_02g003910          468   1e-155   Sorghum bicolor [broomcorn]
ref|XP_009412333.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   1e-155   
ref|XP_009418954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    467   3e-155   
ref|XP_006362259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   3e-155   
ref|XP_010036190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   4e-155   
ref|XP_004493147.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   5e-155   
gb|KHN00669.1|  Glucan endo-1,3-beta-glucosidase 8                      466   6e-155   
ref|XP_002463758.1|  hypothetical protein SORBIDRAFT_01g005610          466   6e-155   Sorghum bicolor [broomcorn]
gb|AAQ90287.1|  beta-1,3-glucanase, acidic                              466   8e-155   Coffea arabica [arabica coffee]
ref|XP_006574750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    466   9e-155   
gb|KHN32753.1|  Glucan endo-1,3-beta-glucosidase 8                      465   1e-154   
ref|XP_006650710.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    465   2e-154   
gb|KDP39719.1|  hypothetical protein JCGZ_02739                         464   2e-154   
gb|KDO55074.1|  hypothetical protein CISIN_1g048257mg                   465   3e-154   
gb|ACG29689.1|  glucan endo-1,3-beta-glucosidase 5 precursor            464   3e-154   Zea mays [maize]
ref|XP_006297581.1|  hypothetical protein CARUB_v10013602mg             464   4e-154   
ref|NP_001130924.1|  putative O-Glycosyl hydrolase superfamily pr...    464   6e-154   Zea mays [maize]
emb|CDY03359.1|  BnaC09g09890D                                          463   6e-154   
ref|XP_009112609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      462   9e-154   
ref|XP_007030700.1|  O-Glycosyl hydrolases family 17 protein            462   2e-153   
ref|XP_006443394.1|  hypothetical protein CICLE_v10023781mg             463   2e-153   
ref|XP_010276412.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   3e-153   
ref|NP_176656.1|  O-glycosyl hydrolases family 17 protein               461   3e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    462   3e-153   
ref|XP_004249143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   3e-153   
ref|XP_004288532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    461   3e-153   
gb|AAS99718.1|  At1g64760                                               461   4e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151834.1|  hypothetical protein PHAVU_004G079100g             461   7e-153   
ref|XP_010257709.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   7e-153   
ref|XP_002525445.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    460   1e-152   Ricinus communis
emb|CDY48710.1|  BnaA09g09850D                                          460   1e-152   
ref|XP_006599436.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    460   1e-152   
ref|XP_002888279.1|  glycosyl hydrolase family 17 protein               459   2e-152   
ref|XP_011034355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   2e-152   
ref|XP_009353157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   4e-152   
ref|XP_003559620.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    459   6e-152   
ref|XP_011010121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      458   6e-152   
ref|XP_010470322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    458   8e-152   
ref|XP_010496623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   1e-151   
ref|XP_008465328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    457   1e-151   
ref|XP_004141142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    455   9e-151   
ref|XP_003619009.1|  Glucan endo-1,3-beta-glucosidase                   454   9e-151   
ref|XP_008391677.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      455   1e-150   
ref|XP_010672074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    454   2e-150   
ref|XP_009388996.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    453   6e-150   
ref|XP_006400369.1|  hypothetical protein EUTSA_v10015448mg             453   8e-150   
gb|AIR93903.1|  glucanase                                               452   8e-150   
dbj|BAJ94415.1|  predicted protein                                      452   1e-149   
ref|XP_006289696.1|  hypothetical protein CARUB_v10003257mg             452   2e-149   
ref|XP_002319699.1|  glycosyl hydrolase family 17 family protein        451   3e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010553811.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    451   3e-149   
ref|NP_001050810.1|  Os03g0656800                                       451   7e-149   Oryza sativa Japonica Group [Japonica rice]
gb|KFK26060.1|  hypothetical protein AALP_AA8G198000                    450   1e-148   
ref|XP_010495273.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   1e-148   
ref|XP_010549610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    450   1e-148   
ref|NP_197323.1|  O-Glycosyl hydrolases family 17 protein               450   1e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006837787.1|  hypothetical protein AMTR_s00104p00085600          449   2e-148   
ref|XP_006826313.1|  hypothetical protein AMTR_s00004p00082670          449   2e-148   
ref|XP_010454046.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   2e-148   
emb|CDY42897.1|  BnaC05g47540D                                          449   3e-148   
ref|XP_002466725.1|  hypothetical protein SORBIDRAFT_01g012900          449   3e-148   Sorghum bicolor [broomcorn]
ref|XP_010928419.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    449   3e-148   
emb|CDM83452.1|  unnamed protein product                                448   5e-148   
ref|XP_010420566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    448   6e-148   
ref|XP_009393970.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   7e-148   
dbj|BAD31779.1|  putative 3-glucanase                                   447   1e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121000.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      448   1e-147   
ref|XP_002884423.1|  glycosyl hydrolase family 17 protein               447   1e-147   
gb|KDO55075.1|  hypothetical protein CISIN_1g011532mg                   447   1e-147   
ref|XP_006443393.1|  hypothetical protein CICLE_v10019922mg             447   1e-147   
ref|XP_010242326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   2e-147   
emb|CDM86682.1|  unnamed protein product                                447   2e-147   
ref|XP_008240488.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   2e-147   
ref|XP_009130411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      447   3e-147   
ref|XP_010528707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    447   3e-147   
gb|AAD38251.1|AC006193_7  Similar to glucan endo-1,3-beta-glucosi...    445   4e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873877.1|  predicted protein                                  446   5e-147   
ref|XP_010485770.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    446   6e-147   
gb|AAT42176.1|  putative 3-glucanase                                    445   1e-146   Zea mays [maize]
ref|XP_006408232.1|  hypothetical protein EUTSA_v10020592mg             445   1e-146   
ref|XP_010415342.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    444   2e-146   
ref|NP_001058984.2|  Os07g0168600                                       446   2e-146   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057968.1|  Os06g0590600                                       444   3e-146   Oryza sativa Japonica Group [Japonica rice]
gb|KHN46790.1|  Glucan endo-1,3-beta-glucosidase 8                      441   4e-146   
ref|XP_010467891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   5e-146   
ref|XP_004982257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   5e-146   
ref|NP_187051.3|  O-glycosyl hydrolases family 17 protein               443   5e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    443   5e-146   
ref|XP_006657484.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   8e-146   
dbj|BAJ85378.1|  predicted protein                                      442   9e-146   
ref|XP_004979540.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   1e-145   
gb|KFK37837.1|  hypothetical protein AALP_AA3G035600                    445   1e-145   
gb|EAZ37505.1|  hypothetical protein OsJ_21839                          442   1e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010517383.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   2e-145   
ref|XP_010528719.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   2e-145   
ref|NP_001147672.1|  glucan endo-1,3-beta-glucosidase 5                 442   3e-145   Zea mays [maize]
ref|XP_003561381.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    442   3e-145   
gb|KDP35276.1|  hypothetical protein JCGZ_09435                         441   3e-145   
ref|XP_008778100.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    440   4e-145   
ref|XP_006297514.1|  hypothetical protein CARUB_v10013538mg             441   6e-145   
ref|XP_010086599.1|  Glucan endo-1,3-beta-glucosidase 8                 440   6e-145   
ref|XP_002325410.1|  hypothetical protein POPTR_0019s04850g             441   8e-145   Populus trichocarpa [western balsam poplar]
ref|XP_010672072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      439   2e-144   
ref|XP_004982258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   3e-144   
ref|XP_003557824.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    439   3e-144   
ref|NP_001068140.2|  Os11g0577800                                       437   1e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449743.1|  hypothetical protein SORBIDRAFT_05g022490          437   1e-143   Sorghum bicolor [broomcorn]
gb|EAZ18823.1|  hypothetical protein OsJ_34360                          437   2e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656196.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   2e-143   
ref|XP_008457953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    436   2e-143   
ref|XP_009393986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      433   5e-143   
dbj|BAK05853.1|  predicted protein                                      436   5e-143   
gb|AES75227.2|  O-glycosyl hydrolase family 17 protein                  434   5e-143   
ref|XP_009366428.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      435   6e-143   
gb|ACG41694.1|  glucan endo-1,3-beta-glucosidase 5 precursor            435   8e-143   Zea mays [maize]
dbj|BAJ90806.1|  predicted protein                                      435   8e-143   
dbj|BAJ98060.1|  predicted protein                                      435   9e-143   
ref|XP_007204344.1|  hypothetical protein PRUPE_ppa005641mg             433   9e-143   
ref|XP_008386810.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    435   1e-142   
ref|XP_009402192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    433   1e-142   
gb|EAY81406.1|  hypothetical protein OsI_36575                          433   4e-142   Oryza sativa Indica Group [Indian rice]
ref|NP_001140660.1|  putative O-Glycosyl hydrolase superfamily pr...    432   6e-142   Zea mays [maize]
ref|XP_008361509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    432   1e-141   
ref|XP_008338651.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   2e-141   
ref|XP_009336373.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   2e-141   
ref|XP_008232375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    431   3e-141   
ref|XP_007207576.1|  hypothetical protein PRUPE_ppa018453mg             429   4e-141   
ref|XP_008793474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   5e-141   
ref|XP_003560627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    430   8e-141   
ref|XP_010257791.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      429   1e-140   
ref|XP_008440124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      429   1e-140   
ref|XP_010261306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    429   2e-140   
ref|XP_006352469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   7e-140   
dbj|BAK06743.1|  predicted protein                                      427   1e-139   
ref|XP_004250551.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      427   1e-139   
ref|XP_010915073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   1e-139   
ref|XP_003575938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    427   2e-139   
ref|XP_004149714.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   2e-139   
ref|XP_004170594.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    426   4e-139   
ref|XP_002530257.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    424   8e-139   Ricinus communis
gb|KHG25475.1|  hypothetical protein F383_09937                         422   9e-139   
ref|XP_004142041.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    424   9e-139   
ref|XP_004966001.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    424   1e-138   
ref|XP_009336372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    424   2e-138   
ref|XP_008392630.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    423   3e-138   
ref|NP_001183732.1|  uncharacterized protein LOC100502325 precursor     423   4e-138   
ref|NP_001152213.1|  glucan endo-1,3-beta-glucosidase 5 precursor       422   6e-138   Zea mays [maize]
ref|XP_004164948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    422   7e-138   
ref|XP_006299509.1|  hypothetical protein CARUB_v10015679mg             422   8e-138   
ref|XP_009102513.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      421   2e-137   
ref|XP_010513396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    421   3e-137   
emb|CDY66442.1|  BnaCnng50870D                                          421   3e-137   
ref|XP_010088872.1|  Glucan endo-1,3-beta-glucosidase 8                 421   4e-137   
ref|XP_002440138.1|  hypothetical protein SORBIDRAFT_09g026690          420   5e-137   Sorghum bicolor [broomcorn]
ref|XP_008338633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    420   6e-137   
ref|XP_004961391.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    418   7e-137   
ref|XP_009769717.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      419   8e-137   
ref|XP_006418767.1|  hypothetical protein EUTSA_v10002822mg             421   1e-136   
emb|CDX77431.1|  BnaA07g05690D                                          419   2e-136   
ref|XP_010086919.1|  Glucan endo-1,3-beta-glucosidase 8                 419   2e-136   
ref|XP_010049931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      419   2e-136   
ref|XP_002991155.1|  hypothetical protein SELMODRAFT_132967             418   4e-136   
ref|XP_008232612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    416   7e-136   
gb|KHN10411.1|  Glucan endo-1,3-beta-glucosidase 8                      416   7e-136   
ref|NP_189076.1|  O-Glycosyl hydrolases family 17 protein               417   8e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    417   8e-136   
ref|XP_010669543.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      417   1e-135   
gb|KCW82758.1|  hypothetical protein EUGRSUZ_C04137                     419   1e-135   
gb|EPS65796.1|  hypothetical protein M569_08979                         416   2e-135   
ref|XP_007208233.1|  hypothetical protein PRUPE_ppa017706mg             415   3e-135   
ref|XP_002275701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      415   3e-135   Vitis vinifera
emb|CDP03371.1|  unnamed protein product                                415   4e-135   
ref|XP_002970933.1|  hypothetical protein SELMODRAFT_267465             414   5e-135   
ref|XP_008787369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      414   5e-135   
emb|CAN62816.1|  hypothetical protein VITISV_031885                     415   5e-135   Vitis vinifera
ref|XP_003565994.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   6e-135   
gb|KFK39737.1|  hypothetical protein AALP_AA3G281400                    414   6e-135   
ref|XP_007204529.1|  hypothetical protein PRUPE_ppa017632mg             414   8e-135   
ref|XP_002438620.1|  hypothetical protein SORBIDRAFT_10g022940          414   1e-134   Sorghum bicolor [broomcorn]
ref|XP_009626950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    415   1e-134   
ref|XP_010688142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      414   2e-134   
ref|XP_004498612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    413   2e-134   
ref|XP_010488537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    414   2e-134   
gb|EMS57429.1|  Glucan endo-1,3-beta-glucosidase 8                      412   3e-134   
ref|NP_001056153.1|  Os05g0535100                                       413   3e-134   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60021.1|  Glucan endo-1,3-beta-glucosidase 8                      417   4e-134   
ref|XP_010027756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      412   4e-134   
ref|XP_002968123.1|  hypothetical protein SELMODRAFT_231117             411   7e-134   
ref|XP_011078347.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      412   8e-134   
gb|KCW54346.1|  hypothetical protein EUGRSUZ_I00311                     410   1e-133   
gb|ACN32122.1|  unknown                                                 412   1e-133   Zea mays [maize]
emb|CCH47219.1|  similar to glucan endo-1,3-beta-glucosidase            411   1e-133   
ref|XP_006655526.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    411   2e-133   
ref|XP_006355982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    410   3e-133   
ref|XP_010914019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      409   3e-133   
ref|XP_008242583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      410   4e-133   
ref|XP_010681060.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    410   4e-133   
gb|KDO80436.1|  hypothetical protein CISIN_1g047337mg                   410   4e-133   
ref|XP_011082117.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      409   7e-133   
ref|XP_002970359.1|  hypothetical protein SELMODRAFT_231628             409   7e-133   
ref|XP_006476105.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    409   8e-133   
ref|XP_007048158.1|  O-Glycosyl hydrolases family 17 protein, put...    409   9e-133   
gb|EEE64491.1|  hypothetical protein OsJ_19341                          409   1e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009781628.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    409   1e-132   
ref|XP_004237474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    408   1e-132   
ref|XP_010913808.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    408   2e-132   
gb|EMT04543.1|  Glucan endo-1,3-beta-glucosidase 8                      407   2e-132   
gb|KEH41651.1|  O-glycosyl hydrolase family 17 protein                  408   2e-132   
gb|EMS47593.1|  Glucan endo-1,3-beta-glucosidase 8                      407   4e-132   
ref|XP_004504006.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    407   4e-132   
gb|KFK28168.1|  hypothetical protein AALP_AA8G481200                    407   5e-132   
dbj|BAK03700.1|  predicted protein                                      407   5e-132   
ref|XP_010520102.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      407   7e-132   
ref|XP_010669627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      406   1e-131   
ref|XP_008458070.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      407   1e-131   
gb|EYU37424.1|  hypothetical protein MIMGU_mgv1a005873mg                405   1e-131   
ref|XP_009127212.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      406   1e-131   
gb|KEH39797.1|  glucan endo-1,3-beta-glucosidase-like protein           405   1e-131   
gb|KEH32093.1|  glucan endo-1,3-beta-glucosidase-like protein           407   2e-131   
ref|XP_006596135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    405   2e-131   
ref|XP_009336879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    405   2e-131   
emb|CDY28246.1|  BnaA01g06030D                                          405   3e-131   
gb|KGN60639.1|  hypothetical protein Csa_2G005360                       405   3e-131   
ref|XP_004513603.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    405   4e-131   
ref|XP_004951931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    405   4e-131   
ref|XP_004163604.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    404   5e-131   
ref|XP_011017570.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      404   6e-131   
ref|XP_011009207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      404   6e-131   
ref|XP_006372260.1|  hypothetical protein POPTR_0018s14730g             404   6e-131   
ref|XP_004508564.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   6e-131   
gb|KDO67128.1|  hypothetical protein CISIN_1g010789mg                   405   7e-131   
ref|XP_009595344.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    404   9e-131   
ref|XP_002324967.2|  hypothetical protein POPTR_0018s06250g             404   9e-131   Populus trichocarpa [western balsam poplar]
dbj|BAK03448.1|  predicted protein                                      404   1e-130   
gb|EPS71987.1|  hypothetical protein M569_02770                         403   1e-130   
ref|NP_194843.1|  glucan endo-1,3-beta-glucosidase 5                    404   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201284.1|  O-Glycosyl hydrolases family 17 protein               403   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883518.1|  glycosyl hydrolase family 17 protein               402   2e-130   
emb|CDP14258.1|  unnamed protein product                                402   2e-130   
ref|XP_002281500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      403   2e-130   Vitis vinifera
ref|XP_006580871.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    402   3e-130   
gb|KFK29702.1|  hypothetical protein AALP_AA7G168000                    402   3e-130   
ref|XP_006394112.1|  hypothetical protein EUTSA_v10004092mg             402   4e-130   
ref|XP_009392760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    402   6e-130   
gb|KHN38236.1|  Glucan endo-1,3-beta-glucosidase 8                      401   8e-130   
ref|XP_006450066.1|  hypothetical protein CICLE_v10008079mg             402   8e-130   
ref|XP_009418582.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    402   8e-130   
ref|XP_009352686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    401   8e-130   
ref|XP_009112157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    401   9e-130   
ref|XP_011097609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    403   1e-129   
gb|EYU24023.1|  hypothetical protein MIMGU_mgv1a004416mg                402   1e-129   
emb|CDX68724.1|  BnaC01g07290D                                          401   1e-129   
ref|XP_009792045.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    400   1e-129   
ref|XP_010048510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      400   2e-129   
ref|XP_002310612.1|  glycosyl hydrolase family 17 family protein        400   2e-129   
ref|XP_009797292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    400   3e-129   
ref|XP_004972550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    400   3e-129   
ref|XP_002864921.1|  glycosyl hydrolase family 17 protein               400   4e-129   
ref|XP_010099734.1|  Glucan endo-1,3-beta-glucosidase 6                 399   4e-129   
gb|KDO50472.1|  hypothetical protein CISIN_1g045344mg                   404   5e-129   
ref|XP_002869343.1|  glycosyl hydrolase family 17 protein               399   5e-129   
ref|XP_006601109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    399   6e-129   
ref|XP_004154666.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    399   7e-129   
ref|XP_004139090.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    399   7e-129   
ref|XP_010536989.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      399   7e-129   
ref|XP_006283637.1|  hypothetical protein CARUB_v10004695mg             399   7e-129   
ref|XP_008776624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    399   7e-129   
gb|EYU23029.1|  hypothetical protein MIMGU_mgv1a006384mg                397   8e-129   
ref|XP_008362938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    399   8e-129   
ref|XP_010444426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    399   1e-128   
ref|XP_008443646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      398   2e-128   
ref|XP_002515573.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    398   2e-128   
gb|EYU24024.1|  hypothetical protein MIMGU_mgv1a004416mg                399   2e-128   
ref|XP_006281667.1|  hypothetical protein CARUB_v10027803mg             398   2e-128   
ref|XP_009623324.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   2e-128   
ref|XP_004239309.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      397   3e-128   
ref|XP_006483661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    398   3e-128   
ref|XP_006451059.1|  hypothetical protein CICLE_v10007363mg             412   3e-128   
ref|XP_006338109.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    397   5e-128   
ref|XP_007159772.1|  hypothetical protein PHAVU_002G266100g             398   5e-128   
gb|KDP32321.1|  hypothetical protein JCGZ_13246                         397   6e-128   
ref|XP_007155137.1|  hypothetical protein PHAVU_003G176600g             412   7e-128   
ref|XP_010462737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   7e-128   
ref|XP_007161283.1|  hypothetical protein PHAVU_001G057100g             396   8e-128   
ref|XP_011025580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   9e-128   
ref|XP_006355222.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   1e-127   
ref|XP_004239361.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    396   1e-127   
emb|CDY46823.1|  BnaC02g43310D                                          396   1e-127   
ref|XP_006412625.1|  hypothetical protein EUTSA_v10025047mg             395   2e-127   
ref|XP_001773368.1|  predicted protein                                  396   2e-127   
gb|AFU52650.1|  beta-1,3-glucanase 16                                   395   2e-127   
ref|XP_009792149.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    395   2e-127   
ref|XP_008380615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      395   2e-127   
ref|XP_009376335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      395   3e-127   
ref|XP_003523713.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    395   4e-127   
gb|EMT08496.1|  Glucan endo-1,3-beta-glucosidase 5                      395   5e-127   
ref|XP_009601131.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    394   5e-127   
gb|KHN10282.1|  Glucan endo-1,3-beta-glucosidase 5                      394   5e-127   
ref|XP_008781699.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    394   5e-127   
ref|XP_006474357.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    394   7e-127   
ref|XP_010447615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    394   7e-127   
gb|ABK25447.1|  unknown                                                 393   8e-127   
ref|XP_010415358.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    391   8e-127   
ref|XP_009130473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    394   9e-127   
ref|XP_009407893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      394   1e-126   
ref|XP_010438078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      393   2e-126   
ref|XP_010526287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    393   2e-126   
gb|KDO73371.1|  hypothetical protein CISIN_1g011636mg                   392   2e-126   
gb|AFK43211.1|  unknown                                                 392   2e-126   
ref|XP_010432901.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   2e-126   
gb|KHN16471.1|  Glucan endo-1,3-beta-glucosidase 5                      392   2e-126   
ref|XP_010484272.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   3e-126   
ref|XP_004288682.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   3e-126   
gb|EYU20663.1|  hypothetical protein MIMGU_mgv1a018565mg                389   3e-126   
ref|XP_010939839.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   4e-126   
ref|XP_006578454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    392   4e-126   
gb|KHN05785.1|  Glucan endo-1,3-beta-glucosidase 8                      392   5e-126   
ref|XP_006280397.1|  hypothetical protein CARUB_v10026324mg             391   5e-126   
emb|CDP12875.1|  unnamed protein product                                391   6e-126   
gb|AFU52639.1|  beta-1,3-glucanase 4                                    392   6e-126   
ref|XP_003528028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    391   7e-126   
ref|XP_010048500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      391   8e-126   
ref|XP_009776006.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    391   1e-125   
ref|XP_009126789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   1e-125   
ref|XP_008466353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      390   2e-125   
ref|XP_003526446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   2e-125   
gb|KHG03269.1|  hypothetical protein F383_27500                         390   2e-125   
gb|EEC79587.1|  hypothetical protein OsI_20766                          389   2e-125   
ref|XP_010525845.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    390   3e-125   
ref|XP_004289256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   3e-125   
ref|XP_002866250.1|  glycosyl hydrolase family 17 protein               389   4e-125   
ref|XP_006648298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    388   5e-125   
ref|NP_001151032.1|  glucan endo-1,3-beta-glucosidase 6 precursor       389   5e-125   
ref|XP_009137993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   6e-125   
ref|XP_010483379.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      389   7e-125   
ref|XP_010273788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   9e-125   
ref|XP_008800518.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    389   1e-124   
gb|KFK27342.1|  hypothetical protein AALP_AA8G370600                    388   1e-124   
ref|XP_002985205.1|  hypothetical protein SELMODRAFT_121927             388   2e-124   
emb|CDY13412.1|  BnaA03g51300D                                          387   2e-124   
ref|XP_008391995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    388   2e-124   
emb|CDY54044.1|  BnaC09g54160D                                          385   2e-124   
gb|EYU31104.1|  hypothetical protein MIMGU_mgv1a006003mg                387   2e-124   
ref|XP_002969872.1|  hypothetical protein SELMODRAFT_171231             387   3e-124   
emb|CDX72294.1|  BnaC07g43160D                                          387   3e-124   
ref|XP_004246072.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      387   3e-124   
ref|XP_004242904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    387   3e-124   
ref|XP_004502874.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    387   4e-124   
ref|NP_200617.2|  glucan endo-1,3-beta-glucosidase 6                    386   4e-124   
ref|XP_002968207.1|  hypothetical protein SELMODRAFT_89756              389   5e-124   
ref|XP_007222660.1|  hypothetical protein PRUPE_ppa004964mg             386   5e-124   
ref|XP_007013263.1|  O-Glycosyl hydrolases family 17 protein            387   6e-124   
ref|XP_006401129.1|  hypothetical protein EUTSA_v10013422mg             386   6e-124   
gb|EPS64137.1|  hypothetical protein M569_10642                         386   7e-124   
ref|XP_003541322.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    387   7e-124   
ref|XP_010453200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    386   7e-124   
emb|CDY38496.1|  BnaA10g16620D                                          384   7e-124   
ref|XP_002976170.1|  hypothetical protein SELMODRAFT_104523             388   8e-124   
ref|XP_007137587.1|  hypothetical protein PHAVU_009G138800g             386   9e-124   
ref|XP_010095481.1|  Glucan endo-1,3-beta-glucosidase 5                 386   9e-124   
ref|XP_009369739.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    386   1e-123   
ref|XP_002530371.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    385   1e-123   
ref|XP_003550587.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    386   1e-123   
ref|XP_009786880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    386   1e-123   
ref|XP_006851012.1|  hypothetical protein AMTR_s00025p00220320          385   2e-123   
ref|XP_003573567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    385   2e-123   
ref|XP_006850025.1|  hypothetical protein AMTR_s00022p00188990          385   2e-123   
ref|XP_008242139.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      385   2e-123   
gb|AAL24251.1|  AT5g58090/k21l19_70                                     384   3e-123   
ref|XP_009618025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    385   3e-123   
ref|XP_004303439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   3e-123   
ref|XP_009120323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      384   4e-123   
emb|CDY02795.1|  BnaC02g10940D                                          384   4e-123   
emb|CDY62695.1|  BnaA10g29270D                                          384   4e-123   
ref|XP_002445228.1|  hypothetical protein SORBIDRAFT_07g006340          384   4e-123   
ref|NP_001045844.1|  Os02g0139300                                       384   4e-123   
ref|XP_010443524.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   5e-123   
ref|XP_004136331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    384   5e-123   
ref|XP_004289257.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    383   5e-123   
gb|EAY84415.1|  hypothetical protein OsI_05789                          384   5e-123   
emb|CDY43882.1|  BnaC09g33610D                                          384   6e-123   
gb|EMS57703.1|  Glucan endo-1,3-beta-glucosidase 8                      382   6e-123   
gb|EYU25788.1|  hypothetical protein MIMGU_mgv1a027166mg                383   7e-123   
ref|XP_003574453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      384   8e-123   
ref|XP_008224566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      383   1e-122   
ref|XP_002982430.1|  hypothetical protein SELMODRAFT_155115             382   1e-122   
ref|XP_008219823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    383   2e-122   
ref|XP_009395879.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    383   2e-122   
ref|XP_002516181.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    383   2e-122   
ref|XP_010418908.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 8      379   2e-122   
ref|XP_002966594.1|  hypothetical protein SELMODRAFT_86140              382   2e-122   
ref|XP_004296615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   3e-122   
ref|XP_010929423.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   3e-122   
ref|XP_010928748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   3e-122   
ref|XP_011003008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    382   6e-122   
gb|KDP39750.1|  hypothetical protein JCGZ_02770                         380   6e-122   
ref|XP_006344579.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    381   6e-122   
ref|XP_009783390.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    381   6e-122   
ref|XP_008678187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    381   7e-122   
ref|XP_011093909.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    381   7e-122   
ref|XP_009610855.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    380   8e-122   
ref|XP_001757439.1|  predicted protein                                  381   8e-122   
ref|XP_002324127.1|  hypothetical protein POPTR_0018s04200g             381   9e-122   
ref|XP_003528268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    380   1e-121   
ref|XP_004517299.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    376   1e-121   
gb|KHN20653.1|  Glucan endo-1,3-beta-glucosidase 8                      380   1e-121   
ref|XP_003630124.1|  Glucan endo-1,3-beta-glucosidase                   384   1e-121   
ref|XP_007222346.1|  hypothetical protein PRUPE_ppa004814mg             380   1e-121   
ref|XP_006474550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    380   2e-121   
ref|XP_009363574.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    380   2e-121   
ref|NP_001051526.2|  Os03g0792800                                       376   3e-121   
ref|XP_002277217.3|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      379   3e-121   
gb|KDO73724.1|  hypothetical protein CISIN_1g011391mg                   379   5e-121   
ref|XP_006452923.1|  hypothetical protein CICLE_v10008127mg             378   8e-121   
emb|CDY50874.1|  BnaA05g37350D                                          375   8e-121   
ref|XP_001754617.1|  predicted protein                                  378   1e-120   
ref|XP_010687609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    377   2e-120   
ref|XP_006836569.1|  hypothetical protein AMTR_s00131p00072670          377   3e-120   
ref|XP_008373974.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      377   3e-120   
ref|XP_010252157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    377   4e-120   
ref|XP_007201955.1|  hypothetical protein PRUPE_ppa004643mg             377   4e-120   
emb|CDP19937.1|  unnamed protein product                                377   4e-120   
ref|XP_009390478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    376   5e-120   
ref|XP_006382223.1|  hypothetical protein POPTR_0006s29500g             377   5e-120   
ref|XP_007154528.1|  hypothetical protein PHAVU_003G126100g             376   8e-120   
gb|EPS63303.1|  hypothetical protein M569_11481                         374   2e-119   
ref|XP_008347693.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    375   2e-119   
gb|EAZ06041.1|  hypothetical protein OsI_28283                          375   2e-119   
dbj|BAJ95993.1|  predicted protein                                      375   2e-119   
ref|XP_001775842.1|  predicted protein                                  375   3e-119   
ref|NP_193451.2|  O-Glycosyl hydrolases family 17 protein               374   3e-119   
ref|XP_009144687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      374   4e-119   
ref|NP_001061277.1|  Os08g0224500                                       374   4e-119   
emb|CAB10499.1|  glucanase like protein                                 374   6e-119   
gb|KHG29709.1|  hypothetical protein F383_09866                         373   7e-119   
ref|XP_006414264.1|  hypothetical protein EUTSA_v10024947mg             374   7e-119   
gb|KHM99319.1|  Glucan endo-1,3-beta-glucosidase 5                      370   2e-118   
ref|XP_002870120.1|  glycosyl hydrolase family 17 protein               372   2e-118   
ref|XP_007138338.1|  hypothetical protein PHAVU_009G200400g             372   2e-118   
ref|XP_007012497.1|  O-Glycosyl hydrolases family 17 protein            372   2e-118   
ref|XP_010496624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    369   2e-118   
ref|XP_009388760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    372   2e-118   
ref|XP_008384211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      372   3e-118   
ref|XP_006371155.1|  hypothetical protein POPTR_0019s04850g             368   4e-118   
ref|XP_004508054.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    372   4e-118   
ref|XP_010107097.1|  Glucan endo-1,3-beta-glucosidase 5                 372   4e-118   
ref|XP_011019284.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      371   5e-118   
ref|XP_004289017.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    372   5e-118   
ref|XP_009359672.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    372   5e-118   
ref|XP_007147571.1|  hypothetical protein PHAVU_006G135700g             371   6e-118   
gb|KDP33989.1|  hypothetical protein JCGZ_07560                         371   6e-118   
ref|XP_006284895.1|  hypothetical protein CARUB_v10006187mg             370   8e-118   
ref|XP_010434711.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    370   8e-118   
ref|XP_008379681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    371   8e-118   
gb|AES92122.2|  glucan endo-1,3-beta-glucosidase-like protein           370   9e-118   
ref|XP_010440044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    370   9e-118   
gb|KFK32198.1|  hypothetical protein AALP_AA6G210100                    370   1e-117   
ref|XP_009338848.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      370   2e-117   
ref|XP_010655026.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      370   2e-117   
ref|XP_010449654.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    369   2e-117   
ref|XP_009374821.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 6      370   2e-117   
ref|XP_002528007.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    369   3e-117   
emb|CDY35595.1|  BnaC01g21170D                                          369   3e-117   
ref|XP_008782991.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 5      369   4e-117   
ref|XP_002309443.2|  hypothetical protein POPTR_0006s23330g             369   6e-117   
ref|XP_009354031.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    369   6e-117   
gb|ABD65105.1|  glycosyl hydrolase family protein                       367   8e-117   
gb|AAS75228.1|  unknown protein                                         374   8e-117   
gb|AIR93902.1|  glucanase                                               367   1e-116   
ref|XP_010252866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    367   1e-116   
gb|EPS66439.1|  hypothetical protein M569_08338                         365   1e-116   
gb|EAZ06546.1|  hypothetical protein OsI_28792                          368   1e-116   



>ref|XP_009773016.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=505

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 268/439 (61%), Positives = 322/439 (73%), Gaps = 6/439 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN  + +LNALAGTGIEVMIG  N 
Sbjct  19    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETILNALAGTGIEVMIGISNQ  78

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLKDLVN +VA  +VKENVT ++P SP GV ITL+GVGNEPFL+ Y K  L  VT PAL 
Sbjct  79    LLKDLVNPDVATKWVKENVTRFDPKSPKGVNITLIGVGNEPFLRDY-KDTLTNVTGPALE  137

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G T KATVP NADVYLSP + PVPSAG FR DI D +  I++VLDKN A
Sbjct  138   NIQNALNDAGLGDTTKATVPLNADVYLSPSWNPVPSAGFFRADIVDPLNYILKVLDKNKA  197

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALSREK  899
             PFM+N+YPFLSLFY    FP D+AFFDGV  PL D +G  YTN FDAN DT  AAL+   
Sbjct  198   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVTNPLKDKDGIEYTNCFDANLDTCAAALAGAG  257

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +  + ++VGE+GWPTDG+ +AN ++A +FY GF+ +LA  KG+P RPG  ++ Y+F L+D
Sbjct  258   YPNMTIMVGEMGWPTDGNPYANVTLAEKFYKGFVSYLAKGKGSPRRPGY-LEAYVFALFD  316

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED+KSTLPGNFE HWGI   DG  KF LDLSGK  K   +  V  +E LPKKWC +K + 
Sbjct  317   EDRKSTLPGNFETHWGIYYEDGTPKFPLDLSGK-NKTSTLVPVPNVEKLPKKWCVVKPDV  375

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
             K  N  +   YAC RADCTP+++GSSC  LSD +K SY  NAYFQ Q+Q   SCDF+G  
Sbjct  376   K--NFTSLMSYACDRADCTPLTNGSSCQNLSDADKASYALNAYFQNQEQKDGSCDFEGKA  433

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              VTTK+ S  +C F IG K
Sbjct  434   TVTTKDPSQGTCNFTIGFK  452



>ref|XP_009597565.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=503

 Score =   514 bits (1325),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 266/439 (61%), Positives = 319/439 (73%), Gaps = 7/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN  +  LNALAGTGIEVMIG  N 
Sbjct  18    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETTLNALAGTGIEVMIGISNQ  77

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLKDLVN +VA  +VKENVT ++P SP GV ITL+GVGNEPFL+ Y K  L  VT PAL 
Sbjct  78    LLKDLVNPDVATKWVKENVTRFDPKSPKGVNITLIGVGNEPFLRDY-KDTLTNVTGPALE  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G T KATVP NADVYLSP + PVPSAG FR DI D +  I++VLDKN A
Sbjct  137   NIQNALNDAGLGDTTKATVPLNADVYLSPSWNPVPSAGFFRADIVDPLNYILKVLDKNKA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALSREK  899
             PFM+N+YPFLSLFY    FP D+AFFDGV  PL D +G  YTN FDAN DT  AAL+   
Sbjct  197   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVTNPLKDKDGIEYTNCFDANLDTCAAALAGAG  256

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +  + ++VGE+GWPTDG+ +AN ++A +FY GF+ +LA  KG+P RPG  ++ Y+F L+D
Sbjct  257   YPNMTIMVGEMGWPTDGNPYANVTLADKFYKGFVSYLAKGKGSPRRPGY-LEAYLFALFD  315

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED+KSTLPGNFE HWGI   DG  KF LDLSGK      +  V  +E LPKKWC +K + 
Sbjct  316   EDRKSTLPGNFETHWGIYYDDGTPKFPLDLSGKNKTS--LVPVPNVEKLPKKWCVVKPDV  373

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
             K  N      YAC RADCTP+++GSSC  LSD +K SY  NAYFQ Q+Q   SCDF+G  
Sbjct  374   K--NFTGLMSYACDRADCTPLTNGSSCQNLSDADKASYALNAYFQNQEQKDGSCDFEGKA  431

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              VTTK+ S  +C F +G K
Sbjct  432   TVTTKDPSQGACNFTVGFK  450



>ref|XP_004234774.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=502

 Score =   505 bits (1301),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 266/439 (61%), Positives = 318/439 (72%), Gaps = 8/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN  + +LNALAGTGIEVMIG  N 
Sbjct  21    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETILNALAGTGIEVMIGISNQ  80

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLKDLVN +VAK +VKENVT Y P SP GV ITLVGVGNEPFL+ Y K  L  VT PAL 
Sbjct  81    LLKDLVNPDVAKKWVKENVTRYEPKSPKGVNITLVGVGNEPFLRDY-KDTLTNVTGPALE  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G T KATVP NADVYLSP Y PVPS G FR DI D +  I++VL+KN A
Sbjct  140   NIQNALNDAGLGDTTKATVPLNADVYLSPSYNPVPSGGFFRADIVDPLNYILKVLNKNKA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALSREK  899
             PFM+N+YPFLSLFY    FP D+AFFDGV  PL D +G  YTN FDAN DT  AAL+   
Sbjct  200   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVSNPLKDKDGVEYTNCFDANLDTCAAALAGAG  259

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +G + ++VGE+GWPTDG+N+AN ++A +FY GF+ +LA  KG+P RPG +++ Y+F L+D
Sbjct  260   YGNMTIMVGEMGWPTDGNNYANVTLAEKFYKGFVSYLAKGKGSPRRPG-NVEAYIFALFD  318

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED+KSTLPGNFE HWG+   DG  KF LDL    G  K +  V  +E L KKWC +K + 
Sbjct  319   EDRKSTLPGNFETHWGLYYDDGTPKFPLDLH---GNKKNLVPVPNVEKLSKKWCVIKPDV  375

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
             K  N      YAC RADCTP+++GSSC  L+D  K SY  NAYFQ   Q  DSC+F+G  
Sbjct  376   K--NFTDVMTYACDRADCTPLTNGSSCQNLNDAAKASYAVNAYFQNSQQKDDSCNFEGKA  433

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              VTTK+ S  +C F IG K
Sbjct  434   TVTTKDPSQGTCNFTIGFK  452



>ref|XP_006349582.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=506

 Score =   503 bits (1296),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 263/439 (60%), Positives = 317/439 (72%), Gaps = 8/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWGDISSH LPPK VVKML+ NGIKKVKLFN  + +LNALAGTGIEVMIG  N 
Sbjct  21    VEGLGVNWGDISSHKLPPKDVVKMLQENGIKKVKLFNNDETILNALAGTGIEVMIGISNQ  80

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLKDLVN +VAK +VKENVT Y P SP GV ITLVGVGNEPFL+ Y K  L  VT PAL 
Sbjct  81    LLKDLVNPDVAKKWVKENVTRYEPKSPKGVNITLVGVGNEPFLRDY-KDTLTNVTGPALE  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G T KATVP NADVYLSP + PVPS G FR DI D +  I++VL+KN A
Sbjct  140   NIQNALNDAGLGDTTKATVPLNADVYLSPSWNPVPSGGFFRADIIDPLNSILKVLNKNKA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALSREK  899
             PFM+N+YPFLSLFY    FP D+AFFDGV  PL D +G  YTN FDAN DT  AAL+   
Sbjct  200   PFMVNIYPFLSLFYGNGAFPFDYAFFDGVSNPLKDKDGVEYTNCFDANLDTCAAALAGAG  259

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +G + ++VGE+GWPTDG+N+ N ++A +FY GF+ +LA  KG+P RPG +++ Y+F L+D
Sbjct  260   YGNMTIMVGEMGWPTDGNNYGNVTLAEKFYKGFVSYLAKGKGSPRRPG-NVEAYLFALFD  318

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED+KSTLPGNFE HWG+   DG  KF LDL    G  K +  V  +E L KKWC +K + 
Sbjct  319   EDRKSTLPGNFETHWGLYYDDGTPKFPLDLH---GNKKTLVSVPNVEKLSKKWCVIKPDV  375

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
             K  N      YAC RADCTP+++GSSC  L+D  K SY  NAYFQ   Q  D+C+F+G  
Sbjct  376   K--NFTDLMTYACDRADCTPLTNGSSCQNLNDAAKASYAVNAYFQNNQQKDDTCNFEGKA  433

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              VTTK+ S  +C F IG K
Sbjct  434   TVTTKDPSQGTCNFTIGFK  452



>emb|CDP18693.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   490 bits (1262),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 250/441 (57%), Positives = 319/441 (72%), Gaps = 7/441 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             A ++GLGVNWG +SSH L P+ V+++LK NGI+KVKLF+    +L ALAG+G+EVMI   
Sbjct  21    ACVEGLGVNWGTVSSHKLAPETVIQLLKDNGIQKVKLFDADPTILMALAGSGLEVMIAAT  80

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  L DL +   AK +V +NV  YN  S DGV IT+V VGNEPFL+ Y  +    VT PA
Sbjct  81    NLELADLGDPTKAKDWVHKNVIPYNVNSKDGVNITIVAVGNEPFLQAYGDK-FTGVTAPA  139

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q ALNEAG+GKT KA++PFN DVY+SP Y PVPSAG+FR DIAD+++ I+++L  N
Sbjct  140   LKNIQDALNEAGVGKTTKASIPFNGDVYMSPLYNPVPSAGIFRPDIADKIRDILKILSAN  199

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF++N+YPFLSL+++KD FP+++AFFDG   PL D    YTNV DAN DT V+AL  E
Sbjct  200   NAPFIVNIYPFLSLYFAKD-FPLEYAFFDGA-TPLVDGKIQYTNVLDANMDTLVSALKVE  257

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              +  + ++VGEIGWPTDGD  AN ++A RF  G IKHLA  KG+P+RPG  ++ Y+FGL+
Sbjct  258   GYSDMPIIVGEIGWPTDGDTNANVTLAQRFLQGLIKHLASNKGSPLRPGY-LETYLFGLF  316

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED+KSTLPGNFE  WGI  YDGQ KF LDLSGK G+ K +   + ++YLPKKWC LK +
Sbjct  317   DEDKKSTLPGNFERSWGIFKYDGQPKFPLDLSGK-GENKTLVAAKDVQYLPKKWCVLKGD  375

Query  1257  AKL-TNLKANTDYACGR-ADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A    NL  N +YAC    DCTP+ DGSSCN L   +K SY FN+YFQ Q+Q+  SCDF+
Sbjct  376   APTDANLADNMNYACNNGGDCTPIQDGSSCNFLDAKQKASYVFNSYFQIQNQSNTSCDFK  435

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VTT++ S P+C F I I
Sbjct  436   GLATVTTQDPSVPNCNFTIQI  456



>ref|XP_002277003.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 ref|XP_010653839.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
 emb|CAN83571.1| hypothetical protein VITISV_041708 [Vitis vinifera]
 emb|CBI29926.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 249/443 (56%), Positives = 312/443 (70%), Gaps = 7/443 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G A ++GLGVNWG ++SH LPPK VV+MLK NGI+KVKLF+     ++ALAG+GIEVM+ 
Sbjct  18    GCASVEGLGVNWGTMASHKLPPKVVVQMLKDNGIQKVKLFDADSVTMSALAGSGIEVMVA  77

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN  L  + +Y+ AKA+V+ NVT YN     GV I  VGVGNEPFL  Y    L  +T 
Sbjct  78    IPNDQLAVMNDYDRAKAWVRRNVTRYNFNG--GVTIKYVGVGNEPFLSSYNGSFL-NITL  134

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI++ + +IV+ L+
Sbjct  135   PALQNIQNALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRTDISELMTQIVQFLN  194

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
             KN APF +N+YPFLSL Y  D FP D+AFFDGV  P+ DNG +YTNVFDAN+DT V+AL 
Sbjct  195   KNNAPFTVNIYPFLSL-YGNDNFPFDYAFFDGVSNPIVDNGISYTNVFDANFDTLVSALK  253

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                 G + ++VGE+GWPTDGD  AN++ A RFYNG +  LAG  GTP+RPG  I+VY+FG
Sbjct  254   AVGLGDMTILVGEVGWPTDGDKNANSNNAYRFYNGLLPRLAGNIGTPLRPGY-IEVYLFG  312

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWGI  YDGQ K+ LDLSG+ G+ K++   + + YLP+KWC   
Sbjct  313   LIDEDAKSIAPGNFERHWGIFKYDGQPKYALDLSGQ-GQNKLLVAAKDVTYLPQKWCMFN  371

Query  1251  ANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              NA  L+ L  N +YAC  +DCT +  GSSCNGL      SY FN YFQ ++Q   SC F
Sbjct  372   PNAGDLSKLGDNINYACTFSDCTALGYGSSCNGLDAQGNASYAFNMYFQVKNQDDLSCYF  431

Query  1428  QGLGEVTTKNLSTPSCRFNIGIK  1496
             QGL +VTT+N+S  SC F + I+
Sbjct  432   QGLAKVTTQNISQGSCNFIVQIE  454



>ref|XP_009610199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   479 bits (1232),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 243/441 (55%), Positives = 307/441 (70%), Gaps = 7/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             ++G++GLGVNWG +++H LPPK VV++LK NGI KVKLF+  +  ++ALAG+ IEVM+  
Sbjct  14    LSGVEGLGVNWGTMATHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGSDIEVMVAI  73

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN  L  + +Y  AK +V+ NVT YN     GV I  V VGNEPFL  Y        T+P
Sbjct  74    PNDQLSAMNDYHRAKDWVRRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNS-FINTTFP  130

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI D + ++V+ +++
Sbjct  131   ALENIQNALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMVQFMNQ  190

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF +N+YPFLSL Y+ + FPVDFAFFDG   P+ D G TYTNVFDAN+DT V+AL  
Sbjct  191   NNAPFTVNIYPFLSL-YANEHFPVDFAFFDGASNPILDKGVTYTNVFDANFDTLVSALRA  249

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                G + ++VGE+GWPTDGD  AN ++A RFY G +  LA   GTP+RPG  I+VY+FGL
Sbjct  250   AGVGNMTILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGY-IEVYLFGL  308

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PGNFE HWGI  YDGQ KF++DL+G+ G+ K + G + +EYLPKKWC L  
Sbjct  309   IDEDGKSIAPGNFERHWGIFRYDGQPKFSMDLTGQ-GQDKFLVGAQNVEYLPKKWCMLNP  367

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  +DCT +  GSSCNGL      SY FN YFQAQ+Q   SC FQ
Sbjct  368   NAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQAQNQGDFSCGFQ  427

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VT +N+S  +C F I I
Sbjct  428   GLAMVTDQNISQANCNFTIQI  448



>ref|XP_009605785.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   479 bits (1232),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 303/436 (69%), Gaps = 7/436 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG ++SHPL PK VV+MLK NGIKKVKLF+  K  +NALAGT IEVM+  PN 
Sbjct  24    VEGLGVNWGTMASHPLEPKIVVQMLKDNGIKKVKLFDADKTTMNALAGTDIEVMVAIPND  83

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +V+ NVT YN  +  GV I  V VGNEPFL  Y       +T+PAL 
Sbjct  84    QLLTMTDYDRAKDWVRRNVTRYNIKA--GVNIKYVAVGNEPFLTAYNNS-FVNLTFPALQ  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DIA+ + +IV+ ++KN A
Sbjct  141   NIQNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMNKNQA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL YS + FP+DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL    +
Sbjct  201   PFTVNIYPFLSL-YSNEHFPIDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGY  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN + A RFY G    LA  KGTP+RPG  I+VY+FGL DE
Sbjct  260   GNMNILVGEVGWPTDGDKNANLNYAYRFYKGLFSRLAANKGTPLRPGY-IEVYLFGLIDE  318

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-  1259
             D KS  PGNFE HWGI  YDGQ KF +D+SG+ G+ K +   + ++YLPK+WC L  NA 
Sbjct  319   DAKSIAPGNFERHWGIFRYDGQPKFPMDISGQ-GQDKHLVAAKNVQYLPKRWCMLNPNAN  377

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N DYAC  +DCT +  GSSCN L      SY FN Y+Q Q+Q   SCDFQGL 
Sbjct  378   NLSILANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLA  437

Query  1440  EVTTKNLSTPSCRFNI  1487
              VT KN+S  +C F I
Sbjct  438   MVTDKNISQGTCNFII  453



>ref|XP_011078775.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=478

 Score =   476 bits (1224),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 306/438 (70%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++ LGVNWG +++H LPPK VV+ML  NGIKKVKLF+  +  ++ALAGTG+EVM+  PN 
Sbjct  23    VESLGVNWGTMATHKLPPKVVVQMLTDNGIKKVKLFDADQSTMSALAGTGVEVMVAIPND  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +VK N+T YN     GV I  V VGNEPFL  Y        T+PAL 
Sbjct  83    QLSAMGSYDRAKEWVKRNITRYNFNG--GVTIKYVAVGNEPFLTSYNNS-FVNTTFPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI+DQ+ +IV+ L++N A
Sbjct  140   NIQNALNEAGVGDSIKATVPLNADVYGSPENNPVPSAGRFRTDISDQMSQIVKFLNQNKA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y+ + FPVD+AFFDGV  P+ DNG +Y+NVFDAN+DT V+AL    +
Sbjct  200   PFTVNIYPFLSL-YANENFPVDYAFFDGVSNPIVDNGISYSNVFDANFDTLVSALKALGY  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN + A RFY G +  LAG KGTP+RPG  I+VY+FGL DE
Sbjct  259   GDMTIIVGEVGWPTDGDKNANINYALRFYRGLLPRLAGNKGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF +DLSG+    K + G + + YLP KWC L+ +A 
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQQSD-KYLVGAQNVNYLPTKWCMLRPDAN  376

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q   +C+FQGL 
Sbjct  377   DLSKLADNINYACTFSDCTALGFGSSCNGLDANGNASYAFNMYFQVQNQRDLTCNFQGLA  436

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VT KN+S  +C F I I
Sbjct  437   MVTDKNISQGNCNFTIQI  454



>ref|XP_004981482.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
 ref|XP_004981483.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X2 
[Setaria italica]
Length=494

 Score =   476 bits (1225),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 307/443 (69%), Gaps = 6/443 (1%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMI  347
             +GVA ++ LG+NWG  ++H LPPK VV+MLK NGIKKVKLF+  +  L+ALAGTGIEVM+
Sbjct  24    SGVARVEALGMNWGTQATHQLPPKIVVQMLKDNGIKKVKLFDADQSTLSALAGTGIEVMV  83

Query  348   GTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVT  527
               PN LL  + +Y+ AK +V+ NV+ YN     GV I  V VGNEPFL  Y      KVT
Sbjct  84    AIPNVLLDRITDYDTAKEWVRHNVSRYNFDG--GVTIKYVAVGNEPFLAAYNNT-FDKVT  140

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
             +PAL N+Q AL+EAG+G T+KATVP NADVY+SP   PVPSAG +R DIAD + ++V+ L
Sbjct  141   FPALQNIQNALDEAGLGDTIKATVPLNADVYMSPTDNPVPSAGRWRPDIADLMTQMVQFL  200

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
               + APF +N+YPF+SLF + D FPVDFAFFDG   P+ DNG  YTNVFDAN+DT VAAL
Sbjct  201   SNHSAPFTVNIYPFISLFLN-DNFPVDFAFFDGGATPVLDNGVQYTNVFDANFDTLVAAL  259

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
                 HG + V+VGE+GWPTDGD  A    A RFYNG +K LA   GTPVRP   I+VY+F
Sbjct  260   KASGHGDLPVIVGEVGWPTDGDKHATNVYAQRFYNGLLKRLAANAGTPVRPNQYIEVYLF  319

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
             GL DED KS  PGNFE HWGIL YDGQ K+ +DLSG+ G+  ++   +G+EYLP+ WC +
Sbjct  320   GLLDEDIKSVAPGNFERHWGILRYDGQPKYPMDLSGQ-GQNAMLVPAQGVEYLPRTWCVV  378

Query  1248  KANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
                +  +  L  N ++AC  ADCT +  GS+C G+      SY FNA+FQ +DQA ++CD
Sbjct  379   NTESPNMDKLADNINFACTFADCTALGYGSTCGGMDSNGNASYAFNAFFQMKDQADEACD  438

Query  1425  FQGLGEVTTKNLSTPSCRFNIGI  1493
             FQGL   T  + ST +C F I I
Sbjct  439   FQGLARPTQTDPSTNTCNFTIQI  461



>ref|XP_009786014.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=474

 Score =   475 bits (1222),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 305/441 (69%), Gaps = 7/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             ++ ++GLGVNWG ++ H LPPK VV++LK NGI KVKLF+  +  ++ALAGT IEVM+  
Sbjct  14    LSEVEGLGVNWGTMAMHKLPPKTVVQLLKDNGIGKVKLFDADQSTMSALAGTDIEVMVAI  73

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN  L  + +Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y        T+P
Sbjct  74    PNDQLSAMNDYDRAKDWVRRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNS-FINTTFP  130

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI D + ++V+ +++
Sbjct  131   ALQNIQNALNEAGLGNSIKATVPLNADVYFSPESNPVPSAGRFRQDINDLMTQMVQFMNQ  190

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF +N+YPFLSL Y+ + FPVDFAFFDG   P+ D G TYTNVFDAN+DT V+AL  
Sbjct  191   NNAPFTVNIYPFLSL-YANEHFPVDFAFFDGASSPILDKGVTYTNVFDANFDTLVSALRA  249

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                G + ++VGE+GWPTDGD  AN ++A RFY G +  LA   GTP+RPG  I+VY+FGL
Sbjct  250   AGVGNMTILVGEVGWPTDGDKNANVNLAYRFYKGLLSRLAANTGTPLRPGY-IEVYLFGL  308

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PGNFE HWGI  YDGQ KF +DL+G+ G+ K + G + +EYLPKKWC L  
Sbjct  309   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLTGQ-GQDKFLVGAQNVEYLPKKWCMLNP  367

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  +DCT +  GSSCNGL      SY FN Y+QAQ+Q   SC FQ
Sbjct  368   NAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQGDFSCGFQ  427

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VT +N+S  +C F I I
Sbjct  428   GLAMVTDQNISQANCNFTIQI  448



>ref|XP_009793269.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
sylvestris]
Length=480

 Score =   473 bits (1216),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 244/436 (56%), Positives = 299/436 (69%), Gaps = 7/436 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG ++SHPL PK VV+MLK NGIKKVKLF+  K  +NALAGT IEVM+  PN 
Sbjct  24    VEGLGVNWGTMASHPLEPKIVVQMLKENGIKKVKLFDADKTSMNALAGTDIEVMVAIPND  83

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +V+ NVT YN  S  GV I  V VGNEPFL  Y       +T+PAL 
Sbjct  84    QLLTMTDYDRAKDWVRRNVTRYNIKS--GVNIKYVAVGNEPFLTAYNNS-FVNLTFPALQ  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  +KATVP NADVY SP   PVPSAG FR DIA+ + +IV+ + KN A
Sbjct  141   NIQNALNEAGVGDYIKATVPLNADVYFSPESNPVPSAGRFRPDIAELMTQIVQFMSKNQA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y+ + FP DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL    +
Sbjct  201   PFTVNIYPFLSL-YANEHFPFDFAFFDGASNPVVDNGVEYTNVFDANFDTLYSALKAVGY  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN + A RFY G    L   KGTP+RPG  I+VY+FGL DE
Sbjct  260   GNMTILVGEVGWPTDGDKNANLNNAYRFYKGLFSRLGANKGTPLRPGY-IEVYLFGLIDE  318

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-  1259
             D KS  PGNFE HWGI  YDGQ KF +D+SG+G + K +   + ++YLPK+WC L  NA 
Sbjct  319   DAKSISPGNFERHWGIFRYDGQPKFAMDISGQGHE-KHLVAAKNVQYLPKRWCMLNPNAN  377

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N DYAC  +DCT +  GSSCN L      SY FN Y+Q Q+Q   SCDFQGL 
Sbjct  378   NLSILANNIDYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQLDLSCDFQGLA  437

Query  1440  EVTTKNLSTPSCRFNI  1487
              VT KN+S  +C F I
Sbjct  438   MVTDKNISQGTCNFII  453



>gb|AAO37977.1| putative beta-1,3 glucanase [Oryza sativa Japonica Group]
 gb|ABF99303.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY92146.1| hypothetical protein OsI_13858 [Oryza sativa Indica Group]
 gb|EAZ28873.1| hypothetical protein OsJ_12912 [Oryza sativa Japonica Group]
 dbj|BAH01366.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 305/438 (70%), Gaps = 8/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             + LG+NWG  +SHPLPPK V ++L+ NGIKKVKLF+  +  L+ALAGTGIEVM+  PN +
Sbjct  32    EALGMNWGTQASHPLPPKIVAQLLQDNGIKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  91

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +Y+ AK +V+ NV+ YN     GV I  V VGNEPFL  Y   G F KVT PAL 
Sbjct  92    LDSITDYDTAKEWVRRNVSRYNFDG--GVTIKYVAVGNEPFLAAYN--GTFDKVTLPALM  147

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SP    VPSAG FR DIAD + ++V+ L  N A
Sbjct  148   NIQNALNDAGLGDSIKATVPLNADVYDSPQDQQVPSAGRFRADIADLMTQMVQFLANNSA  207

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPF+SL Y  D FPVDFAFFDG   P+ DNG +YTNVFDAN+DT VAAL    H
Sbjct  208   PFTVNIYPFISL-YLNDDFPVDFAFFDGGATPVVDNGISYTNVFDANFDTLVAALKGVGH  266

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + +VVGE+GWPTDGD  A A+ A RFYNG +K LA   GTP RPG  I+VY+FGL DE
Sbjct  267   GDMPIVVGEVGWPTDGDKHATATYAQRFYNGLLKRLAANAGTPARPGQYIEVYLFGLLDE  326

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG+FE HWGIL +DGQ K+ +DL+G+ G+  ++   +G+ YLP+ WC +  NAK
Sbjct  327   DAKSVAPGDFERHWGILRFDGQPKYPVDLTGQ-GQNTMLVPAKGVTYLPRTWCVINTNAK  385

Query  1263  LTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              T+ L  N ++AC  ADCT +  GS+C G+      SY FNAYFQ Q+Q  D+CDFQGL 
Sbjct  386   DTSKLADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDDACDFQGLA  445

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + STP+C F I I
Sbjct  446   MPTQTDPSTPACNFTIQI  463



>ref|XP_010314012.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=475

 Score =   472 bits (1214),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 307/441 (70%), Gaps = 7/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             ++G+DGLGVNWG +++H LPPK VV+MLK NGI KVKLF+  +  ++ALAG+ +EVM+  
Sbjct  17    LSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAI  76

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN  L  + +Y+ AK +VK NVT YN     GV I  V VGNEPFL  Y    L   T+P
Sbjct  77    PNDQLSAMNDYDRAKDWVKRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNSFL-NTTFP  133

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI D + +IV+ + +
Sbjct  134   ALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQ  193

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF +N+YPFLSL Y+ + FPV+FAFFDG   P+ DNG +YTNVFDAN+DT V+AL  
Sbjct  194   NNAPFTVNIYPFLSL-YANEHFPVNFAFFDGASNPIVDNGLSYTNVFDANFDTLVSALKA  252

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                G + ++VGE+GWPTDGD  AN ++A RFY G +  LA   GTP+RPG  I+VY+FGL
Sbjct  253   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANVGTPLRPGF-IEVYLFGL  311

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PGNFE HWGI  YDGQ KF +DL+G+ G+ K +   + +EYL KKWC    
Sbjct  312   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLTGQ-GQDKFLVAAQNVEYLSKKWCMFNP  370

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  +DCT +  GSSCNGL      SY FN Y+QAQ+Q + SC+FQ
Sbjct  371   NAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQ  430

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  +T +N+S  +C F I I
Sbjct  431   GLATLTDQNISQANCNFTIQI  451



>gb|AFU52646.1| beta-1,3-glucanase 11 [Solanum tuberosum]
Length=469

 Score =   471 bits (1213),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 7/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             ++G+DGLGVNWG +++H LPPK VV+MLK NGI KVKLF+  +  ++ALAG+ +EVM+  
Sbjct  11    LSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAI  70

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN  L  + +Y+ AK +VK NVT YN     GV I  V VGNEPFL  Y    L   T+P
Sbjct  71    PNDQLSAMNDYDRAKDWVKRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNSFL-NTTFP  127

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI D + +IV+ + +
Sbjct  128   ALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQ  187

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF +N+YPFLSL Y+ + FPVDFAFFDG   P+ DNG +YTNVFDAN+DT V+AL  
Sbjct  188   NNAPFTVNIYPFLSL-YANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKA  246

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                G + ++VGE+GWPTDGD  AN ++A RFY G +  LA   GTP+RPG  I+VY+FGL
Sbjct  247   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPGF-IEVYLFGL  305

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PGNFE HWGI  YDGQ KF +DL G+ G+ K +     +EY  KKWC    
Sbjct  306   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLMGQ-GQDKFLVAARNVEYFSKKWCMFNP  364

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  +DCT +  GSSCNGL      SY FN Y+QAQ+Q + SC+FQ
Sbjct  365   NAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQ  424

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  +T +N+S  +C F I I
Sbjct  425   GLATLTDQNISQANCNFTIQI  445



>ref|XP_004955566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=487

 Score =   472 bits (1214),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 249/440 (57%), Positives = 305/440 (69%), Gaps = 7/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G + LG+NWG  +SHPLPPKAVV++L+ NGIKKVKLF+T    ++AL+GTGIEVM   PN
Sbjct  22    GAEALGMNWGTQASHPLPPKAVVQVLRDNGIKKVKLFDTDFAAMSALSGTGIEVMAAIPN  81

Query  360   ALLKDLVNYE-VAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
              +L DL +    AK +VK NV  Y+     GV I  V VGNEPFL+ Y       +T+PA
Sbjct  82    NMLADLADDAGKAKDWVKRNVKRYDFDG--GVTIKYVAVGNEPFLQSYNGT-FINITFPA  138

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q ALN+AG+G  +KATVP NADVY SP   PVPSAG FR DI+  +  IV+ L KN
Sbjct  139   LQNIQNALNDAGVGDRIKATVPLNADVYNSPDSHPVPSAGRFRPDISGLMTDIVKFLAKN  198

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF +N+YPFLSL+ S D FP+D+AFFDG   P++DNG  YTNVFDAN+DT VAAL   
Sbjct  199   NAPFTVNIYPFLSLYLS-DNFPLDYAFFDGGATPVNDNGVLYTNVFDANFDTLVAALRAV  257

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + VVVGE+GWPTDGD  A  S A RFY G ++ LA   GTP RP   I+VY+FGL 
Sbjct  258   GHGDMPVVVGEVGWPTDGDKHAKVSYAQRFYAGLLRRLAANAGTPARPNQYIEVYLFGLV  317

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGIL YDGQ K+ +DL+G+ G+  ++   +GI+YLPK WCAL  N
Sbjct  318   DEDLKSVAPGNFERHWGILRYDGQPKYPMDLAGQ-GRNTMLVPAKGIKYLPKTWCALNPN  376

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK L+ L AN DYAC  ADCTP+  GS+CNG+      SY FNAY+Q Q+Q  D+CDFQG
Sbjct  377   AKDLSKLGANIDYACTFADCTPLGYGSTCNGMDTAGNASYAFNAYYQVQNQKDDACDFQG  436

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L   T  + ST +C F I I
Sbjct  437   LALPTETDPSTAACNFTIQI  456



>ref|XP_003624610.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|ABN09816.1| Glycoside hydrolase, family 17; X8 [Medicago truncatula]
 gb|AES80828.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=480

 Score =   471 bits (1212),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 310/438 (71%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPP+ VVKMLK NGI+KVKLF+     + ALAG+GIEVM+  PN 
Sbjct  23    VEGLGVNWGTQATHKLPPETVVKMLKDNGIQKVKLFDADDTTMTALAGSGIEVMVAIPNN  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ +++ A+ +V++NVT YN     GVKI  V VGNEPFLK Y    L  +T+PAL 
Sbjct  83    QLAEMNDFKRAQYWVRKNVTRYNFDG--GVKIKYVAVGNEPFLKAYNNSFL-NITFPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q A+NEAG+G TVKATVP NADVY+SPP   VPSAG+FR DI   + ++V+ L+KNGA
Sbjct  140   NIQNAINEAGLGDTVKATVPLNADVYMSPPDNQVPSAGIFRPDINGLMTQMVQFLNKNGA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP +FAFFDGVDKP+ DNG  YTNVFDAN+DT V+AL     
Sbjct  200   PFTVNIYPFLSL-YGNDDFPFNFAFFDGVDKPITDNGIQYTNVFDANFDTLVSALKSIGF  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G   ++VGE+GWPT+GD  AN+  A RFYNG +  LA  +GTP+RPG  I+VY+FGL DE
Sbjct  259   GDTPILVGEVGWPTEGDKNANSGNAIRFYNGLLSRLAANRGTPLRPGF-IEVYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF +DLSG+  + K++ G +G++YL   WC    +AK
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQ-LQNKLLVGAQGVKYLDPMWCMFNPDAK  376

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N ++AC   DCT +  GSSCN L      SY FN Y+Q Q+Q + +C+F+GL 
Sbjct  377   DLSKLADNINFACTFGDCTALGYGSSCNNLDANGNASYAFNMYYQTQNQDRQACNFEGLA  436

Query  1440  EVTTKNLSTPSCRFNIGI  1493
             + TT N+STP+C F I I
Sbjct  437   KPTTDNISTPTCNFIIQI  454



>ref|XP_006348032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=475

 Score =   471 bits (1212),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 7/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             ++G+DGLGVNWG +++H LPPK VV+MLK NGI KVKLF+  +  ++ALAG+ +EVM+  
Sbjct  17    LSGVDGLGVNWGTMATHKLPPKTVVQMLKDNGIGKVKLFDADQSTMSALAGSDLEVMVAI  76

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN  L  + +Y+ AK +VK NVT YN     GV I  V VGNEPFL  Y    L   T+P
Sbjct  77    PNDQLSAMNDYDRAKDWVKRNVTRYNFKG--GVNIKYVAVGNEPFLTSYNNSFL-NTTFP  133

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI D + +IV+ + +
Sbjct  134   ALQNIQNALNEAGLGSSIKATVPLNADVYFSPDDNPVPSAGRFREDINDLMTQIVQFMSQ  193

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF +N+YPFLSL Y+ + FPVDFAFFDG   P+ DNG +YTNVFDAN+DT V+AL  
Sbjct  194   NNAPFTVNIYPFLSL-YANEHFPVDFAFFDGASNPIADNGLSYTNVFDANFDTLVSALKA  252

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                G + ++VGE+GWPTDGD  AN ++A RFY G +  LA   GTP+RPG  I+VY+FGL
Sbjct  253   AGVGNLPILVGEVGWPTDGDKNANVNLAYRFYKGLLPRLAANTGTPLRPGF-IEVYLFGL  311

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PGNFE HWGI  YDGQ KF +DL G+ G+ K +     +EY  KKWC    
Sbjct  312   IDEDGKSIAPGNFERHWGIFRYDGQPKFAMDLMGQ-GQDKFLVAARNVEYFSKKWCMFNP  370

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  +DCT +  GSSCNGL      SY FN Y+QAQ+Q + SC+FQ
Sbjct  371   NAKDLSKLADNINYACTFSDCTALGYGSSCNGLDANGNASYAFNMYYQAQNQEEFSCNFQ  430

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  +T +N+S  +C F I I
Sbjct  431   GLATLTDQNISQANCNFTIQI  451



>ref|XP_006409040.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
 gb|ESQ50493.1| hypothetical protein EUTSA_v10022665mg [Eutrema salsugineum]
Length=482

 Score =   471 bits (1211),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 307/438 (70%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  ++ALAG+G++VM+  PN 
Sbjct  22    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADESTMSALAGSGLQVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V++NVT YN T   GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMCSYDRAKDWVRKNVTRYNFTG--GVNITFVAVGNEPFLKSYNGS-FINITFPALQ  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P++DNG  YTNVFDAN+DT V+AL    H
Sbjct  199   PITINIYPFLSL-YGNDDFPLNYAFFDGA-QPINDNGVDYTNVFDANFDTLVSALKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN   A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANTGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG+FE HWGI  +DGQ KF +DLSG+ G+ K++ G +G+ YLP KWC     AK
Sbjct  316   DAKSIAPGDFERHWGIFKFDGQPKFPIDLSGQ-GQNKMLIGAQGVTYLPNKWCTFNPQAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN D+AC  +DCT +  GSSCNGL      SY FN YFQ ++Q + +C FQGL 
Sbjct  375   DLTKLAANIDFACTYSDCTGLGYGSSCNGLDANGNASYAFNMYFQVKNQDEGACIFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  435   TITTQNISQGQCNFPIQI  452



>ref|XP_007161926.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
 gb|ESW33920.1| hypothetical protein PHAVU_001G109400g [Phaseolus vulgaris]
Length=477

 Score =   470 bits (1210),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/433 (56%), Positives = 303/433 (70%), Gaps = 7/433 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +G+GVNWG  ++H LPP  VV++LK NGI+KVKLF+     ++ALAGTGIEVM+  PN  
Sbjct  21    EGIGVNWGTQATHKLPPDTVVQLLKDNGIQKVKLFDADDSTMSALAGTGIEVMVAIPNIQ  80

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L ++ ++  AK +VK+NVT Y  T   GV I  V VGNEPFLK Y    L  +T+PAL N
Sbjct  81    LLEMNDFGRAKQWVKKNVTRY--TFNGGVNIKYVAVGNEPFLKSYNNSFL-NITFPALQN  137

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q ALN+AG+G T+KATVP NADVY SP   PVPSAG+FR DI   + +IV+ L KNGAP
Sbjct  138   IQNALNDAGVGDTIKATVPLNADVYQSPENNPVPSAGIFRPDITGLMTQIVQFLSKNGAP  197

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y  D FP ++AFFDGVD P++DNG  YTNVFDAN+DT VAAL     G
Sbjct  198   FTVNIYPFLSL-YGNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFG  256

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + ++VGE+GWPT+GD  AN   A RFYNG +  LAG +GTP RPG  I+VY+FGL DED
Sbjct  257   DLPILVGEVGWPTEGDKNANVGNALRFYNGLLPRLAGNRGTPCRPG-HIEVYLFGLIDED  315

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI  YDGQ KF +DLSG+  + K + G + ++YL  +WC    NAK 
Sbjct  316   AKSIAPGNFERHWGIFRYDGQPKFPMDLSGQ-NQNKFLIGAQNVKYLAPRWCMFNPNAKD  374

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             LT+L  N +YAC   DCT +  GSSCN L      SY FN YFQ Q+Q   +C+FQGL +
Sbjct  375   LTSLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAK  434

Query  1443  VTTKNLSTPSCRF  1481
             +TT N+STP+C F
Sbjct  435   ITTDNISTPTCNF  447



>ref|XP_003548760.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=478

 Score =   470 bits (1209),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 305/438 (70%), Gaps = 7/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  ++H LPP  VV+MLK NGIKKVKLF++    ++ALAGTGIEVM+  PN 
Sbjct  20    VEGIGVNWGTQATHKLPPDTVVQMLKDNGIKKVKLFDSDDSTMSALAGTGIEVMVAIPNN  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ +Y  AK +VK+NVT YN     GV +  V VGNEPFLK Y    L  +T PAL 
Sbjct  80    QLAEMNDYGRAKQWVKKNVTRYNFNG--GVNVKYVAVGNEPFLKSYNNSFL-NITLPALQ  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  +KATVP NADVY SP   PVPSAG+FR DI+  + +IV+ L KNGA
Sbjct  137   NIQNALNEAGLGDKIKATVPLNADVYQSPESNPVPSAGIFRPDISGLMTQIVQFLSKNGA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP ++AFFDGVD P++DNG  YTNVFDAN+DT VAAL     
Sbjct  197   PFTVNIYPFLSL-YGNDDFPFNYAFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGF  255

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  ANA  A RFYNG +  LA  +GTP RPG  I+VY+FGL DE
Sbjct  256   GDLPILVGEVGWPTEGDKNANAGNALRFYNGLLPRLAANRGTPRRPGY-IEVYLFGLIDE  314

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF +DLSG+  + K + G + ++YL  +WC    +AK
Sbjct  315   DAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQ-NQNKFLIGAQNVKYLAPRWCMFNPDAK  373

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC   DCT +  GSSCN L      SY FN YFQ Q+Q   +C+FQGL 
Sbjct  374   DLSKLPDNINYACTFGDCTALGYGSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLA  433

Query  1440  EVTTKNLSTPSCRFNIGI  1493
             ++TT N+STP+C F + I
Sbjct  434   KLTTDNISTPTCNFIVQI  451



>ref|XP_008806060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=460

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 239/443 (54%), Positives = 306/443 (69%), Gaps = 6/443 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++HPLPP  VV++LK NGI KVKLF+    +++ALAG+GIEVM+  PN 
Sbjct  2     VEGLGVNWGTLATHPLPPNIVVQLLKDNGINKVKLFDADAKMMSALAGSGIEVMVAIPNN  61

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y  AK +V++NVT Y+     GV IT V VGNEPFLK Y       VT+PAL 
Sbjct  62    QLAAMNDYTTAKEWVRKNVTRYHFDG--GVNITYVAVGNEPFLKSY-NDSFSNVTFPALQ  118

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP    VPSAG FR DI D + +IV+  ++NGA
Sbjct  119   NIQNALNEAGVGDSVKATVPLNADVYESPAGNAVPSAGRFRSDINDVMTQIVQFFNQNGA  178

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP+DFAFFDG   P+ DNG  YTNVFDAN+DT V+AL+    
Sbjct  179   PFTVNIYPFLSL-YGNDNFPLDFAFFDGTSPPVVDNGIEYTNVFDANFDTLVSALNAVGL  237

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A AS A RFYNG +K LA  +GTP+RP   ++VY+FGL DE
Sbjct  238   GNLPIIVGEVGWPTDGDKSAEASYAQRFYNGLLKRLAAGQGTPLRPNQYLEVYLFGLLDE  297

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF +DLSG+ G+ K++   + +EYLP+KWC    +AK
Sbjct  298   DAKSVAPGNFERHWGIFRYDGQPKFPVDLSGQ-GQNKMLAAAKNVEYLPQKWCVFNPDAK  356

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N ++AC  +DCT +  GS+C+ L      SY FN Y+Q Q+Q   SC FQGL 
Sbjct  357   DLSKLADNVNFACTFSDCTSLGSGSTCSDLDANGSASYAFNMYYQVQNQDDTSCFFQGLA  416

Query  1440  EVTTKNLSTPSCRFNIGIKLGAE  1508
               T ++ ST  C+F + IK  A 
Sbjct  417   METAQDPSTADCKFTVQIKTSAS  439



>ref|NP_179534.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAD10143.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM14870.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC06881.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=478

 Score =   469 bits (1208),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 305/442 (69%), Gaps = 8/442 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G+  +DGLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  ++AL+G+G+EVM+ 
Sbjct  14    GIVMVDGLGVNWGTMATHKLPPKKVVQMLKDNNINKVKLFDADETTMSALSGSGLEVMVA  73

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN  LK + +Y+ AK +V +NVT YN     GV IT V VGNEPFLK Y       +T+
Sbjct  74    IPNDQLKVMGSYDRAKDWVHKNVTRYNFNG--GVNITFVAVGNEPFLKSYNGS-FINLTF  130

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L 
Sbjct  131   PALQNIQNALNEAGLGSSVKATVPLNADVYDSPSSNPVPSAGRFRPDIIGQMTQIVDFLG  190

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
              N AP  IN+YPFLSL Y  D FP+++AFFDG  KP+DDNG  YTNVFDAN+DT V+AL 
Sbjct  191   NNSAPITINIYPFLSL-YGNDDFPLNYAFFDGA-KPVDDNGIAYTNVFDANFDTLVSALK  248

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                HG + ++VGE+GWPT+GD  AN+  A RFYNG +  L   +GTP+RP   I+VY+FG
Sbjct  249   AVGHGDMPIIVGEVGWPTEGDKHANSGSAYRFYNGLLPRLGENRGTPLRP-TYIEVYLFG  307

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K++ G E + Y PKKWC   
Sbjct  308   LLDEDAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQ-GQNKLLIGAENVTYQPKKWCMFN  366

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
               AK LT L AN DYAC  +DCT +  GSSCN L      SY FN YFQ ++Q +D+C F
Sbjct  367   TEAKDLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKNQDEDACIF  426

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL  +TTKN+S   C F I I
Sbjct  427   QGLATITTKNISQGQCNFPIQI  448



>emb|CDP18694.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   469 bits (1208),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 244/443 (55%), Positives = 300/443 (68%), Gaps = 7/443 (2%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMI  347
             N V G++GLGVNWG  ++H LPPK VV+MLK NGI KVKLF+     ++ALAG+ IEVM+
Sbjct  20    NDVVGVEGLGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMV  79

Query  348   GTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVT  527
               PN  L  + +Y+ AK +VK NVT Y      GV I  V VGNEPFL  Y        T
Sbjct  80    AIPNDQLLVMNDYDRAKNWVKRNVTVY--LFNGGVNIKYVAVGNEPFLASYNNS-FVNTT  136

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
             +PAL N+Q ALN+AG G T+KATVP NADVY SP   PVPSAG FR DI+ Q+ +IV+ L
Sbjct  137   FPALQNIQNALNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFL  196

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             ++N APF +N+YPFLSL Y    FPVD+AFFDG   P+ D+G  YTNVFDAN+DT V+AL
Sbjct  197   NQNNAPFTVNIYPFLSL-YLNSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDTLVSAL  255

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
                 +G + ++VGE+GWPTDGD  AN + A RFY G +  LA  KGTP+RPG  I+VY+F
Sbjct  256   KGLGYGSMNILVGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGY-IEVYLF  314

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
             GL DED KS  PGNFE HWGI  YDGQ KF +DLSG+  + K + G + ++YLP KWC  
Sbjct  315   GLLDEDLKSVAPGNFERHWGIFRYDGQPKFPMDLSGQ-LQDKYLVGAQNVQYLPAKWCQF  373

Query  1248  KANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
               NAK L+ L  N +YAC  ADCT +  GSSCNGL      SY FN YFQ Q+Q   SC+
Sbjct  374   NPNAKDLSKLAENINYACTFADCTALGYGSSCNGLDSNGNASYAFNMYFQVQNQGDLSCN  433

Query  1425  FQGLGEVTTKNLSTPSCRFNIGI  1493
             FQGL  VT +N+S  +C F I I
Sbjct  434   FQGLAMVTEQNISQANCNFTIQI  456



>ref|XP_010054473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
 gb|KCW89851.1| hypothetical protein EUGRSUZ_A02084 [Eucalyptus grandis]
Length=478

 Score =   468 bits (1205),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 301/441 (68%), Gaps = 8/441 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             VA ++GLGVNWG +++H LPP  VV+MLK NGIKKVKLF+  +  L+ALAG+ IEVM+  
Sbjct  19    VAHVEGLGVNWGTMATHELPPGTVVQMLKDNGIKKVKLFDADQYTLSALAGSNIEVMVAI  78

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN  L  + +YE AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT+P
Sbjct  79    PNDQLASMTSYERAKQWVQRNVTRYNFNG--GVSIKYVAVGNEPFLSAYNGSFL-NVTFP  135

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q ALNE G+G TVKATVP NADVY SP   PVPSAG FR DI+D + +IVE L K
Sbjct  136   ALQNIQNALNEVGVGDTVKATVPVNADVYNSPVSNPVPSAGRFRTDISDLMTQIVEFLAK  195

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N AP  +N+YPFLSL Y  D FP+D+AFFDG   P+ DNG  YTNVFDAN+DT V+AL  
Sbjct  196   NSAPLTVNIYPFLSL-YGNDNFPIDYAFFDGA-TPVVDNGIQYTNVFDANFDTLVSALKA  253

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
               HG + ++VGE+GWPTDGD  AN + A RFYNG +  LA   GTP+RPG  I+VY+FGL
Sbjct  254   VGHGDMTLMVGEVGWPTDGDKNANIASAVRFYNGLMPRLAANTGTPLRPGY-IEVYLFGL  312

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PG+FE HWGI  YDGQ KF LDLSG+  + K +   + + YLP++WC L  
Sbjct  313   IDEDAKSIAPGSFERHWGIFRYDGQPKFPLDLSGQ-NQNKFLVAAKNVNYLPQQWCVLNP  371

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
              A  L+ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F+
Sbjct  372   KANDLSKLGTNINYACTFADCTSLGYGSSCNSLDANGNASYAFNMYYQVQNQNPLSCNFE  431

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VTT+N+S  +C F I I
Sbjct  432   GLATVTTQNISQGTCNFIIQI  452



>ref|XP_008812061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Phoenix dactylifera]
Length=477

 Score =   468 bits (1203),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 300/439 (68%), Gaps = 7/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++HPLPP+ VV++LK NGIKKVKLF+     ++ALAG+GIEVM+  PN 
Sbjct  20    VEGLGVNWGTMATHPLPPEIVVQLLKDNGIKKVKLFDADAATMSALAGSGIEVMVAIPNN  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y  AK +V  NVT YN     GV I  V VGNEPFL  Y    L  VT+PAL 
Sbjct  80    QLGAMNDYATAKKWVNRNVTRYNFDG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQ  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG G  +KATVP NADVY SP   PVPSAG FR DI D + +IV+ L++ GA
Sbjct  137   NIQNALNEAGAGG-IKATVPLNADVYNSPTNNPVPSAGRFRSDINDLMTQIVQFLNQAGA  195

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP+DFAFFDG  +P+ DNG  Y NVFDAN+DT V+AL     
Sbjct  196   PFTVNIYPFLSL-YDNDNFPLDFAFFDGTSQPVVDNGIQYANVFDANFDTLVSALKAVGL  254

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  A AS A RFYNG +K LA   GTP+RP   ++VY+F L DE
Sbjct  255   GDLPVIVGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANSGTPLRPNQYLEVYLFSLIDE  314

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGIL YDGQ KF +DLSG+ G+ K++   + +EYLP+ WC    NAK
Sbjct  315   DAKSIAPGNFERHWGILKYDGQPKFPMDLSGQ-GQNKMLVAAKNVEYLPQTWCVFNPNAK  373

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC  +DCTP+  GS+CN L      SY FN YFQ Q+Q   SC FQGL 
Sbjct  374   DLSKLGDNINYACTFSDCTPLGYGSTCNQLDANGNASYAFNMYFQVQNQKDMSCFFQGLA  433

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
               TT+N ST  C F I IK
Sbjct  434   MQTTQNPSTAECNFTIQIK  452



>gb|EPS74227.1| beta-1,3-glucanase, acidic, partial [Genlisea aurea]
Length=444

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 308/439 (70%), Gaps = 8/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++ LGVNWG +++H LPP  VV++LK NGI KVKLF+  +  +NALAGTGIEVM+  PN 
Sbjct  7     VESLGVNWGTMATHRLPPNVVVQILKDNGINKVKLFDADQSTMNALAGTGIEVMVAIPND  66

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y  AKA+V+ NVT YN +   GV I  V VGNEPFL  Y    L   T+PAL 
Sbjct  67    QLAAMGSYNRAKAWVRRNVTRYNFSG--GVNIKYVAVGNEPFLTSYNNSFL-HTTFPALQ  123

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI DQ+ ++V+ L++N A
Sbjct  124   NIQNALNEAGLGDSVKATVPLNADVYGSPDSNPVPSAGRFRPDILDQMTQMVQFLNQNKA  183

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKP-LDDNGKTYTNVFDANYDTAVAALSREK  899
             PF +N+YPFLSL Y+ + FPVD+AFFDG   P +D NG  YTNVFDAN+DT V+AL    
Sbjct  184   PFTVNIYPFLSL-YANENFPVDYAFFDGAAAPVVDTNGIQYTNVFDANFDTLVSALRGLG  242

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +G + +VVGE+GWPTDGD  AN + A RFY G +  LA  +GTP+RPG  ++VY+FGL D
Sbjct  243   YGDMAIVVGEVGWPTDGDRNANVNNAVRFYRGLLPRLAANRGTPLRPGY-VEVYLFGLID  301

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGIL YDGQ KF +DLSG+G + + + G +G++YLPKKWC  + +A
Sbjct  302   EDAKSVQPGNFERHWGILRYDGQPKFPMDLSGQGVE-RYLVGAQGVKYLPKKWCVFRQDA  360

Query  1260  K-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
             K L+ L  N ++AC  +DCT +  GSSC GL      SY FN YFQ Q+Q + SC FQGL
Sbjct  361   KDLSKLGPNINFACTFSDCTALGYGSSCGGLDANGNASYAFNMYFQTQNQDELSCVFQGL  420

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
               VT +N+S  +C F + I
Sbjct  421   AVVTDQNVSQGNCNFTLQI  439



>ref|XP_010909077.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=478

 Score =   468 bits (1203),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 302/443 (68%), Gaps = 6/443 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++HPLPPK VV++LK NGIKKVKLF+     ++ALAG+GIEVM+  PN 
Sbjct  20    VEGLGVNWGTMATHPLPPKIVVQLLKDNGIKKVKLFDADAATMSALAGSGIEVMVAIPNN  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +V  NV+ Y+     GV I  V VGNEPFL  Y    L  VT+PAL 
Sbjct  80    QLGAMNDYDTAKKWVDRNVSRYHFDG--GVTIKYVAVGNEPFLSSYNGSFL-NVTFPALQ  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG G T+KATVP NADVY SP   PVPSAG FR DI D + +IV+  + +GA
Sbjct  137   NIQNALNEAGFGDTIKATVPLNADVYNSPTNNPVPSAGRFRTDINDLMTQIVQFFNLSGA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP+DFAFFDG  +P+ DNG  YTNVFDAN+DT ++AL     
Sbjct  197   PFTVNIYPFLSL-YGNDNFPLDFAFFDGTSQPVVDNGIQYTNVFDANFDTLLSALKAVGL  255

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A AS A RFYNG +K LA   GTP+RP   ++VY+F L DE
Sbjct  256   GNLPIIVGEVGWPTDGDKNAKASYAQRFYNGLLKRLAANVGTPLRPNQYLEVYLFSLIDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGIL YDGQ +F +DLSG+ G+ K++   + +EYLP+ WC    NAK
Sbjct  316   DAKSIAPGNFERHWGILKYDGQPQFPMDLSGQ-GQNKMLVAAKNVEYLPQTWCVFNPNAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC  +DCT +  GS+CN L      SY FN YFQ Q+Q   SC FQGL 
Sbjct  375   DLSKLGDNINYACTFSDCTSLGYGSTCNQLDANGNASYAFNMYFQDQNQKDMSCFFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGIKLGAE  1508
               TT+N ST  C F I IK  A 
Sbjct  435   MQTTQNPSTTECNFTIQIKTSAS  457



>ref|XP_002459388.1| hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
 gb|EER95909.1| hypothetical protein SORBIDRAFT_02g003910 [Sorghum bicolor]
Length=490

 Score =   468 bits (1204),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 247/440 (56%), Positives = 303/440 (69%), Gaps = 7/440 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LG+NWG  ++HPLPPKAVV++L+ NGIKKVKLF+T    ++ALAGTGIEVM+  PN +L 
Sbjct  29    LGMNWGTQATHPLPPKAVVQVLQDNGIKKVKLFDTDPAAMSALAGTGIEVMVAIPNNMLA  88

Query  372   DLVNYE-VAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             DL +    AK +VK NV  Y+     GV I  V VGNEPFL+ Y       VT+PAL N+
Sbjct  89    DLADDAGKAKDWVKRNVRRYDFDG--GVTIKYVAVGNEPFLESYNGS-FINVTFPALENI  145

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q ALN AGIG  +KATVP NADVY SP    VPSAG FR DIA  +  +V+ L KN APF
Sbjct  146   QNALNNAGIGDRIKATVPLNADVYNSPKNNQVPSAGRFRADIAGLMTDMVKFLAKNNAPF  205

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y  D FP+D+AFFDG   P++DNG  YTNVFDAN+DT VAAL    HG 
Sbjct  206   TVNIYPFLSL-YLNDNFPLDYAFFDGGATPVNDNGVLYTNVFDANFDTLVAALKAVGHGD  264

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + +VVGE+GWPTDGD  A AS A RFY G +K LA   GTP RP    +VY+FGL DED 
Sbjct  265   LPIVVGEVGWPTDGDKHAKASYAERFYAGLLKRLAANTGTPARPNQYTEVYLFGLVDEDA  324

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PG+FE HWG+L YDGQ KF +DL+G+ G+  ++   +G++YLP+ WCAL  NAK L
Sbjct  325   KSVAPGSFERHWGVLRYDGQPKFAMDLAGQ-GRNTMLVPAKGVKYLPRAWCALNPNAKDL  383

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               L AN DYAC  ADCTP+  GS+CNG+      SY FNAY+Q Q+Q  ++CDFQGL   
Sbjct  384   GKLGANIDYACTFADCTPLGYGSTCNGMDVAGNASYAFNAYYQVQNQKDEACDFQGLALP  443

Query  1446  TTKNLSTPSCRFNIGIKLGA  1505
             T  + ST +C F I I+ GA
Sbjct  444   TETDPSTATCNFTIQIQTGA  463



>ref|XP_009412333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 240/433 (55%), Positives = 297/433 (69%), Gaps = 6/433 (1%)
 Frame = +3

Query  213   ISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLVNYEV  392
             +++H LPPK + ++L+ NGIKKVK+F+     ++ALAGTGIEVMI  PN +L  + +Y+ 
Sbjct  1     MATHRLPPKTIAQLLQDNGIKKVKIFDADPSSMSALAGTGIEVMIAIPNDMLAKMNDYDA  60

Query  393   AKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAG  572
             AK +VK+NVT YN    DGV I  V VGNEPFLK Y       +T+PAL N+Q ALNEAG
Sbjct  61    AKQWVKKNVTRYNFN--DGVDIKYVAVGNEPFLKSYNDS-FTNITFPALKNIQNALNEAG  117

Query  573   IGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFL  752
             IG  +KATVP NADVY SP   PVPSAG FR DI D + +IVE    NGAPF +N+YPFL
Sbjct  118   IGDAIKATVPLNADVYDSPASNPVPSAGDFRADIRDLMAQIVEFFSLNGAPFTVNIYPFL  177

Query  753   SLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEI  932
             SL Y    FP+DFAFFDG   P+ DNG  YTNVFDAN+DT V+AL +   G + +VVGE+
Sbjct  178   SL-YGNSDFPIDFAFFDGTSAPVVDNGVAYTNVFDANFDTLVSALRKAGFGDLPIVVGEV  236

Query  933   GWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNF  1112
             GWPTDGD  AN +MA RF+ G +K LA K GTP+RP  ++ VY+FGL DED KS  PGNF
Sbjct  237   GWPTDGDVNANVAMAERFFGGLLKRLAAKSGTPLRPNMEMQVYLFGLVDEDAKSVAPGNF  296

Query  1113  EPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK-ANAKLTNLKANTD  1289
             E HWG+  YDG+ KF +D SG+G  G +  G +G++YLP +WCAL  A   L  L  N +
Sbjct  297   ERHWGLFTYDGRPKFAVDFSGQGQNG-MPVGAKGVQYLPTRWCALNPAATDLGKLADNVN  355

Query  1290  YACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTP  1469
             +AC  ADCT +  G SC+ L  + K SY FNAYFQAQ Q  +SC FQGL  VTT+N+S  
Sbjct  356   FACTYADCTALGGGCSCDALDASGKASYAFNAYFQAQSQNGESCYFQGLAMVTTQNISQG  415

Query  1470  SCRFNIGIKLGAE  1508
             SC F I I   AE
Sbjct  416   SCNFTIQIASSAE  428



>ref|XP_009418954.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   467 bits (1201),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 298/438 (68%), Gaps = 7/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++HPLPPK VV++LK NGI+KVK+F+     +NALAG+GIEVM+  PN +
Sbjct  21    DGLGVNWGTMATHPLPPKIVVQLLKDNGIRKVKIFDADAATMNALAGSGIEVMVAIPNNM  80

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L  +++YE AK +V +NVT YN     GV I  V VGNEPFL  Y    L  +T PAL N
Sbjct  81    LGYMIDYETAKKWVNQNVTRYNFQG--GVNIKYVAVGNEPFLTTYNGSFL-NLTLPALQN  137

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q ALN AGIG T+KATVP NADVY SP   PVPSAG FR DI D + +IV  L+++GAP
Sbjct  138   VQTALNNAGIGDTIKATVPLNADVYNSPVSNPVPSAGRFRADINDLMTEIVMFLNQSGAP  197

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FPVD+AFFDG   P+ DNG  YTNVFDAN+DT V+AL+    G
Sbjct  198   FTVNIYPFLSL-YDNPNFPVDYAFFDGTSTPVVDNGIQYTNVFDANFDTLVSALNAVGLG  256

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + ++VGE+GWPTDGD  A  S A RFYNG ++ L   +GTP+RP   I+VYMF L DED
Sbjct  257   NLPIIVGEVGWPTDGDINAKVSYAQRFYNGLLRRLTVNQGTPLRPNQYIEVYMFSLIDED  316

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN--A  1259
              KS  PGNFE HWGI  YDGQ K+ LD SG+ G+  +    +G++YLP+KWC    N   
Sbjct  317   AKSIDPGNFERHWGIFKYDGQPKYALDPSGQ-GQNMMPVAAKGVQYLPQKWCVFNPNGGG  375

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              ++ L  N +YAC R+DCT +  GS+CNGL      S+ FN YFQ Q+Q   SC FQGL 
Sbjct  376   DMSKLGDNINYACSRSDCTALGYGSTCNGLDANGNASFAFNMYFQVQNQMTQSCFFQGLA  435

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               TT+N ST  C F I I
Sbjct  436   VETTQNPSTADCNFTIQI  453



>ref|XP_006362259.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=479

 Score =   466 bits (1200),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/436 (55%), Positives = 300/436 (69%), Gaps = 7/436 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G GVNWG +++H L PK VV+MLK NGI KVKLF+  K  +NALAGT IEVM+  PN 
Sbjct  23    VEGFGVNWGTMATHMLEPKIVVQMLKDNGINKVKLFDADKSTMNALAGTDIEVMVAIPND  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +V+ NVT YN    +GV I  V VGNEPFL  Y    L  +T+PAL 
Sbjct  83    QLLTMTDYDRAKDWVRRNVTRYN--FKNGVNIKYVAVGNEPFLTAYNNSFL-NLTFPALR  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DIA+ + +IVE + KN A
Sbjct  140   NIQNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVEFMSKNQA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y+ + FP+DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL    +
Sbjct  200   PFTVNIYPFLSL-YANEHFPIDFAFFDGTPSPVLDNGVEYTNVFDANFDTLYSALKAVGY  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN + A RFY G    LA  +GTP+RPG  I+VY+FGL DE
Sbjct  259   GNMAILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ+KF +D+SG+ G+ K +   + ++YLP +WC L  NA 
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQSKFPMDISGQ-GQDKHLVAAKNVQYLPNRWCMLNPNAT  376

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N DYAC  +DCT +  GSSCN L      SY FN ++Q Q+Q   SCDF+GL 
Sbjct  377   DLSKLANNIDYACTFSDCTSLGYGSSCNNLDAIGNASYAFNMFYQVQNQLDLSCDFEGLA  436

Query  1440  EVTTKNLSTPSCRFNI  1487
              VT +NLS  +C F I
Sbjct  437   MVTNRNLSQGTCNFII  452



>ref|XP_010036190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Eucalyptus 
grandis]
 gb|KCW47732.1| hypothetical protein EUGRSUZ_K01479 [Eucalyptus grandis]
Length=481

 Score =   466 bits (1200),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 307/442 (69%), Gaps = 8/442 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G   +DGLGVNWG +++H LPPK VV+MLK NGI+KVKLF+  +  ++ALAG+GIEVM+ 
Sbjct  21    GCGRVDGLGVNWGTLATHKLPPKTVVQMLKDNGIQKVKLFDADRKTMSALAGSGIEVMVA  80

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN  L  + +Y+ A+ +VK+NVT+YN T   GV +  V VGNEPFLK Y        T 
Sbjct  81    IPNDQLAVMGSYDRAQEWVKKNVTAYNFTG--GVNVKYVAVGNEPFLKSYNGS-FVNTTL  137

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+QKALNEAG+G TVKATVP NADVY SP   P+PSAG FR DI+D + +IV+ + 
Sbjct  138   PALQNIQKALNEAGLGDTVKATVPLNADVYESPEDNPLPSAGTFRSDISDVMTQIVKFMA  197

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
             +N APF +N+YPFLSL Y  + FP ++AFFDG   P+ D G  YTNVFDAN+DT V+AL 
Sbjct  198   ENNAPFTVNIYPFLSL-YGNNDFPFNYAFFDGA-TPIVDKGIEYTNVFDANFDTLVSALK  255

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                HG + +++GE+GWPT+GD  AN   A RFYNG    L   +GTP+RPG  I+VY+FG
Sbjct  256   AVGHGNMTIIIGEVGWPTEGDINANNGNAYRFYNGLFTKLGANRGTPLRPGY-IEVYLFG  314

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWG+  YDGQ KF +DL+G+ G+ K++   + +EY P+KWC   
Sbjct  315   LIDEDAKSVAPGNFERHWGLFRYDGQPKFLIDLTGR-GQNKLLIPAQNVEYQPQKWCTFN  373

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
             A AK ++ L  N ++AC  ADCT +  GSSCN L      SY FNAYFQ Q+Q  DSC+F
Sbjct  374   AGAKDVSKLVDNINFACTYADCTTLGYGSSCNSLDANGNASYAFNAYFQTQNQDPDSCNF  433

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL  VTTKN+S  SC F I +
Sbjct  434   QGLATVTTKNISQGSCNFTIQL  455



>ref|XP_004493147.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=477

 Score =   466 bits (1199),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 242/444 (55%), Positives = 308/444 (69%), Gaps = 9/444 (2%)
 Frame = +3

Query  171   GVAGL--DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             G+ GL  +GLGVNWG  ++H LPP+ VV+MLK NGI+KVKLF+     ++ALAG+GIEVM
Sbjct  14    GLMGLYVEGLGVNWGTQATHQLPPETVVQMLKDNGIQKVKLFDADDNTMSALAGSGIEVM  73

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  L  + +Y+ A+ +VK+NVT YN     GV I  V VGNEPFLK Y    L  +
Sbjct  74    VAIPNNQLAVMNDYKRAQQWVKKNVTRYNFHG--GVNIKYVAVGNEPFLKSYNNSFL-NI  130

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T PAL N+Q A+NEAG+G TVKATVP NADVY SP   P+PSAG FR DI+  + ++V+ 
Sbjct  131   TLPALQNIQNAINEAGLGDTVKATVPLNADVYQSPEDNPLPSAGTFRPDISGLMTEMVQF  190

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L+KN APF +N+YPFLSL Y  D FP ++AFFDGVD P+ DNG  YTNVFDAN+DT V+A
Sbjct  191   LNKNSAPFTVNIYPFLSL-YGNDDFPFNYAFFDGVDAPIMDNGIQYTNVFDANFDTLVSA  249

Query  885   LSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYM  1064
             L     G   ++VGE+GWPT+GD  ANA  A RFYNG +  LA  KGTP RPG  I+VY+
Sbjct  250   LKSVGFGDTPILVGEVGWPTEGDKNANAGNALRFYNGLLSRLAANKGTPRRPGF-IEVYL  308

Query  1065  FGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCA  1244
             FGL DED KS  PGNFE HWGI  YDGQ KF +DL+G+ G+ K + G + ++YL   WC 
Sbjct  309   FGLIDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLTGQ-GQNKFLIGAQNVKYLSPTWCM  367

Query  1245  LKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
             +  +AK L+ L  N ++AC   DCT +  GSSCN L      SY FN Y+Q Q+Q + +C
Sbjct  368   VNPDAKDLSKLADNLNFACAYGDCTALGYGSSCNNLDAIGNASYAFNMYYQVQNQNRQAC  427

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGI  1493
             +FQGL ++TT N+STP+C F I I
Sbjct  428   NFQGLAKLTTDNISTPTCNFTIQI  451



>gb|KHN00669.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=468

 Score =   466 bits (1198),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 244/444 (55%), Positives = 310/444 (70%), Gaps = 9/444 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             GV G  + GLGVNWG  ++H L    VV+MLK NGI+KVKLF+  +  ++AL+G+GIEVM
Sbjct  4     GVMGWCVAGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVM  63

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  L ++ +Y+ A  +VK+NVT YN     GV I  V VGNEPFLK Y    L  +
Sbjct  64    VAIPNNQLAEMNDYDRALQWVKKNVTRYNFRG--GVNIKYVAVGNEPFLKSYNGSFL-NI  120

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T PAL N+Q ALN+AG+G ++KATVP NADVY SPP +PVPSAG+FR DI+D + +IV+ 
Sbjct  121   TLPALQNIQNALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQF  180

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L KN APF +N+YPFLSL Y  D FP D+AFFDGV  P+ DNG +YTNVFDAN+DT V+A
Sbjct  181   LAKNKAPFTVNIYPFLSL-YGNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSA  239

Query  885   LSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYM  1064
             L +  +G + V+VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+VY+
Sbjct  240   LKKVGYGNMPVLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPGF-IEVYL  298

Query  1065  FGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCA  1244
             FGL DED K+  PGNFE HWGI GYDG+ KF +DLSGKG K K++ G + + YL   WC 
Sbjct  299   FGLIDEDAKNIAPGNFERHWGIFGYDGKPKFPMDLSGKGQK-KVLVGAQNVHYLEPNWCM  357

Query  1245  LKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
                +A+ L+ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q QDQ   +C
Sbjct  358   FNPDAQDLSKLADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMAC  417

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGI  1493
             +F+GL  +TT N+STP+C F + I
Sbjct  418   NFEGLARLTTSNISTPTCNFIVQI  441



>ref|XP_002463758.1| hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor]
 gb|EER90756.1| hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor]
Length=495

 Score =   466 bits (1200),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 302/442 (68%), Gaps = 12/442 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPLPPK V ++L+ NGIKKVKLF+  +  L+ALAGTGIEVM+  PN +
Sbjct  29    DALGMNWGTQATHPLPPKIVAQLLRDNGIKKVKLFDADQETLSALAGTGIEVMVAIPNVM  88

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +Y+ AK +V+ NV+ YN     GV I  V VGNEPFL  Y   G F KVT+PAL 
Sbjct  89    LDTMTDYDTAKEWVRRNVSRYNFDG--GVTIKYVAVGNEPFLAAYN--GTFDKVTFPALQ  144

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G T+KATVP NADVY+SP   PVPSAG +R DI D + ++V+ L  N A
Sbjct  145   NIQNALNEAGLGDTIKATVPLNADVYMSPKDNPVPSAGRWRTDITDLMTQMVQFLSNNSA  204

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSRE  896
             PF +N+YPF+SLF + D FPV+FAFFDG   PL D   G +YTNVFDAN+DT VAAL   
Sbjct  205   PFTVNIYPFISLFLN-DDFPVNFAFFDGDATPLVDPGTGVSYTNVFDANFDTLVAALKSV  263

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + +VVGE+GWPTDGD  A ++ A RFYNG +K LA   GTP RP   I+VY+FGL 
Sbjct  264   GHGDMPIVVGEVGWPTDGDKHATSAYAQRFYNGLLKRLAANAGTPARPNQYIEVYLFGLL  323

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGIL YDGQ K+ +DLSG+ G+  ++    G+EYLP+ WC +  N
Sbjct  324   DEDVKSVAPGNFERHWGILRYDGQPKYPMDLSGQ-GQNTMLVPASGVEYLPRTWCVVNTN  382

Query  1257  A---KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
             A    +  L  N +YAC  ADCT +  GS+C G+      SY FNA+FQ Q+Q  ++C F
Sbjct  383   AGSDAMEKLADNINYACTFADCTALGYGSTCGGMDSNGNASYAFNAFFQVQNQKDEACGF  442

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL   T  + ST +C F I I
Sbjct  443   QGLAVPTQTDPSTATCNFTIQI  464



>gb|AAQ90287.1| beta-1,3-glucanase, acidic [Coffea arabica]
Length=480

 Score =   466 bits (1198),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 242/443 (55%), Positives = 298/443 (67%), Gaps = 7/443 (2%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMI  347
             N V G++GLGVNWG  ++H LPPK VV+MLK NGI KVKLF+     ++ALAG+ IEVM+
Sbjct  20    NDVVGVEGLGVNWGTQATHKLPPKVVVQMLKDNGITKVKLFDADASTMSALAGSNIEVMV  79

Query  348   GTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVT  527
               PN  L  + +Y+ AK +VK NVT Y      GV I  V VGNEPFL  Y        T
Sbjct  80    AIPNDQLLVMNDYDRAKNWVKRNVTVY--LFNGGVNIKYVAVGNEPFLASYNNS-FVNTT  136

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
             +PAL N+Q ALN+AG G T+KATVP NADVY SP   PVPSAG FR DI+ Q+ +IV+ L
Sbjct  137   FPALQNIQNALNDAGHGDTIKATVPLNADVYFSPEGNPVPSAGRFRADISSQMTQIVQFL  196

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             ++N APF +N+YPFLSL Y    FPVD+AFFDG   P+ D+G  YTNVFDAN+D  V+AL
Sbjct  197   NQNNAPFTVNIYPFLSL-YLNSHFPVDYAFFDGAANPIVDDGVQYTNVFDANFDALVSAL  255

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
                 +G + ++VGE+GWPTDGD  AN + A RFY G +  LA  KGTP+RPG  I+VY+F
Sbjct  256   KGLGYGSMNILVGEVGWPTDGDRNANVNYAIRFYRGLLPRLAANKGTPLRPGY-IEVYLF  314

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
             GL DED KS  PGNFE HWGI  YDGQ KF +DLSG+  + K + G + ++Y P KWC  
Sbjct  315   GLLDEDLKSVAPGNFERHWGIFRYDGQPKFPMDLSGQ-LQDKYLVGAQNVQYFPAKWCQF  373

Query  1248  KANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
               NAK L+ L  N +YAC  ADCT +  GSSCNGL      SY FN YFQ Q+Q   SC+
Sbjct  374   NPNAKDLSKLVENINYACTFADCTALGYGSSCNGLDANGNASYAFNMYFQVQNQGDLSCN  433

Query  1425  FQGLGEVTTKNLSTPSCRFNIGI  1493
             FQGL  VT +N+S  +C F I I
Sbjct  434   FQGLAMVTEQNISQANCNFTIQI  456



>ref|XP_006574750.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=484

 Score =   466 bits (1198),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 244/444 (55%), Positives = 310/444 (70%), Gaps = 9/444 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             GV G  + GLGVNWG  ++H L    VV+MLK NGI+KVKLF+  +  ++AL+G+GIEVM
Sbjct  20    GVMGWCVAGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVM  79

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  L ++ +Y+ A  +VK+NVT YN     GV I  V VGNEPFLK Y    L  +
Sbjct  80    VAIPNNQLAEMNDYDRALQWVKKNVTRYNFRG--GVNIKYVAVGNEPFLKSYNGSFL-NI  136

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T PAL N+Q ALN+AG+G ++KATVP NADVY SPP +PVPSAG+FR DI+D + +IV+ 
Sbjct  137   TLPALQNIQNALNDAGLGDSIKATVPLNADVYESPPNSPVPSAGIFRPDISDLMTQIVQF  196

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L KN APF +N+YPFLSL Y  D FP D+AFFDGV  P+ DNG +YTNVFDAN+DT V+A
Sbjct  197   LAKNKAPFTVNIYPFLSL-YGNDNFPFDYAFFDGVANPIIDNGVSYTNVFDANFDTLVSA  255

Query  885   LSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYM  1064
             L +  +G + V+VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+VY+
Sbjct  256   LKKVGYGNMPVLVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAMNKGTPLRPGF-IEVYL  314

Query  1065  FGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCA  1244
             FGL DED K+  PGNFE HWGI GYDG+ KF +DLSGKG K K++ G + + YL   WC 
Sbjct  315   FGLIDEDAKNIAPGNFERHWGIFGYDGKPKFPMDLSGKGQK-KVLVGAQNVHYLEPNWCM  373

Query  1245  LKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
                +A+ L+ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q QDQ   +C
Sbjct  374   FNPDAQDLSKLADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMAC  433

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGI  1493
             +F+GL  +TT N+STP+C F + I
Sbjct  434   NFEGLARLTTSNISTPTCNFIVQI  457



>gb|KHN32753.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   465 bits (1196),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 238/439 (54%), Positives = 308/439 (70%), Gaps = 7/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H L    VV+MLK NGI+KVKLF+  +  ++AL+G+GIEVM+  PN 
Sbjct  8     VEGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  67

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ +Y+ A  +VK+NVT YN     G+ I  V VGNEPFLK Y    L  +T PAL 
Sbjct  68    QLAEMNDYDRALQWVKKNVTRYNFRG--GINIKYVAVGNEPFLKSYNGSFL-NITLPALQ  124

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SPP  PVPSAG+FR DI+D + +IV+ L KN A
Sbjct  125   NIQNALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNA  184

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP D+AFFDGV  P++DNG +YTNVFDAN+DT V+AL +  +
Sbjct  185   PFTVNIYPFLSL-YGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGY  243

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+VY+FGL DE
Sbjct  244   GNMPILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPGF-IEVYLFGLIDE  302

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D K+  PGNFE HWGI GYDG+ KF +DLSGK G+ K++ G + + YL   WC    +A+
Sbjct  303   DAKTIAPGNFERHWGIFGYDGKPKFPMDLSGK-GQNKLLVGAQNVHYLEPNWCMFNPDAQ  361

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q QDQ   +C+F+GL 
Sbjct  362   DLSKLADNINYACTFADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNYMACNFEGLA  421

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              +TT N+STP+C F + I 
Sbjct  422   RLTTSNISTPTCNFIVQIN  440



>ref|XP_006650710.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=493

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 304/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             + LG+NWG  +SHPLPPK V ++LK NG+KKVKLF+  +  L+ALAGTGIEVM+  PN +
Sbjct  33    EALGMNWGTQASHPLPPKVVAQLLKDNGVKKVKLFDADQDTLSALAGTGIEVMVAIPNVM  92

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +Y+ AK +V+ NV+ YN     GV I  V VGNEPFL  Y   G F KVT PAL 
Sbjct  93    LDSITDYDTAKEWVRRNVSRYNFDG--GVTIKYVAVGNEPFLAAYN--GTFDKVTLPALM  148

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SP    VPSAG FR DIAD + ++V+ L  N A
Sbjct  149   NIQNALNDAGLGDSIKATVPLNADVYNSPADQQVPSAGRFRADIADLMTQMVQFLANNSA  208

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPF+SL Y  D FPVDFAFFDG   P  DNG +YTNVFDAN+DT VAAL    H
Sbjct  209   PFTVNIYPFISL-YLNDNFPVDFAFFDGGATPGADNGISYTNVFDANFDTLVAALKAVGH  267

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A A+ A RFYNG ++ LA   GTP+RPG  I+VY+FGL DE
Sbjct  268   GDMPIIVGEVGWPTDGDKHATAAYAQRFYNGLLRRLAANAGTPLRPGQYIEVYLFGLLDE  327

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG+FE HWGIL +DGQ K+ +DL+G+ G+  ++   + ++YL + WC +  NAK
Sbjct  328   DAKSVAPGSFERHWGILRFDGQPKYPVDLTGQ-GQNTMLVPAKDVQYLSRTWCVVNTNAK  386

Query  1263  LTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              T+ L  N ++AC  ADCT +  GS+C G+      SY FNAYFQ Q+Q  ++CDFQGL 
Sbjct  387   DTSKLADNINFACTFADCTALGYGSTCAGMDANGNASYAFNAYFQVQNQKDEACDFQGLA  446

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + STP+C F + I
Sbjct  447   MPTQTDPSTPACNFTVQI  464



>gb|KDP39719.1| hypothetical protein JCGZ_02739 [Jatropha curcas]
Length=478

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 296/438 (68%), Gaps = 9/438 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG  ++H LPPK VV+MLK NGIKKVKLF+T    + ALAGTGIEVM+  PN  L
Sbjct  22    GLGVNWGTQATHKLPPKTVVQMLKDNGIKKVKLFDTEASTMRALAGTGIEVMVAIPNDQL  81

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
               + +Y+ AK FVK N++ YN     GV I  V VGNEPFL  Y        T+PAL N+
Sbjct  82    LAMNDYKRAKDFVKSNISIYNFNG--GVNIKYVAVGNEPFLTSYNGS-FINTTFPALQNI  138

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q ALNEAG+G ++KATVP NADVY SP     PSAG FR DI D + +IV+ L+KN APF
Sbjct  139   QNALNEAGVGDSIKATVPLNADVYNSPTGQSYPSAGRFRSDINDLMTQIVQFLNKNNAPF  198

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSREKH  902
              +N+YPFLSL Y  D FP+D+AFFDGV + + D  +G  YTNVFDAN+DT V+AL     
Sbjct  199   TVNIYPFLSL-YGNDNFPIDYAFFDGVSQTVVDVGSGIQYTNVFDANFDTLVSALKAVGF  257

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  A    A RFYNG +  LA  +GTP+RPG  I+VY+FGL DE
Sbjct  258   GDMTVIVGEVGWPTDGDKSATVDYAYRFYNGLLPRLASNRGTPLRPGF-IEVYLFGLLDE  316

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF LDLSG+ G+ K++ G + ++YLP KWC    NA+
Sbjct  317   DAKSIAPGNFERHWGIFKYDGQPKFALDLSGQ-GQNKLLIGAQNVQYLPSKWCTFNPNAQ  375

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N DYAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q   +CDFQGL 
Sbjct  376   DLSKLADNIDYACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVQNQDPMACDFQGLA  435

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VT  N+S   C F I I
Sbjct  436   TVTNVNISQGKCNFIIQI  453



>gb|KDO55074.1| hypothetical protein CISIN_1g048257mg [Citrus sinensis]
Length=510

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 247/446 (55%), Positives = 310/446 (70%), Gaps = 9/446 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             GV G  ++GLGVNWG ++SH LPPK  VK+LK NGI KVKLF+    +L+ALAGT IEVM
Sbjct  15    GVLGCRVNGLGVNWGTVASHQLPPKTTVKLLKDNGILKVKLFDADNTILDALAGTDIEVM  74

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +   N  LK + +++ AK +VK NVT Y  T+  GV I  V VGNEPFLK Y    +   
Sbjct  75    LAVSNQELKTMTDFDKAKEWVKANVTKY--TNKGGVNIKFVAVGNEPFLKAYNGSHI-NT  131

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+Q ALN+AG+G T+KATVPFNADVY SP   P PSAG FR DI   +K+IV+ 
Sbjct  132   TFPALKNIQNALNDAGVGDTIKATVPFNADVYDSPDKNPYPSAGKFRTDIFATMKEIVDF  191

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD-NGKTYTNVFDANYDTAVA  881
             L +N APF++N+YPFLSL Y  D FPVD+AFFDG    +D   G  YT+VFDANYDT V+
Sbjct  192   LAENKAPFIVNIYPFLSL-YGNDDFPVDYAFFDGGKSIVDSVTGNKYTDVFDANYDTCVS  250

Query  882   ALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVY  1061
             AL    HG + VVVGEIGWPTDGD  AN + A R+Y+G +  LA  KGTP+RPG+ I+VY
Sbjct  251   ALKAAGHGDMPVVVGEIGWPTDGDKMANTANAFRYYSGLLPKLAADKGTPLRPGSYIEVY  310

Query  1062  MFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWC  1241
             MF L+DED KS  PGNFE HWGI  YDGQ KF +D SGK G+ K + G + ++YLPKKWC
Sbjct  311   MFSLFDEDSKSIDPGNFEKHWGIFTYDGQPKFPMDFSGK-GENKTLVGAKDVKYLPKKWC  369

Query  1242  ALKANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDS  1418
              +  +A  T+ L     +AC ++DCT +  GSSCN L    KVSY FN Y+Q  +Q   +
Sbjct  370   TVNPDATDTSKLAEKMQFACNKSDCTSLGFGSSCNKLDGNGKVSYAFNMYYQMNNQDDRA  429

Query  1419  CDFQGLGEVTTKNLSTPSCRFNIGIK  1496
             CDFQGLG+VTT+N+S  +C F I ++
Sbjct  430   CDFQGLGKVTTENISQGTCNFLIQLE  455



>gb|ACG29689.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=485

 Score =   464 bits (1194),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 298/441 (68%), Gaps = 8/441 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG  ++HPLPPKAVV++L+ NGIKKVKLF+     + ALAGTGIEVM+  PNA+L 
Sbjct  21    LGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAMLA  80

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L  +   A+ +VK NV  Y+     GV I  V VGNEPFL+ Y       VT PAL N+
Sbjct  81    GLAADAGQARDWVKRNVRRYDFDG--GVTIKYVAVGNEPFLESYNGS-FINVTLPALQNV  137

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q ALN+AGIG  +KATVP NADVY SP   PVPSAG FR DIA  +  +V  L +NGAPF
Sbjct  138   QNALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPF  197

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y  + FP+D+AFFDG   P+DD+G  YTNVFDAN+DT VAAL    HG 
Sbjct  198   TVNIYPFLSL-YLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGD  256

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGAD-IDVYMFGLYDED  1085
             + VVVGE+GWPTDGD  A AS A RFY G ++ LA   GTP RPG    +VY+FGL DED
Sbjct  257   MPVVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANAGTPARPGQRPAEVYLFGLVDED  316

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWG+L YDGQ KF +DL+G+ G+   +    G+ YL + WCAL   AK 
Sbjct  317   AKSVAPGNFERHWGVLRYDGQPKFAMDLTGQ-GRDTTLVPARGVAYLSRTWCALNPRAKD  375

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L  L AN DYAC  ADCTP+  GS+C G+      SY FNAY+QAQ+Q  ++CDFQGL  
Sbjct  376   LGRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLAL  435

Query  1443  VTTKNLSTPSCRFNIGIKLGA  1505
              T  + ST +C F I I+ GA
Sbjct  436   PTETDPSTATCNFTIQIQTGA  456



>ref|XP_006297581.1| hypothetical protein CARUB_v10013602mg [Capsella rubella]
 gb|EOA30479.1| hypothetical protein CARUB_v10013602mg [Capsella rubella]
Length=477

 Score =   464 bits (1193),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 304/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK VV+MLK N IKKVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  18    VDGLGVNWGTMATHKLPPKTVVQMLKDNNIKKVKLFDADETTMGALAGSGLEVMVAIPND  77

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  78    QLKVMGSYDRAKEWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  134

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  VKATVP NADVY SPP  PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  135   NIQNALNEAGVGNGVKATVPLNADVYDSPPSNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  194

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG   P+DD+G  YTNVFDAN+DT V++L    H
Sbjct  195   PITINIYPFLSL-YGNDDFPLNYAFFDGA-TPVDDHGIAYTNVFDANFDTLVSSLKAVGH  252

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN+  A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  253   GDMPIIVGEVGWPTEGDKHANSGDAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  311

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K++ G + + YL  KWC     AK
Sbjct  312   DAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQ-GQNKMLIGAQNVSYLSNKWCMFNPAAK  370

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN D+AC  +DCT +  GSSCNGL      SY FN YFQ ++Q + +C+FQGL 
Sbjct  371   DLTKLAANIDFACTFSDCTALGYGSSCNGLDAAGNASYAFNMYFQVKNQDEMACNFQGLA  430

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  431   TITTQNISQGQCNFPIQI  448



>ref|NP_001130924.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF79312.1| unknown [Zea mays]
 gb|ACG29657.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 tpg|DAA42581.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=486

 Score =   464 bits (1193),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 298/441 (68%), Gaps = 8/441 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG  ++HPLPPKAVV++L+ NGIKKVKLF+     + ALAGTGIEVM+  PNA+L 
Sbjct  22    LGVNWGTQATHPLPPKAVVQVLRDNGIKKVKLFDADPAAMRALAGTGIEVMVAIPNAMLA  81

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L  +   A+ +VK NV  Y+     GV I  V VGNEPFL+ Y       VT PAL N+
Sbjct  82    GLAADAGQARNWVKHNVRRYDFDG--GVTIKYVAVGNEPFLESYNGS-FINVTLPALKNV  138

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q ALN+AGIG  +KATVP NADVY SP   PVPSAG FR DIA  +  +V  L +NGAPF
Sbjct  139   QNALNDAGIGDRIKATVPLNADVYNSPRSNPVPSAGRFRADIAGLMADMVRFLARNGAPF  198

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y  + FP+D+AFFDG   P+DD+G  YTNVFDAN+DT VAAL    HG 
Sbjct  199   TVNIYPFLSL-YLNEHFPLDYAFFDGGAAPVDDHGVLYTNVFDANFDTLVAALGAVGHGD  257

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGAD-IDVYMFGLYDED  1085
             + VVVGE+GWPTDGD  A AS A RFY G ++ LA   GTP RPG    +VY+FGL DED
Sbjct  258   MPVVVGEVGWPTDGDRHAKASYAQRFYAGLLRRLAANTGTPARPGQRPAEVYLFGLVDED  317

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWG+L YDGQ KF +DL+G+ G+   +    G+ YL + WCAL   AK 
Sbjct  318   AKSVAPGNFERHWGVLRYDGQPKFAMDLTGQ-GRDTTLVPARGVAYLSRTWCALNPRAKD  376

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L  L AN DYAC  ADCTP+  GS+C G+      SY FNAY+QAQ+Q  ++CDFQGL  
Sbjct  377   LGRLGANVDYACTFADCTPLGYGSTCGGMDVAGNASYAFNAYYQAQNQKDEACDFQGLAL  436

Query  1443  VTTKNLSTPSCRFNIGIKLGA  1505
              T  + ST +C F I I+ GA
Sbjct  437   PTETDPSTATCNFTIQIQTGA  457



>emb|CDY03359.1| BnaC09g09890D [Brassica napus]
Length=477

 Score =   463 bits (1192),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 304/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  22    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V +NVT YN +   GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYDRAKDWVHKNVTRYNFSG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASDPVPSAGRFRPDILGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P+DD+G +YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPINYAFFDGA-QPIDDHGVSYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN   A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+  +DGQ KF LDLSG+ G+ K++ G   + YLP KWC    NAK
Sbjct  316   DAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQ-GQNKLLIGARNVTYLPNKWCMFNPNAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L  N D+AC  +DCT +  GSSCNGL      SY FN YFQ ++Q +++C FQGL 
Sbjct  375   DLTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VTT+N+S   C F + I
Sbjct  435   TVTTQNISQGQCDFPVQI  452



>ref|XP_009112609.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112611.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
 ref|XP_009112614.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=478

 Score =   462 bits (1190),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 304/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  23    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  83    QLKVMGSYDRAKDWVRKNVTRYNFNG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  140   NIQNALNEAGLGNSIKATVPLNADVYDSPVSDPVPSAGRFRPDILGQMTQIVDFLGKNNA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P+DD+G +YTNVFDAN+DT V++L    H
Sbjct  200   PITINIYPFLSL-YGNDDFPINYAFFDGA-QPIDDHGVSYTNVFDANFDTLVSSLKAVGH  257

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN   A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  258   GDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  316

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+  +DGQ KF LDLSG+ G+ K++ G   + YLP KWC    NAK
Sbjct  317   DAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQ-GQNKLLIGARNVTYLPNKWCMFNPNAK  375

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L  N D+AC  +DCT +  GSSCNGL      SY FN YFQ ++Q +++C FQGL 
Sbjct  376   DLTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLA  435

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VTT+N+S   C F + I
Sbjct  436   TVTTQNISQGQCDFPVQI  453



>ref|XP_007030700.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY11202.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=479

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 302/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+M+K NGIKKVKLF+     ++ALAG+ +EVM+  PN 
Sbjct  24    VNGLGVNWGTMATHKLPPKTVVQMIKDNGIKKVKLFDADSNTMSALAGSDLEVMVAIPND  83

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y       +T+PAL 
Sbjct  84    QLLAMNSYDRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTTYNGS-FVNITFPALQ  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SP   PVPSAG FR DI+  + +IV+ L KN A
Sbjct  141   NIQNALNDAGVGDSIKATVPLNADVYNSPDSNPVPSAGRFRSDISGIMTQIVDFLSKNSA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP ++AFFDG   P+ DNG  YTNVFDAN+DT V+AL    H
Sbjct  201   PFTVNIYPFLSL-YGNDDFPFNYAFFDG-GTPITDNGIQYTNVFDANFDTLVSALKAVGH  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN + A RFYNG +  LA   GTP+RPG  I+VY+FGL DE
Sbjct  259   GDMTIIVGEVGWPTDGDKNANVANAQRFYNGLMPRLAANTGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF LDLSG+  + + + G + +EYLP+KWC    NAK
Sbjct  318   DAKSIAPGNFERHWGIYRYDGQPKFPLDLSGQ-NQNRFLIGAQNVEYLPQKWCTFNPNAK  376

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC  +DCT +  GSSCN L      S+ FN Y+Q Q+Q   +C+FQGLG
Sbjct  377   DLSKLADNINYACTFSDCTALGYGSSCNNLDANGNASFAFNMYYQVQNQNDMACNFQGLG  436

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VTT+NLS  +C F I I
Sbjct  437   TVTTQNLSQGTCNFIIQI  454



>ref|XP_006443394.1| hypothetical protein CICLE_v10023781mg [Citrus clementina]
 ref|XP_006479327.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
 gb|ESR56634.1| hypothetical protein CICLE_v10023781mg [Citrus clementina]
Length=510

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 246/446 (55%), Positives = 310/446 (70%), Gaps = 9/446 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             GV G  ++GLGVNWG ++SH LPPK  VK+LK NGI KVKLF+    +L+ALAGT IEVM
Sbjct  15    GVLGCRVNGLGVNWGTVASHQLPPKTTVKLLKDNGILKVKLFDADNTILDALAGTDIEVM  74

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +   N  LK + +++ AK +VK NVT Y  T+  GV I  V VGNEPFLK Y    +   
Sbjct  75    LAVSNQELKTMTDFDKAKEWVKANVTKY--TNKGGVNIKFVAVGNEPFLKAYNGSHI-NT  131

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+Q ALN+AG+G T+KATVPFNADVY SP   P PSAG FR DI   +++IV+ 
Sbjct  132   TFPALKNIQNALNDAGVGDTIKATVPFNADVYDSPDKNPDPSAGKFRPDIFATIQEIVDF  191

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD-NGKTYTNVFDANYDTAVA  881
             L +N APF++N+YPFLSL Y  D FPVD+AFFDG    +D   G  YT+VFDANYDT V+
Sbjct  192   LAENKAPFIVNIYPFLSL-YGNDDFPVDYAFFDGGKSIVDSVTGNKYTDVFDANYDTCVS  250

Query  882   ALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVY  1061
             AL    HG + VVVGEIGWPTDGD  AN + A R+Y+G +  LA  KGTP+RPG+ I+VY
Sbjct  251   ALKAAGHGDMPVVVGEIGWPTDGDKMANTANAFRYYSGLLPKLAADKGTPLRPGSYIEVY  310

Query  1062  MFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWC  1241
             MF L+DED KS  PGNFE HWGI  YDGQ KF +D SGK G+ K + G + ++YLPKKWC
Sbjct  311   MFSLFDEDSKSIDPGNFEKHWGIFTYDGQPKFPMDFSGK-GENKTLVGAKDVKYLPKKWC  369

Query  1242  ALKANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDS  1418
              +  +A  T+ L     +AC ++DCT +  GSSCN L    KVSY FN Y+Q  +Q   +
Sbjct  370   TVNPDATDTSKLAEKMQFACNKSDCTSLGFGSSCNKLDGNGKVSYAFNMYYQMNNQDDRA  429

Query  1419  CDFQGLGEVTTKNLSTPSCRFNIGIK  1496
             CDFQGLG+VTT+N+S  +C F I ++
Sbjct  430   CDFQGLGKVTTENISQGTCNFLIQLE  455



>ref|XP_010276412.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=477

 Score =   461 bits (1187),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 303/445 (68%), Gaps = 9/445 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPP  VV+MLK NGIKKVKLF+  +  ++ALAGT IEVM+  PN 
Sbjct  20    IEGLGVNWGTMATHKLPPDTVVQMLKDNGIKKVKLFDADQSTMSALAGTEIEVMVAIPND  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +VK NVT Y      GV I  V VGNEPFL+ Y    L  +T PAL 
Sbjct  80    QLAVMNDYDRAKDWVKRNVTRY--IFNGGVNIKYVAVGNEPFLQSYNNSFL-NITLPALQ  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG G ++KATVP NADVY SP   PVPSAG FR DI+D + +IV+ L+KN A
Sbjct  137   NIQNALNEAGHGDSIKATVPLNADVYNSPVSNPVPSAGRFRTDISDLMTQIVQFLNKNNA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y+   FPVDFAFFDG   P  D  NG  Y+NVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSL-YADQNFPVDFAFFDGTANPTTDTGNGIQYSNVFDANFDTLVSALKSV  255

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
               G + ++VGE+GWPTDGD  AN ++A RFYNG +  LA  KGTP+RPG  ++VY+FGL 
Sbjct  256   GFGDMPILVGEVGWPTDGDKNANVALAQRFYNGLLPRLAANKGTPLRPGY-LEVYLFGLI  314

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI  YDGQ KF LD+SG+ G+  ++   + ++YLP++WC    N
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFLLDISGQ-GQNTLLVAAKNVQYLPQRWCVFNPN  373

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK L+ L  N +YAC  +DCT +   SSC  L      SY FN YFQAQ+Q   SC+F+G
Sbjct  374   AKDLSKLADNINYACTFSDCTTLGYQSSCGNLDTQGNASYAFNMYFQAQNQQDMSCNFEG  433

Query  1434  LGEVTTKNLSTPSCRFNIGIKLGAE  1508
             L  VTT+N S  +C F I I L + 
Sbjct  434   LAMVTTQNASQGNCNFTIQIALSSS  458



>ref|NP_176656.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 ref|NP_001031232.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|Q6NKW9.2|E138_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 8; AltName: Full=(1->3)-beta-glucan 
endohydrolase 8; Short=(1->3)-beta-glucanase 
8; AltName: Full=Beta-1,3-endoglucanase 8; Short=Beta-1,3-glucanase 
8; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD43273.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44619.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34283.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEE34284.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=481

 Score =   461 bits (1187),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 303/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PALA
Sbjct  82    QLKVMTSYDRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALA  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG + P++DNG  YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPLNYAFFDGAE-PINDNGIDYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  ANA  A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K + G + + YLP KWC     AK
Sbjct  316   DAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQ-GQSKFLIGAQNVPYLPNKWCTFNPEAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN DYAC  +DCT +  GSSCN L      SY FN +FQ ++Q + +C FQGL 
Sbjct  375   DLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  435   TITTQNISQGQCNFPIQI  452



>ref|XP_004288531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   462 bits (1188),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 9/441 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G++GLGVNWG +++H LPP  VV++LK NGI+KVKLF+  +  ++ALAGT IEVM+  PN
Sbjct  25    GVEGLGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPN  84

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
               L+ + +Y  AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  +T+PAL
Sbjct  85    DQLQAMTSYPRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NITFPAL  141

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G T+KATVP NADVY SP   PVPSAG FR DI+  + +IV+ LDKN 
Sbjct  142   QNIQNALNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNK  201

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSR  893
             APF IN+YPFLSL Y  D FP ++AFFDG   P+ D   G  YTNVFDAN+DT V++L  
Sbjct  202   APFTINIYPFLSL-YGNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKA  260

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
               +G + +VVGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I++Y+FGL
Sbjct  261   VGYGDMAIVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPGF-IEIYLFGL  319

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PG+FE HWGI  YDGQ KF +D+SG+ G+ K++ G + ++YL KKWC    
Sbjct  320   IDEDAKSIAPGSFERHWGIFSYDGQPKFPIDVSGQ-GQNKLLMGAKNVQYLEKKWCMFNP  378

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F+
Sbjct  379   NAKDLSKLADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFE  438

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VTT+N+S  +C F I I
Sbjct  439   GLATVTTQNISQGTCNFIIQI  459



>ref|XP_004249143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=479

 Score =   461 bits (1187),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/436 (54%), Positives = 299/436 (69%), Gaps = 7/436 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G GVNWG +++H L PK +V+ML+ NGIKKVKLF+  K  ++ALAGT IEVM+  PN 
Sbjct  23    VEGFGVNWGTMATHMLEPKILVQMLRDNGIKKVKLFDADKSTMDALAGTDIEVMVAIPND  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + + + AK +V+ NVT YN    +GV I  V VGNEPFL  Y       +T+PAL 
Sbjct  83    QLLTMTDIDRAKDWVRRNVTRYN--FKNGVNIKYVAVGNEPFLTSYNNS-FVNLTFPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DIA+ + +IV+ + KN A
Sbjct  140   NIQNALNEAGVGDSIKATVPLNADVYFSPESNPVPSAGRFRTDIAELMTQIVQFMSKNQA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y+ + FP+DFAFFDG   P+ DNG  YTNVFDAN+DT  +AL    +
Sbjct  200   PFTVNIYPFLSL-YANEHFPMDFAFFDGTPNPVLDNGVEYTNVFDANFDTLYSALKAVGY  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN + A RFY G    LA  +GTP+RPG  I+VY+FGL DE
Sbjct  259   GHMAILVGEVGWPTDGDKNANLNNAYRFYKGLFAKLASNRGTPLRPGY-IEVYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF +D+SG+ G+ K +   + ++YLP +WC L  NAK
Sbjct  318   DAKSIAPGNFERHWGIFRYDGQPKFPMDISGQ-GQDKHLVAAKNVQYLPNRWCMLNPNAK  376

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N DYAC  +DCT +  GSSCN L      SY FN Y+Q Q+Q   SCDF+GL 
Sbjct  377   DLSKLANNIDYACTFSDCTSLGFGSSCNNLDAIGNASYAFNMYYQVQNQLDLSCDFEGLA  436

Query  1440  EVTTKNLSTPSCRFNI  1487
              VT KNLS  +C F I
Sbjct  437   MVTNKNLSQGTCNFII  452



>ref|XP_004288532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=474

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 9/441 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G++GLGVNWG +++H LPP  VV++LK NGI+KVKLF+  +  ++ALAGT IEVM+  PN
Sbjct  25    GVEGLGVNWGTMATHKLPPDTVVQLLKDNGIQKVKLFDAEQSTMSALAGTSIEVMVAIPN  84

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
               L+ + +Y  AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  +T+PAL
Sbjct  85    DQLQAMTSYPRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NITFPAL  141

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G T+KATVP NADVY SP   PVPSAG FR DI+  + +IV+ LDKN 
Sbjct  142   QNIQNALNEAGVGDTIKATVPLNADVYNSPETNPVPSAGTFRSDISQLMTEIVQFLDKNK  201

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSR  893
             APF IN+YPFLSL Y  D FP ++AFFDG   P+ D   G  YTNVFDAN+DT V++L  
Sbjct  202   APFTINIYPFLSL-YGNDDFPFNYAFFDGDATPIVDATTGIQYTNVFDANFDTLVSSLKA  260

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
               +G + +VVGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I++Y+FGL
Sbjct  261   VGYGDMAIVVGEVGWPTDGDKNANVGNAYRFYNGLLARLAANKGTPLRPGF-IEIYLFGL  319

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PG+FE HWGI  YDGQ KF +D+SG+ G+ K++ G + ++YL KKWC    
Sbjct  320   IDEDAKSIAPGSFERHWGIFSYDGQPKFPIDVSGQ-GQNKLLMGAKNVQYLEKKWCMFNP  378

Query  1254  NAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NAK L+ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F+
Sbjct  379   NAKDLSKLADNINYACTFADCTALEYGSSCNILDANGNASYAFNMYYQVQNQDDLSCNFE  438

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VTT+N+S  +C F I I
Sbjct  439   GLATVTTQNISQGTCNFIIQI  459



>gb|AAS99718.1| At1g64760 [Arabidopsis thaliana]
 dbj|BAD95084.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=481

 Score =   461 bits (1187),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 302/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK  V++NVT YN     GV IT V VGNEPFLK Y       +T+PALA
Sbjct  82    QLKVMTSYDRAKDLVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALA  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG + P++DNG  YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPLNYAFFDGAE-PINDNGIDYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  ANA  A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K + G + + YLP KWC     AK
Sbjct  316   DAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQ-GQSKFLIGAQHVPYLPNKWCTFNPEAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN DYAC  +DCT +  GSSCN L      SY FN +FQ ++Q + +C FQGL 
Sbjct  375   DLTKLAANIDYACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  435   TITTQNISQGQCNFPIQI  452



>ref|XP_007151834.1| hypothetical protein PHAVU_004G079100g [Phaseolus vulgaris]
 gb|ESW23828.1| hypothetical protein PHAVU_004G079100g [Phaseolus vulgaris]
Length=479

 Score =   461 bits (1185),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 239/442 (54%), Positives = 306/442 (69%), Gaps = 7/442 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G  G++GLGVNWG  ++H L    VV+MLK NGI+KVKLF+  +  ++AL+G+GIE M+ 
Sbjct  18    GWWGVEGLGVNWGTQATHQLRADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIETMVA  77

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN  L ++ +Y+ A  +VK+NVTSYN     GV I  V VGNEPFL+ Y      KVT+
Sbjct  78    IPNNQLSEMNDYDRAMQWVKKNVTSYNFRG--GVNIKYVAVGNEPFLRSYNGS-FMKVTF  134

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q ALNE G+G ++KATVP NADVY SP   PVPSAGMFR DI++ + +IV+ L 
Sbjct  135   PALQNIQNALNEVGVGDSIKATVPLNADVYESPINNPVPSAGMFRPDISELMIQIVQFLA  194

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
             KN APF +N+YPFLSL Y  D FP D+AFFDGV  P++DNG +YTNVFDAN+DT V+AL 
Sbjct  195   KNNAPFTVNIYPFLSL-YGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALQ  253

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
             +  +G + ++VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP++P   I+VY+FG
Sbjct  254   KVGYGDMPILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLALNKGTPLKPKY-IEVYLFG  312

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWGI  YDG+ KF +DLSGKG K K++ G + + YL  KWC   
Sbjct  313   LIDEDAKSIDPGNFERHWGIFKYDGKPKFPMDLSGKGPK-KLLVGAQNVHYLDPKWCMFN  371

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                + ++ L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q QDQ   +C+F
Sbjct  372   PETQDISKLADNINYACTLADCTALGYGSSCNNLDANGNASYAFNMYYQTQDQNDLACNF  431

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  +TT N+STPSC F + I
Sbjct  432   EGLARLTTTNISTPSCNFILQI  453



>ref|XP_010257709.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=475

 Score =   460 bits (1184),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 238/443 (54%), Positives = 302/443 (68%), Gaps = 7/443 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G   ++GLGVNWG +++H LPP  VV+M+K NGIKKVKLF+  +  ++ALAGT IEVM+ 
Sbjct  16    GSIAVEGLGVNWGTMATHKLPPNTVVQMMKDNGIKKVKLFDADQNTMSALAGTEIEVMVA  75

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN  L  + +Y  AK +VK N+T Y      GV I  V VGNEPFL  Y    L  VT+
Sbjct  76    IPNDQLAVMNDYGRAKDWVKRNITRY--LFNGGVNIKYVAVGNEPFLASYNNSFL-NVTF  132

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q ALNEAG G ++KATVP NADVY SP    VPSAG FR DI+D + +IV+ L+
Sbjct  133   PALQNIQDALNEAGHGDSIKATVPLNADVYNSPSDNSVPSAGRFRSDISDLMTQIVQFLN  192

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
             KN APF +N+YPFLSL Y+ + FP+DFAFFDG   PL DNG  Y NVFDAN+DT V+AL 
Sbjct  193   KNNAPFTVNIYPFLSL-YANENFPLDFAFFDGTPNPLLDNGIQYNNVFDANFDTLVSALK  251

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                 G++ ++VGE+GWPTDGD  AN  +A RFYNG +  LA  KGTP+RPG  ++VY+FG
Sbjct  252   AVGFGEMPILVGEVGWPTDGDKNANVGLAQRFYNGLLPRLAANKGTPLRPGY-LEVYLFG  310

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWGI  YDGQ K+ +DLSG+ G+   +   + ++YLP++WC L 
Sbjct  311   LIDEDAKSIAPGNFERHWGIFRYDGQPKYQMDLSGQ-GQNTFLVAAKNVKYLPQRWCVLN  369

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              NA+ L+ L  N ++AC  +DCT +  GSSC  L      SY FN Y+QAQ+Q   SC+F
Sbjct  370   PNAEDLSKLGENINFACTHSDCTALGYGSSCGNLDTQGNASYAFNMYYQAQNQQDLSCNF  429

Query  1428  QGLGEVTTKNLSTPSCRFNIGIK  1496
             QGL  VTT+N S  +C F I I 
Sbjct  430   QGLAMVTTQNASQGNCNFTIQIS  452



>ref|XP_002525445.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36935.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=480

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 297/438 (68%), Gaps = 9/438 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG  ++H LPPK VV+MLK NGI+KVKLF++ +  + ALAG+G+EVM+  PN  L
Sbjct  22    GLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDSDRNTMTALAGSGLEVMVAIPNDQL  81

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
               + +Y+ AK +VK NV+ YN     GV I  V VGNEPFL  Y       +T+PAL N+
Sbjct  82    AAMNDYDRAKDWVKRNVSIYNFNG--GVNIKYVAVGNEPFLTSYNGS-FINITFPALQNI  138

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q ALNEAG+G +VKATVP NADVY SP   P PSAG FR DI D +  IV+ L KN APF
Sbjct  139   QNALNEAGVGDSVKATVPLNADVYNSPTDQPYPSAGRFRIDINDIMTNIVQFLHKNNAPF  198

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSREKH  902
              +N+YPFLSL Y  D FP D+AFFDG  +P+ D G    YTNVFDAN+DT V+AL     
Sbjct  199   TVNIYPFLSL-YGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAVGF  257

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A    A RFYNG +  LAG +GTP+RPG  I+VY+FGL DE
Sbjct  258   GDMPIIVGEVGWPTDGDKNAKVDYAYRFYNGLLPRLAGNRGTPLRPGF-IEVYLFGLLDE  316

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF LDLSG+ G+ K++ G + ++Y P KWC    NAK
Sbjct  317   DAKSIAPGNFERHWGIFRYDGQPKFALDLSGQ-GQNKLLVGAQNVQYQPSKWCMFNPNAK  375

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N DYAC  +DCT +  GSSCNGL      SY FN Y+Q Q Q   +C+FQGL 
Sbjct  376   DLSKLADNIDYACTFSDCTALGYGSSCNGLDSNGNASYAFNMYYQVQKQDDMACNFQGLA  435

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VTT+NLS  +C F I I
Sbjct  436   MVTTQNLSQGTCNFIIQI  453



>emb|CDY48710.1| BnaA09g09850D [Brassica napus]
Length=477

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 302/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALA +G+EVM+  PN 
Sbjct  22    VDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALASSGLEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYDRAKDWVRKNVTRYNFNG--GVNITFVAVGNEPFLKSYNGT-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G TVKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNTVKATVPLNADVYDSPVSDPVPSAGRFRPDILGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P+DD+G +YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPINYAFFDGA-QPIDDHGVSYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN   A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANNGEAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+  +DGQ KF LDLSG+ G+  ++ G   + YLP KWC    NAK
Sbjct  316   DAKSIAPGAFERHWGLFRFDGQPKFPLDLSGQ-GQNTLLIGARNVTYLPNKWCMFNPNAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L  N D+AC  +DCT +  GSSCNGL      SY FN YFQ ++Q +++C FQGL 
Sbjct  375   DLTKLAQNIDFACTFSDCTALGYGSSCNGLDANGNASYAFNMYFQVKNQDEEACIFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              VTT+N+S   C F + I
Sbjct  435   TVTTQNISQGQCDFPVQI  452



>ref|XP_006599436.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=483

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/439 (54%), Positives = 307/439 (70%), Gaps = 7/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H L    VV+MLK NGI+KVKLF+  +  ++AL+G+GIEVM+  PN 
Sbjct  25    VEGLGVNWGTQATHQLKADTVVEMLKDNGIQKVKLFDADESSMSALSGSGIEVMVAIPNN  84

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ +Y+ A  +VK+NVT YN     G+ I  V VGNEPFLK Y    L  +T PAL 
Sbjct  85    QLAEMNDYDRALQWVKKNVTRYNFRG--GINIKYVAVGNEPFLKSYNGSFL-NITLPALQ  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SPP  PVPSAG+FR DI+D + +IV+ L KN A
Sbjct  142   NIQNALNDAGLGDSIKATVPLNADVYESPPNNPVPSAGIFRPDISDLMTQIVQFLAKNNA  201

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP D+AFFDGV  P++DNG +YTNVFDAN+DT V+AL +  +
Sbjct  202   PFTVNIYPFLSL-YGNDNFPFDYAFFDGVANPINDNGVSYTNVFDANFDTLVSALEKVGY  260

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+VY+FGL DE
Sbjct  261   GNMPILVGEVGWPTDGDKNANVGNAFRFYNGLLPRLAINKGTPLRPGF-IEVYLFGLIDE  319

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D K+  PGNFE HWGI GYDG+ KF +DLSGK G+ K++ G + + YL   WC    +A+
Sbjct  320   DAKTIAPGNFERHWGIFGYDGKPKFPMDLSGK-GQNKLLVGAQNVHYLEPNWCMFNPDAQ  378

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+ L  N +YAC  ADCT +  GSS N L      SY FN Y+Q QDQ   +C+F+GL 
Sbjct  379   DLSKLADNINYACTFADCTAIGYGSSGNNLDANGNASYAFNMYYQTQDQNYMACNFEGLA  438

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              +TT N+STP+C F + I 
Sbjct  439   RLTTSNISTPTCNFIVQIN  457



>ref|XP_002888279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64538.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   459 bits (1181),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 303/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y+ AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMTSYDRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALT  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P++DNG  YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPLNYAFFDGA-QPINDNGIDYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN+  A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K++ G + + YLP KWC     AK
Sbjct  316   DAKSIAPGPFERHWGIFKFDGQPKFPIDLSGQ-GQNKLLIGAQNVPYLPNKWCTFNPEAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN D+AC  +DCT +  GSSCN L      SY FN YFQ ++Q + +C FQGL 
Sbjct  375   DLTKLAANIDFACTFSDCTALGYGSSCNTLDANGNASYAFNMYFQVKNQDESACFFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  435   TITTQNISQGQCNFPIQI  452



>ref|XP_011034355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Populus euphratica]
Length=479

 Score =   459 bits (1181),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 240/440 (55%), Positives = 298/440 (68%), Gaps = 9/440 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + GLGVNWG ++   LPP+ VV+MLK NGI+KVKLF+  +  +N+LAGTGIEVM+  PN 
Sbjct  20    VHGLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPND  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y  AK +VK NVT YN     GV I  V VGNEPFL  Y    L   T+PAL 
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYNFNG--GVTIKYVAVGNEPFLSSYNGSFL-NTTFPALR  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SP     PS+G FR DI D + +IV+ L +NGA
Sbjct  137   NIQNALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y  D FP D+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSL-YGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAA  255

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + +VVGE+GWPTDGD  AN   A RFYNG I  L G +GTP+RPG  I+VY+FGL 
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANTGYAIRFYNGLIPRLVGNRGTPLRPGY-IEVYLFGLL  314

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI  YDGQ KF LDLSG+  + K + G   ++YLP KWC    N
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFPLDLSGQ-NQNKFLAGARNVQYLPAKWCMFNPN  373

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK L+ L  N DYAC R+DCT +  GSSCN L      SY FN Y+Q Q+Q + +C+F+G
Sbjct  374   AKDLSKLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEG  433

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +T++N+S  +C F I I
Sbjct  434   LATITSQNISQGNCNFIIQI  453



>ref|XP_009353157.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=478

 Score =   459 bits (1180),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 304/442 (69%), Gaps = 9/442 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             +G++GLGVNWG +++H LPP+ VV+MLK NGI+KVKLF+  +  ++ALAG+G+EVM+  P
Sbjct  18    SGVEGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIP  77

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  L  + +Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT PA
Sbjct  78    NDQLAVMTSYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTLPA  134

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI   + +IV+ LDKN
Sbjct  135   LQNIQNALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKN  194

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALS  890
              APF IN+YPFLSL Y  D FP ++AFFDG   P+ D G    YTNVFDAN+DT V++L 
Sbjct  195   QAPFTINIYPFLSL-YGNDDFPFNYAFFDGDTNPIVDTGTGIQYTNVFDANFDTLVSSLK  253

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                 G + +VVGE+GWPTDGD  ANA  A RFYNG +  L   +GTP+RPG  I+VY+FG
Sbjct  254   AVGFGNMPIVVGEVGWPTDGDKNANAGNALRFYNGLLTRLGTNRGTPLRPGY-IEVYLFG  312

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PG+FE HWGI GYDGQ KF +DLSG+ G+ K++   + ++YL KKWC   
Sbjct  313   LIDEDAKSIAPGSFERHWGIFGYDGQPKFPVDLSGQ-GQNKLLVPAKNVQYLSKKWCMFN  371

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              NAK ++ L  N +YAC  +DCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F
Sbjct  372   PNAKDVSKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNF  431

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL  +TT+N+S  +C F I I
Sbjct  432   QGLATLTTQNISQGNCNFIIQI  453



>ref|XP_003559620.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=492

 Score =   459 bits (1180),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 235/440 (53%), Positives = 304/440 (69%), Gaps = 10/440 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG ++SH LPP +VV+ML+ NGIKKVKLF+     L ALAG+GIEVM+  PN +L 
Sbjct  30    LGVNWGTMASHQLPPSSVVRMLQDNGIKKVKLFDADAGPLEALAGSGIEVMVAIPNIMLD  89

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y+ A+ +V +NV++YN     GV I  V VGNEPFL          VT+PAL N+Q
Sbjct  90    MMTDYDTARDWVHKNVSAYN--FDGGVNIKYVAVGNEPFLSSLNGT-FLNVTFPALQNIQ  146

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             +ALNEAG+G TVKATVP NADVY SP   PVPSAG FR +I+  + +IV+ L+++GAPF 
Sbjct  147   RALNEAGVGDTVKATVPLNADVYESPKDNPVPSAGRFRAEISGLMTEIVQFLNQSGAPFT  206

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSREKHg  905
             +N+YP+LSL Y    FP+DFAFFDG   P+ D  +G +YTNVFDAN+DT V+AL+    G
Sbjct  207   VNIYPYLSL-YGNAGFPLDFAFFDGTTSPVVDTNSGISYTNVFDANFDTLVSALNAAGVG  265

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + V+VGE+GWPTDGD  A A+ A RFY G +K LA   GTP+R    ++VY+F L DED
Sbjct  266   GLPVMVGEVGWPTDGDKQATAAYAQRFYAGLLKKLASNAGTPLRANQYVEVYLFSLIDED  325

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--  1259
              KS  PGNFE HWGI+ YDGQ K+ +DL+G+ G+   + G  G+EYLP+ WC L ANA  
Sbjct  326   VKSVAPGNFERHWGIMRYDGQPKYAMDLTGQ-GRNTALVGARGVEYLPRAWCVLNANAPA  384

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               ++ L  N DYAC  ADCT +S GS+C GL      SY FNAYFQ Q+Q  ++C FQGL
Sbjct  385   ESMSRLGDNVDYACSNADCTALSYGSTCGGLDAAGNASYAFNAYFQVQNQEVEACGFQGL  444

Query  1437  GEVTTKNLSTPSCRFNIGIK  1496
                TT++ ST +C F+I I+
Sbjct  445   AASTTQDPSTGTCNFSIQIE  464



>ref|XP_011010121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Populus euphratica]
Length=480

 Score =   458 bits (1179),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 240/440 (55%), Positives = 300/440 (68%), Gaps = 9/440 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG ++   LPP+ VV+MLK NGI+KVKLF+  +  +N+LAGTGIEVM+  PN 
Sbjct  20    VDGLGVNWGTMAIRKLPPETVVEMLKDNGIQKVKLFDADQNTMNSLAGTGIEVMVAIPND  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y  AK +VK NVT YN     GV I  V VGNEPFLK Y    L   T+PAL 
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYNFNG--GVTIKYVAVGNEPFLKSYNGSFL-NTTFPALR  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SP     PS+G FR DI D + +IV+ L +N A
Sbjct  137   NIQNALNDAGVGDSIKATVPLNADVYNSPDDQAYPSSGRFRSDINDLMTEIVQFLAQNNA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y  D FP D+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSL-YGNDDFPFDYAFFDGAPQPVVDRGTGIQYTNVFDANFDTLVSALKAA  255

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + +VVGE+GWPTDGD  AN   A RFYNG +  LAG +GTP+RPG  I+VY+FGL 
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANIGNAIRFYNGLLPRLAGNRGTPLRPGY-IEVYLFGLL  314

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI  YDGQ KF +DLSG+    K + G + ++YLP +WC    N
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQVAN-KWLVGAQNVQYLPSRWCMFNPN  373

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK L+ L  N +YAC R+DCT +  GSSCNGL      SY FN Y+Q Q+Q + +C+F+G
Sbjct  374   AKDLSKLADNINYACSRSDCTALGYGSSCNGLDTNGNASYAFNMYYQVQNQDEFACNFEG  433

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  VT +N+S  +C F I I
Sbjct  434   LATVTEQNISQGNCNFTIQI  453



>ref|XP_010470322.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=481

 Score =   458 bits (1178),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 301/438 (69%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYHRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P++DNG  YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPLNYAFFDGA-QPINDNGVDYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN+  A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K + G + + YLP KWC     AK
Sbjct  316   DAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQ-GQNKFLIGAQNVPYLPNKWCVFNPEAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN D+AC  +DCT +  GSSCN L      SY FN YFQ ++Q + +C FQGL 
Sbjct  375   DLTKLAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKNQDESACFFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  435   TITTQNISQGQCSFPIQI  452



>ref|XP_010496623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=482

 Score =   457 bits (1177),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 300/438 (68%), Gaps = 8/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+MLK N I K KLF+  +  + ALAG+GIEVM+  PN 
Sbjct  22    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKFKLFDADETTMGALAGSGIEVMVAIPND  81

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  82    QLKVMGSYHRAKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALQ  138

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN A
Sbjct  139   NIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             P  IN+YPFLSL Y  D FP+++AFFDG  +P++DNG  YTNVFDAN+DT V++L    H
Sbjct  199   PITINIYPFLSL-YGNDDFPLNYAFFDGA-QPINDNGVDYTNVFDANFDTLVSSLKAVGH  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN+  A RFYNG +  L   KGTP+RP   I+VY+FGL DE
Sbjct  257   GDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWGI  +DGQ KF +DLSG+ G+ K + G + + YLP KWC     AK
Sbjct  316   DAKSIAPGEFERHWGIFKFDGQPKFPIDLSGQ-GQNKFLIGAQNVPYLPNKWCVFNPEAK  374

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L AN D+AC  +DCT +  GSSCN L      SY FN YFQ ++Q + +C FQGL 
Sbjct  375   DLTKLAANIDFACTFSDCTALGYGSSCNSLDANGNASYAFNMYFQVKNQDESACFFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT+N+S   C F I I
Sbjct  435   TITTQNISQGQCSFPIQI  452



>ref|XP_008465328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=479

 Score =   457 bits (1176),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 243/446 (54%), Positives = 302/446 (68%), Gaps = 11/446 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             GV G  ++GLGVNWG +++H LPPK VV+MLK NGI+KVKLF+  +  + ALAGTGIEVM
Sbjct  14    GVLGSCVEGLGVNWGTMANHRLPPKTVVQMLKDNGIQKVKLFDADQSSMGALAGTGIEVM  73

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  L  + +Y  AK +V+ NVT Y      GV I  V VGNEPFL  Y    L  V
Sbjct  74    VAIPNDQLSAMGDYNRAKQWVQRNVTRY--IFDGGVTIKYVAVGNEPFLSSYNGSFL-NV  130

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+Q ALNEAG G ++KATVP NADVY SP  +P PSAG FR DI   +  IV+ 
Sbjct  131   TFPALQNIQNALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRSDINQLMNDIVQF  190

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L+KN APF +N+YPFLSL Y  D FP D+AFFDG   P+ D   G  YTNVFDAN+DT V
Sbjct  191   LNKNKAPFTVNIYPFLSL-YGNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLV  249

Query  879   AALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDV  1058
             ++L     G + ++VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+V
Sbjct  250   SSLKAVGLGDMPILVGEVGWPTDGDKNANDGNAYRFYNGLLPRLAANKGTPLRPGF-IEV  308

Query  1059  YMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKW  1238
             Y+F   DE+ KS  PGNFE HWGI GYDGQ KF +DLSG+ G+ K++ G + +EYLP+KW
Sbjct  309   YLFSFLDENGKSIAPGNFERHWGIFGYDGQPKFGMDLSGQ-GQNKLLVGAQNVEYLPQKW  367

Query  1239  CALKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKD  1415
             C    NAK L+ L  N DYAC  +DCT +  GSSCN L      SY FN YFQ Q+Q + 
Sbjct  368   CMFNPNAKDLSKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDEL  427

Query  1416  SCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             +C+FQGL  +T++NLS  +C F I +
Sbjct  428   ACNFQGLATITSRNLSQGTCNFIIQL  453



>ref|XP_004141142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 ref|XP_004171752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN59764.1| hypothetical protein Csa_3G843830 [Cucumis sativus]
Length=479

 Score =   455 bits (1171),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 242/446 (54%), Positives = 301/446 (67%), Gaps = 11/446 (2%)
 Frame = +3

Query  171   GVAG--LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             GV G  ++GLGVNWG +++H LPPK VV+M K NGI+KVKLF+  +  + ALAGTGIEVM
Sbjct  14    GVLGSCVEGLGVNWGTMANHRLPPKTVVQMFKDNGIQKVKLFDADQSSMGALAGTGIEVM  73

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  L  + +Y  AK +V+ NVT Y  T   GV I  V VGNEPFL  Y    L  V
Sbjct  74    VAIPNDQLSAMGDYNRAKQWVQRNVTRY--TFDGGVTIKYVAVGNEPFLSSYNGSFL-NV  130

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+Q ALNEAG G ++KATVP NADVY SP  +P PSAG FR DI   +  IV+ 
Sbjct  131   TFPALLNIQNALNEAGHGDSIKATVPLNADVYNSPVNSPYPSAGRFRNDINQLMTDIVQF  190

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L+KN APF +N+YPFLSL Y  D FP D+AFFDG   P+ D   G  YTNVFDAN+DT V
Sbjct  191   LNKNKAPFTVNIYPFLSL-YGNDNFPFDYAFFDGASNPVVDIGTGIQYTNVFDANFDTLV  249

Query  879   AALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDV  1058
             ++L     G + ++VGE+GWPTDGD   N   A RFYNG +  LA  KGTP+RPG  I+V
Sbjct  250   SSLKAVGLGDMPILVGEVGWPTDGDKNGNVGNAYRFYNGLLPRLAANKGTPLRPGF-IEV  308

Query  1059  YMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKW  1238
             Y+F   DE+ KS  PGNFE HWGI GYDGQ KF +DLSG+ G+ K++ G + ++YLP+KW
Sbjct  309   YLFSFLDENGKSIAPGNFERHWGIFGYDGQPKFGMDLSGQ-GQNKLLVGAQNVQYLPQKW  367

Query  1239  CALKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKD  1415
             C    NAK L+ L  N DYAC  +DCT +  GSSCN L      SY FN YFQ Q+Q + 
Sbjct  368   CMFNPNAKDLSKLADNIDYACTFSDCTSLGYGSSCNNLDANGNASYAFNMYFQVQNQDEL  427

Query  1416  SCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             +C+FQGL  VT++NLS  +C F I +
Sbjct  428   ACNFQGLATVTSQNLSQGTCNFIIQL  453



>ref|XP_003619009.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=449

 Score =   454 bits (1168),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 233/435 (54%), Positives = 299/435 (69%), Gaps = 6/435 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++HPL P  VV+MLK NGI+KVKLF+  +  ++AL G+GIEVM+  PN 
Sbjct  15    VEGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNN  74

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ +Y+ A  +V++NVT YN  S  GV I  V VGNEPFLK Y    L  VT+PAL 
Sbjct  75    QLAEMSDYDRALQWVRKNVTRYNFKS-GGVNIKYVAVGNEPFLKAYNNSFL-NVTFPALM  132

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSP-PYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
             N+Q ALN+ G+G ++KATVP NADVY SP     VPSAG+FR D+++ + +IV+ L KN 
Sbjct  133   NIQNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNN  192

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL Y  D FP D+AFFDGV  P++DNG  YTNVFDAN+DT V+AL    
Sbjct  193   APFTVNIYPFLSL-YGNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIG  251

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + + VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP R G  I+VY+FGL D
Sbjct  252   FGNMPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQGY-IEVYLFGLID  310

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF + +S + G+ K++ G + + YL  KWC    NA
Sbjct  311   EDAKSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNA  370

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               L+NL  N +YAC  ADCTP+  GSSCN L      SY FN Y+Q Q+Q   +C+F+GL
Sbjct  371   NNLSNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEGL  430

Query  1437  GEVTTKNLSTPSCRF  1481
               +TT N+STP+C F
Sbjct  431   AMLTTNNISTPTCVF  445



>ref|XP_008391677.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Malus domestica]
Length=484

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 304/442 (69%), Gaps = 9/442 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             +G++GLGVNWG +++H LPP+ VV+MLK NGI+KVKLF+  +  ++ALAG+G+EVM+  P
Sbjct  18    SGVEGLGVNWGTMATHKLPPETVVQMLKDNGIQKVKLFDAEESTMSALAGSGLEVMVAIP  77

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  L  + +Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT+PA
Sbjct  78    NDQLAVMTSYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTFPA  134

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI   + +IV+ LDKN
Sbjct  135   LQNIQNALNEAGVGDSVKATVPLNADVYNSPENNPVPSAGRFRTDILQLMTEIVQFLDKN  194

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALS  890
              APF IN+YPFLSL Y  D FP ++AFFDG   P+ D   G  YTNVFDAN+DT V++L 
Sbjct  195   QAPFSINIYPFLSL-YGNDDFPFNYAFFDGDTNPIVDAGTGIQYTNVFDANFDTLVSSLK  253

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                 G + +VVGE+GWPTDGD  ANA  A RFYNG +  L   +GTP+RPG  I+VY+FG
Sbjct  254   AVGFGNMPIVVGEVGWPTDGDKNANAGNALRFYNGLLPRLGTNRGTPLRPGY-IEVYLFG  312

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PG+FE HWGI  YDGQ KF +DLSG+ G+ K++   + ++YL KKWC   
Sbjct  313   LIDEDAKSIAPGSFERHWGIFRYDGQPKFPVDLSGQ-GQNKLLVPAKNVQYLSKKWCMFN  371

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              NAK ++ L  N +YAC  +DCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F
Sbjct  372   PNAKDVSKLADNINYACTFSDCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNF  431

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL  +TT+N+S  +C F I I
Sbjct  432   QGLATLTTQNISQGNCNFIIQI  453



>ref|XP_010672074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   454 bits (1169),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/442 (53%), Positives = 305/442 (69%), Gaps = 9/442 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  + H LPP  VV+MLK NGI+KVKLF+  +  L+A +GT IEVM+  PN 
Sbjct  31    VEGLGVNWGTQAIHKLPPSTVVQMLKDNGIQKVKLFDADESTLSAFSGTNIEVMVAIPNG  90

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VTYPAL  539
              L  +++Y+ A+ +V++NVT YN     GV I  V VGNEPFLK Y   G F+  T+PAL
Sbjct  91    DLVAMLDYDRARKWVEKNVTRYN--FKGGVNIKYVAVGNEPFLKAY--NGTFENATFPAL  146

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G TVKATVP NADVY SP   PVPSAG FR D+AD + ++V+ L +N 
Sbjct  147   KNIQNALNEAGVGNTVKATVPLNADVYESPEGTPVPSAGRFRPDVADLMTQMVQFLSQNN  206

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL Y    FPVD+AFFDG   P+ DNG  YTNVFDAN+DT V+AL    
Sbjct  207   APFSVNIYPFLSL-YGNPGFPVDYAFFDGGAAPIADNGIEYTNVFDANFDTLVSALKAAG  265

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +G + ++VGE+GWPT+GD  AN + A RFY G +  +A   GTP+RPG +I++Y+FGL D
Sbjct  266   YGDLPIIVGEVGWPTNGDVNANINNAIRFYRGLLPRIAANTGTPLRPG-NIEMYLFGLLD  324

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED K+  PGNFE HWGI  YDGQ KF +DL+G+  +   + G + + YL  +WC    NA
Sbjct  325   EDAKTVAPGNFERHWGIFRYDGQPKFPMDLTGQ-NRDVYLVGAKDVTYLQNQWCEFNPNA  383

Query  1260  K-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
             K ++ L  N D+AC  ADCTP+  GSSC+G+     +SY FN YFQ Q+Q  ++C+FQGL
Sbjct  384   KDVSKLAENIDFACTFADCTPLGYGSSCHGMDANGNISYAFNVYFQTQNQNLEACNFQGL  443

Query  1437  GEVTTKNLSTPSCRFNIGIKLG  1502
               +T +N+S P+C F I I  G
Sbjct  444   ARLTLQNISAPTCNFTIQIASG  465



>ref|XP_009388996.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   453 bits (1165),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 233/441 (53%), Positives = 298/441 (68%), Gaps = 7/441 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SHPLPPK VV++LK NGI KVK+F+     + ALAG+ IEVM+  PN +L
Sbjct  23    GLGVNWGTMASHPLPPKIVVQLLKDNGIDKVKIFDADSSTMKALAGSDIEVMVAIPNNML  82

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             + + +Y  A+ +VK NVT Y+     GV I  V VGNEPFL  Y    L  VT+PAL N+
Sbjct  83    RTMTDYGAARDWVKTNVTRYHFEG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALKNI  139

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q ALN+AG+G ++KATVP NADVY SP   PVPSAG FR DI+D + +IV+ L+++GAPF
Sbjct  140   QNALNDAGVGGSIKATVPLNADVYNSPESNPVPSAGRFRTDISDLMTEIVQFLNQSGAPF  199

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y    FPV+FAFFDG   P+ DNG  YTNVFDAN+DT V+AL     G 
Sbjct  200   TVNIYPFLSL-YGNPNFPVEFAFFDGGSDPVVDNGIQYTNVFDANFDTLVSALKGVGLGD  258

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + ++VGE+GWPTDGD  A AS A RFY+G +K L    GTP+RP   I+VY+F L DED 
Sbjct  259   LPIIVGEVGWPTDGDKNAKASYAQRFYDGLLKRLVANHGTPLRPNQYIEVYLFSLIDEDA  318

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN--AK  1262
             KS  PGNFE HWG+L YDGQ K+N+DLSG+ G+ K +   + +EYLPKKWC    N    
Sbjct  319   KSIEPGNFERHWGVLKYDGQPKYNMDLSGQ-GQAKTLVPTKDVEYLPKKWCVFDPNGGGN  377

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++ L     +AC  +DCT +  GS+CNGL      S+ FN Y+Q Q+  + SC+FQGL  
Sbjct  378   VSTLGDQITFACTWSDCTALGYGSTCNGLDGNGNASFAFNMYYQVQNHQELSCNFQGLAT  437

Query  1443  VTTKNLSTPSCRFNIGIKLGA  1505
              TT++ ST  C F I I   A
Sbjct  438   ETTQDPSTAGCNFTIQIATSA  458



>ref|XP_006400369.1| hypothetical protein EUTSA_v10015448mg [Eutrema salsugineum]
 gb|ESQ41822.1| hypothetical protein EUTSA_v10015448mg [Eutrema salsugineum]
Length=494

 Score =   453 bits (1166),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 235/440 (53%), Positives = 296/440 (67%), Gaps = 14/440 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK VV+MLK N ++KVKLF+     + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVQKVKLFDADTNTMGALAGSGIEVMVAIPND  88

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLK + +Y  AK +V+ N+T +N    D VKI  V VGNE FL  Y       +TYPAL 
Sbjct  89    LLKAMGSYNRAKDWVRRNITRFN----DAVKIKYVAVGNEAFLSSYNGS-FINLTYPALF  143

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI +++K IV  L  N A
Sbjct  144   NIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGRFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFF+G    ++DNG  YTNVFDAN+DT +A+L    H
Sbjct  204   PFTVNIYPFLSLYLSSD-FPFDYAFFNG-QNTVNDNGVIYTNVFDANFDTLLASLRALGH  261

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN   A RFY+G +  LAG +GTP+RPG  I+VY+FG  DE
Sbjct  262   GDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNRGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  +DGQ KF  DLSG+ GK KI+TG + ++YL  +WC L  N  
Sbjct  321   DAKSIAPGNFERHWGIFRFDGQPKFPADLSGE-GKKKILTGAQNVQYLQNQWCMLNPNGH  379

Query  1263  -----LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  GSSC  L +    SY FN YFQ Q+Q  ++CDF
Sbjct  380   SFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDF  439

Query  1428  QGLGEVTTKNLSTPSCRFNI  1487
             +GL  +TT+N+S   C F I
Sbjct  440   EGLAMITTRNISREQCNFPI  459



>gb|AIR93903.1| glucanase [Cicer arietinum]
Length=480

 Score =   452 bits (1164),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 231/439 (53%), Positives = 298/439 (68%), Gaps = 7/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  ++HPL    VV+MLK NGI+KVKLF+T    ++AL G+GIEVM+  PN 
Sbjct  23    VEGVGVNWGTQATHPLKADTVVEMLKDNGIQKVKLFDTDDATMSALGGSGIEVMVAIPNN  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ NY+ A  +V++NVT +  T   GV I  V VGNEPFLK Y    L  VT+PAL 
Sbjct  83    QLAEMNNYDRALQWVRKNVTRF--TFKGGVNIKYVAVGNEPFLKSYNNT-LLNVTFPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNE G+G ++KATVP NAD+Y SP    VPSAG+FR D+   + +I++ L+KN A
Sbjct  140   NIQNALNEVGLGDSIKATVPLNADIYESPIENSVPSAGIFRPDLIGLMTQIIQFLNKNNA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  + FP DFAFFDG   P++DNG  YTNVFDAN+DT V+AL     
Sbjct  200   PFTVNIYPFLSL-YGNENFPFDFAFFDGNSNPINDNGILYTNVFDANFDTLVSALKSIGF  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + + VGE+GWPTDGD  AN   A RFYNG  + +A  KGTP RPG  I++Y+FGL DE
Sbjct  259   GDMPIFVGEVGWPTDGDKNANIENALRFYNGLFQKIASNKGTPKRPGY-IEIYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-  1259
             D K+  PGNFE HWGI  +DG+ KF + +S + G+ K++ G + + YL  KWC    N+ 
Sbjct  318   DAKAIAPGNFERHWGIFSFDGKPKFPMHISSQ-GQNKLLIGAKNVYYLDPKWCIFNPNSN  376

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT L  N DYAC  ADCTP+  GSSCN L      SY FN Y+Q Q+Q   +C+F+GL 
Sbjct  377   NLTKLAENIDYACTYADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQVDMACNFEGLA  436

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
              VTTKN+STP+C F I I 
Sbjct  437   MVTTKNISTPTCNFIIEIN  455



>dbj|BAJ94415.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 295/442 (67%), Gaps = 10/442 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG  +SHPLPPK VV++LK NGI KVKLF T    + ALAG+G+EVM+  PN +
Sbjct  23    EGLGVNWGTQASHPLPPKVVVQLLKDNGINKVKLFETNLEAMKALAGSGVEVMLAIPNNM  82

Query  366   LKDLV--NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
             L  +   +   A+ +VK NV  ++     GV I  V VGNEPFL+ Y K    KVT PAL
Sbjct  83    LHHIAGDSGAAARDWVKRNVKRFDFDG--GVVIKYVAVGNEPFLEAY-KGSFIKVTLPAL  139

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALN+AG+G  +KATVP NADVY SP   PVPSAG FR +I+  +  IV  L KN 
Sbjct  140   ENIQNALNDAGVGDRIKATVPLNADVYNSPARNPVPSAGRFRAEISGVMTDIVRFLAKNK  199

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL Y  D FP++FAFFDG   P++D G  Y+NV+DAN+DT VAAL+   
Sbjct  200   APFTVNIYPFLSL-YLDDNFPLNFAFFDGGATPVNDKGVMYSNVYDANFDTLVAALAAVG  258

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG + ++VGE+GWPTDGD  A AS A RFY+G ++ LA  +GTP RP   I+ Y+FGL D
Sbjct  259   HGDMPIIVGEVGWPTDGDRHAKASHARRFYDGLLRRLAANRGTPARPNRHIETYLFGLVD  318

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED+KS  PG+FE HWGI  YDGQ KF +DLSG+G +   +   +G++YL + WCA+   A
Sbjct  319   EDRKSVQPGSFERHWGIFRYDGQPKFAMDLSGQGRRDATLVPAKGVQYLSRTWCAVNPKA  378

Query  1260  KLTN----LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                +    L A  DYAC  ADCT +  GS+CNG+      SY FNAY+QAQ Q  ++CDF
Sbjct  379   SRDDLGKLLGAKIDYACSNADCTTLGYGSTCNGMDAMGNASYAFNAYYQAQSQKDEACDF  438

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL   T  + ST +C F I I
Sbjct  439   QGLALPTQTDPSTTTCNFTIQI  460



>ref|XP_006289696.1| hypothetical protein CARUB_v10003257mg [Capsella rubella]
 gb|EOA22594.1| hypothetical protein CARUB_v10003257mg [Capsella rubella]
Length=491

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 238/442 (54%), Positives = 292/442 (66%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK VV+M+K N +KKVKLF+     + ALAGTGIEVM+  PN 
Sbjct  27    VSALGVNWGTMATHQLPPKTVVQMMKDNNVKKVKLFDADTNTMVALAGTGIEVMVAIPND  86

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  AK +V+ N+T +N    D VKI  V VGNEPFL  Y       VTYPAL 
Sbjct  87    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINVTYPALF  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI +++K IV  L  N A
Sbjct  142   NIQKALNEAGVGDFIKATVPLNADVYNSPPDNPVPSAGSFRQDIFEEMKLIVNFLAHNKA  201

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFFDG    + DNG  YTNVFDAN+DT +A+L    H
Sbjct  202   PFTVNIYPFLSLYLSSD-FPFDYAFFDG-QNTVSDNGVIYTNVFDANFDTLLASLRALGH  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN   A RFY G +  LAG +GTP+RPG  I VY+FG  DE
Sbjct  260   GDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAGNRGTPMRPGY-IQVYLFGFIDE  318

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  +DGQ KF  DLSG+G K KI+ G + ++Y   +WC L  +A 
Sbjct  319   DAKSIAPGNFERHWGIFKFDGQPKFPADLSGEGQK-KILNGAQNVQYFQNQWCMLNPDAH  377

Query  1263  -----LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  GSSC  L +    SY FN YFQ  DQ  ++CDF
Sbjct  378   TFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVHDQKAEACDF  437

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  VTT+N+S   C F I I
Sbjct  438   EGLAMVTTRNISREQCNFPIQI  459



>ref|XP_002319699.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE95622.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=478

 Score =   451 bits (1161),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 294/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + GLGVNWG ++   L P+ VV+MLK NGI KVKLF+  +  + ALAG+GIEVM+  PN 
Sbjct  20    VHGLGVNWGTMAIRKLSPETVVQMLKDNGILKVKLFDADQTTMTALAGSGIEVMVAIPND  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y  AK +VK NVT YN     G+ I  V VGNEPFL  Y    L   T+PAL 
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYNFNG--GITIKYVAVGNEPFLTSYNGSFL-NTTFPALR  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G ++KATVP NADVY SP     PS+G FR DI D + +IV+ L +NGA
Sbjct  137   NIQNALNDAGVGDSIKATVPLNADVYGSPDDQAYPSSGRFRSDINDIMTQIVQFLSQNGA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y  D FP D+AFFDG  +P+ D G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSL-YGNDDFPFDYAFFDGAPQPVVDKGTGIQYTNVFDANFDTLVSALKAA  255

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + +VVGE+GWPTDGD  AN   A RFYNG I  L G +GTP+RPG  I+VY+FGL 
Sbjct  256   GHGDMPIVVGEVGWPTDGDKNANIGYATRFYNGLIPRLVGNRGTPLRPGY-IEVYLFGLL  314

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI  YDGQ KF LDLSG+  + K + G   ++YLP KWC    N
Sbjct  315   DEDAKSIAPGNFERHWGIFRYDGQPKFPLDLSGQ-NQNKFLAGARNVQYLPAKWCMFNPN  373

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK L+ L  N DYAC R+DCT +  GSSCN L      SY FN Y+Q Q+Q + +C+F+G
Sbjct  374   AKDLSKLAENIDYACSRSDCTALGYGSSCNSLDSNGNASYAFNMYYQVQNQDEFACNFEG  433

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +T +N+S  +C F I I
Sbjct  434   LATLTNQNISQGNCNFIIQI  453



>ref|XP_010553811.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=488

 Score =   451 bits (1161),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 298/438 (68%), Gaps = 9/438 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN 
Sbjct  27    VNGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMKALAGSGMEVMVAIPND  86

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L+ + +Y+ AK +V+ NV+ YN     GV IT V VGNEPFLK Y       +T+PAL 
Sbjct  87    QLRVMGSYDRAKEWVQRNVSRYNFNG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALQ  143

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  VKATVP NADVY SP   PVPS G FR DI  Q+ +IV+ L KN A
Sbjct  144   NIQNALNEAGLGN-VKATVPLNADVYDSPASNPVPSTGRFRPDILGQMTQIVDFLGKNNA  202

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF IN+YPFLSL Y  D FP ++AFFDG   P+ DNG  Y NVFDAN+DT V+AL    H
Sbjct  203   PFTINIYPFLSL-YGNDDFPFNYAFFDGA-TPIIDNGIEYNNVFDANFDTLVSALKAAGH  260

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPT+GD  AN   A RFYNG +  LA  +GTP+R G  I+VY+FGL DE
Sbjct  261   GDMPIIVGEVGWPTEGDKNANNGNAFRFYNGLLPRLAANRGTPLRQGY-IEVYLFGLLDE  319

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  +DGQ KF LDLSG+ G+ K++ G + + YLP KWC     AK
Sbjct  320   DAKSIAPGNFERHWGIFRFDGQPKFPLDLSGQ-GQNKLLIGAQNVTYLPSKWCQFNPQAK  378

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              ++ L  N D+AC  +DCT +  GSSCNGL      SY FN YFQ ++Q +D+C FQGL 
Sbjct  379   DISKLADNIDFACTYSDCTALEYGSSCNGLDVNGNASYAFNMYFQVKNQDEDACFFQGLA  438

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TT N+S   C F I I
Sbjct  439   AITTVNISQGQCNFPIQI  456



>ref|NP_001050810.1| Os03g0656800 [Oryza sativa Japonica Group]
 gb|AAP50997.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF97974.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12724.1| Os03g0656800 [Oryza sativa Japonica Group]
 gb|EAY91247.1| hypothetical protein OsI_12861 [Oryza sativa Indica Group]
 gb|EAZ27997.1| hypothetical protein OsJ_11963 [Oryza sativa Japonica Group]
 dbj|BAG91465.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   451 bits (1159),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 235/445 (53%), Positives = 303/445 (68%), Gaps = 11/445 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG ++SHPLPP+AVV+ML+ NGI KVKLF+     + ALAG+G+EVM+  PN L
Sbjct  25    EGLGVNWGTMASHPLPPRAVVRMLQDNGISKVKLFDADAGTMEALAGSGVEVMVAIPNNL  84

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  L +Y+ A+ +V ENV+ Y  +   GV I  V VGNEPFL      G F  VT+PAL 
Sbjct  85    LDLLTDYDAARDWVHENVSRY--SFDGGVNIKYVAVGNEPFLS--SLNGTFLNVTFPALQ  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q+AL +AG G T+KATVP NADVY SP    VPSAG FR DIA  + +IV+ L+++GA
Sbjct  141   NIQRALYDAGHGDTIKATVPLNADVYNSPENMQVPSAGRFRPDIAGLMTEIVQFLNQSGA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPL-DDNGKTYTNVFDANYDTAVAALSREK  899
             PF +N+YPFLSL Y  D FP+D+AFFDG   P+ D NG  YTNVFDAN+DT V+AL    
Sbjct  201   PFTVNIYPFLSL-YGNDNFPLDYAFFDGTTSPVVDTNGIQYTNVFDANFDTLVSALVAAG  259

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + VVVGE+GWPTDGD  A A +A RFY G ++ LA   GTP+RP   ++VY+F L D
Sbjct  260   VGGLPVVVGEVGWPTDGDKHARADLAQRFYAGLLRKLASNAGTPLRPNQYVEVYLFSLVD  319

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGIL YDGQ K+++DL+G+ G+   +    G+ YLP+ WC L  +A
Sbjct  320   EDAKSVAPGNFERHWGILRYDGQPKYSMDLAGQ-GRDTALVAARGVAYLPRAWCVLNPSA  378

Query  1260  K---LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                 ++ +  N +YAC  ADCT +  GS+CNG+      SY FNAYFQ Q+Q ++SC FQ
Sbjct  379   TPDAMSRVGDNVNYACTYADCTSLGYGSTCNGMDAAGNASYAFNAYFQVQNQVEESCGFQ  438

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLGA  1505
             GL   T ++ ST +C F I I+  A
Sbjct  439   GLAVQTQQDPSTNACNFTIQIEPSA  463



>gb|KFK26060.1| hypothetical protein AALP_AA8G198000 [Arabis alpina]
Length=484

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 292/442 (66%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +S+H LPPK VV+MLK N ++KVKLF+     + ALAG+GIEVM+  PN 
Sbjct  25    VSALGVNWGTMSTHQLPPKTVVEMLKDNNVQKVKLFDADTNTMVALAGSGIEVMVAIPND  84

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + NY  AK +V+ N+T +N    D VKI  V VGNEPFL  Y       VTYPAL 
Sbjct  85    QLKAMGNYSRAKDWVRRNITRFN----DSVKIKYVAVGNEPFLTSYNGT-FINVTYPALF  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI +++K IV  L +N A
Sbjct  140   NIQKALNEAGVGDFIKATVPLNADVYNSPPDNPVPSAGRFRQDIFEEMKLIVNFLAQNKA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFF+     ++DNG  YTNVFDAN+DT +A+L    H
Sbjct  200   PFTVNIYPFLSLYLSSD-FPFDYAFFNS-QNTVNDNGLVYTNVFDANFDTLLASLRALGH  257

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN + A RFY G +  LA  +GTP RPG  I VY+FG  DE
Sbjct  258   GDLTVIVGEVGWPTDGDKNANIANAERFYTGLLPKLAANRGTPARPGY-IQVYLFGFIDE  316

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF  DLSG+G K K + G + ++YL  +WC L  N  
Sbjct  317   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQK-KSLNGAQNVQYLQNQWCMLNPNGH  375

Query  1263  -----LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  GSSC  L +    SY FN YFQ Q+Q  ++CDF
Sbjct  376   SFSNSTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDF  435

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  +TT+N+S   C F I I
Sbjct  436   EGLAMITTRNISREQCNFPIQI  457



>ref|XP_010495273.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=491

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 236/440 (54%), Positives = 293/440 (67%), Gaps = 14/440 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              LGVNWG +++H LPPK VV+MLK N +KKVKLF+     + ALAG+GIEVM+  PN  L
Sbjct  31    ALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPNDQL  90

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             K + +Y  AK +V+ N+T +N    D VKI  V VGNEPFL  Y       +TYPAL ++
Sbjct  91    KAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALFHI  145

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI +++K IV  L  N APF
Sbjct  146   QKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGSFRQDIYEEMKLIVNFLAHNKAPF  205

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL+ S D FP D+AFF+G    + DNG  YTNVFDAN+DT +A+L    HG 
Sbjct  206   TVNIYPFLSLYLSSD-FPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLRALGHGD  263

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + V+VGE+GWPTDGD  AN   A RFY+G +  LAG KGTP+RPG  I+VY+FG  DED 
Sbjct  264   MTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNKGTPMRPGY-IEVYLFGFIDEDA  322

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK--  1262
             KS  PGNFE HWGI  YDGQ KF  DLSG+G K K++ G + ++YL  +WC L  NA   
Sbjct  323   KSIAPGNFERHWGIFKYDGQPKFPADLSGEGQK-KMLNGAQSVQYLQNQWCMLNPNAHTF  381

Query  1263  ---LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
                   L  N +YAC  +DCT +  G+SC  L +    SY FN YFQ  DQ  ++CDF+G
Sbjct  382   SNSTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT N+S   C F I I
Sbjct  442   LAIITTHNISREQCNFPIQI  461



>ref|XP_010549610.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=488

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 232/441 (53%), Positives = 297/441 (67%), Gaps = 9/441 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G + LGVNWG ++SH LPPK VV+MLK N I+KVKLF+     + A+AG+G+EVM+  PN
Sbjct  25    GGEALGVNWGTMASHQLPPKTVVQMLKGNNIQKVKLFDADGSTMGAIAGSGMEVMVAIPN  84

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
               LK + ++  AK +V+ NVTSYN     GV +  V VGNEPFL  Y       +TYPAL
Sbjct  85    DQLKAMGSFSRAKDWVRRNVTSYNFNG--GVNVKYVAVGNEPFLTSYNGT-FINLTYPAL  141

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALN+AG+G ++KATVP NADVY SPP  P PS+G FR DI DQ+  IV  L +N 
Sbjct  142   VNIQNALNQAGLGDSIKATVPLNADVYNSPPEKPFPSSGRFRQDILDQMSLIVNFLAQNK  201

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLD-DNGKTYTNVFDANYDTAVAALSRE  896
             APF +N+YPFLSL+ S D FPV++AFF+G +   D DNG  YTNVFDAN+DT VA+L   
Sbjct  202   APFTVNIYPFLSLYLSSD-FPVNYAFFEGQNTVNDPDNGVVYTNVFDANFDTLVASLKAL  260

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + ++VGE+GWPTDGD  AN + A RFY G +  LA  +GTP+RPG  I+VY+FGL 
Sbjct  261   NHGDMPIIVGEVGWPTDGDKNANVANAERFYAGLLPRLAANRGTPMRPGY-IEVYLFGLL  319

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL--K  1250
             DED KS  PG+FE HWGI  YDGQ KF +D SG+G K K + G + ++YLP +WC     
Sbjct  320   DEDAKSIAPGSFERHWGIFKYDGQPKFPMDFSGQGLK-KFLVGAQNVDYLPARWCMYNPN  378

Query  1251  ANAKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
              N  ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q +++C FQ
Sbjct  379   GNGDISKLGENIDYACRFSDCTALGYGSSCGNLDVNGNASYAFNMYFQVQNQQEEACYFQ  438

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  +T++NLS   C F + I
Sbjct  439   GLATITSQNLSQGQCNFPVQI  459



>ref|NP_197323.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB09480.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AED92520.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=488

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 237/442 (54%), Positives = 292/442 (66%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +S+H LPPK VV+MLK N +KKVKLF+     + ALAG+GIEVM+  PN 
Sbjct  27    VSALGVNWGTMSTHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPND  86

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  AK +V+ N+T +N    D VKI  V VGNEPFL  Y       +TYPAL 
Sbjct  87    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALNEAG+G  +KATVP NADVY SP   PVPSAG FR DI +++K IV  L  N A
Sbjct  142   NIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGSFRQDIFEEMKLIVNFLAHNKA  201

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFF+G    + DNG  YTNVFDAN+DT +A+L    H
Sbjct  202   PFTVNIYPFLSLYLSSD-FPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLKALGH  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN   A RFY G +  LA  +GTP+RPG  I+VY+FG  DE
Sbjct  260   GDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANRGTPMRPGY-IEVYLFGFIDE  318

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-  1259
             D KS  PGNFE HWGI  YDGQ KF  DLSG G K KI+TG + ++YL  +WC    NA 
Sbjct  319   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQK-KILTGAQNVQYLRNQWCMFNPNAL  377

Query  1260  ----KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  GSSC  L +    SY FN YFQ Q+Q  ++CDF
Sbjct  378   TFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDF  437

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  +TT+N+S   C F I I
Sbjct  438   EGLAIITTRNISREQCNFPIQI  459



>ref|XP_006837787.1| hypothetical protein AMTR_s00104p00085600 [Amborella trichopoda]
 gb|ERN00356.1| hypothetical protein AMTR_s00104p00085600 [Amborella trichopoda]
Length=479

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 300/438 (68%), Gaps = 8/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG++++HPL P  VV+MLK NGIKKVKLF+     L++L G+GIEV +  PN +
Sbjct  21    EGLGVNWGNMATHPLKPDIVVQMLKDNGIKKVKLFDADAWTLSSLVGSGIEVTVAIPNDM  80

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             L  +   YE AK +VK+NVT YN     GV I  V VGNEPFL  Y      K T+PAL 
Sbjct  81    LGRMAGKYEHAKEWVKKNVTRYNYEG--GVNIKYVAVGNEPFLTSYNGS-FMKSTFPALQ  137

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALNEAGIG  +KAT+P NADVY SP   P+PS+G FR DI   +K+IV  L+++ +
Sbjct  138   NIQKALNEAGIGDKIKATIPLNADVYNSPSDDPMPSSGDFRADIRSLMKEIVHFLNEHNS  197

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PFM+N+YPFLSL+ +K+ FPVDFAFFDG  KPL+D G +Y NVFDAN+DT V +L +   
Sbjct  198   PFMVNIYPFLSLYQNKN-FPVDFAFFDGGSKPLNDKGLSYLNVFDANFDTLVWSLRKAGV  256

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
               + + VGE+GWPTDGD   N  +A RFYNG IK+LA  KGTP++PG  I+ Y+F L DE
Sbjct  257   PNMNIAVGEVGWPTDGDKNGNVMLAKRFYNGLIKNLANNKGTPLKPG-HIETYLFSLLDE  315

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK-ANA  1259
             D KS LPG+FE HWGI  +DG+ KF +DLSG+ G+ K + G + +EY+P++WC +K  + 
Sbjct  316   DAKSILPGDFERHWGIFRFDGKPKFEMDLSGE-GREKQLVGAKNVEYMPRQWCVMKPGHV  374

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              +  +  N DYAC  +DCT +    SC  L     VSY FN YFQ QDQ   +C+FQGL 
Sbjct  375   DVAKVANNVDYACSLSDCTSLGFERSCGYLDLKGNVSYAFNMYFQTQDQDVQACNFQGLA  434

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +TTKN +  +C F I I
Sbjct  435   MITTKNPAHDTCLFPIQI  452



>ref|XP_006826313.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
 gb|ERM93550.1| hypothetical protein AMTR_s00004p00082670 [Amborella trichopoda]
Length=481

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 297/443 (67%), Gaps = 7/443 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DG+GVNWG ++   LPP  VV++LK NG +KVKLF+  +  +++LAG+GIEVM+  PN 
Sbjct  23    IDGIGVNWGTMAIRRLPPDTVVQLLKDNGFQKVKLFDADQSTMSSLAGSGIEVMVAIPNN  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L+ + +YE AK +V  N+T YN     GV I  V VGNEPFLK Y    L   T+PAL 
Sbjct  83    QLEAMNDYETAKRWVDRNITLYNFDG--GVNIKYVAVGNEPFLKSYNGSFL-NTTFPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG G T+KATVP NADVY SP    VPSAG FR DI D + +IV+ L+ + A
Sbjct  140   NIQNALNEAGAGDTIKATVPLNADVYDSPKDNSVPSAGRFRSDINDLMVQIVQFLNNSNA  199

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YP+LSL Y    FP+D+AFFDG  KP+DDNG  Y NVFDAN+DT V++L     
Sbjct  200   PFTVNIYPYLSL-YGNTGFPIDYAFFDGTSKPVDDNGVMYDNVFDANFDTLVSSLRAAGF  258

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
               + +++GE+GWPTDGD FA +  A RFYNG +K LA  KG+P+RPG  + VY+FGL DE
Sbjct  259   PDLPILIGEVGWPTDGDMFATSLYAQRFYNGLLKRLAQNKGSPLRPGHLV-VYLFGLIDE  317

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF +DLSG+ G+  +  G   ++YLP +WC L  NAK
Sbjct  318   DAKSIAPGNFERHWGIFSYDGQPKFPMDLSGQ-GQSSLPIGANNVKYLPAQWCVLNTNAK  376

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              ++ L  N +YAC  +DCT +  GS+CN L      SY FN Y+Q Q    +SCDF GL 
Sbjct  377   DMSTLPDNINYACTYSDCTSLGYGSTCNKLDAQGNASYAFNMYYQVQGHKDESCDFGGLA  436

Query  1440  EVTTKNLSTPSCRFNIGIKLGAE  1508
              VTT+N S   C+F I I++ + 
Sbjct  437   VVTTQNASQDPCKFPIQIEVSSS  459



>ref|XP_010454046.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 294/442 (67%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK VV+MLK N +KKVKLF+     + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPND  88

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  A+ +V+ N+T +N    D VKI  V VGNEPFL  Y       +TYPAL 
Sbjct  89    QLKAMGSYNRARDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  143

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             ++QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI +++K IV  L  N A
Sbjct  144   HIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGSFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFF+G    + DNG  YTNVFDAN+DT +A+L    H
Sbjct  204   PFTVNIYPFLSLYLSSD-FPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLRALGH  261

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN   A RFY+G +  LAG +GTP+RPG  I+VY+FG  DE
Sbjct  262   GDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNRGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF  DLSG+G K K++ G + ++YL  +WC L  NA 
Sbjct  321   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGQK-KMLNGAQSVQYLQNQWCMLNPNAH  379

Query  1263  -----LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  G+SC  L +    SY FN YFQ  DQ  ++CDF
Sbjct  380   TFSNNTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEACDF  439

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  +TT N+S   C F I I
Sbjct  440   EGLAIITTHNISREQCNFPIQI  461



>emb|CDY42897.1| BnaC05g47540D [Brassica napus]
Length=492

 Score =   449 bits (1155),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 233/440 (53%), Positives = 295/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+  LGVNWG +SSH LPPK VV+ML  N IKKVKLF+     + ALAG+G+EVM+  PN
Sbjct  29    GVSALGVNWGTMSSHQLPPKTVVRMLTDNNIKKVKLFDADTDTMGALAGSGVEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ +  Y+ AK +V+ NV+ +N    DGVKI  V VGNEPFL  Y       +TYPAL
Sbjct  89    DLLQAMGTYQRAKDWVQRNVSRFNFN--DGVKIKYVAVGNEPFLTSYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAGIG  +KATVP NADVY SPP   VPSAG FR DI  ++  IV  L +N 
Sbjct  146   VNIQTALNEAGIGDYIKATVPLNADVYNSPPDNQVPSAGRFRSDILQEMTDIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ S D FP ++AFFDG    ++DNG  YTNVFDA++DT +A+L+   
Sbjct  206   APFTVNIYPFLSLYLSSD-FPFEYAFFDG-QNTVNDNGVIYTNVFDASFDTLLASLNALN  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN + A RFY+G +  LA   GTP+R G  I+VY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVANAERFYSGLLPRLANNIGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DGQ KF +DL G+G K K +TG + ++YL  +WC    N 
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGQPKFPVDLQGQGQK-KFLTGAQNVQYLLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+G
Sbjct  382   RGNISKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTQNISQGQCVFPIQI  461



>ref|XP_002466725.1| hypothetical protein SORBIDRAFT_01g012900 [Sorghum bicolor]
 gb|AAL73976.1|AF466201_5 3-glucanase [Sorghum bicolor]
 gb|EER93723.1| hypothetical protein SORBIDRAFT_01g012900 [Sorghum bicolor]
Length=493

 Score =   449 bits (1155),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 298/437 (68%), Gaps = 7/437 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG +++H LPP  VV+ML+ NGI+KVKLF+     ++ALAGT +EVM+  PN +L 
Sbjct  31    LGVNWGTMATHRLPPGTVVRMLEDNGIRKVKLFDADAGPMDALAGTSVEVMVAIPNNMLD  90

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y  A+ +V +NV+ YN     GV I  V VGNEPFL  +       VT PAL N+Q
Sbjct  91    MMTDYGTARDWVHQNVSRYNFDG--GVNIKYVAVGNEPFLSSFNGT-FLNVTLPALQNIQ  147

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             +ALN+AG+G ++KATVP NADVY SP  +P PSAG FR DIAD + +IV+ L+++GAPF 
Sbjct  148   RALNDAGLGDSIKATVPLNADVYNSPTESPYPSAGRFRSDIADLMTEIVQFLNQSGAPFT  207

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSREKHg  905
             +N+YPFLSL Y  D FP+D+AFFDG   P+ D  NG  YTNVFDAN+DT V+AL+    G
Sbjct  208   VNIYPFLSL-YDSDDFPLDYAFFDGTSSPVVDAGNGIRYTNVFDANFDTLVSALAAAGVG  266

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + VVVGE+GWPTDGD  A A+ A +FY G ++ LA   GTP+RPG  I+VY+F L DED
Sbjct  267   GLPVVVGEVGWPTDGDKHATAAYAQKFYAGLLRKLAANAGTPLRPGQYIEVYLFSLVDED  326

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI+ YDGQ K+ +DLSG+G     +    G++YLP++WC +  NA+ 
Sbjct  327   AKSVAPGNFERHWGIMRYDGQPKYGMDLSGQGRTNTALVAARGVQYLPRQWCVVNPNAQD  386

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++ +     YAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q + SCDFQGL  
Sbjct  387   MSKIGDGVTYACTFSDCTSLGYGSSCNGLDAGGNASYAFNMYFQVQNQVEGSCDFQGLAV  446

Query  1443  VTTKNLSTPSCRFNIGI  1493
              T +N ST +C F I I
Sbjct  447   PTAQNPSTDACNFTIQI  463



>ref|XP_010928419.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=485

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 239/447 (53%), Positives = 303/447 (68%), Gaps = 11/447 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DG+GVNWG + SHP+ P  VV+MLK N I +VKLF+    ++NALAGTGIEVM+  PN 
Sbjct  27    IDGIGVNWGTLMSHPMDPAMVVQMLKGNRINQVKLFDADPWIVNALAGTGIEVMLAIPND  86

Query  363   LLKDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              L D+  NYE AK +VK+NV  Y+    DGV I  V VGNEPFLK Y K      T+PAL
Sbjct  87    HLGDMGSNYENAKEWVKQNVIKYD--HKDGVHIKYVAVGNEPFLKSY-KGSFTSTTFPAL  143

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+QKAL+EAG+G  +KAT+P NAD+Y SP    VPSAG FR DI   + KIV  L   G
Sbjct  144   KNIQKALDEAGVGNRIKATIPQNADIYSSPVNNSVPSAGNFRKDIRALMTKIVRYLHSKG  203

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNG-KTYTNVFDANYDTAVAALSRE  896
             +PF++N+YP+LSL Y    FPVDFAFFDG  +P+ D G   YTNVFDANYDT V +L + 
Sbjct  204   SPFVVNIYPYLSL-YQDPNFPVDFAFFDGKSQPVVDEGLHNYTNVFDANYDTLVWSLRKA  262

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +K++VGE+GWPTDGD  AN  +A RFY+GF+K +AG+ GTP+RPG  ++VY+FGL 
Sbjct  263   GVPNMKIIVGEVGWPTDGDENANTKLAKRFYDGFLKKMAGQVGTPLRPGK-MEVYLFGLI  321

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL---  1247
             DED KS +PGNFE HWGI  YDG+ KF  D +GK  + + + G  G++YL ++WC L   
Sbjct  322   DEDMKSVVPGNFERHWGIFTYDGRPKFATDFTGKVTE-RYLIGATGVQYLAERWCVLDEK  380

Query  1248  KANAKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              A  KL  + ++ +YAC   DCTP+  GSSC GLS    +SY FNAYFQ  DQ   +CDF
Sbjct  381   AAKKKLKLIPSSVNYACSTGDCTPLGYGSSCEGLSLWGNISYAFNAYFQTMDQDVRACDF  440

Query  1428  QGLGEVTTKNLSTPSCRFNIGIKLGAE  1508
             QGLG++TT NLS   C F + I    E
Sbjct  441   QGLGKITTANLSQGRCLFPVQIVSAGE  467



>emb|CDM83452.1| unnamed protein product [Triticum aestivum]
Length=485

 Score =   448 bits (1153),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 299/444 (67%), Gaps = 8/444 (2%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G+    GLGVNWG ++SH LPP  VV+ML+ NGIKKVKLF+     L ALA +GIEVM+ 
Sbjct  19    GLPAAVGLGVNWGTMASHQLPPSTVVQMLQDNGIKKVKLFDADAEPLGALARSGIEVMVA  78

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVT  527
              PN +L  + +Y+ A+ +V +NV++YN     GV I  V VGNEPFL      G F  VT
Sbjct  79    IPNKMLDMMTDYDTAREWVHKNVSAYNFGG--GVNIRYVAVGNEPFLS--SLNGTFLNVT  134

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PAL N+QKAL+EAG+G T+KATVP NADVY SP   PVPSAG FR +I+  + +IV+ L
Sbjct  135   LPALQNIQKALDEAGVGDTIKATVPLNADVYQSPKDTPVPSAGRFRPEISGLMTEIVQFL  194

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             +++GAPF +N+YP+LSL Y  D FP+DFAFFDG   P+ D    YTNVFDAN+DT V+AL
Sbjct  195   NQSGAPFTVNIYPYLSL-YGNDDFPLDFAFFDGASSPVVDGNIQYTNVFDANFDTLVSAL  253

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
             +    G + V+VGE+GWPTDG+  A A+ A RFY G  + LA   GTP+RP   I++Y+F
Sbjct  254   TAAGVGGLPVIVGEVGWPTDGEKHATAAYAQRFYTGLFRKLASNAGTPLRPNQYIEIYLF  313

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DED KS  PG FE HWG++ YDGQ K+ +D +G+ G+   + G  G+EYLP+ WC L
Sbjct  314   SLIDEDVKSIDPGYFERHWGVMRYDGQPKYAMDPTGQ-GRNTALVGARGVEYLPRVWCVL  372

Query  1248  KANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
              ANA  ++ L  N  YAC  ADCT +S GS+CNG+      SY FNAYFQ QDQ + +C 
Sbjct  373   NANAGNMSRLADNVGYACSNADCTSLSLGSTCNGMDPAGNASYAFNAYFQVQDQDEQACG  432

Query  1425  FQGLGEVTTKNLSTPSCRFNIGIK  1496
             F GL   T ++ ST +C F I ++
Sbjct  433   FDGLAVRTRQDPSTGTCNFTIQLE  456



>ref|XP_010420566.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=494

 Score =   448 bits (1153),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 293/442 (66%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK VV+MLK N +KKVKLF+     + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVKKVKLFDADTNTMVALAGSGIEVMVAIPND  88

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  AK +V+ N+T +N    D VKI  V VGNEPFL  Y       +TYPAL 
Sbjct  89    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  143

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             ++QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI +++K IV  L  N A
Sbjct  144   HIQKALNEAGVGDFIKATVPLNADVYNSPPENPVPSAGTFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL  S D FP D+AFF+G    + DNG  YTNVFDAN+DT +A+L    H
Sbjct  204   PFTVNIYPFLSLSLSSD-FPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLRALGH  261

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN   A RFY+G +  LAG KGTP+RPG  I+VY+FG  DE
Sbjct  262   GDMTVIVGEVGWPTDGDKNANIPNAERFYSGLLPKLAGNKGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF  DL G+G K K++TG + ++YL  +WC L  NA 
Sbjct  321   DAKSIAPGNFERHWGIFKYDGQPKFPADLPGEGQK-KVLTGAQSVQYLQNQWCMLNPNAH  379

Query  1263  -----LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  G+SC  L +    SY FN YFQ  DQ  ++CDF
Sbjct  380   TFSNNTNQLGDNVNYACTFSDCTALGYGTSCGNLDEVGNASYAFNMYFQVHDQKAEACDF  439

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  +TT N+S   C F I I
Sbjct  440   EGLAIITTHNISREQCNFPIQI  461



>ref|XP_009393970.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=479

 Score =   447 bits (1151),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 297/446 (67%), Gaps = 8/446 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             A  DG+GVNWG + SHP+ P  VV+MLK NGI+KVKLF+     + ALAGT IEVM+  P
Sbjct  20    ATADGVGVNWGTMMSHPMLPTTVVQMLKDNGIRKVKLFDADPWTVGALAGTAIEVMLAIP  79

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  L+ +  ++ A  +VKENVT Y+     GV I  V VGNEPFLK Y        T+PA
Sbjct  80    NDQLQRMCKHKHAAEWVKENVTQYD--HEGGVHIKYVAVGNEPFLKSYNGS-FINSTFPA  136

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q AL+EAG+G  +KA VP NADVY SP   PVPSAG FR DI + +  IV  L+ N
Sbjct  137   LKNVQSALDEAGVGDRIKAVVPLNADVYFSPANDPVPSAGSFRKDIEELMVDIVRFLNSN  196

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
             GAPF++N+YPFLSL      FPV+FAFFDG  +P+ D G  YTNVFDANYDT V ++ + 
Sbjct  197   GAPFVVNIYPFLSL-NQNPNFPVEFAFFDGGSQPVTDKGAQYTNVFDANYDTLVWSVKKA  255

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +K+ +GEIGWPTDG   AN   A RF++GF + +A K+GTP+RPG  +D Y+FGL 
Sbjct  256   GVPDMKITIGEIGWPTDGVKNANVDYAKRFFDGFSRKMAKKEGTPLRPGP-LDFYLFGLL  314

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS LPGNFE HWGI  +DG+ KF +DLSGK GK + + G +G+++LP +WC L   
Sbjct  315   DEDMKSVLPGNFERHWGIFTFDGKPKFPMDLSGK-GKDEYLVGAKGVQHLPAQWCVLNVE  373

Query  1257  AK--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
              +    ++ ++ +YAC  ADCT +  GSSCNGLS    VSY FN+YFQ  DQ   +C+F 
Sbjct  374   DRGNFRSIPSSVNYACANADCTALGYGSSCNGLSSEGNVSYAFNSYFQTMDQDVRACNFD  433

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLGAE  1508
             GL  + T N+ST SC F + I   A+
Sbjct  434   GLATIVTTNMSTGSCLFPVQILSNAQ  459



>dbj|BAD31779.1| putative 3-glucanase [Oryza sativa Japonica Group]
 gb|EAZ02906.1| hypothetical protein OsI_25042 [Oryza sativa Indica Group]
 gb|EAZ38824.1| hypothetical protein OsJ_23232 [Oryza sativa Japonica Group]
 dbj|BAG97331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 299/439 (68%), Gaps = 11/439 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLG+NWG  ++HPLPPKAVV++LK NGI KVKLF+T    ++ALAG+G+EVM+  PN  
Sbjct  23    EGLGINWGTQATHPLPPKAVVQLLKDNGIAKVKLFDTDFAAMSALAGSGVEVMVAIPNKD  82

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             L  +  +Y  AK +VK+NV  ++     GV I  V VGNEPFLK Y       +T PAL 
Sbjct  83    LATMASDYGNAKDWVKKNVKRFDFDG--GVTIKYVAVGNEPFLKAYNGS-FINITLPALQ  139

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AGIG  +KATVP NADVY S     VPSAG FR +IA  +  IV+ L KN A
Sbjct  140   NVQNALNDAGIGDRIKATVPLNADVYEST----VPSAGRFRPEIAGLMTDIVKFLAKNNA  195

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  + FP++FAFFDG   P++D G  YTNVFDAN+DT VAAL    H
Sbjct  196   PFTVNIYPFLSL-YLDEHFPINFAFFDGGSTPVNDGGIMYTNVFDANFDTLVAALKAVGH  254

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A   +A RFY G +K LA   GTP RP   I++Y+FGL DE
Sbjct  255   GDMPIIVGEVGWPTDGDKNARVDLAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDE  314

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG+FE HWG+L YDGQ KF +DL+G+ G+  ++   +GIEYLPK WC +  NAK
Sbjct  315   DMKSVAPGSFERHWGVLRYDGQPKFAMDLAGQ-GRNTMLVPAKGIEYLPKTWCVINTNAK  373

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              ++ L  N ++AC  ADCTP+  GSSCNG+      SY FNAYFQAQ Q +++C+FQGL 
Sbjct  374   DVSKLGDNINFACTYADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLA  433

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
               T  + +T  C F I IK
Sbjct  434   VPTETDPTTAQCNFTIQIK  452



>ref|XP_009121000.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=492

 Score =   448 bits (1152),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/445 (53%), Positives = 296/445 (67%), Gaps = 14/445 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             + +  LGVNWG +++H LPPK VV+MLK N ++KVKLF+     + ALAG+GIEVM+  P
Sbjct  27    SNVSALGVNWGTMATHQLPPKTVVQMLKDNNVQKVKLFDADTNTMVALAGSGIEVMVAIP  86

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  LK + +Y  AK +V+ N+T +N    D +KI  V VGNEPFL  Y       +TYPA
Sbjct  87    NDQLKAMGSYNRAKDWVRRNITRFN----DDIKIKYVAVGNEPFLTSYNGS-FINLTYPA  141

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+QKALNEAG+G  +KATVP NADVY SPP  PVPSAG FR DI ++++ IV  L  N
Sbjct  142   LFNIQKALNEAGVGDFIKATVPSNADVYSSPPENPVPSAGRFRQDIYEEMRLIVNFLAHN  201

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD-NGKTYTNVFDANYDTAVAALSR  893
              APF +N+YPFLSL+ S D FP D+AFF+G +   D+ NG  YTNVFDAN+DT +A+L  
Sbjct  202   KAPFTVNIYPFLSLYLSSD-FPFDYAFFNGQNTVNDNGNGVVYTNVFDANFDTLLASLKE  260

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
               HG + V+VGE+GWPTDGD  AN   A RFY G +  LA  +GTP+RPG  I+VY+FG 
Sbjct  261   LGHGDMTVIVGEVGWPTDGDKNANIPNAERFYAGLLPKLAANRGTPMRPGY-IEVYLFGF  319

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS  PGNFE HWGI  YDGQ KF  DLSG+G K K +TG + ++YL  +WC L  
Sbjct  320   IDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGEGEK-KALTGAQNVQYLQNQWCMLNP  378

Query  1254  NA-----KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDS  1418
             NA         L  N +YAC  +DCT +  GSSC  L +    SY FN YFQ Q+Q  ++
Sbjct  379   NAISFSNSTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEA  438

Query  1419  CDFQGLGEVTTKNLSTPSCRFNIGI  1493
             CDF+GL  +TTKN+S   C F I I
Sbjct  439   CDFEGLAMITTKNISRDQCNFPIQI  463



>ref|XP_002884423.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60682.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 296/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+ GLGVNWG +++H LPPK VV+MLK N I+KVKLF+     + ALAG+G+EVM+  PN
Sbjct  29    GVSGLGVNWGTMATHQLPPKTVVEMLKDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ + NY+ AK +V+ NV+ +N    +GVKI  V VGNEPFL  Y       + YPAL
Sbjct  89    DLLQAMGNYQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLIYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G   KATVP NADVY SPP   VPSAG FR DI  ++ +IV  L +N 
Sbjct  146   FNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ S D FP D+AFFDG    ++DNG  YTNVFDAN+DT +A+L+   
Sbjct  206   APFTVNIYPFLSLYLSSD-FPFDYAFFDG-QNTVNDNGVVYTNVFDANFDTLLASLNALN  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN   A RFY+G +  LA   GTP+R G  I+VY+FG  D
Sbjct  264   HGNMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPRLANNVGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DGQ KF +D  G+G K K +TG + ++YL  +WC    N 
Sbjct  323   EDVKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQK-KFLTGAQNVQYLLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  +++L  N +YAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+G
Sbjct  382   RGNMSSLGDNINYACSHSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTQNISQGECNFPIQI  461



>gb|KDO55075.1| hypothetical protein CISIN_1g011532mg [Citrus sinensis]
Length=483

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 299/440 (68%), Gaps = 10/440 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPPK +V+MLK NGI KVKLF+  +  + ALAG+ IEVM+  PN 
Sbjct  20    VNGLGVNWGTQTTHQLPPKTIVQMLKDNGISKVKLFDAHQGTMIALAGSDIEVMVAIPNK  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L D+ +Y+ AK +VK NVT YN     GV I  V VGNEPFLK Y        T+PAL 
Sbjct  80    DLLDMNSYDRAKQWVKRNVTRYNFKG--GVSIKYVAVGNEPFLKAYNGS-FLNTTFPALQ  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   P PS G FR DI  Q+ +IVE L KN A
Sbjct  137   NIQNALNEAGVGDSIKATVPLNADVYESPENNPYPSFGRFRTDILGQMTQIVEFLAKNNA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y  D FP ++AFFDG   P+ D+G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSL-YGNDDFPFNYAFFDG-GTPIVDSGTGIQYTNVFDANFDTLVSALKAV  254

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + ++VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+VY+FGL 
Sbjct  255   GHGDMPMIVGEVGWPTDGDKNANNGNAYRFYNGLLPKLAANKGTPLRPGY-IEVYLFGLV  313

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PG FE HWGI  YDGQ KF +DLSG+ G+ K++ G  G++Y+P +WC L  +
Sbjct  314   DEDAKSIDPGYFERHWGIFRYDGQPKFAMDLSGQ-GQNKMLIGASGVKYMPSQWCMLNPD  372

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK ++ L  N  YAC  +DCT +  GSSCN L      SY FN Y+Q ++Q + +C FQG
Sbjct  373   AKDMSKLVDNIKYACTWSDCTALGYGSSCNNLDANGNASYAFNMYYQIKNQDELACGFQG  432

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             LG+VTT+NLS   C F I +
Sbjct  433   LGKVTTQNLSQGQCSFIIQL  452



>ref|XP_006443393.1| hypothetical protein CICLE_v10019922mg [Citrus clementina]
 ref|XP_006479087.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
 gb|ESR56633.1| hypothetical protein CICLE_v10019922mg [Citrus clementina]
Length=483

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 299/440 (68%), Gaps = 10/440 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPPK +V+MLK NGI KVKLF+  +  + ALAG+ IEVM+  PN 
Sbjct  20    VNGLGVNWGTQTTHQLPPKTIVQMLKDNGISKVKLFDAHQGTMIALAGSDIEVMVAIPNK  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L D+ +Y+ AK +VK NVT YN     GV I  V VGNEPFLK Y        T+PAL 
Sbjct  80    DLLDMNSYDRAKQWVKRNVTRYNFKG--GVSIKYVAVGNEPFLKAYNGS-FLNTTFPALQ  136

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   P PS G FR DI  Q+ +IVE L KN A
Sbjct  137   NIQNALNEAGVGDSIKATVPLNADVYESPENNPYPSFGRFRTDILGQMTQIVEFLAKNNA  196

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y  D FP ++AFFDG   P+ D+G    YTNVFDAN+DT V+AL   
Sbjct  197   PFTVNIYPFLSL-YGNDDFPFNYAFFDG-GTPIVDSGTGIQYTNVFDANFDTLVSALKAV  254

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              HG + ++VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP+RPG  I+VY+FGL 
Sbjct  255   GHGDMPMIVGEVGWPTDGDKNANNGNAYRFYNGLLPKLAANKGTPLRPGY-IEVYLFGLV  313

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PG FE HWGI  YDGQ KF +DLSG+ G+ K++ G  G++Y+P +WC L  +
Sbjct  314   DEDAKSIDPGYFERHWGIFRYDGQPKFAMDLSGQ-GQNKMLIGASGVKYMPSQWCMLNPD  372

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK ++ L  N  YAC  +DCT +  GSSCN L      SY FN Y+Q ++Q + +C FQG
Sbjct  373   AKDMSKLVDNIKYACTWSDCTALGYGSSCNNLDANGNASYAFNMYYQIKNQDELACGFQG  432

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             LG+VTT+NLS   C F I +
Sbjct  433   LGKVTTQNLSQGQCSFIIQL  452



>ref|XP_010242326.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=480

 Score =   447 bits (1149),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 233/443 (53%), Positives = 308/443 (70%), Gaps = 12/443 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG+I S PL P  VV+MLK NGIKKVKLF++    +++LAG+GI+VM+  PN  L
Sbjct  25    GIGVNWGNIMSQPLHPTTVVRMLKDNGIKKVKLFDSDYRTVSSLAGSGIQVMVAIPNDQL  84

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             +   N Y+ AK +V+EN+TS+      GV I  V +GNEPFLK Y   G+F + T+P L 
Sbjct  85    QLFSNDYDSAKYWVEENITSH--LYKGGVDIKYVAIGNEPFLKSY--HGVFTRHTFPTLK  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q+AL+EAG+G  +KAT+P NADVY S      PS G FR DI + + KIV+ L+KN A
Sbjct  141   NIQRALDEAGVGNKIKATIPLNADVYDSS--TGKPSGGSFRKDIREVMTKIVKHLNKNKA  198

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF++N+YPFLSL Y+ D FP++FAFF+G  KP+ DNG  YTNV DAN+DT V +L +   
Sbjct  199   PFVVNIYPFLSL-YANDNFPMEFAFFEGGSKPIYDNGVKYTNVLDANHDTLVWSLRKAGV  257

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
              K+K+++GEIGWPTDGD  AN   A RFY+G  K LA  KGTP+R G  +D+Y+F L+DE
Sbjct  258   PKLKIIIGEIGWPTDGDKNANVRYAKRFYDGLFKRLASDKGTPLRAGR-MDIYLFSLFDE  316

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             +QKS LPG FE HWGI  YDG+ KF +D SG+ G  K++   +G++YLP++WC      K
Sbjct  317   NQKSVLPGFFERHWGIFRYDGKPKFRMDFSGE-GHDKLLVAAKGVKYLPRQWCVFDREIK  375

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              ++ + AN D+AC  ADCTP+ +G SC+GL    K SY FN YFQ Q+QA D+CDFQGL 
Sbjct  376   NMSRVPANMDFACNYADCTPLVNGGSCSGLDIKWKTSYAFNIYFQMQNQAMDACDFQGLA  435

Query  1440  EVTTKNLSTPSCRFNIGIKLGAE  1508
              +TTKN+S  SC F + I    E
Sbjct  436   ILTTKNVSRGSCLFPVQIVSAGE  458



>emb|CDM86682.1| unnamed protein product [Triticum aestivum]
Length=498

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 233/441 (53%), Positives = 293/441 (66%), Gaps = 11/441 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++  LPPK + ++LK NG KKVK+F+  +  +  LAGTGIE MI  PN +
Sbjct  22    EGLGVNWGTLATRRLPPKVMARLLKDNGFKKVKIFDADEATMMGLAGTGIETMIAVPNDM  81

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPAL  539
             L  +  +Y  AK +VK NVT Y+     GV I  V +GNEPFL  Y   G +  VT PAL
Sbjct  82    LAAVAADYRRAKEWVKMNVTKYDYHG--GVNIKFVAIGNEPFLTAY--NGTYDNVTVPAL  137

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q+AL+EAG G  +KATVP NADVY SP   PVPSAG FR D+A  +  +V+ L+ +G
Sbjct  138   KNIQRALDEAGHGSAIKATVPVNADVYDSPASNPVPSAGKFRDDVAAIITDMVKFLNHSG  197

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAALSRE  896
             APF +N+YPFLSL Y  D FP+D+AFFDG    P+ DNG  YTNVFDAN+DT V+AL + 
Sbjct  198   APFSVNIYPFLSL-YGNDNFPIDYAFFDGAPPTPVIDNGVNYTNVFDANFDTLVSALDKI  256

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
               G + VV+GE+GWPTDGD  A    A RFYNG +K LA ++GTP+RP A IDVY+FGL 
Sbjct  257   GFGSMPVVIGEVGWPTDGDKHATVPYAERFYNGLLKRLAARQGTPLRPRASIDVYLFGLM  316

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI  +DG+ KF LDL G  G+  +  G  G++YLP++WC L  N
Sbjct  317   DEDAKSVAPGNFERHWGIFTFDGRPKFPLDLRGN-GRPAMPAGARGVQYLPRRWCVLNPN  375

Query  1257  AKL--TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A    T +  N  YAC RADCTP+    SC  L      SY FNAY+QAQ Q   +CDFQ
Sbjct  376   ASTNATAVAENVAYACSRADCTPLGYACSCGALDAAGNASYAFNAYYQAQGQVPLACDFQ  435

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  VT K++S P C F + +
Sbjct  436   GLAVVTDKDVSRPPCNFTVQV  456



>ref|XP_008240488.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=485

 Score =   447 bits (1149),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 299/440 (68%), Gaps = 9/440 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG +++H LPP+ VV+MLK NGI+KVKLF+  +  ++ALAG+G+EVM+  PN 
Sbjct  26    VEGLGVNWGTMATHELPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPND  85

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  +  Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT+PAL 
Sbjct  86    QLAVMATYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTFPALQ  142

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G ++KATVP NADVY SP   PVPSAG FR DI+  +  IV+ L KN A
Sbjct  143   NIQNALNEAGVGDSIKATVPLNADVYNSPESNPVPSAGRFRSDISPLMIAIVQFLAKNKA  202

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSRE  896
             PF IN+YPFLSL Y  D FP ++AFFDG   P+ D   G  YTNVFDAN+DT V++L   
Sbjct  203   PFTINIYPFLSL-YGNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAV  261

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
               G + +VVGE+GWPTDGD  AN   A RFYNG +  L   +GTP+RPG  I+VY+FGL 
Sbjct  262   GFGDMTIVVGEVGWPTDGDKNANTGNAYRFYNGLLPKLGTNRGTPLRPGY-IEVYLFGLI  320

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PG+FE HWGI  YDGQ KF +DLSG+ G+ K++   + ++YL KKWC    N
Sbjct  321   DEDAKSIAPGSFERHWGIFRYDGQPKFLVDLSGQ-GQNKLLVPAKNVQYLSKKWCMFNPN  379

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK +T L  N +YAC  ADCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F+G
Sbjct  380   AKDVTKLADNINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEG  439

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S  +C F I I
Sbjct  440   LATMTTQNISQGNCNFIIQI  459



>ref|XP_009130411.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=492

 Score =   447 bits (1149),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/440 (53%), Positives = 295/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+  LGVNWG ++SH LPPK VV+ML  N IKKVKLF+     + ALAG+G+EVM+  PN
Sbjct  29    GVSALGVNWGTMASHQLPPKTVVRMLTDNNIKKVKLFDADTDTMGALAGSGVEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ +  Y+ AK +V+ NV+ +N    DGVKI  V VGNEPFL  Y       +TYPAL
Sbjct  89    DLLQTMGTYQRAKDWVQRNVSRFNFN--DGVKIKYVAVGNEPFLTSYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAGIG  +KATVP NADVY SPP   VPSAG FR DI  ++  IV  L +N 
Sbjct  146   VNIQTALNEAGIGDYIKATVPLNADVYNSPPDNQVPSAGRFRSDILQEMTDIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ S D FP ++AFFDG    ++DNG  YTNVFDA++DT +A+L+   
Sbjct  206   APFTVNIYPFLSLYLSSD-FPFEYAFFDG-QNTVNDNGVIYTNVFDASFDTLLASLNALN  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN + A RFY+G +  LA   GTP+R G  I+VY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVANAERFYSGLLPRLANNIGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DGQ KF +DL G+G K K +TG + ++YL  +WC    N 
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGQPKFPVDLQGQGQK-KFLTGAQNVQYLLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  ++ L  N +YAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+G
Sbjct  382   RGNISKLGDNINYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTQNISQGQCVFPIQI  461



>ref|XP_010528707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=495

 Score =   447 bits (1149),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 297/435 (68%), Gaps = 9/435 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+GIEVM+  PN  
Sbjct  28    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMRALAGSGIEVMVAIPNDQ  87

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L+ + +Y+ AK +V+ NV+ YN     GV IT V VGNEPFL  Y       +T+PAL N
Sbjct  88    LRVMGSYDRAKEWVQMNVSRYNFDG--GVNITYVAVGNEPFLTSYNG-SFVNLTFPALQN  144

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q ALNEA +G  VKATVP NADVY SP    VPSAG FR DI  Q+ +IV+ L KN AP
Sbjct  145   VQNALNEARLGH-VKATVPLNADVYDSPANNQVPSAGRFRPDIISQMTEIVDFLGKNNAP  203

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F IN+YPFLSL+ S D FP D+AFFDG  + + DNG  Y NVFDAN+DT V+AL    HG
Sbjct  204   FTINIYPFLSLYGSSD-FPFDYAFFDGPTQ-IVDNGIQYNNVFDANFDTLVSALKAIGHG  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + ++VGE+GWPTDGD  AN   A R+YNG +  LA KKGTP+RPG  I+VY+FGL DED
Sbjct  262   DMPIIVGEVGWPTDGDKNANTGNALRYYNGLLPRLAAKKGTPLRPGY-IEVYLFGLLDED  320

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI+ +DGQ KF LDLSG+ G+ K + G + ++YL  KWC     AK 
Sbjct  321   AKSIAPGNFERHWGIVRFDGQPKFPLDLSGQ-GQNKFLIGAQNVKYLQNKWCMFNPEAKD  379

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++ L  N DYAC  +DCT +  GSSCN L      SY FN YFQ ++Q +D+C FQGL  
Sbjct  380   ISKLVENVDYACTHSDCTALGFGSSCNSLDGHRNASYAFNMYFQVRNQEEDACFFQGLAT  439

Query  1443  VTTKNLSTPSCRFNI  1487
             +TT+N+S   C F I
Sbjct  440   ITTQNISQGQCNFPI  454



>gb|AAD38251.1|AC006193_7 Similar to glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
Length=450

 Score =   445 bits (1144),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 234/428 (55%), Positives = 294/428 (69%), Gaps = 8/428 (2%)
 Frame = +3

Query  213   ISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLVNYEV  392
             +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM+  PN  LK + +Y+ 
Sbjct  1     MATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVMVAIPNDQLKVMTSYDR  60

Query  393   AKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAG  572
             AK +V++NVT YN     GV IT V VGNEPFLK Y       +T+PALAN+Q ALNEAG
Sbjct  61    AKDWVRKNVTRYNFDG--GVNITFVAVGNEPFLKSYNGS-FINLTFPALANIQNALNEAG  117

Query  573   IGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFL  752
             +G +VKATVP NADVY SP   PVPSAG FR DI  Q+ +IV+ L KN AP  IN+YPFL
Sbjct  118   LGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGQMTQIVDFLGKNNAPITINIYPFL  177

Query  753   SLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEI  932
             SL Y  D FP+++AFFDG + P++DNG  YTNVFDAN+DT V++L    HG + ++VGE+
Sbjct  178   SL-YGNDDFPLNYAFFDGAE-PINDNGIDYTNVFDANFDTLVSSLKAVGHGDMPIIVGEV  235

Query  933   GWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNF  1112
             GWPT+GD  ANA  A RFYNG +  L   KGTP+RP   I+VY+FGL DED KS  PG F
Sbjct  236   GWPTEGDKHANAGSAYRFYNGLLPRLGTNKGTPLRP-TYIEVYLFGLLDEDAKSIAPGPF  294

Query  1113  EPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LTNLKANTD  1289
             E HWGI  +DGQ KF +DLSG+ G+ K + G + + YLP KWC     AK LT L AN D
Sbjct  295   ERHWGIFKFDGQPKFPIDLSGQ-GQSKFLIGAQNVPYLPNKWCTFNPEAKDLTKLAANID  353

Query  1290  YACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTP  1469
             YAC  +DCT +  GSSCN L      SY FN +FQ ++Q + +C FQGL  +TT+N+S  
Sbjct  354   YACTFSDCTALGYGSSCNTLDANGNASYAFNMFFQVKNQDESACYFQGLATITTQNISQG  413

Query  1470  SCRFNIGI  1493
              C F I I
Sbjct  414   QCNFPIQI  421



>ref|XP_002873877.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50136.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   446 bits (1147),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 293/442 (66%), Gaps = 14/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +  LGVNWG +++H LPPK VV+MLK N ++KVKLF+     + ALAG+GIEVM+  PN 
Sbjct  29    VSALGVNWGTMATHQLPPKTVVQMLKDNNVRKVKLFDADTNTMVALAGSGIEVMVAIPND  88

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              LK + +Y  AK +V+ N+T +N    D VKI  V VGNEPFL  Y    L  +TYPAL 
Sbjct  89    QLKAMGSYNRAKDWVRRNITRFN----DDVKIKYVAVGNEPFLTAYNGSFL-NLTYPALF  143

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALNEAG+G  +KATVP NADVY SP   PVPSAG FR DI +++K IV  L  N A
Sbjct  144   NIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGSFRQDIFEEMKLIVNFLAHNKA  203

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFF+G    + DNG  YTNVFDAN+DT +A+L    H
Sbjct  204   PFTVNIYPFLSLYLSSD-FPFDYAFFNG-QNTVSDNGVIYTNVFDANFDTLLASLKALGH  261

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + V+VGE+GWPTDGD  AN   A RFY G +  LA  +GTP+RPG  I+VY+FG  DE
Sbjct  262   GDMSVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANRGTPMRPGY-IEVYLFGFIDE  320

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-  1259
             D KS  PGNFE HWGI  YDGQ KF  DLSG G K KI+TG + ++YL  +WC L  +  
Sbjct  321   DAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQK-KILTGAQNVQYLQNQWCMLNPDGL  379

Query  1260  ----KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
                     L  N +YAC  +DCT +  GSSC  L +    SY FN YFQ Q+Q  ++CDF
Sbjct  380   TFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYAFNMYFQVQNQKAEACDF  439

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             +GL  +TT+N+S   C F I I
Sbjct  440   EGLAIITTRNISREQCNFPIQI  461



>ref|XP_010485770.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   446 bits (1147),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 293/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + GLGVNWG +++H LPPK VV+M + N I+KVKLF+     + ALAG+G+EVM+  PN 
Sbjct  30    VSGLGVNWGTMATHQLPPKTVVEMFRDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPND  89

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLK + N++ AK +V+ NV+ +N    +GVKI  V VGNEPFL  Y       +TYPAL 
Sbjct  90    LLKAMGNFQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  146

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  +KATVP NADVY SPP   VPSAG FR DI  ++ +IV  L +N A
Sbjct  147   NIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNKA  206

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFFDG    ++DNG  YTNVFDA++DT VA+L+   H
Sbjct  207   PFTVNIYPFLSLYLSSD-FPFDYAFFDG-QNTVNDNGVIYTNVFDASFDTLVASLNALNH  264

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G ++V+VGE+GWPTDGD  AN   A RFY+G +  L    GTP+R G  I+VY+FG  DE
Sbjct  265   GDMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPRLTNNVGTPMRKGY-IEVYLFGFIDE  323

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  +DGQ KF  D  G+G K K +TG   ++Y+  +WC    NA+
Sbjct  324   DAKSVAPGNFERHWGIFKFDGQPKFPFDFRGQGQK-KFLTGARNVQYMLNQWCMFNPNAR  382

Query  1263  --LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+GL
Sbjct  383   GNMSKLGDNIDYACSLSDCTALGSGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
               +TT+N+S   C F I I
Sbjct  443   ATITTRNISQGQCNFPIQI  461



>gb|AAT42176.1| putative 3-glucanase [Zea mays]
 gb|ACN27628.1| unknown [Zea mays]
 gb|AFW68098.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=492

 Score =   445 bits (1144),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 301/442 (68%), Gaps = 6/442 (1%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G+     LGVNWG +++H LPP  VV+ML+ NGI+KVKLF+     ++ALAGT +EVM+ 
Sbjct  27    GLPAAGALGVNWGTMATHQLPPATVVRMLEDNGIRKVKLFDADAGPMDALAGTSVEVMVA  86

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN +L  + +Y  A+ +V++NV+ YN     GV I  V VGNEPFL  +    L  VT 
Sbjct  87    IPNNMLDMMTDYGTARDWVRQNVSRYNFDG--GVNIKYVAVGNEPFLSSFNGTFL-NVTL  143

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q+ALN+AG G T+KATVP NADVY SP    VPSAG FR DIA  + +IV+ L+
Sbjct  144   PALQNIQRALNDAGFGDTIKATVPLNADVYNSPKDNLVPSAGRFRPDIAGLMTEIVQFLN  203

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
             ++GAPF +N+YPFLSL Y  D FP+D+AFFDG   P+ DNG  YTNVFDAN+DT V+AL+
Sbjct  204   QSGAPFTVNIYPFLSL-YDNDDFPLDYAFFDGTGSPVVDNGIQYTNVFDANFDTLVSALA  262

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                 G + VVVGE+GWPTDGD  A A+ A +FY G ++ LA   GTP+RPG  I+VY+F 
Sbjct  263   AAGVGGLPVVVGEVGWPTDGDKHATAAFAQKFYAGLLRKLAASAGTPLRPGQYIEVYLFS  322

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWGI+ YDGQ K+ +DLSG+ G+   +    G++YLP++WC + 
Sbjct  323   LIDEDAKSVAPGNFERHWGIMRYDGQPKYAMDLSGQ-GRNTALVAARGVQYLPRQWCVVN  381

Query  1251  ANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              NA+ T+ +  +  YAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q + SC F
Sbjct  382   PNAQDTSKIGDSVTYACTFSDCTSLGYGSSCNGLDAAGNASYAFNMYFQVQNQVEGSCYF  441

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL   T++N ST +C F I I
Sbjct  442   QGLAVPTSQNPSTDACNFTIQI  463



>ref|XP_006408232.1| hypothetical protein EUTSA_v10020592mg [Eutrema salsugineum]
 gb|ESQ49685.1| hypothetical protein EUTSA_v10020592mg [Eutrema salsugineum]
Length=493

 Score =   445 bits (1144),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 231/440 (53%), Positives = 295/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+  LGVNWG ++SH LPPK VV+MLK N IKKVKLF+     + ALAG+GIEVM+  PN
Sbjct  29    GVSALGVNWGTMASHQLPPKTVVQMLKDNNIKKVKLFDADTNTMGALAGSGIEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LLK + +Y+ AK +V+ NVT +N    +GVKI  V VGNEPFL  Y    +  +TYPAL
Sbjct  89    DLLKAMGSYQRAKDWVQRNVTRFNFN--NGVKIKYVAVGNEPFLTAYNGSYI-NLTYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALN+AGIG  +KATVP NADVY SPP   VPSAG FR DI  ++  IV  L +N 
Sbjct  146   VNIQTALNDAGIGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTLIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ S D FP D+AFFDG    ++DNG  YTNV DAN+DT +A+L+   
Sbjct  206   APFTVNIYPFLSLYLSSD-FPFDYAFFDG-QNTINDNGVIYTNVLDANFDTLLASLNALN  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN   A RFY+G +  LA   GTP+R  + I+VY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPMRK-SYIEVYLFGFID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWG+  +DGQ KF +D  G+G K + +TG + ++YL  +WC    N 
Sbjct  323   EDAKSVAPGNFERHWGLFKFDGQPKFPVDFQGQGQK-RFLTGAQNVQYLLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+G
Sbjct  382   RGNISKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTRNISQGQCNFPIQI  461



>ref|XP_010415342.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
 ref|XP_010415349.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Camelina sativa]
Length=477

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 302/444 (68%), Gaps = 10/444 (2%)
 Frame = +3

Query  171   GVAGL--DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             G+ G+  DGLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+G+EVM
Sbjct  12    GIMGIVVDGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDADETTMGALAGSGLEVM  71

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  LK + +Y+ AK +V++NVT YN     GV IT V VGNEPFLK Y       +
Sbjct  72    VAIPNNQLKVMGSYDRAKDWVRQNVTRYNFDG--GVNITSVAVGNEPFLKSYNGS-FINL  128

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+Q ALNEAG+G +VKATVP NADVY SP   PVP AG FR DI   + +IV+ 
Sbjct  129   TFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPYAGRFRPDIIGPMTQIVDF  188

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L  N AP  IN+YPFLSL Y  D FP+++AFFDG   P+DDNG  YTNVFDAN+DT V++
Sbjct  189   LGNNSAPIAINIYPFLSL-YGNDDFPINYAFFDGA-PPVDDNGIDYTNVFDANFDTLVSS  246

Query  885   LSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYM  1064
             L    HG + ++VGE+GWPT+GD  AN+  A RFYNG +  L   KGTP+RP   I+VY+
Sbjct  247   LKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTNKGTPLRP-TYIEVYL  305

Query  1065  FGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCA  1244
             FGL DE+ KS  PG FE HWG+  +DGQ KF +DLSG+ G+ K++ G + + YL  KWC 
Sbjct  306   FGLLDENAKSIAPGPFERHWGLFKFDGQPKFPIDLSGQ-GQNKLLIGAQNVTYLSSKWCM  364

Query  1245  LKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
                ++K LT L  N ++AC  +DCT +  GSSCNGL      SY FN YFQ ++Q +++C
Sbjct  365   FNPDSKDLTKLADNINFACTYSDCTALGYGSSCNGLDANGNASYAFNMYFQEKNQDENAC  424

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGI  1493
              FQG+   TT+N+S   C F I I
Sbjct  425   VFQGMATTTTQNISQGQCNFPIQI  448



>ref|NP_001058984.2| Os07g0168600 [Oryza sativa Japonica Group]
 dbj|BAF20898.2| Os07g0168600, partial [Oryza sativa Japonica Group]
Length=558

 Score =   446 bits (1148),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 299/439 (68%), Gaps = 11/439 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLG+NWG  ++HPLPPKAVV++LK NGI KVKLF+T    ++ALAG+G+EVM+  PN  
Sbjct  102   EGLGINWGTQATHPLPPKAVVQLLKDNGIAKVKLFDTDFAAMSALAGSGVEVMVAIPNKD  161

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             L  +  +Y  AK +VK+NV  ++     GV I  V VGNEPFLK Y       +T PAL 
Sbjct  162   LATMASDYGNAKDWVKKNVKRFDFDG--GVTIKYVAVGNEPFLKAYNGS-FINITLPALQ  218

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AGIG  +KATVP NADVY S     VPSAG FR +IA  +  IV+ L KN A
Sbjct  219   NVQNALNDAGIGDRIKATVPLNADVYEST----VPSAGRFRPEIAGLMTDIVKFLAKNNA  274

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  + FP++FAFFDG   P++D G  YTNVFDAN+DT VAAL    H
Sbjct  275   PFTVNIYPFLSL-YLDEHFPINFAFFDGGSTPVNDGGIMYTNVFDANFDTLVAALKAVGH  333

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A   +A RFY G +K LA   GTP RP   I++Y+FGL DE
Sbjct  334   GDMPIIVGEVGWPTDGDKNARVDLAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDE  393

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG+FE HWG+L YDGQ KF +DL+G+ G+  ++   +GIEYLPK WC +  NAK
Sbjct  394   DMKSVAPGSFERHWGVLRYDGQPKFAMDLAGQ-GRNTMLVPAKGIEYLPKTWCVINTNAK  452

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              ++ L  N ++AC  ADCTP+  GSSCNG+      SY FNAYFQAQ Q +++C+FQGL 
Sbjct  453   DVSKLGDNINFACTYADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLA  512

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
               T  + +T  C F I IK
Sbjct  513   VPTETDPTTAQCNFTIQIK  531



>ref|NP_001057968.1| Os06g0590600 [Oryza sativa Japonica Group]
 dbj|BAD32917.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF19882.1| Os06g0590600 [Oryza sativa Japonica Group]
 gb|EAZ01513.1| hypothetical protein OsI_23546 [Oryza sativa Indica Group]
Length=483

 Score =   444 bits (1141),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 295/435 (68%), Gaps = 11/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL PK+VV+MLK NGI KVKLF+     + AL  +GIEVM+G PN +L+
Sbjct  33    VGVNWGSQLSHPLLPKSVVQMLKENGILKVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  92

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y  A+ +VKENVTSY     D +KI  V VGNEPFLK Y      K T+PAL N+Q
Sbjct  93    TMNSYGNAQDWVKENVTSYG----DKLKIKYVAVGNEPFLKAYNGS-FMKTTFPALKNIQ  147

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             KALNEAG+G  VKATVP NADVY+SP   P  S+G FR DI   +  +V+ L ++G+PF+
Sbjct  148   KALNEAGVGDKVKATVPLNADVYVSPDNKP--SSGAFRPDIQGLMTDMVKFLHEHGSPFV  205

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkv  911
             +N+YPFLSL Y  D FP +FAF DG     D  G +Y+NVFDANYDT V AL +     +
Sbjct  206   VNIYPFLSL-YQSDDFPFEFAFVDGGKTIQDKGGISYSNVFDANYDTLVTALKKAGVPSL  264

Query  912   kvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQK  1091
             KVVVGE+GWPTDGD  AN  +A R+Y+G +K L+ K+GTP+RPG  +DVYMFGL+DED K
Sbjct  265   KVVVGEVGWPTDGDKNANLKLARRYYDGLLKKLSKKEGTPLRPGK-MDVYMFGLFDEDMK  323

Query  1092  STLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LT  1268
             S LPGNFE HWGI  YDG+ KF +DLSG G   K + GV G+EYLPK+WC     A+  +
Sbjct  324   SILPGNFERHWGIFTYDGKPKFPMDLSGHGND-KPLAGVPGVEYLPKQWCVFDDGAEDKS  382

Query  1269  NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVT  1448
              L  N  YAC   DCT +  G SCNGL +   +SY FN YFQ QDQ   +CDF GL ++T
Sbjct  383   KLPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKIT  442

Query  1449  TKNLSTPSCRFNIGI  1493
             TKN S   C F I I
Sbjct  443   TKNASARGCAFPIQI  457



>gb|KHN46790.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=436

 Score =   441 bits (1135),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 231/415 (56%), Positives = 287/415 (69%), Gaps = 7/415 (2%)
 Frame = +3

Query  252   MLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLVNYEVAKAFVKENVTSYN  431
             MLK NGIKKVKLF++    ++ALAGTGIEVM+  PN  L ++ +Y  AK +VK+NVT YN
Sbjct  1     MLKDNGIKKVKLFDSDDSTMSALAGTGIEVMVAIPNNQLAEMNDYGRAKQWVKKNVTRYN  60

Query  432   PTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGIGKTVKATVPFNA  611
                  GV +  V VGNEPFLK Y    L  +T PAL N+Q ALNEAG+G  +KATVP NA
Sbjct  61    FNG--GVNVKYVAVGNEPFLKSYNNSFL-NITLPALQNIQNALNEAGLGDKIKATVPLNA  117

Query  612   DVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFLSLFYSKDQFPVDF  791
             DVY SP   PVPSAG+FR DI+  + +IV+ L KNGAPF +N+YPFLSL Y  D FP ++
Sbjct  118   DVYQSPESNPVPSAGIFRPDISGLMTQIVQFLSKNGAPFTVNIYPFLSL-YGNDDFPFNY  176

Query  792   AFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEIGWPTDGDNFANAS  971
             AFFDGVD P++DNG  YTNVFDAN+DT VAAL     G + ++VGE+GWPT+GD  ANA 
Sbjct  177   AFFDGVDNPVNDNGTPYTNVFDANFDTLVAALKSVGFGDLPILVGEVGWPTEGDKNANAG  236

Query  972   MAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNFEPHWGILGYDGQT  1151
              A RFYNG +  LA  +GTP RPG  I+VY+FGL DED KS  PGNFE HWGI  YDGQ 
Sbjct  237   NALRFYNGLLPRLAANRGTPRRPGY-IEVYLFGLIDEDAKSIAPGNFERHWGIFRYDGQP  295

Query  1152  KFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LTNLKANTDYACGRADCTPMSD  1328
             KF +DLSG+  + K + G + ++YL  +WC    +AK L+ L  N +YAC   DCT +  
Sbjct  296   KFPMDLSGQ-NQNKFLIGAQNVKYLAPRWCMFNPDAKDLSKLPDNINYACTFGDCTALGY  354

Query  1329  GSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             GSSCN L      SY FN YFQ Q+Q   +C+FQGL ++TT N+STP+C F + I
Sbjct  355   GSSCNNLDANGNASYAFNMYFQVQNQNPMACNFQGLAKLTTDNISTPTCNFIVQI  409



>ref|XP_010467891.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=477

 Score =   443 bits (1139),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 234/444 (53%), Positives = 302/444 (68%), Gaps = 10/444 (2%)
 Frame = +3

Query  171   GVAGL--DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             G+ G+  DGLGVNWG +++H L PK VV++LK N I KVKLF+  +  + ALAG+G+EVM
Sbjct  12    GIMGIVVDGLGVNWGTMATHKLSPKTVVQLLKDNNINKVKLFDADETTMGALAGSGLEVM  71

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +  PN  LK + +Y+ AK +V+ NVT YN     GV IT V VGNEPFLK Y      K+
Sbjct  72    VAIPNDQLKVMGSYDRAKDWVRHNVTRYNFDG--GVNITSVAVGNEPFLKSYNGS-FIKL  128

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+Q ALNEAG+G +VKATVP NADVY SP   PVPSAG FR DI   + +IV+ 
Sbjct  129   TFPALQNIQNALNEAGLGNSVKATVPLNADVYDSPASNPVPSAGRFRPDIIGPMTQIVDF  188

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L  N AP  IN+YPFLSL Y  D FP+++AFFDG   P+DDNG  YTNVFDAN+DT V++
Sbjct  189   LGNNSAPIAINIYPFLSL-YGNDDFPLNYAFFDGA-PPIDDNGIAYTNVFDANFDTLVSS  246

Query  885   LSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYM  1064
             L    HG + ++VGE+GWPT+GD  AN+  A RFYNG +  L  KKGTP+RP   I+VY+
Sbjct  247   LKAVGHGDMPIIVGEVGWPTEGDKHANSGNAYRFYNGLLPRLGTKKGTPLRP-TYIEVYL  305

Query  1065  FGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCA  1244
             FGL DE+ KS  PG FE HWG+  +DGQ KF +DLSG+ G+ K++ G + + YL  KWC 
Sbjct  306   FGLLDENAKSIAPGPFERHWGLFKFDGQPKFPIDLSGQ-GQNKLLIGAQNVTYLSSKWCM  364

Query  1245  LKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
                ++K LT L  N ++AC  +DCT +  GSSCN L      SY FN YFQ ++Q + +C
Sbjct  365   FNPDSKDLTKLADNINFACTYSDCTALGYGSSCNSLDANGNASYAFNMYFQEKNQDEYAC  424

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGI  1493
              FQG+  +TT+N+S   C F I I
Sbjct  425   VFQGMATITTQNISQGQCNFPIQI  448



>ref|XP_004982257.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X1 
[Setaria italica]
Length=495

 Score =   443 bits (1140),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 237/450 (53%), Positives = 305/450 (68%), Gaps = 13/450 (3%)
 Frame = +3

Query  174   VAGL---DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             VAGL     LGVNWG +++H LP   VV+ML+ NGI+KVKLF+     ++ALAG+GIEVM
Sbjct  20    VAGLPAAGALGVNWGTMATHRLPSGTVVRMLQDNGIRKVKLFDADPGPMDALAGSGIEVM  79

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +G PN +L  + +Y  A+ +V ENV+ YN     GV I  V VGNEPFL  +       V
Sbjct  80    VGIPNNMLDMMTDYGTARDWVHENVSRYNFDG--GVTIKYVAVGNEPFLSAFNGT-FLNV  136

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T PAL N+Q+AL++AG+G+++KATVP NADVY SP   PVPSAG FR DIAD + +IV+ 
Sbjct  137   TLPALQNIQRALDDAGLGESIKATVPLNADVYNSPVSNPVPSAGRFRSDIADLMTEIVQF  196

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L+++GAPF +N+YPFLSL Y  D FP+D+AFFDG   P+ D  +G TYTNVFDAN+DT V
Sbjct  197   LNQSGAPFTVNIYPFLSL-YGSDGFPLDYAFFDGTSSPVVDAGSGITYTNVFDANFDTLV  255

Query  879   AALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDV  1058
             +AL+    G + VVVGE+GWPTDGD  A A+ A +FY G ++ LA   GTP+RP   I+V
Sbjct  256   SALAAAGAGGLPVVVGEVGWPTDGDTHATAAYAQKFYAGLLRKLAANAGTPLRPSQYIEV  315

Query  1059  YMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLS-GKGGK--GKIMTGVEGIEYLP  1229
             Y+F L DED KS  PGNFE HWGI+ YDGQ K+ +DLS G+GG      +    G++YLP
Sbjct  316   YLFSLIDEDAKSVAPGNFERHWGIVRYDGQPKYPMDLSGGQGGNAAPAALVAARGVQYLP  375

Query  1230  KKWCALKANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQ  1406
             ++WC    NA  T+ +     YAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q
Sbjct  376   RQWCVANPNAPDTSRISDGVAYACSLSDCTALGYGSSCNGLDAAGNASYAFNMYFQVQNQ  435

Query  1407  AKDSCDFQGLGEVTTKNLSTPSCRFNIGIK  1496
             A+ SCDFQGL   T +N ST +C F I I+
Sbjct  436   AEGSCDFQGLAVTTAQNPSTDACNFTIQIE  465



>ref|NP_187051.3| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF05860.1|AC011698_11 putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABJ98575.1| At3g04010 [Arabidopsis thaliana]
 gb|AEE74025.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=491

 Score =   443 bits (1140),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 294/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+ GLGVNWG ++SH LPPK VV+MLK N I+KVKLF+     + ALAG+G+EVM+  PN
Sbjct  29    GVSGLGVNWGTMASHQLPPKTVVEMLKDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LL  + NY+ AK +V+ NV+ +N    +GVKI  V VGNEPFL  Y       +TYPAL
Sbjct  89    DLLLAMGNYQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G   KATVP NADVY SPP   VPSAG FR DI  ++ +IV  L +N 
Sbjct  146   FNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ S D FP ++AFFDG    ++DNG  YTNVFDA++DT +A+L+   
Sbjct  206   APFTVNIYPFLSLYLSSD-FPFEYAFFDG-QNTVNDNGVIYTNVFDASFDTLLASLNALN  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN   A RFY+G +  LA   GTP+R G  I+VY+FG  D
Sbjct  264   HGNMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DGQ KF +D  G+G K K +TG + ++Y   +WC    N 
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQK-KFLTGAQNVQYFLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  ++ L  N +YAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+G
Sbjct  382   RGNMSRLGDNINYACSHSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTQNISQGQCNFPIQI  461



>ref|XP_010463871.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   443 bits (1140),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 293/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + GLGVNWG +++H LPPK VV+M K N I+KVKLF+     + ALAG+G+EVM+  PN 
Sbjct  30    VSGLGVNWGTMATHQLPPKTVVEMFKDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPND  89

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLK + N++ AK +V+ NV+ +N    +GVKI  V VGNEPFL  Y       +TYPAL 
Sbjct  90    LLKAMGNFQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  146

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  +KATVP NADVY SPP   VPSAG FR DI  ++ +IV  L +N A
Sbjct  147   NIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNKA  206

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFFDG    ++DNG  YTNVFDA++DT VA+L+   H
Sbjct  207   PFTVNIYPFLSLYLSSD-FPFDYAFFDG-QNTVNDNGVIYTNVFDASFDTLVASLNALNH  264

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G ++V+VGE+GWPTDGD  AN   A RFY+G +  L+   GTP+R G  I+VY+FG  DE
Sbjct  265   GDMEVIVGEVGWPTDGDKNANIQNAERFYSGLLPRLSNNVGTPMRKGY-IEVYLFGFIDE  323

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  +DGQ KF  D  G+G K K +TG   ++Y+  +WC    N +
Sbjct  324   DAKSVAPGNFERHWGIFKFDGQPKFPFDFRGQGQK-KFLTGARNVQYMLNQWCMFNPNGR  382

Query  1263  --LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+GL
Sbjct  383   GNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
               +TT+N+S   C F I I
Sbjct  443   ATITTRNISQGQCNFPIQI  461



>ref|XP_006657484.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=480

 Score =   442 bits (1138),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 232/439 (53%), Positives = 298/439 (68%), Gaps = 11/439 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLG+NWG  ++HPLPPK VV+ML+ NGI KVKLF+T    ++ALAG+GIEVM+  PN  
Sbjct  21    EGLGMNWGTQATHPLPPKVVVQMLRDNGITKVKLFDTDFAAMSALAGSGIEVMVAIPNKD  80

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             L  +  +Y  A+++VK+NV  Y+     GV I  V VGNEPFLK Y       +T PAL 
Sbjct  81    LNTMASDYSNAQSWVKKNVKRYDFDG--GVTIKYVAVGNEPFLKTYNGS-FINITLPALQ  137

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AGIG  +KATVP NADVY       +PSAG FR +I+  +  IV+ L KN A
Sbjct  138   NIQNALNDAGIGDRIKATVPLNADVY----DGQLPSAGRFRPEISGLMTDIVKFLAKNNA  193

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FPV++AFFDG   P++D G  YTNVFDAN+DT VAAL    H
Sbjct  194   PFTVNIYPFLSL-YLDDNFPVNYAFFDGGSTPVNDGGVLYTNVFDANFDTLVAALKGVGH  252

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD  A  ++A RFY G +K LA   GTP RP   I++Y+FGL DE
Sbjct  253   GDMPIIVGEVGWPTDGDKNAKVALAQRFYAGLLKRLAANVGTPARPNQYIEMYLFGLVDE  312

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG+FE HWG+L YDGQ KF +DL+G+ G+  ++    G++YL K WC +  NAK
Sbjct  313   DAKSVAPGSFERHWGVLRYDGQPKFAMDLTGQ-GRNTMLVPARGVQYLSKTWCVINTNAK  371

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L+NL    ++AC  ADCTP+  GSSCNG+      SY FNAYFQAQ Q +++C+FQGL 
Sbjct  372   DLSNLGDKINFACTFADCTPLGFGSSCNGMDTNGNASYAFNAYFQAQSQKEEACNFQGLA  431

Query  1440  EVTTKNLSTPSCRFNIGIK  1496
               T  + ST +C F I IK
Sbjct  432   VPTQTDPSTNACNFTIQIK  450



>dbj|BAJ85378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   442 bits (1138),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 226/440 (51%), Positives = 300/440 (68%), Gaps = 10/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              LGVNWG ++SH LPP  VV+ML+ NGI+KVKLF+     L ALAG+GIEVM+  PN +L
Sbjct  26    ALGVNWGTMASHQLPPSTVVRMLQDNGIRKVKLFDADAEPLGALAGSGIEVMVAIPNNML  85

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALAN  545
               + +Y+ A+ +V +NV++YN     GV I  V VGNEPFL      G F  VT+PAL N
Sbjct  86    DMMTDYDTAREWVHKNVSAYNFDG--GVNIRYVAVGNEPFLS--SLNGTFLNVTFPALRN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL+EAG+G TVKATVP NADVY SP    VPSAG FR +IA  + +IV+ L+++GAP
Sbjct  142   IQQALDEAGVGDTVKATVPLNADVYESPKDNSVPSAGRFRPEIAGLMTEIVQFLNQSGAP  201

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YP+LSL Y  D FP+DFAFFDG   P+ D    YTNVFDAN+DT V+AL++   G
Sbjct  202   FTVNIYPYLSL-YGNDDFPLDFAFFDGASSPVVDGSIQYTNVFDANFDTLVSALAKAGVG  260

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + VVVGE+GWPTDG+  A A+ A RFY G  + LAG  GTP+RP   +++Y+F L DED
Sbjct  261   GLPVVVGEVGWPTDGEKHATAAYAQRFYAGLFRKLAGNAGTPLRPNQYMEIYLFSLIDED  320

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--  1259
              KS  PGNFE HWG++ YDGQ K+ +D +G+ G+   +TG  G++YLP+ WC L  N+  
Sbjct  321   MKSIAPGNFERHWGVMRYDGQPKYAMDPTGQ-GRNTALTGARGVDYLPRAWCVLNTNSPP  379

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               ++ L  N  YAC  ADCT +S GS+C+G+      SY FN YFQ QDQ +++C F GL
Sbjct  380   ENMSRLGDNVGYACTNADCTSLSYGSTCSGMDAAGNASYAFNTYFQMQDQVEEACGFDGL  439

Query  1437  GEVTTKNLSTPSCRFNIGIK  1496
                T ++ ST +C F I ++
Sbjct  440   AVRTRQDPSTGTCNFTIQLE  459



>ref|XP_004979540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=490

 Score =   442 bits (1138),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 296/441 (67%), Gaps = 16/441 (4%)
 Frame = +3

Query  201   NWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV  380
             NWG +S+  LPPK + ++L  NG +KVK+F+  +  +  LAGTGIE M+  PN LL  + 
Sbjct  28    NWGTMSTRRLPPKVMARLLADNGFRKVKIFDADERTMEGLAGTGIETMVAVPNDLLAAVA  87

Query  381   NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALANMQKA  557
             +Y  A+ +VKENVT Y      GV I  V VGNEPFL+ Y   G F +VT PAL N+Q+A
Sbjct  88    DYARAREWVKENVTRY--AFDGGVNIRFVAVGNEPFLRAY--NGSFDRVTVPALRNIQRA  143

Query  558   LNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMIN  737
             L+EAG G  VKATVP NADVY SPP  PVPSAG FR D+A  + ++V +L+++GAP  +N
Sbjct  144   LDEAGHGGAVKATVPVNADVYDSPPGNPVPSAGRFRADVAGVMTEMVRLLNRSGAPLTVN  203

Query  738   VYPFLSLFYSKDQFPVDFAFFD----GVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             +YPFLSL Y  D FP+D+AFFD    G  KP+ D    YTNVFDAN+DT V+AL R   G
Sbjct  204   IYPFLSL-YGNDDFPLDYAFFDDAGAGKAKPVVDGRVNYTNVFDANFDTLVSALKRVGFG  262

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
             ++ V++GE+GWPTDGD  A A++A RFY G ++ LA +KGTP+RP A I+VY+FGL DED
Sbjct  263   RLPVMIGEVGWPTDGDKHATAALAERFYKGLLRRLAARKGTPLRPNARIEVYLFGLMDED  322

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS  PGNFE HWG+   DG+ KF LDL G GG+  +     G+EYLP++WC L  +A  
Sbjct  323   AKSVAPGNFERHWGLFTSDGRPKFPLDLRG-GGRPAMPVPARGVEYLPRRWCVLNPDAAA  381

Query  1266  ---TNLKANTDYACGRADCTPMSDGSSCNG--LSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                  L  N  YACGRADCTP+  G SC G  L      SY FNAY+Q+Q QA+ +CDFQ
Sbjct  382   GGDDRLAGNVGYACGRADCTPLGYGCSCGGGALDARGNASYAFNAYYQSQGQAESACDFQ  441

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  V  K+ S  +C+F++G 
Sbjct  442   GLAVVVDKDPSLGACKFSVGF  462



>gb|KFK37837.1| hypothetical protein AALP_AA3G035600 [Arabis alpina]
Length=553

 Score =   445 bits (1144),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 292/440 (66%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+  LGVNWG +++H LPPK VV+ML+ N IKKVKLF+     + ALAG+G+EVM+  PN
Sbjct  29    GVSALGVNWGTMATHQLPPKTVVEMLRDNNIKKVKLFDADTKTMGALAGSGVEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LL+ + NY+ AK +V+ NVT +N    +GVKI  V VGNEPFL  Y       +TYPAL
Sbjct  89    DLLQAMGNYQRAKDWVQRNVTRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALN+AGIG  +KATVP NADVY SPP   VPSAG FR DI  ++  IV  L +N 
Sbjct  146   VNIQTALNDAGIGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIMQEMTNIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ + D FP D+ FFDG    ++DNG  YTNVFDAN+DT +A+L+   
Sbjct  206   APFTVNIYPFLSLYLTSD-FPFDYTFFDG-QNTVNDNGVVYTNVFDANFDTLLASLNALN  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN   A RFY G +  LA   GTP+R G  I+VY+FG  D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVPNAERFYAGLLPRLANNVGTPMRKGY-IEVYLFGFID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             E+ KS  PGNFE HWG+  +DGQ KF +D  G+G K K +TG + ++YL  +WC    N 
Sbjct  323   EEAKSVAPGNFERHWGLFKFDGQPKFPVDFIGQGQK-KFLTGAQNVQYLLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  ++    N DYAC RADCT +  GSSC  L      SY FN YFQ Q+Q   +CDF G
Sbjct  382   RGNISKFGDNVDYACSRADCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFDG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTQNISQGQCNFPIQI  461



>gb|EAZ37505.1| hypothetical protein OsJ_21839 [Oryza sativa Japonica Group]
Length=483

 Score =   442 bits (1137),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 295/435 (68%), Gaps = 11/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL PK+VV+MLK NGI KVKLF+     + AL  +GIEVM+G PN +L+
Sbjct  33    VGVNWGSQLSHPLLPKSVVQMLKENGILKVKLFDADPWPVGALVDSGIEVMLGIPNDMLE  92

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y  A+ +VKENVTSY     D +KI  V VGNEPFLK Y      K T+PAL N+Q
Sbjct  93    TMNSYGNAQDWVKENVTSYG----DKLKIKYVAVGNEPFLKAYNGS-FMKTTFPALKNIQ  147

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             KALNEAG+G  VKATVP NADVY+SP   P  S+G FR DI   +  +V+ L ++G+PF+
Sbjct  148   KALNEAGVGDKVKATVPLNADVYVSPDNKP--SSGAFRPDIQGLMTDMVKFLHEHGSPFV  205

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkv  911
             +N+YPFLSL Y  D FP +FAF DG     D  G +Y+NVFDANYDT V AL +     +
Sbjct  206   VNIYPFLSL-YQSDDFPFEFAFVDGGKTIQDKGGISYSNVFDANYDTLVTALKKAGVPSL  264

Query  912   kvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQK  1091
             KVVVGE+GWPTDGD  AN  +A R+Y+G +K L+ K+GTP+RPG  +DVYMFGL+DED K
Sbjct  265   KVVVGEVGWPTDGDKNANLKLARRYYDGLLKKLSKKEGTPLRPGK-MDVYMFGLFDEDMK  323

Query  1092  STLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LT  1268
             S LPGNFE HWGI  YDG+ KF +DLSG G   K + GV G+EYLPK+WC     A+  +
Sbjct  324   SILPGNFERHWGIFTYDGKPKFPMDLSGHGND-KPLAGVPGVEYLPKQWCVFDDGAEDKS  382

Query  1269  NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVT  1448
              L  N  YAC   DCT +  G SCNGL +   +SY FN Y+Q QDQ   +CDF GL ++T
Sbjct  383   KLPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYYQMQDQDVRACDFDGLAKIT  442

Query  1449  TKNLSTPSCRFNIGI  1493
             TKN S   C F I I
Sbjct  443   TKNASARGCAFPIQI  457



>ref|XP_010517383.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=493

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 227/439 (52%), Positives = 294/439 (67%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + GLGVNWG +++H LPPK VV+ML+ N I+KVKLF+     + ALAG+G+EVM+  PN 
Sbjct  30    VSGLGVNWGTMATHQLPPKTVVEMLRDNNIQKVKLFDADTNTMGALAGSGVEVMVAIPND  89

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             LLK + N++ AK +V+ NV+ +N    +GVKI  V VGNEPFL  Y       +TYPAL 
Sbjct  90    LLKAMGNFQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPALF  146

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALNEAG+G  +KATVP NADVY SPP   VPSAG FR DI  ++ +IV  L +N A
Sbjct  147   NIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNKA  206

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL+ S D FP D+AFFDG    ++DNG  YTNVFDA++DT VA+L+   H
Sbjct  207   PFTVNIYPFLSLYLSSD-FPFDYAFFDG-QNTVNDNGVIYTNVFDASFDTLVASLNALNH  264

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G ++V+VGE+GWPTDGD  AN   A RFY+G +  L+   GTP+R G  I+VY+FG  DE
Sbjct  265   GDMEVIVGEVGWPTDGDKNANVQNAERFYSGLLPRLSNNLGTPMRKGY-IEVYLFGFIDE  323

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  +DG+ KF  D  G+G K K +TG   ++Y+  +WC    N +
Sbjct  324   DAKSVAPGNFERHWGIFKFDGKPKFPFDFRGQGQK-KFLTGARNVQYMLNQWCMFNPNGR  382

Query  1263  --LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+GL
Sbjct  383   GNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEGL  442

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
               +TT+N+S   C F I I
Sbjct  443   AMITTRNISQGQCNFPIQI  461



>ref|XP_010528719.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Tarenaya 
hassleriana]
Length=493

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 236/435 (54%), Positives = 295/435 (68%), Gaps = 9/435 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++H LPPK VV+MLK N I KVKLF+  +  + ALAG+GIEVM+  PN  
Sbjct  28    NGLGVNWGTMATHKLPPKTVVQMLKDNNINKVKLFDAEESTMRALAGSGIEVMVAIPNDQ  87

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L+ + +Y+ AK +V+ NV+ YN     GV IT V VGNEPFL  Y       +T+PAL N
Sbjct  88    LRVMGSYDRAKEWVQRNVSRYNFDG--GVNITYVAVGNEPFLTSYNG-SFVNLTFPALQN  144

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q ALNEA +G  VKATVP NADVY SP    VPSAG FR DI  Q+ +IV+ L KN AP
Sbjct  145   VQNALNEARLGH-VKATVPLNADVYDSPANNQVPSAGRFRPDIISQMTEIVDFLGKNNAP  203

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F IN+YPFLSL+ S D FP D+AFFDG  + + DNG  Y NVFDAN+DT V+AL    HG
Sbjct  204   FTINIYPFLSLYGSSD-FPFDYAFFDGPTQ-IVDNGIQYNNVFDANFDTLVSALKAIGHG  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + ++VGE+GWPTDGD  AN   A R+YNG +  LA  KGTP+RPG  I+VY+FGL DED
Sbjct  262   DMPIIVGEVGWPTDGDKNANTGNALRYYNGLLPRLAANKGTPLRPGY-IEVYLFGLLDED  320

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI+ +DGQ KF LDL G+ G+ K + G + ++YL  KWC     AK 
Sbjct  321   AKSIAPGNFERHWGIVRFDGQPKFPLDLLGQ-GQNKFLIGAQNVKYLQNKWCMFNPEAKD  379

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++ L  N DYAC  +DCT +  GSSCN L      SY FN YFQ ++Q +D+C FQGL  
Sbjct  380   ISKLAENVDYACTHSDCTALGFGSSCNSLDAHGNASYAFNMYFQVRNQEEDACFFQGLAT  439

Query  1443  VTTKNLSTPSCRFNI  1487
             +TT+N+S   C F I
Sbjct  440   ITTQNISQGQCDFPI  454



>ref|NP_001147672.1| glucan endo-1,3-beta-glucosidase 5 [Zea mays]
 gb|ACG28332.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=492

 Score =   442 bits (1136),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 229/442 (52%), Positives = 298/442 (67%), Gaps = 6/442 (1%)
 Frame = +3

Query  171   GVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIG  350
             G+     LGVNWG +++H LP   VV+ML+ NGI+KVKLF+     ++ALAGT +EVM+ 
Sbjct  27    GLPAAGALGVNWGTMATHQLPTATVVRMLEDNGIRKVKLFDADAGPMDALAGTSVEVMVA  86

Query  351   TPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
              PN +L  + +Y  A+ +V++NV+ YN     GV I  V VGNEPFL  +       VT 
Sbjct  87    IPNNMLDMMTDYGTARDWVRQNVSRYNFDG--GVNIKYVAVGNEPFLSSFNGT-FLNVTL  143

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q+ALN+AG G T+KATVP NADVY SP    VPSAG FR DIA  + +IV+ L+
Sbjct  144   PALQNIQRALNDAGFGDTIKATVPLNADVYNSPKDNLVPSAGRFRPDIAGLMTEIVQFLN  203

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
             ++GAPF +N+YPFLSL Y  D FP+D+AFFDG   P+ DNG  YTNVFDAN+DT V+AL+
Sbjct  204   QSGAPFTVNIYPFLSL-YDNDDFPLDYAFFDGTGSPVVDNGIQYTNVFDANFDTLVSALA  262

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
                 G + VVVGE+GWPTDGD  A A+ A +FY G ++ LA   GTP+RPG  I+VY+F 
Sbjct  263   AAGVGGLPVVVGEVGWPTDGDKHATAAFAQKFYAGLLRKLAASAGTPLRPGQYIEVYLFS  322

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWGI+ YDGQ K+ +DLSG+ G+   +    G++YLP++WC + 
Sbjct  323   LIDEDAKSVAPGNFERHWGIMRYDGQPKYAMDLSGQ-GRNTALVAARGVQYLPRQWCVVN  381

Query  1251  ANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              NA+ T+ +  +  YAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q + SC F
Sbjct  382   PNAQDTSKIGDSVTYACTFSDCTSLGYGSSCNGLDAAGNASYAFNMYFQVQNQVEGSCYF  441

Query  1428  QGLGEVTTKNLSTPSCRFNIGI  1493
             QGL   T +N ST +C F I I
Sbjct  442   QGLAVPTAQNPSTDACNFTIQI  463



>ref|XP_003561381.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=494

 Score =   442 bits (1136),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 295/446 (66%), Gaps = 10/446 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG  +SHPLP K VV++L+ NGIKKVKLF T    ++ALAG+GIEVM   PN +
Sbjct  25    EGLGVNWGTQASHPLPAKVVVQLLRDNGIKKVKLFETNLDAMSALAGSGIEVMAAIPNNM  84

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
             L D+  + + A+ +VK NV  ++     GV I  V VGNEPFL+ Y      K T PAL 
Sbjct  85    LHDMAADPKAARDWVKRNVKRFDFDG--GVIIKYVAVGNEPFLEAYNGS-FIKATLPALE  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG G  +KATVP NADVY SP   PVPSAG FR DI+  +  IV+ L KN A
Sbjct  142   NIQNALNDAGAGDRIKATVPLNADVYNSPAKNPVPSAGRFRSDISGVMTDIVKFLAKNKA  201

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL+ S D FP+DFAFFD    P+ D  NG TYTNVFDAN+DT VAAL   
Sbjct  202   PFTVNIYPFLSLYLS-DDFPLDFAFFDDGGPPVHDGGNGVTYTNVFDANFDTLVAALRAA  260

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADID-VYMFGL  1073
              HG + V+VGE+GWPTDGD  A A++A RFY G +K LA   G+P RPG  I+ VY+FGL
Sbjct  261   GHGDMPVIVGEVGWPTDGDRRATAALAERFYGGLLKRLATTHGSPARPGQRIEAVYLFGL  320

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKI-MTGVEGIEYLPKKWCALK  1250
              DED+KS  PG+FE HWGI  YDGQ K+ +DL+G+G +    +   +G+EYL + WCAL 
Sbjct  321   VDEDRKSVAPGSFERHWGIFRYDGQPKYGMDLAGQGRRANARLVPAKGVEYLSRTWCALN  380

Query  1251  ANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
               A  L  L    DYAC  ADCT +  GS+CNG+      SY FNAY+Q Q Q  ++CDF
Sbjct  381   PKAGDLGKLGEKIDYACSNADCTTLGYGSTCNGMDARGNASYAFNAYYQTQSQKDEACDF  440

Query  1428  QGLGEVTTKNLSTPSCRFNIGIKLGA  1505
             QGL   T  + ST +C F I I   A
Sbjct  441   QGLALPTQTDPSTHACNFTIQIATSA  466



>gb|KDP35276.1| hypothetical protein JCGZ_09435 [Jatropha curcas]
Length=468

 Score =   441 bits (1133),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 298/439 (68%), Gaps = 13/439 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG+I+SHPL P  VV+MLK NGIK+VKLF+     LN LAG+GIEVM+  PN LL
Sbjct  10    GLGVNWGNIASHPLNPNIVVQMLKDNGIKRVKLFDFDSWTLNCLAGSGIEVMVAIPNKLL  69

Query  369   KDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +D+  +Y+ AK +VK+NV  Y      GV I  V VGNEPFLK Y+ + L K T+PAL N
Sbjct  70    EDMATSYDHAKDWVKDNVAEY-LKDKGGVDIRYVAVGNEPFLKAYDGEYL-KTTFPALKN  127

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKALNE  +G  +KAT+PFNADVY        PS G FR D+ D ++KIV+ L ++ AP
Sbjct  128   IQKALNEHKLGDKIKATIPFNADVYDGNK----PSEGNFRSDVRDVMQKIVKFLHQHKAP  183

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPF+S+ Y    FP+D+AFF+G  + + D   +Y+NVFDANYDT V +L +    
Sbjct  184   FVVNIYPFISV-YQSSGFPLDYAFFEGSSRKVSDKNVSYSNVFDANYDTLVWSLEKAGVP  242

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              ++++VGEIGWPTDG  +AN   A RFY+G ++ LA KKGTP+RPG  I VY+FGL DED
Sbjct  243   NLEILVGEIGWPTDGSPYANTQYAGRFYDGLLRRLASKKGTPLRPGI-IIVYLFGLLDED  301

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS  PGNFE HWGI  YDGQ KF +DLSG+ GK K++   +G++YLPK+WC L  +   
Sbjct  302   MKSIEPGNFERHWGIYRYDGQPKFPIDLSGQ-GKNKMLVAAKGVQYLPKQWCVLSEDVID  360

Query  1266  TN---LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
              N   + A   YAC R+DCT ++ GSSC  +     VSY FN YFQ  DQ   +CDF GL
Sbjct  361   ANNNLIPAGLTYACSRSDCTSLTYGSSCGSMQLRSNVSYAFNMYFQMNDQDVAACDFNGL  420

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
             G + T+N S  +C F I I
Sbjct  421   GTIVTRNASQGTCLFPIQI  439



>ref|XP_008778100.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=466

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 236/435 (54%), Positives = 295/435 (68%), Gaps = 12/435 (3%)
 Frame = +3

Query  219   SHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV-NYEVA  395
             SHP+ P  VV+MLKANGI KVKLF+     +NALAGT IEVM+  PN  L D+  NYE A
Sbjct  2     SHPMDPAMVVRMLKANGINKVKLFDADPWTVNALAGTRIEVMLAIPNDHLGDMSSNYENA  61

Query  396   KAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVT-YPALANMQKALNEAG  572
             K +VK+NV  ++    DGV I  V VGNEPFL+ Y  +G F  T +PAL N+Q+AL+EAG
Sbjct  62    KDWVKQNVVKHD--RKDGVNIKYVAVGNEPFLRSY--KGSFASTAFPALKNIQRALDEAG  117

Query  573   IGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFL  752
             +G  +KAT+P NAD+Y SP    VPSAG FR DI   + KIV  LD  G+PF++N+YP+L
Sbjct  118   VGDRIKATIPQNADIYSSPVNDSVPSAGNFRRDIRALMTKIVRYLDSKGSPFVVNIYPYL  177

Query  753   SLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEI  932
             SL Y    FPVDFAFFDG  +P+ D G  YTNVFDANYDT V +L +     +K++VGEI
Sbjct  178   SL-YQDPNFPVDFAFFDGKSQPVVDEGLRYTNVFDANYDTLVWSLRKAGVPNMKILVGEI  236

Query  933   GWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNF  1112
             GWPTDGD  AN   A RFY+G +K +A + GTP+RPG  ++VY+FGL DED KS  PGNF
Sbjct  237   GWPTDGDKNANTKHAKRFYDGLLKKVAKEVGTPLRPGK-MEVYLFGLIDEDMKSVEPGNF  295

Query  1113  EPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA---KLTNLKAN  1283
             E HWGI  YDG+ KF  D +GK GK + + G  G+ YLPK+WCAL   A   KL  + ++
Sbjct  296   ERHWGIFSYDGRPKFPTDFTGK-GKDRYLVGATGVRYLPKRWCALDETAAKKKLKMIPSS  354

Query  1284  TDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLS  1463
              +YAC   DCTP+  GSSC GLS +  +SY FNAYFQ  DQ   +CDF+GLG+V T NLS
Sbjct  355   VNYACSTGDCTPLGYGSSCQGLSLSGNISYAFNAYFQTMDQDVRACDFEGLGKVATTNLS  414

Query  1464  TPSCRFNIGIKLGAE  1508
               +C F + I    E
Sbjct  415   QGTCLFPVQIVSAGE  429



>ref|XP_006297514.1| hypothetical protein CARUB_v10013538mg [Capsella rubella]
 gb|EOA30412.1| hypothetical protein CARUB_v10013538mg [Capsella rubella]
Length=493

 Score =   441 bits (1133),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 294/440 (67%), Gaps = 9/440 (2%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G+ GLGVNWG +++H LPPK VV+ML+ N I+KVKLF+     + ALAG+GIEVM+  PN
Sbjct  29    GVSGLGVNWGTMATHQLPPKTVVEMLRDNNIQKVKLFDADTNTMGALAGSGIEVMVAIPN  88

Query  360   ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LLK + N + AK +V+ NV+ +N    +GVKI  V VGNEPFL  Y       +TYPAL
Sbjct  89    DLLKAMGNPQRAKDWVQRNVSRFNFN--NGVKIKYVAVGNEPFLTAYNGS-FINLTYPAL  145

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G  +KATVP NADVY SPP   VPSAG FR DI  ++ +IV  L +N 
Sbjct  146   FNIQTALNEAGVGDFIKATVPLNADVYNSPPDNQVPSAGRFRSDIIQEMTQIVNFLAQNK  205

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL+ S  +FP D+AFFDG    ++DNG  YTNVFDAN+DT +A+L    
Sbjct  206   APFTVNIYPFLSLYLSS-EFPFDYAFFDG-QNTVNDNGVIYTNVFDANFDTLLASLKALD  263

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             HG ++V+VGE+GWPTDGD  AN   A RFY+G +  LA   GTPVR G  I+VY+FGL D
Sbjct  264   HGDMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRLANNVGTPVRKGY-IEVYLFGLID  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF +   G+G K K +TG   ++Y+  +WC    N 
Sbjct  323   EDAKSVAPGNFERHWGIFKFDGKPKFPVGFGGQGQK-KYLTGARNVQYMLNQWCMFNPNG  381

Query  1260  K--LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             +  ++ L  N DYAC  +DCT +  GSSC  L      SY FN YFQ Q+Q   +CDF+G
Sbjct  382   RGNMSKLGDNIDYACSLSDCTALGYGSSCGNLDANGNASYAFNMYFQVQNQEAQACDFEG  441

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  +TT+N+S   C F I I
Sbjct  442   LATITTRNISQGQCNFPIQI  461



>ref|XP_010086599.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB22055.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=488

 Score =   440 bits (1132),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 231/419 (55%), Positives = 288/419 (69%), Gaps = 9/419 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++H LPPK VV+MLK NGI+KVKLF+T    ++ALAG+GIEV +  PN 
Sbjct  30    VEGLGVNWGTQATHKLPPKTVVQMLKDNGIQKVKLFDTDDSTMSALAGSGIEVFVAIPND  89

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +++ A+ +VK NVT YN +   GV I  V VGNEPFL  Y    L  VT+PAL 
Sbjct  90    QLSAMNSFKRAQDWVKRNVTRYNFSG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQ  146

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q+ALNEAG+G ++KATVP NADVY SP   P PSAG FR DI   + +IV+ L++N A
Sbjct  147   NIQRALNEAGVGDSIKATVPLNADVYNSPESNPFPSAGRFRTDINQLMTQIVQFLNENKA  206

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSRE  896
             PF +N+YPFLSL Y  D FP D+AFFDGV   + D   G  YTNVFDAN+DT VAAL   
Sbjct  207   PFTVNIYPFLSL-YGNDHFPFDYAFFDGVSNTILDPSTGIQYTNVFDANFDTLVAALRAA  265

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
              +G + ++VGE+GWPTDGD  AN   A RFYNG +  LA  +GTP+RPG  I+VY+FGL 
Sbjct  266   GYGDMTILVGEVGWPTDGDKNANTGYAYRFYNGLLPRLASNRGTPLRPGY-IEVYLFGLI  324

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI  YDGQ KF +DLSG+ G+ K++   + +EYLP KWC    N
Sbjct  325   DEDAKSVAPGNFERHWGIFRYDGQPKFPVDLSGQ-GQNKLLVPAKNVEYLPNKWCMFNPN  383

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             AK L+ L  N DYAC  +DCT +  GSSCN L      SY FN YFQ Q+Q   +C+FQ
Sbjct  384   AKDLSKLADNIDYACTFSDCTALGYGSSCNNLDSNGNASYAFNMYFQVQNQDDMACNFQ  442



>ref|XP_002325410.1| hypothetical protein POPTR_0019s04850g [Populus trichocarpa]
 gb|EEE99791.1| hypothetical protein POPTR_0019s04850g [Populus trichocarpa]
Length=508

 Score =   441 bits (1134),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 301/466 (65%), Gaps = 33/466 (7%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG ++   LPP+ VV+MLK NGI KVKLF+  +  + +LAGTGIEVM+  PN 
Sbjct  20    VDGLGVNWGTMAIRKLPPETVVQMLKDNGILKVKLFDADQNTMTSLAGTGIEVMVAIPND  79

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPD-----GVKITL---------------------  464
              L  + +Y  AK +VK NVT Y+    +     G KI L                     
Sbjct  80    QLAVMGDYNRAKDWVKRNVTRYDFDGGEFVVFVGGKICLPFLNKLVIMTSQGIINAVEKY  139

Query  465   VGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPV  644
             V VGNEPFLK Y    L   T+PAL N+Q ALN+AG+G ++KATVPFNADVY SP     
Sbjct  140   VAVGNEPFLKSYNGSFL-NTTFPALRNIQNALNDAGVGDSIKATVPFNADVYNSPDDQAY  198

Query  645   PSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLD  824
             PS+G FR DI D + ++V+ L +N APF +N+YPFLSL Y  D FP D+AFFDG  +P+ 
Sbjct  199   PSSGRFRSDINDIMTEMVQFLGQNNAPFTVNIYPFLSL-YGNDDFPFDYAFFDGAPQPVV  257

Query  825   DNGK--TYTNVFDANYDTAVAALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGF  998
             D G    YTNVFDAN+DT V+AL    HG + ++VGE+GWPTDGD  AN   A RFYNG 
Sbjct  258   DRGTGIQYTNVFDANFDTLVSALKAAGHGDMPIIVGEVGWPTDGDKNANIGNAIRFYNGL  317

Query  999   IKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGK  1178
             +  LAG +GTP+RPG  I+VY+FGL DED KS  PGNFE HWGI  YDGQ KF +DLSG+
Sbjct  318   LPRLAGNRGTPLRPGY-IEVYLFGLLDEDAKSIAPGNFERHWGIFRYDGQPKFPMDLSGQ  376

Query  1179  GGKGKIMTGVEGIEYLPKKWCALKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSD  1355
                 K + G + ++YLP KWC    NAK L+ L  N +YAC R+DCT +  GSSCNGL  
Sbjct  377   VAN-KWLVGAQNVQYLPSKWCMFNPNAKDLSKLADNINYACSRSDCTALGYGSSCNGLDT  435

Query  1356  TEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
                 SY FN Y+Q Q+Q + +C+F+GL  VT +N+S  +C F I I
Sbjct  436   NGNASYAFNMYYQVQNQDEFACNFEGLAMVTEQNISQGNCNFTIQI  481



>ref|XP_010672072.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=478

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/439 (52%), Positives = 298/439 (68%), Gaps = 9/439 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  ++H LP   VV+MLK N I+KVKLF+  + +L+AL+GTGIEVM+  PN 
Sbjct  23    VEGIGVNWGTQANHKLPLNTVVQMLKDNRIQKVKLFDADESILSALSGTGIEVMVAIPNG  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VTYPAL  539
              L  +++   A+ +V+ NV  YN     GV I  V VGNEPFL+ Y   G F+  T PAL
Sbjct  83    DLVTMLDSNQARRWVERNVVRYNFRG--GVNIKYVAVGNEPFLRSYN--GTFENATLPAL  138

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q ALNEAG+G TVKATVP NADVY SPP  PVPSAG FR D+A  + ++V+ + +N 
Sbjct  139   VNIQNALNEAGVGNTVKATVPLNADVYGSPPSNPVPSAGRFRADVAVLMTQMVQFMSQNN  198

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL Y    FPV++AFFDG   PLDDNG  YTNVFDAN+DT V+AL+   
Sbjct  199   APFTVNIYPFLSL-YEDPNFPVNYAFFDGGATPLDDNGLQYTNVFDANFDTLVSALNAAG  257

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +G + ++VGE+GWPTDGD  AN + A RFY   +  +A   GTP+RPG +ID+Y+FGL D
Sbjct  258   YGNMPIIVGEVGWPTDGDINANINNAFRFYRSLLPRIAANTGTPLRPG-NIDMYLFGLLD  316

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PG+FE HWGI  YDGQ KF +DLSG+  +   + G + ++YL  +WC    NA
Sbjct  317   EDAKSIGPGSFERHWGIFQYDGQPKFPMDLSGQ-NQDIYLVGAKNVQYLENEWCEFNPNA  375

Query  1260  K-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
             + L+ L  + ++AC  ADCTP+  GSSC GL   +  SY FN Y+Q Q Q   +CDF GL
Sbjct  376   RDLSRLGDSINFACSAADCTPLGYGSSCQGLDVYQNASYAFNVYYQTQYQNLQACDFGGL  435

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
               +T +N+S  +C F I I
Sbjct  436   ARLTLQNISIGTCNFTIQI  454



>ref|XP_004982258.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like isoform X2 
[Setaria italica]
Length=493

 Score =   439 bits (1128),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 305/450 (68%), Gaps = 15/450 (3%)
 Frame = +3

Query  174   VAGL---DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVM  344
             VAGL     LGVNWG +++H LP   VV+ML+ NGI+KVKLF+     ++ALAG+GIEVM
Sbjct  20    VAGLPAAGALGVNWGTMATHRLPSGTVVRMLQDNGIRKVKLFDADPGPMDALAGSGIEVM  79

Query  345   IGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKV  524
             +G PN +L  + +Y  A+ +V ENV+ Y+      +++  V VGNEPFL  +       V
Sbjct  80    VGIPNNMLDMMTDYGTARDWVHENVSCYDCR----LRLPYVAVGNEPFLSAFNGT-FLNV  134

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T PAL N+Q+AL++AG+G+++KATVP NADVY SP   PVPSAG FR DIAD + +IV+ 
Sbjct  135   TLPALQNIQRALDDAGLGESIKATVPLNADVYNSPVSNPVPSAGRFRSDIADLMTEIVQF  194

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAV  878
             L+++GAPF +N+YPFLSL Y  D FP+D+AFFDG   P+ D  +G TYTNVFDAN+DT V
Sbjct  195   LNQSGAPFTVNIYPFLSL-YGSDGFPLDYAFFDGTSSPVVDAGSGITYTNVFDANFDTLV  253

Query  879   AALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDV  1058
             +AL+    G + VVVGE+GWPTDGD  A A+ A +FY G ++ LA   GTP+RP   I+V
Sbjct  254   SALAAAGAGGLPVVVGEVGWPTDGDTHATAAYAQKFYAGLLRKLAANAGTPLRPSQYIEV  313

Query  1059  YMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLS-GKGGK--GKIMTGVEGIEYLP  1229
             Y+F L DED KS  PGNFE HWGI+ YDGQ K+ +DLS G+GG      +    G++YLP
Sbjct  314   YLFSLIDEDAKSVAPGNFERHWGIVRYDGQPKYPMDLSGGQGGNAAPAALVAARGVQYLP  373

Query  1230  KKWCALKANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQ  1406
             ++WC    NA  T+ +     YAC  +DCT +  GSSCNGL      SY FN YFQ Q+Q
Sbjct  374   RQWCVANPNAPDTSRISDGVAYACSLSDCTALGYGSSCNGLDAAGNASYAFNMYFQVQNQ  433

Query  1407  AKDSCDFQGLGEVTTKNLSTPSCRFNIGIK  1496
             A+ SCDFQGL   T +N ST +C F I I+
Sbjct  434   AEGSCDFQGLAVTTAQNPSTDACNFTIQIE  463



>ref|XP_003557824.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=493

 Score =   439 bits (1128),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 234/438 (53%), Positives = 296/438 (68%), Gaps = 9/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             + LG+NWG  ++HPL PK VV+MLK NGIKKVKLF+  +  L ALAGT IEVM+  PN L
Sbjct  28    EALGMNWGTQATHPLSPKIVVQMLKDNGIKKVKLFDADQGTLGALAGTDIEVMVAIPNVL  87

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + + + A+ +V+ NV+ Y+     GV I  V VGNEPFL  Y   G F KVT PAL 
Sbjct  88    LDLMTDSDNARDWVRHNVSRYHFDG--GVNIKYVAVGNEPFLASY--NGTFDKVTLPALK  143

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+   VKATVP NADVY SP   PVPSAG FR DI D + ++V+ L KNGA
Sbjct  144   NIQNALNDAGLSD-VKATVPLNADVYNSPKDKPVPSAGTFRPDITDLMTEMVDFLAKNGA  202

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YP+LSL+ S D FPV+FAFFDG   P+ DNG +YTNVFDAN+DT V+AL    H
Sbjct  203   PFTVNIYPYLSLYLS-DDFPVNFAFFDGGADPVVDNGNSYTNVFDANFDTLVSALKAVGH  261

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + +V+GE+GWPTDGD  A    A RFY G +K LA   GTP+RP   ++VY+FGL DE
Sbjct  262   GDLPIVIGEVGWPTDGDKHATYVYAQRFYTGLLKRLAANVGTPLRPNKYMEVYLFGLLDE  321

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+L +DGQ KF +DL+G+ G+  ++   + ++YLPK WC   ANAK
Sbjct  322   DIKSVAPGAFERHWGVLRFDGQPKFPMDLTGQ-GQNTMLAPAKDVQYLPKTWCVYNANAK  380

Query  1263  LTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              T+ L  N ++AC  ADCT +  GSSC G+      SY FN YFQ Q+Q  ++CDFQ L 
Sbjct  381   DTSKLAENVNFACTFADCTALGFGSSCAGMDAIGNASYAFNMYFQVQNQKDEACDFQALA  440

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + ST +C F I I
Sbjct  441   VPTQTDPSTDTCHFPIQI  458



>ref|NP_001068140.2| Os11g0577800 [Oryza sativa Japonica Group]
 gb|ABA94484.1| Glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28503.2| Os11g0577800 [Oryza sativa Japonica Group]
Length=492

 Score =   437 bits (1125),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 293/441 (66%), Gaps = 12/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++H LPPK + ++LK NG KKVK+F+     ++ LAGTGIE MI  PN +
Sbjct  25    DGLGVNWGTMATHRLPPKVMARLLKDNGFKKVKIFDADATTMSGLAGTGIEAMIAVPNDM  84

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L  + +Y  A+ +VKENVT Y  +   GV I  V VGNEPFLK Y  Q   + T PAL N
Sbjct  85    LAAVGDYGRAREWVKENVTRY--SFDGGVDIRYVAVGNEPFLKAYNGQ-FDRATVPALRN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL+EAG GK +KATVP NADVY SP   PVPSAG FR D+A  +  +V  L+++GAP
Sbjct  142   IQRALDEAGYGKRIKATVPVNADVYDSPASNPVPSAGRFRDDVAGTMADMVRFLNRSGAP  201

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDG--VDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
               +N+YPFLSL Y  D FP+D+AFFDG    +P+ DNG  YTNVFDAN+DT V+AL R  
Sbjct  202   LTVNIYPFLSL-YGNDDFPLDYAFFDGGPPPRPVVDNGINYTNVFDANFDTLVSALKRIG  260

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + +V+GE+GWPTDGD  A    A RFY+G +K LA ++GTP+RP A I+VY+FGL D
Sbjct  261   FGSLPIVIGEVGWPTDGDKHATVPYAQRFYSGLLKRLAARRGTPLRPRARIEVYLFGLMD  320

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF LDL G  G+  +    +G++YLP++WC L  N 
Sbjct  321   EDTKSVAPGNFERHWGIFTFDGRPKFPLDLRG-AGRPAMPVPAKGVKYLPRRWCVLNPNV  379

Query  1260  K---LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                    L  N  YAC  +DCT +  G SC  L      SY FN Y+QAQ QA  +CDFQ
Sbjct  380   TDDDAGRLADNVGYACSHSDCTALGYGCSCGALDARGNASYAFNVYYQAQGQADAACDFQ  439

Query  1431  GLGEVTT--KNLSTPSCRFNI  1487
             GL  VT   ++++  +C F++
Sbjct  440   GLAVVTEDDRDVAQGACNFSV  460



>ref|XP_002449743.1| hypothetical protein SORBIDRAFT_05g022490 [Sorghum bicolor]
 gb|EES08731.1| hypothetical protein SORBIDRAFT_05g022490 [Sorghum bicolor]
Length=497

 Score =   437 bits (1125),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/452 (51%), Positives = 294/452 (65%), Gaps = 26/452 (6%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG +S+  LPPK + ++L  NG +KVK+F+  +  +  LAGTGIE MI  PN +L 
Sbjct  26    LGVNWGTMSTRRLPPKVIARLLTDNGFRKVKIFDADERTMKGLAGTGIETMIAVPNDMLA  85

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALANM  548
              + +Y+ A+ +VK+NVT Y  T   GV I  V VGNEPFLK Y   G F  VT PAL N+
Sbjct  86    AVADYDRARQWVKDNVTKY--TFDGGVNIKFVAVGNEPFLKAY--NGSFDHVTVPALKNI  141

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+AL+EAG G  VKATVP NADVY SP   PVPSAG FRGD+A  +  +V  L+++GAP 
Sbjct  142   QRALDEAGHGAAVKATVPVNADVYDSPASNPVPSAGRFRGDVAGVMTNMVRFLNRSGAPL  201

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDG---VDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
              +N+YPFLSL+   D FP+DFAFFDG     KP+ D    YTNVFDAN+DT V+AL R  
Sbjct  202   TVNIYPFLSLYGDAD-FPLDFAFFDGGGGSAKPVVDGRVVYTNVFDANFDTLVSALRRVG  260

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + V++GE+GWPTDGD  A A++A RFY G +K LA ++GTP+RPGA I+VY+FGL D
Sbjct  261   LGHLPVMIGEVGWPTDGDRHATAALAERFYAGLLKRLAARRGTPLRPGARIEVYLFGLID  320

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKG-GKGKIMTGVEGIEYLPKKWCALK--  1250
             ED KS  PGNFE HWGI  +DG+ KF LDL G G G+  +     G+EYLP++WC L   
Sbjct  321   EDAKSVAPGNFERHWGIFTFDGRPKFPLDLRGGGDGRPAMPVPARGVEYLPRRWCVLNHI  380

Query  1251  -----------ANAKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQA  1397
                        A  ++ +   N  YAC RADCT +  G SC  L      SY FNAY+QA
Sbjct  381   SAGGGDDDDATAGGRVAD---NVGYACSRADCTALGYGCSCGALDARGTASYAFNAYYQA  437

Query  1398  QDQAKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             Q Q + +CDFQGL  V   + S  +C F++ +
Sbjct  438   QGQVESACDFQGLAVVVHDDASQGACNFSVQV  469



>gb|EAZ18823.1| hypothetical protein OsJ_34360 [Oryza sativa Japonica Group]
Length=492

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 293/441 (66%), Gaps = 12/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++H LPPK + ++LK NG KKVK+F+     ++ LAGTGIE MI  PN +
Sbjct  25    DGLGVNWGTMATHRLPPKVMARLLKDNGFKKVKIFDADATTMSGLAGTGIEAMIAVPNDM  84

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L  + +Y  A+ +VKENVT Y  +   GV I  V VGNEPFLK Y  Q   + T PAL N
Sbjct  85    LAAVGDYGRAREWVKENVTRY--SFDGGVDIRYVAVGNEPFLKAYNGQ-FDRATVPALRN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL+EAG GK +KATVP NADVY SP   PVPSAG FR D+A  +  +V  L+++GAP
Sbjct  142   IQRALDEAGYGKRIKATVPVNADVYDSPASNPVPSAGRFRDDVAGTMADMVRFLNRSGAP  201

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDG--VDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
               +N+YPFLSL Y  D FP+D+AFFDG    +P+ DNG  YTNVFDAN+DT V+AL R  
Sbjct  202   LTVNIYPFLSL-YGNDDFPLDYAFFDGGPPPRPVVDNGINYTNVFDANFDTLVSALKRIG  260

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + +V+GE+GWPTDGD  A    A RFY+G +K LA ++GTP+RP A I+VY+FGL D
Sbjct  261   FGSLPIVIGEVGWPTDGDKHATVPYAQRFYSGLLKRLAARRGTPLRPRARIEVYLFGLMD  320

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF LDL G  G+  +    +G++YLP++WC L  N 
Sbjct  321   EDTKSVAPGNFERHWGIFTFDGRPKFPLDLRG-AGRPAMPVPAKGVKYLPRRWCVLNPNV  379

Query  1260  K---LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                    L  N  YAC  +DCT +  G SC  L      SY FN Y+QAQ QA  +CDFQ
Sbjct  380   TDYDAGRLADNVGYACSHSDCTALGYGCSCGALDARGNASYAFNVYYQAQGQADAACDFQ  439

Query  1431  GLGEVTT--KNLSTPSCRFNI  1487
             GL  VT   ++++  +C F++
Sbjct  440   GLAVVTEDDRDVAQGACNFSV  460



>ref|XP_006656196.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Oryza brachyantha]
Length=481

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 233/435 (54%), Positives = 290/435 (67%), Gaps = 11/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P +VV MLK NGI KVKLF+     + AL  +GIEVM+G PN +L+
Sbjct  31    VGVNWGSQLSHPLLPSSVVHMLKENGISKVKLFDADPWPIGALIDSGIEVMLGIPNNMLE  90

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y  AK +VKENVTSY     D + I  V VGNEPFLK Y      K T+PAL N+Q
Sbjct  91    TMNSYGNAKDWVKENVTSYG----DKLNIKYVAVGNEPFLKAYNGS-FMKTTFPALKNIQ  145

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             KALNEAGIG  VKATVP NADVY+SP   P  S+G+FR DI D +  +V+ L   GAPF+
Sbjct  146   KALNEAGIGGKVKATVPLNADVYVSPDNKP--SSGVFRPDIEDLMTGMVKFLHDQGAPFV  203

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkv  911
             +N+YPFLSL Y  D FP +FAF DG     D  G +Y+NVFDAN+DT V A+ +     +
Sbjct  204   VNIYPFLSL-YQSDDFPFEFAFIDGGKTIQDKGGISYSNVFDANFDTLVTAMKKAGVPNI  262

Query  912   kvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQK  1091
             KVVVGE+GWPTDGD  AN  +A R+Y+G +K LA ++GTP+RPG  +DVYMFGL+DED K
Sbjct  263   KVVVGEVGWPTDGDKNANIKLARRYYDGLLKKLAKEEGTPLRPGK-MDVYMFGLFDEDMK  321

Query  1092  STLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LT  1268
             S LPGNFE HWGI  YDG+ KF +DL+G G   K++  V  ++YLPK+WC     AK  +
Sbjct  322   SILPGNFERHWGIFTYDGKPKFPMDLTGHGND-KLLAAVPAVQYLPKQWCVFDDEAKDKS  380

Query  1269  NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVT  1448
              L  N +YAC   DCT +  G SCN L +   +SY FN YFQ QDQ   +CDF GL ++T
Sbjct  381   KLPGNIEYACASGDCTAIGYGCSCNSLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKIT  440

Query  1449  TKNLSTPSCRFNIGI  1493
              KN S   C F I +
Sbjct  441   EKNASAHGCLFPIQV  455



>ref|XP_008457953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis melo]
Length=487

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 297/436 (68%), Gaps = 9/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG ++SHPL P  VV +LK NGIKKVKLF++    +NAL+G+ IE ++G PN  L+
Sbjct  30    LGVNWGSMASHPLNPNIVVNLLKDNGIKKVKLFDSDSWTVNALSGSKIETIVGIPNDQLE  89

Query  372   DL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L  NY  AK +VKEN+T++      GV I  V VGNEPFL  Y    + K+T+PA+ N+
Sbjct  90    SLATNYNHAKDWVKENITAH--IYDGGVNIRYVAVGNEPFLTAYNGTYV-KLTFPAMQNI  146

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKALNEAG  K +K T P NADVY S   +  PS G FR DI D++K+IV+ LD+N A F
Sbjct  147   QKALNEAGYNKKIKVTCPLNADVYESA--SNHPSDGQFRSDILDEMKEIVQFLDRNNAAF  204

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             M+N+YPFLSL+ + D FPVDFAF D   + ++D GKTYTNV DANYDT V +L +  HG 
Sbjct  205   MVNIYPFLSLYLNPD-FPVDFAFMDENGRSINDKGKTYTNVLDANYDTLVWSLKKIGHGD  263

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDG+ FA   +A RFY+G +K LA KKGTP+RP   ++VY+FGL+DED 
Sbjct  264   MKIIVGEVGWPTDGNKFATVGLAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLFDEDT  323

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PG FE HWG+  YDG+ KF +D +GK    K++   +G++YL  KWC +K + K L
Sbjct  324   KSIQPGFFERHWGLFRYDGKPKFPIDFTGKDND-KMLVAAKGVQYLEHKWCVVKNSVKDL  382

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               + +  DYAC  +DCT +  GSSCN L+    +SY +N YFQ QDQ+ ++C F    E+
Sbjct  383   RTISSQVDYACSMSDCTTLGYGSSCNNLNAKGNISYAYNMYFQMQDQSVEACVFGDSAEI  442

Query  1446  TTKNLSTPSCRFNIGI  1493
              TKN S  +C F I I
Sbjct  443   VTKNASVGNCLFPIQI  458



>ref|XP_009393986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Musa acuminata 
subsp. malaccensis]
Length=417

 Score =   433 bits (1113),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 222/396 (56%), Positives = 277/396 (70%), Gaps = 8/396 (2%)
 Frame = +3

Query  309   LNALAGTGIEVMIGTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPF  488
             + ALAGTGIEVMI  PN +L  + +Y+ AK +VK+NVT YN     GV I  V VGNEPF
Sbjct  1     MKALAGTGIEVMIAIPNDMLAMMNDYDAAKEWVKKNVTRYN--FEKGVNIKYVAVGNEPF  58

Query  489   LKFYEKQGLFKVTYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRG  668
             LK Y       +T+PAL N+Q ALNEAG+G T+KAT+P NADVY SP   PVPSAG FR 
Sbjct  59    LKSY-NDSFTNITFPALKNIQNALNEAGVGDTIKATIPLNADVYDSPRSNPVPSAGKFRP  117

Query  669   DIADQVKKIVEVLDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTN  848
             DIAD + +IVE   +NGAPF++N+YPFLSL+ + D FP+D+AFFDG   P+ D G  YTN
Sbjct  118   DIADLMAQIVEFFSQNGAPFIVNIYPFLSLYGNSD-FPIDYAFFDGTSNPVLDEGVEYTN  176

Query  849   VFDANYDTAVAALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGT  1028
             VFDAN+DT V+AL +   G + +VVGE+GWPTDGD  AN +MA RFY G +K LA   GT
Sbjct  177   VFDANFDTLVSALKKVGFGDLPIVVGEVGWPTDGDVNANVTMAERFYAGLLKRLAA--GT  234

Query  1029  PVRPGADIDVYMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGV  1208
             P+RP + I+VY+FGL DED KS  PGNFE HWG+  YDGQ KF +DLSG+ G+ +++ G 
Sbjct  235   PLRPNSTIEVYLFGLMDEDAKSVAPGNFERHWGLFTYDGQPKFPVDLSGQ-GQNQLLVGA  293

Query  1209  EGIEYLPKKWCALKANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNA  1385
             + +EYLP+KWCA+  +A  L+ L  N  YAC  ADCT +  G SCNGL      SY FN 
Sbjct  294   KDVEYLPRKWCAVNPSATDLSKLADNVKYACAHADCTSLGYGCSCNGLDARANASYAFNV  353

Query  1386  YFQAQDQAKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             YFQ Q+   +SCDFQGL  VTT+N+S  +C F I I
Sbjct  354   YFQTQNHKDESCDFQGLAAVTTQNMSNGTCNFTIQI  389



>dbj|BAK05853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   436 bits (1120),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 294/438 (67%), Gaps = 9/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV+MLK NGIKKVKLF+  +  L+ALAGT IEVM+  PN L
Sbjct  26    DALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNL  85

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  +   + A+ +V+ N++ Y+     GV I  V VGNEPFL  Y   G F KVT+PAL 
Sbjct  86    LDLMNEKDNAREWVRHNISRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG  + +KATVP NADVY SP   PVPSAG FR D+   + ++V+ L  N A
Sbjct  142   NIQNALNDAGFSE-IKATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YP+LSL+ S D FPVDFAFFDG+  P+ D   TYTNVFDAN+DT V+AL+   H
Sbjct  201   PFTVNIYPYLSLYLSAD-FPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGH  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G +  ++GE+GWPTDGD  AN ++A RFY+G +  LA   GTP+RP   ++VY+FGL DE
Sbjct  260   GDLPTIIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDE  319

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+L +DGQ KF +DL+GK G+  ++   +G+ YLP+ WC    NA+
Sbjct  320   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGK-GQNTMLVPAKGVRYLPRTWCVYNPNAE  378

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
               + L  N +YAC  ADCT +  GS+C G+      SY FN YFQ Q+Q  ++CDFQ L 
Sbjct  379   DKSKLVENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALA  438

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + ST +C F I I
Sbjct  439   VPTQTDPSTAACNFPIQI  456



>gb|AES75227.2| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=437

 Score =   434 bits (1115),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 224/419 (53%), Positives = 287/419 (68%), Gaps = 6/419 (1%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++GLGVNWG  ++HPL P  VV+MLK NGI+KVKLF+  +  ++AL G+GIEVM+  PN 
Sbjct  23    VEGLGVNWGTQATHPLKPDTVVQMLKDNGIQKVKLFDADEETMSALGGSGIEVMVAIPNN  82

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L ++ +Y+ A  +V++NVT YN  S  GV I  V VGNEPFLK Y    L  VT+PAL 
Sbjct  83    QLAEMSDYDRALQWVRKNVTRYNFKS-GGVNIKYVAVGNEPFLKAYNNSFL-NVTFPALM  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSP-PYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
             N+Q ALN+ G+G ++KATVP NADVY SP     VPSAG+FR D+++ + +IV+ L KN 
Sbjct  141   NIQNALNQVGLGDSIKATVPLNADVYESPDSNNAVPSAGIFRPDLSELMTQIVQFLSKNN  200

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPFLSL Y  D FP D+AFFDGV  P++DNG  YTNVFDAN+DT V+AL    
Sbjct  201   APFTVNIYPFLSL-YGNDNFPFDYAFFDGVSNPINDNGVLYTNVFDANFDTLVSALKSIG  259

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + + VGE+GWPTDGD  AN   A RFYNG +  LA  KGTP R G  I+VY+FGL D
Sbjct  260   FGNMPIFVGEVGWPTDGDKNANIQNALRFYNGLLPRLASNKGTPRRQGY-IEVYLFGLID  318

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF + +S + G+ K++ G + + YL  KWC    NA
Sbjct  319   EDAKSIEPGNFERHWGIFSFDGKPKFPMHVSNQHGQNKLLVGAKDVHYLDPKWCMFNPNA  378

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
               L+NL  N +YAC  ADCTP+  GSSCN L      SY FN Y+Q Q+Q   +C+F+G
Sbjct  379   NNLSNLADNINYACTFADCTPLGYGSSCNNLDANGNASYAFNMYYQVQNQNDLACNFEG  437



>ref|XP_009366428.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Pyrus x bretschneideri]
Length=487

 Score =   435 bits (1119),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 232/434 (53%), Positives = 290/434 (67%), Gaps = 9/434 (2%)
 Frame = +3

Query  201   NWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV  380
             NWG +++H LPP  VV+MLK NGI KVKLF+  +  ++AL  +G+EVM+  PN  L  L 
Sbjct  29    NWGTMATHELPPATVVQMLKDNGIPKVKLFDAEESTMSALLDSGLEVMVAIPNDQLAVLT  88

Query  381   NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKAL  560
             +Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT+PAL N+Q AL
Sbjct  89    SYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQNIQNAL  145

Query  561   NEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINV  740
             NEAG+G +VKATVP NADVY SP   PVPSAG FR DI   + +IV+ LDKN APF IN+
Sbjct  146   NEAGVGDSVKATVPLNADVYDSPENNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINI  205

Query  741   YPFLSLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSREKHgkvk  914
             YPFLSL Y  D FP ++AFFDG   P+ D   G  YTNVFDAN+DT V++L     G + 
Sbjct  206   YPFLSL-YGNDGFPFNYAFFDGDTTPIVDTTTGIQYTNVFDANFDTLVSSLKAVGFGNMP  264

Query  915   vvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKS  1094
             +VVGE+GWPTDGD  AN   A RFYNG +  L   +GTP+R G  I+VY+FGL DED KS
Sbjct  265   IVVGEVGWPTDGDKNANVGNAFRFYNGLLTKLGTNRGTPLRTGY-IEVYLFGLIDEDAKS  323

Query  1095  TLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LTN  1271
               PG+FE HWGI  YDGQ KF +DLSG+ G+ K++   + ++YL KKWC    NAK ++N
Sbjct  324   IAPGSFERHWGIFSYDGQPKFPVDLSGQ-GQNKLLVPAKNVQYLSKKWCMFNPNAKDVSN  382

Query  1272  LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTT  1451
             L    +YAC  ADCT +  GSSCN L      SY FN Y+Q Q+Q   SC+FQGL  +TT
Sbjct  383   LADKINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDQSCNFQGLATLTT  442

Query  1452  KNLSTPSCRFNIGI  1493
             +N+S  +C F I +
Sbjct  443   QNVSQGNCNFIIQM  456



>gb|ACG41694.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
Length=485

 Score =   435 bits (1118),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 224/440 (51%), Positives = 289/440 (66%), Gaps = 10/440 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LGVNWG +S+  LPPK + + L  NG  KVK+F+  +  +  LAGT IE M+  PN +
Sbjct  26    DALGVNWGTMSARRLPPKVMARXLTDNGFTKVKIFDADERTMKGLAGTSIETMVAVPNDM  85

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +Y+ A+ +V++NVT Y  T   GV I  V VGNEPFL+ Y   G F  VT PAL 
Sbjct  86    LAAVADYDRARRWVRDNVTKY--TFDGGVNIKFVAVGNEPFLRAY--NGSFDHVTVPALR  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q+AL+EAG G  VKATVP NADVY SP   PVPSAG FR D+A  +  +V VL+++GA
Sbjct  142   NIQRALDEAGHGAAVKATVPVNADVYDSPASNPVPSAGRFRSDVARVMADMVRVLNRSGA  201

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDG-VDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             P  +N+YPFLSL Y  D FP+D+AFFDG    P+ D    YTNVFDAN+DT V+AL R  
Sbjct  202   PLTVNIYPFLSL-YGNDDFPLDYAFFDGGAGAPVVDGRAVYTNVFDANFDTLVSALKRVG  260

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + V++GE+GWPTDGD  A A++A RFY G ++ LA ++GTP+RPGA I+ Y+FGL D
Sbjct  261   LGHLPVIIGEVGWPTDGDRHATAALAERFYAGLLQRLAARRGTPLRPGARIEAYLFGLVD  320

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK--A  1253
             ED KS  PGNFE HWGI  +DG+ KF LDL G  G+  +     G+EYLP++WC L   +
Sbjct  321   EDAKSVAPGNFERHWGIFTFDGRPKFPLDLRGD-GRPAMPVPARGVEYLPRRWCVLNPIS  379

Query  1254  NAKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
              A    L  N  YAC RADCT +  G SC  L      SY FNAY+QAQ Q + +CDFQG
Sbjct  380   MAGDGRLPDNVAYACSRADCTALGYGCSCRALDARGNASYAFNAYYQAQGQVESACDFQG  439

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L  V  ++ S  +C F++ +
Sbjct  440   LAVVVDEDASQGACNFSVQL  459



>dbj|BAJ90806.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   435 bits (1119),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 295/438 (67%), Gaps = 9/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV+MLK NGIKKVKLF+  +  L+ALAGT IEVM+  PN L
Sbjct  26    DALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNL  85

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  +   + A+ +V+ N++ Y+     GV I  V VGNEPFL  Y   G F KVT+PAL 
Sbjct  86    LDLMNEKDNAREWVRHNISRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG  + +KATVP NADVY SP   PVPSAG FR D+   + ++V+ L  N A
Sbjct  142   NIQNALNDAGFSE-IKATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YP+LSL+ S D FPVDFAFFDG+  P+ D   TYTNVFDAN+DT V+AL+   H
Sbjct  201   PFTVNIYPYLSLYLSAD-FPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGH  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + +++GE+GWPTDGD  AN ++A RFY+G +  LA   GTP+RP   ++VY+FGL DE
Sbjct  260   GDLPIIIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDE  319

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+L +DGQ KF +DL+GK G+  ++   +G+ YLP+ WC    NA+
Sbjct  320   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGK-GQNTMLVPAKGVRYLPRTWCVYNPNAE  378

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
               + L  N +YAC  ADCT +  GS+C G+      SY FN YFQ Q+Q  ++CDFQ L 
Sbjct  379   DKSKLVENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALA  438

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + ST +C F I I
Sbjct  439   VPTQTDPSTAACNFPIQI  456



>dbj|BAJ98060.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   435 bits (1118),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 295/438 (67%), Gaps = 9/438 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV+MLK NGIKKVKLF+  +  L+ALAGT IEVM+  PN L
Sbjct  26    DALGMNWGTQATHPLSPRIVVQMLKDNGIKKVKLFDADQATLSALAGTDIEVMVAIPNNL  85

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  +   + A+ +V+ N++ Y+     GV I  V VGNEPFL  Y   G F KVT+PAL 
Sbjct  86    LDLMNEKDNAREWVRHNISRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG  + +KATVP NADVY SP   PVPSAG FR D+   + ++V+ L  N A
Sbjct  142   NIQNALNDAGFSE-IKATVPLNADVYNSPSANPVPSAGRFRTDVTQLMTQMVQFLANNSA  200

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YP+LSL+ S D FPVDFAFFDG+  P+ D   TYTNVFDAN+DT V+AL+   H
Sbjct  201   PFTVNIYPYLSLYLSAD-FPVDFAFFDGLATPVVDGVNTYTNVFDANFDTLVSALAAVGH  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + +++GE+GWPTDGD  AN ++A RFY+G +  LA   GTP+RP   ++VY+FGL DE
Sbjct  260   GDLPIIIGEVGWPTDGDKHANNALAKRFYDGLLPRLAANTGTPLRPAQYMEVYLFGLLDE  319

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+L +DGQ KF +DL+GK G+  ++   +G+ YLP+ WC    NA+
Sbjct  320   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGK-GQNTMLVPAKGVRYLPRTWCVYNPNAE  378

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
               + L  N +YAC  ADCT +  GS+C G+      SY FN YFQ Q+Q  ++CDFQ L 
Sbjct  379   DKSKLVENVNYACTFADCTALGLGSTCYGMDVNGNASYAFNMYFQVQNQKDEACDFQALA  438

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + ST +C F I I
Sbjct  439   VPTQTDPSTAACNFPIQI  456



>ref|XP_007204344.1| hypothetical protein PRUPE_ppa005641mg [Prunus persica]
 gb|EMJ05543.1| hypothetical protein PRUPE_ppa005641mg [Prunus persica]
Length=450

 Score =   433 bits (1114),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 231/430 (54%), Positives = 291/430 (68%), Gaps = 9/430 (2%)
 Frame = +3

Query  213   ISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLVNYEV  392
             +++H LPP+ VV+MLK NGI+KVKLF+  +  ++ALAG+G+EVM+  PN  L  +  Y+ 
Sbjct  1     MATHKLPPETVVQMLKDNGIQKVKLFDADESTMSALAGSGLEVMVAIPNDQLAVMATYKR  60

Query  393   AKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAG  572
             AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT+PAL N+Q ALNEAG
Sbjct  61    AKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLTSYNGSFL-NVTFPALQNIQNALNEAG  117

Query  573   IGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFL  752
             +G ++KATVP NADVY SP   PVPSAG FR DI+  +  IV+ L KN APF IN+YPFL
Sbjct  118   VGDSIKATVPLNADVYNSPDSNPVPSAGRFRSDISPLMIAIVQFLAKNKAPFTINIYPFL  177

Query  753   SLFYSKDQFPVDFAFFDGVDKPLDD--NGKTYTNVFDANYDTAVAALSREKHgkvkvvvg  926
             SL Y  D FP ++AFFDG   P+ D   G  YTNVFDAN+DT V++L  E  G + +VVG
Sbjct  178   SL-YGNDDFPFNYAFFDGDTNPIVDATTGIQYTNVFDANFDTLVSSLKAEGFGDMTIVVG  236

Query  927   EIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPG  1106
             E+GWPTDGD  ANA  A RFYNG +  L   +GTP+RPG  I+VY+FGL DED KS  PG
Sbjct  237   EVGWPTDGDKNANAGNAYRFYNGLLPKLGTNRGTPLRPGY-IEVYLFGLIDEDAKSIAPG  295

Query  1107  NFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LTNLKAN  1283
             +FE HWGI  YDGQ KF +DLSG+  + K++   + ++YL KKWC    NAK +T L  N
Sbjct  296   SFERHWGIFSYDGQPKFLVDLSGQ-SQNKLLVPAKNVQYLSKKWCMFNPNAKDVTKLADN  354

Query  1284  TDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLS  1463
              +YAC  ADCT +  GSSCN L      SY FN Y+Q Q+Q   SC+F+GL  +TT+N+S
Sbjct  355   INYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQNQDDLSCNFEGLATLTTQNIS  414

Query  1464  TPSCRFNIGI  1493
               +C F I I
Sbjct  415   QGNCNFIIQI  424



>ref|XP_008386810.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=488

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 232/432 (54%), Positives = 288/432 (67%), Gaps = 9/432 (2%)
 Frame = +3

Query  201   NWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV  380
             NWG +++H LPP  V+++LK NGI KVKLF+  +  ++AL G+G+EVM+  PN  L  + 
Sbjct  29    NWGTMATHELPPDTVIQILKDNGIPKVKLFDADESTMSALTGSGLEVMVAIPNDQLAVMT  88

Query  381   NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKAL  560
             +Y+ AK +V+ NVT YN     GV I  V VGNEPFL  Y    L  VT+PAL N+Q AL
Sbjct  89    SYKRAKEWVRRNVTRYNFNG--GVNIKYVAVGNEPFLSSYNGSFL-NVTFPALQNIQNAL  145

Query  561   NEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINV  740
             NEAG+G +VKATVP NADVY SP   PVPSAG FR DI   + +IV+ LDKN APF IN+
Sbjct  146   NEAGVGDSVKATVPLNADVYDSPVDNPVPSAGRFRTDILQLMTEIVQFLDKNKAPFTINI  205

Query  741   YPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGK--TYTNVFDANYDTAVAALSREKHgkvk  914
             YPFLSL Y  D FP ++AFFDG   P+ D G    YTNVFDAN+DT V++L     G + 
Sbjct  206   YPFLSL-YGNDGFPFNYAFFDGDTTPIVDTGTGIQYTNVFDANFDTLVSSLKAVGFGNMP  264

Query  915   vvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKS  1094
             +VVGE+GWPTDGD  AN   A RFYNG +  L   KGTP+R G  I+VY+FGL DED KS
Sbjct  265   IVVGEVGWPTDGDKNANVGNAFRFYNGLLTRLGTNKGTPLRTGY-IEVYLFGLIDEDAKS  323

Query  1095  TLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LTN  1271
               PG+FE HWGI  YDGQ KF +DLSG+ G+ K++   + + YL KKWC    NAK ++N
Sbjct  324   IAPGSFERHWGIFSYDGQPKFPVDLSGQ-GQNKLLVPAKNVLYLSKKWCMXNPNAKDVSN  382

Query  1272  LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTT  1451
             L    +YAC  ADCT +  GSSCN L      SY FN Y+Q QDQ   SC FQGL  +TT
Sbjct  383   LADKINYACTYADCTALEYGSSCNNLDANGNASYAFNMYYQVQDQDDQSCSFQGLATLTT  442

Query  1452  KNLSTPSCRFNI  1487
             +N+S  +C F I
Sbjct  443   QNISQGNCNFII  454



>ref|XP_009402192.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   433 bits (1113),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 228/427 (53%), Positives = 289/427 (68%), Gaps = 8/427 (2%)
 Frame = +3

Query  219   SHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV-NYEVA  395
             SHPL P  VV+M+K+NGI KVKLF+     ++A AGTGIE+M+  PN +LK +  +Y  A
Sbjct  2     SHPLLPTTVVQMIKSNGITKVKLFDADSWTVSAFAGTGIELMLAIPNDMLKRISSDYSHA  61

Query  396   KAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGI  575
             + +VKENVT ++     GV I  V VGNEPFL  Y      K T+PAL N+QKAL+EAG+
Sbjct  62    QDWVKENVTKHDYDG--GVNIKYVAVGNEPFLSSYNGS-FMKTTFPALKNIQKALDEAGV  118

Query  576   GKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFLS  755
             G  +KATVP NADVY SP   PVPSAG FRGDI   +  +V  +  NGAPF++N+YPFLS
Sbjct  119   GNRIKATVPLNADVYNSPESNPVPSAGDFRGDIHSLMVDMVRFMHSNGAPFVVNIYPFLS  178

Query  756   LFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEIG  935
             L+ + D FP+DFAFFDG  + L+D G  YTNVFDANYDT V +L +     +K++VGE+G
Sbjct  179   LYQNPD-FPIDFAFFDGGGRNLNDKGHQYTNVFDANYDTLVWSLKKAGVSDMKIIVGEVG  237

Query  936   WPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNFE  1115
             WPTDGD  AN   A RFY+GF+K +   +GTP+RPG  +DVY+FGL DED KS LPGNFE
Sbjct  238   WPTDGDKNANTENAKRFYDGFLKKMGQNEGTPMRPG-HMDVYLFGLIDEDMKSVLPGNFE  296

Query  1116  PHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LTNLKANTDY  1292
              HWGI  YD + KF +DLSGKG   K +    G++YLP++WC L  + K L+ +  N DY
Sbjct  297   RHWGIFTYDCRPKFPMDLSGKGND-KYLKRATGVQYLPEQWCVLNPDVKQLSAMGPNLDY  355

Query  1293  ACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTPS  1472
             AC  +DCT +  GSSCN L      SY FN YFQ QDQ   +C+F+GL  +TTKN S   
Sbjct  356   ACSLSDCTALGYGSSCNDLDRGGNASYAFNMYFQMQDQDVRACNFEGLAVITTKNASRNG  415

Query  1473  CRFNIGI  1493
             C F + I
Sbjct  416   CLFPVQI  422



>gb|EAY81406.1| hypothetical protein OsI_36575 [Oryza sativa Indica Group]
Length=494

 Score =   433 bits (1114),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 293/441 (66%), Gaps = 12/441 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             DGLGVNWG +++H LPPK + ++L+ NG KKVK+F+     ++ LAGTGIE MI  PN +
Sbjct  27    DGLGVNWGTMATHRLPPKVMARLLQDNGFKKVKIFDADATTMSGLAGTGIEAMIAVPNDM  86

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L  + +Y  A+ +VKE+VT Y  +   GV I  V VGNEPFLK Y  +   + T PAL N
Sbjct  87    LAAVGDYGRAREWVKESVTRY--SFDGGVDIRYVAVGNEPFLKAYNGE-FDRATVPALRN  143

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL+EAG GK +KATVP NADVY SP   PVPSAG FR D+A  +  +V  L+++GAP
Sbjct  144   IQRALDEAGYGKRIKATVPVNADVYDSPASNPVPSAGRFRDDVAGTMADMVRFLNRSGAP  203

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDG--VDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
               +N+YPFLSL Y  D FP+D+AFFDG    +P+ DNG  YTNVFDAN+DT V+AL R  
Sbjct  204   LTVNIYPFLSL-YGNDDFPLDYAFFDGGPPPRPVVDNGINYTNVFDANFDTLVSALKRIG  262

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + +V+GE+GWPTDGD  A    A RFY+G +K LA ++GTP+RP A I+VY+FGL D
Sbjct  263   FGSLPIVIGEVGWPTDGDKHATVPYAQRFYSGLLKRLAARRGTPLRPRARIEVYLFGLMD  322

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF LDL G  G+  +    +G++YLP++WC L  N 
Sbjct  323   EDTKSVAPGNFERHWGIFTFDGRPKFPLDLRG-AGRPAMPVPAKGVKYLPRRWCVLNPNV  381

Query  1260  K---LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                    L  N  YAC  +DCT +  G SC  L      SY FN Y+QAQ QA  +CDFQ
Sbjct  382   TDDDAGRLADNVGYACSHSDCTALGYGCSCGALDARGNASYAFNVYYQAQGQADAACDFQ  441

Query  1431  GLGEVTT--KNLSTPSCRFNI  1487
             GL  VT   ++++  +C F++
Sbjct  442   GLAVVTEDDRDVAQGACNFSV  462



>ref|NP_001140660.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF79768.1| unknown [Zea mays]
 gb|ACF84308.1| unknown [Zea mays]
 tpg|DAA42175.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=484

 Score =   432 bits (1112),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 223/438 (51%), Positives = 288/438 (66%), Gaps = 10/438 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG +S+  LPPK + ++L  NG  KVK+F+  +  +  LAGT IE MI  PN +L 
Sbjct  27    LGVNWGTMSARRLPPKVMARLLTDNGFTKVKIFDADERTMKGLAGTSIETMIAVPNDMLA  86

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALANM  548
              + +Y+ A+ +V++NVT Y  T   GV I  V VGNEPFL+ Y   G F  VT PAL N+
Sbjct  87    AVADYDRARRWVRDNVTKY--TFDGGVNIKFVAVGNEPFLRAY--NGSFDHVTVPALRNI  142

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+AL+EAG G  VKATVP NADVY SP   PVPSAG FR D+A  +  +V  L+++GAP 
Sbjct  143   QRALDEAGHGAAVKATVPVNADVYDSPASNPVPSAGRFRSDVARVMADMVRFLNRSGAPL  202

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDG-VDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
              +N+YPFLSL Y  D FP+D+AFFDG    P+ D    YTNVFDAN+DT V+AL R   G
Sbjct  203   TVNIYPFLSL-YGNDDFPLDYAFFDGGAGAPVVDGRAVYTNVFDANFDTLVSALKRVGLG  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + V++GE+GWPTDGD  A A++A RFY G ++ LA ++GTP+RPGA I+ Y+FGL DED
Sbjct  262   HLPVMIGEVGWPTDGDRHATAALAERFYAGLLQRLAARRGTPLRPGARIEAYLFGLVDED  321

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK--ANA  1259
              KS  PGNFE HWGI  +DG+ KF LDL G  G+  +     G+EYLP++WC L   + A
Sbjct  322   AKSVAPGNFERHWGIFTFDGRPKFPLDLRGD-GRPAMPVPARGVEYLPRRWCVLNPISIA  380

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
                 L  N  YAC RADCT +  G SC  L      SY FNAY+QAQ Q + +CDFQGL 
Sbjct  381   GDGRLADNVAYACSRADCTALGYGCSCGALDPRGNASYAFNAYYQAQGQVESACDFQGLA  440

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              V  ++ S  +C F++ +
Sbjct  441   VVVDEDASQGACNFSVQL  458



>ref|XP_008361509.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=479

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 230/437 (53%), Positives = 296/437 (68%), Gaps = 10/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSH LPPK VV+MLK NGIKKVKLF+     LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPXTLNALAGSGIQVMVGIPNEKL  82

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + L + Y  A+ +VKENVT +      GV I+ VGVGNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSYSEAQEWVKENVTEW--LRDGGVSISNVGVGNEPYLTSYNGT-YVKTTYPALKN  139

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+E+G G  VKATVPFNADVY S   +  PS G FR DI + + +I+  L  + AP
Sbjct  140   IQKALDESGAGGKVKATVPFNADVYEST--SNKPSDGCFRKDIKNNMVEILRHLRDSKAP  197

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ + D FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +E  G
Sbjct  198   FVVNIYPFLSLYQNAD-FPQEFAFFEGGSKPVRDNNIEYKNVFDANCDTLINALKKEGFG  256

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +++V+GE+GWPTDGD  AN   A +FY+G +K L  ++GTP+R G  I+VY+FGL+DED
Sbjct  257   NMEIVIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRKGK-IEVYLFGLFDED  315

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             +KS  PG+FE HWGI  YDGQ K  +DLSGKG   +++  V+G+EYL K+WC L ++ K 
Sbjct  316   ZKSVAPGDFERHWGIFRYDGQPKXPMDLSGKGSGNQMLKAVQGVEYLDKQWCVLNSSVKN  375

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L+  +A  +YAC  +DCT +  G SCN L     VSY FN YFQ +DQ   +CDF G   
Sbjct  376   LSQTQAELNYACAESDCTSLGSGRSCN-LDQQGNVSYAFNXYFQTRDQDVRACDFNGTAT  434

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T  N S   C F + I
Sbjct  435   ITKSNPSVGDCLFPVQI  451



>ref|XP_008338651.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=479

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 230/437 (53%), Positives = 296/437 (68%), Gaps = 10/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSH LPPK VV+MLK NGIKKVKLF+     LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPXTLNALAGSGIQVMVGIPNEKL  82

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + L + Y  A+ +VKENVT +      GV I+ VGVGNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSYSEAQEWVKENVTEW--LRDGGVSISNVGVGNEPYLTSYNGT-YVKTTYPALKN  139

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+E+G G  VKATVPFNADVY S   +  PS G FR DI + + +I+  L  + AP
Sbjct  140   IQKALDESGAGGKVKATVPFNADVYESX--SNKPSDGCFRKDIKNNMVEILRHLRDSKAP  197

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ + D FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +E  G
Sbjct  198   FVVNIYPFLSLYQNAD-FPQEFAFFEGGSKPVRDNNIEYKNVFDANCDTLINALKKEGFG  256

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +++V+GE+GWPTDGD  AN   A +FY+G +K L  ++GTP+R G  I+VY+FGL+DED
Sbjct  257   NMEIVIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRKGK-IEVYLFGLFDED  315

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             +KS  PG+FE HWGI  YDGQ K  +DLSGKG   +++  V+G+EYL K+WC L ++ K 
Sbjct  316   ZKSVAPGDFERHWGIFRYDGQPKXPMDLSGKGSGNQMLKAVQGVEYLDKQWCVLNSSVKN  375

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L+  +A  +YAC  +DCT +  G SCN L     VSY FN YFQ +DQ   +CDF G   
Sbjct  376   LSQTQAELNYACAESDCTSLGSGRSCN-LDQQGNVSYAFNXYFQTRDQDVRACDFNGTAT  434

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T  N S   C F + I
Sbjct  435   ITKSNPSVGDCLFPVQI  451



>ref|XP_009336373.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=479

 Score =   431 bits (1108),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 295/437 (68%), Gaps = 10/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSH LPPK VV+MLK NGIKKVKLF+     LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGTMSSHLLPPKKVVQMLKDNGIKKVKLFDAEPSTLNALAGSGIQVMVGIPNDKL  82

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + L + +  A+ +VKENVT +      GV I+ VGVGNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSFSEAQEWVKENVTKW--LHDGGVSISNVGVGNEPYLTSYNGT-YVKTTYPALKN  139

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+E+G G  VKATVPFNADVY S   +  PS G FR DI + + +I+  L  + AP
Sbjct  140   IQKALDESGAGDKVKATVPFNADVYESS--SNKPSDGCFRKDIKNNMVEILCHLRDSKAP  197

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL Y    FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +E  G
Sbjct  198   FVVNIYPFLSL-YQNANFPQEFAFFEGSSKPVRDNNIEYKNVFDANCDTLINALKKEGFG  256

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +++++GE+GWPTDGD  AN   A +FY+G +K L  ++GTP+R G  I+VY+FGL+DED
Sbjct  257   NMEILIGEVGWPTDGDKNANIKNAKKFYDGLLKKLGKEEGTPLRRGK-IEVYLFGLFDED  315

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             QKS  PG+FE HWGI  YDGQ KF +DLSGKG   +++  V+G+EYL K+WC L ++ K 
Sbjct  316   QKSVAPGDFERHWGIFRYDGQPKFPMDLSGKGSGNQMLKAVQGVEYLDKQWCVLNSHVKN  375

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L+  +A  +YAC  +DCT +  G SCN L      SY FN YFQ +DQ   +CDF G+  
Sbjct  376   LSQTQAELNYACAESDCTSLGTGRSCN-LDQQGNASYAFNIYFQTRDQDVRACDFNGMAT  434

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T  N S   C F + I
Sbjct  435   ITKSNPSVGDCLFPVQI  451



>ref|XP_008232375.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=478

 Score =   431 bits (1107),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 298/437 (68%), Gaps = 10/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG + SH LPPK VV+MLK NGIKKVKLF+     ++ALAG+G++VM+G PN  L
Sbjct  24    GLGVNWGSMGSHSLPPKNVVQMLKDNGIKKVKLFDAEPDTMDALAGSGMQVMVGIPNEKL  83

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + L + Y+ A+ +VK+NVT Y      GV I  V VGNEP+L  Y      K TYPAL N
Sbjct  84    EKLADSYKEAQEWVKQNVTKY--LRDGGVNIRYVAVGNEPYLTSYNGT-YVKTTYPALKN  140

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+EAG G  VKATVPFNADVY SP  +  PS G FR DI + + +I+ VL+ N  P
Sbjct  141   IQKALDEAGSGGKVKATVPFNADVYESP--SNKPSDGRFRKDIKNNIVEILRVLNDNRTP  198

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ S D FP +FAFF+G  +P+ DN   Y NVFDAN DT ++AL +   G
Sbjct  199   FVVNIYPFLSLYQSSD-FPKEFAFFEGGSEPVKDNNIEYKNVFDANCDTLISALKKVGFG  257

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + +++GE+GWPTDGD  AN  +A +FY+G +K LA + GTP+R    ++VY+FGL+DE+
Sbjct  258   NLDIIIGEVGWPTDGDKNANGKLAKKFYDGLLKKLATEDGTPLRK-KKLEVYLFGLFDEN  316

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             QKS  PG+FE HWGI  YDGQ KF +DLSGKG    ++ GV+G++YL ++WC LK++ + 
Sbjct  317   QKSIAPGDFERHWGIFRYDGQPKFTMDLSGKGQGNNLLKGVQGVQYLDQQWCVLKSDVRN  376

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L+N +    YAC  +DCT +  G SC+ L     VSY FNAYFQ +DQ   +CDF G+  
Sbjct  377   LSNTQPEVGYACSMSDCTSLGVGRSCD-LDQHGNVSYAFNAYFQNKDQDVRACDFNGMAN  435

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +  +N S   C F I I
Sbjct  436   IVKQNASMGDCLFPIQI  452



>ref|XP_007207576.1| hypothetical protein PRUPE_ppa018453mg, partial [Prunus persica]
 gb|EMJ08775.1| hypothetical protein PRUPE_ppa018453mg, partial [Prunus persica]
Length=456

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 224/437 (51%), Positives = 297/437 (68%), Gaps = 10/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG + SH LPPK VV+MLK NGIKKVKLF+     ++ALAG+GI+VM+G PN  L
Sbjct  24    GLGVNWGSMGSHSLPPKNVVQMLKENGIKKVKLFDAEPDTMDALAGSGIQVMVGIPNEKL  83

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
               L + Y+ A+ +VK+NVTSY      GV I  V VGNEP+L  Y      K TYPAL N
Sbjct  84    AKLADSYKEAQEWVKQNVTSY--LRDGGVNIRYVAVGNEPYLTSYNGT-YVKTTYPALKN  140

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+EAG G  +KATVPFNADVY SP  +  PS G FR DI + + +I+ +L+ N  P
Sbjct  141   IQKALDEAGSGGKIKATVPFNADVYESP--SNKPSDGRFRKDIKNNIVEILRILNDNRTP  198

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ S D FP +FAFF+G  +P+ DN   Y NVFDAN DT ++AL +   G
Sbjct  199   FVVNIYPFLSLYQSSD-FPKEFAFFEGGSEPVKDNNIDYKNVFDANCDTLISALKKVGFG  257

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + +++GE+GWPTDGD  AN  MA +FY+G +K LA + GTP+R    ++VY+FGL+DE+
Sbjct  258   NLDIIIGEVGWPTDGDKNANGKMAKKFYDGLLKKLATEDGTPLRK-KKLEVYLFGLFDEN  316

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             QKS  PG+FE HWGI  YDG+ KF +DLSGKG    ++ GV+G++YL ++WC LK++ + 
Sbjct  317   QKSIAPGDFERHWGIFRYDGKPKFPMDLSGKGQGNNLLKGVQGVQYLDQQWCMLKSDVRN  376

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L+N +    YAC  +DCT +  G SC+ L     VSY FN YFQ +DQ   +CDF G+  
Sbjct  377   LSNTQPEVSYACSMSDCTSLGVGRSCD-LDQHGNVSYAFNMYFQNKDQDVRACDFNGMAN  435

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +  +N S   C F I I
Sbjct  436   IVKQNASRGDCLFPIQI  452



>ref|XP_008793474.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Phoenix dactylifera]
Length=476

 Score =   430 bits (1106),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 288/440 (65%), Gaps = 11/440 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             A  + +GVNWG  +SHP+PPK VV+MLK NGI+KVKLF+    V++ALA TGIEVM+  P
Sbjct  22    ASTEAIGVNWGTQTSHPMPPKIVVQMLKDNGIQKVKLFDAESSVMSALANTGIEVMVAIP  81

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  L+ +  Y  AKA+V ENVT Y       V I  V VGNEPFLK Y    L K T+PA
Sbjct  82    NDQLEQMGTYSNAKAWVHENVTGYR-----DVNIKYVAVGNEPFLKSYNGTFL-KATFPA  135

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+QKAL+E G  K +KATVP NAD+Y SP    VPSAG FR +I D + +I   L  N
Sbjct  136   LKNIQKALDEMG-SKQIKATVPMNADIYSSPEDNSVPSAGDFRSEIRDLMVEIARFLSSN  194

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
             G+PF+IN+YPFLSL Y    FP DFAFFDG  + ++D G  YTNVFDAN+DT V AL + 
Sbjct  195   GSPFVINIYPFLSL-YENPNFPADFAFFDGGGRSINDKGTKYTNVFDANFDTLVWALKKA  253

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +K++VGE+GWPTDG   A+ + A RFY+G +K +A   GTPVRPG  +DVY+F   
Sbjct  254   GISSMKIIVGEVGWPTDGSKNADVAGAKRFYDGLMKKMASNTGTPVRPGP-MDVYLFAFI  312

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PG FE HWGI  YDG+ KF +DLSGK G GK + G  G+EYL  +WC    +
Sbjct  313   DEDMKSIQPGYFERHWGIFTYDGKPKFPMDLSGK-GNGKYLAGASGVEYLSDEWCVYDPS  371

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             A+    +  + D+AC   DCT +   S C+ L  + +VSY FN YFQ +DQ   +CDFQG
Sbjct  372   ARNQEAVPRSMDFACSNGDCTALMGSSPCSKLDRSGRVSYAFNMYFQMKDQDVRACDFQG  431

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L ++T++N S   C F I I
Sbjct  432   LAKITSRNASRDGCLFPIQI  451



>ref|XP_003560627.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=484

 Score =   430 bits (1105),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 297/436 (68%), Gaps = 13/436 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNT-PKPVLNALAGTGIEVMIGTPNALL  368
             +GVNWG   +HPL P +VVKMLK NGI KVKLF+  P PV  AL  +GIEVM+G PN +L
Sbjct  30    VGVNWGSQLTHPLLPSSVVKMLKDNGIMKVKLFDADPWPV-EALLDSGIEVMLGIPNDML  88

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             + + +Y  A+ +VKENVT+Y     D +K+  V VGNEPFLK Y      K T PAL N+
Sbjct  89    EIMSSYGSAQDWVKENVTAYG----DKLKLKYVAVGNEPFLKSYNGT-FMKTTVPALKNI  143

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKAL+ AG+G  VKATVP NADVY+SP     PS+G FR DI D +  +V+ L  +GAPF
Sbjct  144   QKALDAAGLGDKVKATVPLNADVYVSPD--DKPSSGQFRPDIDDVMTDMVKFLHDHGAPF  201

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y  D FP +FAFFDG     D +G +Y+NVFDANYDT V+AL +   G 
Sbjct  202   VVNIYPFLSL-YQSDDFPFEFAFFDGGRNIQDKDGVSYSNVFDANYDTLVSALKKAGVGG  260

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +KVVVGE+GWPTDG+  AN  +A RFY+G +K LA  +GT +RPG  +DVY+FGL+DED 
Sbjct  261   LKVVVGEVGWPTDGNKNANMKLARRFYDGLMKKLAKNEGTHLRPGK-LDVYLFGLFDEDL  319

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLT  1268
             KS  PGNFE HWGIL YDG+ KF +DLSG+ G  K++ GV G++YLP +WC L   AK  
Sbjct  320   KSIAPGNFERHWGILTYDGKPKFPMDLSGQ-GHDKLLAGVSGVQYLPHQWCVLDDEAKAQ  378

Query  1269  N-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
             + L  N  YAC   DCT +  G SC+GL +   +SY FN YFQ QDQ   +CDF GL  +
Sbjct  379   DKLPGNIQYACAGGDCTALGYGCSCDGLDEKSNISYAFNMYFQMQDQDVRACDFDGLANI  438

Query  1446  TTKNLSTPSCRFNIGI  1493
             T KN ST  C F + I
Sbjct  439   TDKNASTKGCLFPVQI  454



>ref|XP_010257791.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nelumbo nucifera]
Length=481

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 292/444 (66%), Gaps = 7/444 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V  + G+GVNWG +++H LPP+ VV+ML+ NG  KVKLF   + +L AL GT IEVM+  
Sbjct  17    VLNVGGVGVNWGTMATHHLPPEMVVEMLRVNGFDKVKLFEAHEGILRALIGTDIEVMLAI  76

Query  354   PNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             PN +L+D+V+ ++A  +++ENVTSY   +  GV I  V VGNEPFL+ Y    L KVT P
Sbjct  77    PNNMLQDMVDPDLAANWIEENVTSY--LNNGGVNIKYVAVGNEPFLRSYNGTFL-KVTLP  133

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q+AL++AG+G  +KATVPFNAD+Y SP   PVPSAG FR +I D V ++VE L  
Sbjct  134   ALRNIQRALDDAGLGSRIKATVPFNADIYNSPASNPVPSAGDFRREIRDIVLEVVEFLYN  193

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF +N+YPFLSL Y    FPVD+AFFDG  KP+ D    YTNVFDAN DT + +L R
Sbjct  194   NNAPFTVNIYPFLSL-YGDPYFPVDYAFFDGTKKPIKDGDVAYTNVFDANLDTLLWSLKR  252

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
               +  ++++VGE+GWPTDGD  AN   A RF  G ++H+   KGTP++ G  I+VY+F L
Sbjct  253   AGYPSMQIMVGEVGWPTDGDKHANIKNAKRFNQGLLRHVLSGKGTPMKRGR-INVYLFSL  311

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DE+ KS  PGNFE HWGI  +DG+ K+  DLSG   + K + G E +EY P +WC +  
Sbjct  312   LDENAKSIAPGNFERHWGIFEFDGKPKYEFDLSGH-EENKGLIGAENVEYFPMRWCVMNP  370

Query  1254  NA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             NA  LT L +N  YAC  +DCT +  GSSCN L      SY+FN ++Q  +Q    CDF 
Sbjct  371   NADDLTELSSNFQYACSFSDCTALGYGSSCNHLDVRGNASYSFNMFYQWNNQRNWDCDFS  430

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLG  1502
             GL  VT  + S   CRF I I  G
Sbjct  431   GLAVVTDVDPSVGECRFPIMIAYG  454



>ref|XP_008440124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=484

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 288/437 (66%), Gaps = 9/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+G NWG +SSHPL P  VVK+LK NGIKKVKLF++    ++AL+G+ IE +IG PN  L
Sbjct  28    GIGANWGIMSSHPLRPNIVVKLLKDNGIKKVKLFDSDSWTVSALSGSKIETVIGIPNDQL  87

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K    +Y+ AK +VKENVT++      GV +  V VGNE FL  Y    + KVTYPA+ N
Sbjct  88    KKFAESYDDAKDWVKENVTTH--MFEGGVDLRYVSVGNEAFLSAYNGTYV-KVTYPAMQN  144

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+ AG GK VK T   NADVY S     +PS G FR DI   +K IV  LD+N AP
Sbjct  145   IQKALDAAGHGKKVKVTTALNADVYESS--TNLPSDGQFRPDIYKTMKDIVHFLDRNKAP  202

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             FM+N+YPFLSL Y    FP+D+AFF G  K  +D GK+YTNVFDANYDT + +L +    
Sbjct  203   FMVNIYPFLSL-YQNPNFPLDYAFFGGGAKATNDKGKSYTNVFDANYDTLIWSLKKIGVT  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG+ FAN  +A RFY+G  K LA   GTP+RP    +VY+FGL DED
Sbjct  262   DMKIIVGEVGWPTDGNKFANVELAKRFYDGLFKKLASGNGTPMRPKEKFEVYLFGLLDED  321

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS LPG FE HWGI  +DG+ KF +D+SGKG   K++   +G++YL KKWC LK N K 
Sbjct  322   MKSVLPGFFERHWGIFQFDGKPKFPMDMSGKGND-KMLVAAKGVQYLEKKWCVLKENVKN  380

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
                +    DYACG +DCT +  GSSCN L     +SY FN Y+Q QDQ+ ++CDF G   
Sbjct  381   FDKISKEVDYACGLSDCTSLGYGSSCNNLDKRGNISYAFNMYYQMQDQSVEACDFSGSAH  440

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +  KN S  SC F I I
Sbjct  441   IVKKNASVGSCLFPIQI  457



>ref|XP_010261306.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nelumbo nucifera]
Length=481

 Score =   429 bits (1102),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 293/442 (66%), Gaps = 10/442 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG I SHPL P  VV+MLK NGIKKVKLF++    +N+LAG+GI+VM+  PN  L
Sbjct  25    GIGVNWGIIMSHPLLPATVVRMLKDNGIKKVKLFDSDSWTVNSLAGSGIQVMVAIPNDQL  84

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +   + Y+ AK +V +N+TS+      GV I  V +GNEPFLK Y  +     T+PAL N
Sbjct  85    ERFSDDYDNAKDWVHDNITSH--LYKGGVDIKYVAIGNEPFLKSYNGR-FTNHTFPALKN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL+EAG+G  +KAT P NADVY S      PS G FR DI + + KIV+ L+ N AP
Sbjct  142   IQRALDEAGLGDKIKATTPLNADVYDSS--TGTPSGGNFRKDIRELMIKIVKFLNANNAP  199

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL Y  D FP++FAFFD    P+ DNG  YTNV DAN+DT V +L +    
Sbjct  200   FVVNIYPFLSL-YQNDDFPMEFAFFDSDSSPIVDNGIKYTNVLDANHDTLVWSLKKAGVP  258

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K+++GEIGWPTDG   AN   A RFY+G  K LA  KGTP+RPG  +DVY+FGL+DE+
Sbjct  259   NLKIIIGEIGWPTDGHKKANVHYAKRFYDGLFKKLASDKGTPLRPGK-MDVYLFGLFDEN  317

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS LPG FE HWGI  YDG+ KF +D SG+ G  K+  G +G++YLP +WC L    K 
Sbjct  318   MKSILPGFFERHWGIFRYDGKPKFPMDFSGQ-GHDKLPVGAKGVQYLPAQWCILDRKIKN  376

Query  1266  TNL-KANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
              NL  AN DYAC  ADC+ +  G SCNG+     VSY FN YFQ Q+Q   +CDFQGL  
Sbjct  377   VNLVPANMDYACTYADCSALVYGGSCNGMDIYGNVSYAFNMYFQMQNQDVQACDFQGLAV  436

Query  1443  VTTKNLSTPSCRFNIGIKLGAE  1508
             +TTKN S  SC F I I    E
Sbjct  437   LTTKNASRGSCLFPIEIVSAGE  458



>ref|XP_006352469.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum tuberosum]
Length=489

 Score =   427 bits (1099),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 225/444 (51%), Positives = 291/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP +VVKML  NG  KVKLF   + +LNAL GT IEVM+  PN +L+
Sbjct  25    VGVNWGTMATHQLPPNSVVKMLIENGFDKVKLFEADEVILNALIGTEIEVMLAIPNYMLE  84

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             DL  N  +A ++V+ NV++Y    P GVKI  V VGNEPFL+ Y    L +   PAL N+
Sbjct  85    DLSSNSIIADSWVEANVSAY--AYPHGVKIRYVAVGNEPFLRTYNGTYL-QYILPALKNV  141

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+A+N+AG+G  VKAT+PFNAD+Y SP    VPSAG FR ++ D   +IV+ L  N APF
Sbjct  142   QEAINKAGLGAKVKATIPFNADIYFSPESNQVPSAGDFRPEVRDLTLQIVQYLYLNDAPF  201

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y    FP+DFAFFDG +KP+ D    YTNVFDAN+DT V +L +     
Sbjct  202   VVNIYPFLSL-YGNIYFPLDFAFFDGSNKPVRDGDYVYTNVFDANFDTLVWSLKKAGFTD  260

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K+VVGE+GWPTDGD  AN   A RF  G IKH   ++GTP R G  I+VY+F L DE+ 
Sbjct  261   MKIVVGEVGWPTDGDKNANNENAMRFNQGLIKHCLSEQGTPARKGKKIEVYLFSLIDENA  320

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLT  1268
             KS  PGNFE HWG+  +DG+ K+ LDLSG+  K K +  VEG+ Y+ K+WC LK    +T
Sbjct  321   KSIAPGNFERHWGMFEFDGKPKYELDLSGRMQKDKGLVAVEGVNYMHKRWCILKPENAVT  380

Query  1269  ------NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                   +L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q ++Q    CDF 
Sbjct  381   DVDNAEDLPKNIDYACSLSDCTALGYGSSCNHLSTEGNASYAFNMYYQLKNQNSWDCDFD  440

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLG  1502
             GL  VT ++ S   CRF + I +G
Sbjct  441   GLAVVTDEDPSDDKCRFPLMIAVG  464



>dbj|BAK06743.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 289/437 (66%), Gaps = 15/437 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG   +HPL P AVVKMLK NGI KVKLF+     + AL  +GIEVM+G PN +L+
Sbjct  33    LGVNWGSQCTHPLDPSAVVKMLKENGIMKVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  92

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y  A+ +V EN TSY     D +K+  V VGNEPFLK Y      + T PAL N+Q
Sbjct  93    TMTSYGNAEDWVAENATSYG----DRLKLRYVAVGNEPFLKSYNGS-FMETTVPALKNIQ  147

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             KAL+EAG+G  VKATVP NADVY+       PS G FR DI D +  +V+ +  +GAPF+
Sbjct  148   KALDEAGLGDKVKATVPLNADVYVGDK----PSEGKFRPDIDDVMTDMVKFMHDHGAPFV  203

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkv  911
             +N+YPFLSL Y  D FP +FAFFDG     D+ G +Y+NVFDANYDT V+AL +     +
Sbjct  204   VNIYPFLSL-YQSDDFPFEFAFFDGGHSIQDNGGVSYSNVFDANYDTLVSALKKAGVANL  262

Query  912   kvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQK  1091
             KV+VGE+GWPTDG+   NA +A RFY+G +K LA  +GT +R G  +DVY+FGL+DED K
Sbjct  263   KVIVGEVGWPTDGNKNGNAKLARRFYDGLLKKLAKNEGTHLRQGK-MDVYLFGLFDEDMK  321

Query  1092  STLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLT-  1268
             S  PGNFE HWGIL YDG+ KF +DLSG+G   +++  V G+EYLPK+WC    +A    
Sbjct  322   SIAPGNFERHWGILTYDGKPKFAMDLSGQGND-RLLAAVPGVEYLPKQWCVFDEDAAKDG  380

Query  1269  --NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
                L  N  YAC   DCT +  G SCNGL +   +SY FN YFQ QDQ   +CDF GL +
Sbjct  381   KGKLPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAK  440

Query  1443  VTTKNLSTPSCRFNIGI  1493
             ++ KN ST +C F + I
Sbjct  441   ISDKNASTKTCLFPVQI  457



>ref|XP_004250551.2| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Solanum lycopersicum]
Length=493

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 225/444 (51%), Positives = 290/444 (65%), Gaps = 11/444 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP +VVKML  NG  KVKLF   + +LNAL GT IEVM+  PN +L+
Sbjct  30    VGVNWGTMATHQLPPNSVVKMLIENGFDKVKLFEADEVILNALIGTEIEVMLAIPNYMLE  89

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             DL  N  +A ++V+ NV+ Y    P GVKI  V VGNEPFL+ Y    L +   PAL N+
Sbjct  90    DLSSNPIIADSWVEANVSVY--AYPHGVKIRYVAVGNEPFLRTYNGTYL-QYILPALKNV  146

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+A+N+AG+G  VKAT+PFNAD+Y SP    VPSAG FR ++ D   +IV+ L  N APF
Sbjct  147   QEAINKAGLGAKVKATIPFNADIYFSPESNQVPSAGDFRPEVRDLTLQIVQYLYSNDAPF  206

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y    FP+DFAFFDG +KP+ D    YTNVFDAN+DT V +L +     
Sbjct  207   VVNIYPFLSL-YGNIYFPLDFAFFDGSNKPVRDGDNVYTNVFDANFDTLVWSLKKAGFTD  265

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K+VVGE+GWPTDGD  AN   A RF  G IKH   ++GTP R G  I+VY+F L DE+ 
Sbjct  266   MKIVVGEVGWPTDGDKNANIENAMRFNQGLIKHCLSEQGTPARKGKKIEVYLFSLIDENA  325

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLT  1268
             KS  PGNFE HWG+  +DG+ K+ LDLSG+  K K +  VEG+ Y+ K+WC LK    +T
Sbjct  326   KSIAPGNFERHWGMFEFDGKPKYELDLSGRMQKDKGLVAVEGVNYMHKRWCILKPENAVT  385

Query  1269  ------NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
                   +L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q ++Q    CDF 
Sbjct  386   DADNAEDLPKNIDYACSLSDCTALGYGSSCNHLSTEGNASYAFNMYYQLKNQNSWDCDFD  445

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLG  1502
             GL  VT ++ S   CRF + I +G
Sbjct  446   GLAVVTDEDPSDDKCRFPLMIAVG  469



>ref|XP_010915073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Elaeis guineensis]
Length=468

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 226/440 (51%), Positives = 284/440 (65%), Gaps = 11/440 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             A  + +GVNWG  +SHPLPPK VV+ML  NGIKKVKLF+T    ++ALA TGIEVM+G P
Sbjct  14    ASTEAIGVNWGTQASHPLPPKIVVRMLTDNGIKKVKLFDTESSAMSALANTGIEVMVGIP  73

Query  357   NALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
             N  L+ +  +  AKA+V ENVT Y       V I  V VGNEPFL+ Y    L K T+PA
Sbjct  74    NDQLEHMGTFSNAKAWVHENVTGYK-----DVNIKYVAVGNEPFLQSYNGTFL-KTTFPA  127

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+QKAL+E G  K +KAT+P NAD+Y SP    VPSAG FR DI D + +I   LD +
Sbjct  128   LKNIQKALDEMG-HKEIKATIPMNADIYSSPDDNAVPSAGKFRSDIHDLMVEIARFLDSH  186

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
             G+PF+IN+YPFLSL Y    FPVDFAFF G    ++D G  Y NVFDAN+DT V AL + 
Sbjct  187   GSPFVINIYPFLSL-YENPNFPVDFAFFGGGGPSINDEGTQYNNVFDANFDTLVWALKKV  245

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +K+++GE+GWPTDG   AN + A RFY+G +K +    GTP+RPG  +DVY+F   
Sbjct  246   GLSNMKIIIGEVGWPTDGSKHANVADAKRFYDGLLKKMGSNTGTPLRPGP-MDVYLFAFI  304

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PG FE HWGI  YDG+ KF +DLSGKG   K + G  G+EYL  +WC    N
Sbjct  305   DEDMKSIQPGFFERHWGIFAYDGKPKFPMDLSGKGND-KYLVGASGVEYLEDEWCVFDPN  363

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             AK    + ++ D+AC   DCT +   S C+ L   +++SY FN YFQ  DQ   +CDFQG
Sbjct  364   AKNQEKVPSSMDFACFHGDCTALMGSSPCSKLDRNDRISYAFNMYFQMTDQDVRACDFQG  423

Query  1434  LGEVTTKNLSTPSCRFNIGI  1493
             L ++T KN S   C F I I
Sbjct  424   LAKITNKNASRDGCLFPIQI  443



>ref|XP_003575938.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=499

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 287/449 (64%), Gaps = 18/449 (4%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +GLGVNWG +++  LPPK + ++L+ NG  KVK+F+  +  ++ LAGTGIE MI  PN L
Sbjct  18    EGLGVNWGTMATRRLPPKTMARLLRDNGFSKVKIFDADESTMSGLAGTGIEAMIAVPNDL  77

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + +++ A+ +V+ NVT Y      GV I  V VGNEPFLK Y   G +  VT PAL 
Sbjct  78    LAAVSDFDGARKWVRANVTKY--AFRGGVNIKFVAVGNEPFLKAY--NGTYDNVTVPALK  133

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q+ALNEAG G +VKATVP NADVY SPP  PVPSAG FR DIA  +  +V  L+ +GA
Sbjct  134   NIQRALNEAGHGASVKATVPVNADVYDSPPDNPVPSAGAFRADIAGVMADMVAFLNHSGA  193

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDG------VDKPLDD--NGKTYTNVFDANYDTAV  878
             PF +N+YPFLSL Y  D FP+D+AFFD          P+ D  NG  YTNVFDAN+DT V
Sbjct  194   PFSVNIYPFLSL-YGNDDFPLDYAFFDPGNGTGPAPNPVVDAANGINYTNVFDANFDTLV  252

Query  879   AALSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDV  1058
             +AL R   G + VV+GE+GWPTDGD  A    A RFY G +K +A  +GTP+RP A I+V
Sbjct  253   SALKRIGFGDLPVVIGEVGWPTDGDKHATVPYAERFYAGLLKRIASGRGTPLRPKARIEV  312

Query  1059  YMFGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKW  1238
             Y+FGL DED KS  PGNFE HWGI  +DG+ KF LDL   GG   +     G+ YLP++W
Sbjct  313   YLFGLMDEDAKSVAPGNFERHWGIFTFDGRPKFPLDLGLHGGTPAMPKPARGVHYLPRRW  372

Query  1239  CALKAN----AKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQ  1406
             C L  N    +  T L  N  YAC RADCT +  G SC  L      SY FN Y+QAQ Q
Sbjct  373   CVLNTNSTNVSNETALADNVGYACSRADCTALGFGCSCGTLDAAGNASYAFNVYYQAQGQ  432

Query  1407  AKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
                +CDFQGL  VT ++ S  +C F + +
Sbjct  433   VDSACDFQGLAVVTHEDASRGACNFTVQV  461



>ref|XP_004149714.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN61959.1| hypothetical protein Csa_2G277010 [Cucumis sativus]
Length=487

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 293/436 (67%), Gaps = 9/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LG NWG ++SHPL P  VV +L+ NGIKKVKLF++    ++ALAG+ IE ++G PN  L+
Sbjct  30    LGANWGTMASHPLNPNIVVNLLEDNGIKKVKLFDSDSWTVSALAGSKIETIVGIPNDQLE  89

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L  +Y  AK +VKENVT++      GV I  + VGNEPFL  Y    + K+T+PA+ N+
Sbjct  90    SLASDYNHAKDWVKENVTAH--IYDGGVNIRYIAVGNEPFLTAYNGTYI-KLTFPAMQNI  146

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKAL+EAG  K +K T P NADVY S    P  S G FR DI D++K IV  L +N A F
Sbjct  147   QKALDEAGYSKKIKVTCPLNADVYESATNQP--SDGQFRSDILDEMKDIVRFLSRNDAAF  204

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             M+N+YPFLSL+ + D FPVDFAFFD   K ++D GK YTNVFDAN+DT V +L +   G 
Sbjct  205   MVNIYPFLSLYLNSD-FPVDFAFFDENGKSINDKGKKYTNVFDANFDTLVWSLKKIGLGD  263

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDG+ FA   +A RFY+G +K LA KKGTP+RP   ++VY+FGL DED 
Sbjct  264   LKIIVGEVGWPTDGNKFATVELAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLLDEDL  323

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PG FE HWG+  YDG+ KF+LDL+GKG   K +   +G++YL  KWC +K + K L
Sbjct  324   KSIQPGFFERHWGLFRYDGKPKFSLDLTGKGND-KRLVAAKGVQYLEHKWCVVKNSVKDL  382

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               + +  DYAC  +DCT +  GSSCN L+    +SY +N YFQ QDQ+ ++C F    E+
Sbjct  383   GTISSQIDYACSMSDCTSLGYGSSCNNLNSRGNISYAYNMYFQMQDQSVEACVFGESAEI  442

Query  1446  TTKNLSTPSCRFNIGI  1493
              T+N S  SC F I I
Sbjct  443   VTRNASVGSCLFPIQI  458



>ref|XP_004170594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
Length=487

 Score =   426 bits (1094),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 293/436 (67%), Gaps = 9/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LG NWG ++SHPL P  VV +L+ NGIKKVKLF++    ++ALAG+ IE ++G PN  L+
Sbjct  30    LGANWGTMASHPLNPNIVVNLLEDNGIKKVKLFDSDSWTVSALAGSKIETIVGIPNDQLE  89

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L  +Y  AK +VKENVT++      GV I  V VGNEPFL  Y    + K+T+PA+ N+
Sbjct  90    SLASDYNHAKDWVKENVTAH--IYDGGVNIRYVAVGNEPFLTAYNGTYI-KLTFPAMQNI  146

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKAL+EAG  K +K T P NADVY S    P  S G FR DI D++K IV  L +N A F
Sbjct  147   QKALDEAGYSKKIKVTCPLNADVYESATNQP--SDGQFRSDILDEMKDIVRFLSRNDAAF  204

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             M+N+YPFLSL+ + D FPVDFAFFD   K ++D GK YTNVFDAN+DT V +L +   G 
Sbjct  205   MVNIYPFLSLYLNSD-FPVDFAFFDENGKSINDKGKKYTNVFDANFDTLVWSLKKIGLGD  263

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDG+ FA   +A RFY+G +K LA KKGTP+RP   ++VY+FGL DED 
Sbjct  264   LKIIVGEVGWPTDGNKFATVELAKRFYDGLLKKLASKKGTPMRPNEKLEVYLFGLLDEDL  323

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PG FE HWG+  YDG+ KF+LDL+GKG   K +   +G++YL  KWC +K + K L
Sbjct  324   KSIQPGFFERHWGLFRYDGKPKFSLDLTGKGND-KRLVAAKGVQYLEHKWCVVKNSVKDL  382

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               + +  DYAC  +DCT +  GSSCN L+    +SY +N YFQ QDQ+ ++C F    E+
Sbjct  383   GTISSQIDYACSMSDCTSLGYGSSCNNLNSRGNISYAYNMYFQMQDQSVEACVFGESAEI  442

Query  1446  TTKNLSTPSCRFNIGI  1493
              T+N S  +C F I I
Sbjct  443   VTRNASVGNCLFPIQI  458



>ref|XP_002530257.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32127.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=481

 Score =   424 bits (1091),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 293/441 (66%), Gaps = 11/441 (2%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             A L G+GVNWG+I+SHPLPP  VVKMLK N I +VKLF+     +NALAG+GIEVM+  P
Sbjct  24    AVLPGIGVNWGNIASHPLPPDIVVKMLKDNNINRVKLFDADAWTVNALAGSGIEVMVAIP  83

Query  357   NALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             N +L+ + +  + AK +VKENVT Y      GV I  V VGNEPFL  Y      K T+P
Sbjct  84    NNMLQYIADSVDNAKDWVKENVTEY-LRGQGGVDIRYVAVGNEPFLASYNGS-YDKTTFP  141

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+QKAL+E G+G  +KA+VP NADVY       +PS G FR D+ D + KIV  L  
Sbjct  142   ALQNVQKALDEEGVGDKIKASVPLNADVY----EGNLPSQGNFRKDVRDVMTKIVHHLHD  197

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             + APF++N+YPF+SL Y    FP ++AFFDG  K + D   TYTNVF+ANYDT V +L +
Sbjct  198   HKAPFIVNIYPFISL-YQSSSFPFEYAFFDGGGKKIQDKNVTYTNVFEANYDTLVWSLKK  256

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                  +K++VGE+GWPTDG  +ANA++A +FY+G +K LA KKGTP+RPG  +DVY+FGL
Sbjct  257   AGVPDLKILVGEVGWPTDGHVYANANLAKKFYDGLLKTLAAKKGTPLRPGV-LDVYLFGL  315

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DED KS LPGNFE HWGI  +DG+ KF +D SG+G   K++   +G++YLP KWC L  
Sbjct  316   LDEDMKSNLPGNFERHWGIFRFDGRPKFAMDFSGQGND-KMLIEAKGVQYLPAKWCVLNK  374

Query  1254  NAKLTNL-KANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
               +  ++  A   YAC  ADC+ ++ GSSCN L     VSY FN YFQ  +Q   +CDF 
Sbjct  375   EVESKSMIPAEISYACSLADCSSLAYGSSCNKLDSDGNVSYAFNMYFQMNNQDVQACDFS  434

Query  1431  GLGEVTTKNLSTPSCRFNIGI  1493
             GL  + T+N S  +C F I I
Sbjct  435   GLATIVTQNASRGTCLFPIQI  455



>gb|KHG25475.1| hypothetical protein F383_09937 [Gossypium arboreum]
Length=432

 Score =   422 bits (1086),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 223/415 (54%), Positives = 282/415 (68%), Gaps = 8/415 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             +DGLGVNWG +++H LPP+ VV+MLK NGI KVKLF+     ++AL+G+ +EVM+  PN 
Sbjct  25    VDGLGVNWGTMATHKLPPETVVQMLKDNGITKVKLFDADSKTMDALSGSDLEVMVAIPND  84

Query  363   LLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALA  542
              L  + +Y+ AK +VK+N+T+YN     GV I  V VGNEPFLK Y        T PAL 
Sbjct  85    QLLAMNSYDRAKQWVKKNITTYNFKG--GVNIKYVAVGNEPFLKSYNGS-FINTTVPALQ  141

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG+G T+KATVP NADVY SP   PVPSAG FR DI+  + ++VE L KNGA
Sbjct  142   NIQNALNDAGVGDTIKATVPLNADVYNSPESNPVPSAGRFRTDISGPMTQMVEFLAKNGA  201

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPFLSL Y  D FP ++AFFDG   P+ DNG  YTNVFDAN+DT V+AL    H
Sbjct  202   PFTVNIYPFLSL-YGNDDFPFNYAFFDG-GNPITDNGIKYTNVFDANFDTLVSALKAVGH  259

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGE+GWPTDGD   N + A RFYNG +  LA   GTP+RPG  I+VY+FGL DE
Sbjct  260   GDMPIIVGEVGWPTDGDKNGNMANAQRFYNGLLPRLAANTGTPLRPGY-IEVYLFGLIDE  318

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDGQ KF LDLSG+  + K + G + ++YL ++WC    NAK
Sbjct  319   DAKSVAPGNFERHWGIFRYDGQPKFPLDLSGQ-NQNKFLIGAKDVKYLQQQWCMFNPNAK  377

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
              +  L  N +YAC  +DCT +  GSSCN L      SY FN Y+Q Q+Q   + D
Sbjct  378   DIGKLTDNINYACTFSDCTALGYGSSCNNLDANGNASYAFNMYYQVQNQKDMAYD  432



>ref|XP_004142041.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
 gb|KGN48417.1| hypothetical protein Csa_6G486900 [Cucumis sativus]
Length=483

 Score =   424 bits (1091),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 289/442 (65%), Gaps = 9/442 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG +SSHPL P  VVK+LK NGIKKVKLF++    +++L+G+ IE +IG PN  L
Sbjct  28    GIGVNWGILSSHPLRPNIVVKLLKDNGIKKVKLFDSDAWTVSSLSGSKIETIIGIPNDQL  87

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K    +Y+ AK +VKENVTS+      GV +  V VGNE FL  Y      KVT+PA+ N
Sbjct  88    KKFAKSYDDAKDWVKENVTSH--MFEGGVDLRYVSVGNEAFLTAYNGS-FVKVTFPAMQN  144

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKA++ AG GK +K T   NADVY S     +PS G FR DI   +K IV  LD+N AP
Sbjct  145   IQKAIDAAGHGKKIKVTTALNADVYESS--TNLPSDGEFRPDIYSTMKDIVHFLDRNKAP  202

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             FM+N+YPFLSL Y    FP+D+AFFDG  K  +D  K+YTNVFDANYDT + +L +    
Sbjct  203   FMVNIYPFLSL-YQNPNFPLDYAFFDGGGKATNDKDKSYTNVFDANYDTLIWSLKKLGVS  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG+ FAN ++A RFY+G  K LA   GTP+RP    +VY+FGL DED
Sbjct  262   DMKIIVGEVGWPTDGNKFANVNLAKRFYDGLFKKLASGDGTPMRPKEKFEVYLFGLLDED  321

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS LPG FE HWGI  +DG+ KF +D SGKG   K++   +G++YL KKWC LK N K+
Sbjct  322   MKSVLPGFFERHWGIFQFDGKPKFPMDSSGKGND-KMLVAAKGVQYLEKKWCVLKKNVKV  380

Query  1266  -TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
               N+    DYAC  +DCT +  GSSCN L     +SY FN Y+Q QDQ+ ++C F G  E
Sbjct  381   FDNISPQVDYACSLSDCTSLGYGSSCNNLDRRGNISYAFNMYYQMQDQSVEACVFNGSAE  440

Query  1443  VTTKNLSTPSCRFNIGIKLGAE  1508
             +   N S  SC F I I    E
Sbjct  441   IVKNNASVGSCLFPIQIVSAGE  462



>ref|XP_004966001.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=479

 Score =   424 bits (1089),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 227/435 (52%), Positives = 290/435 (67%), Gaps = 11/435 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P +VVKMLKANGI +VKLF+     + AL  +GIEVM+G PN +L+
Sbjct  29    VGVNWGSQLSHPLLPTSVVKMLKANGISRVKLFDADPWPVGALLDSGIEVMLGIPNDMLE  88

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
              + +Y  AK +V ENVT+Y     D +K+  V VGNEPFLK Y      + T+PAL N+Q
Sbjct  89    MMNSYGNAKDWVSENVTAYG----DKLKLKYVAVGNEPFLKAYNGS-FMRTTFPALKNIQ  143

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             KALNEAG+G  VKA VP NADVY+SP     PS+G FR DI D +  +V+ L  +GAPF+
Sbjct  144   KALNEAGVGDKVKAVVPLNADVYVSP--DDKPSSGSFRPDINDLMTDMVKFLHDHGAPFV  201

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkv  911
             +N+YPFLSL Y  D FP +FAFFDG     D  G +Y+NVFDANYDT V AL +     +
Sbjct  202   VNIYPFLSL-YQSDDFPFEFAFFDGGRNIQDKGGISYSNVFDANYDTLVNALEKAGVPNL  260

Query  912   kvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQK  1091
             KV+VGE GWPTDG+  AN  +A RFY+G ++ L+  +GTPVRPG  ++VY+FGL+DED K
Sbjct  261   KVIVGEAGWPTDGNKNANLKLARRFYDGLLEKLSKNEGTPVRPGK-MEVYLFGLFDEDMK  319

Query  1092  STLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-LT  1268
             S  PGNFE HWGI  YDG+ KF +DL+G+    K+++ V  +EYLP +WC     AK  +
Sbjct  320   SIAPGNFERHWGIFTYDGKPKFPIDLTGQ-RHDKLLSPVPDVEYLPHQWCVFDDGAKDKS  378

Query  1269  NLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVT  1448
              L  N  YAC   DCT +  G SCNGL +   +SY FN YFQ QDQ   +CDF GL +++
Sbjct  379   KLPGNIQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFDGLAKIS  438

Query  1449  TKNLSTPSCRFNIGI  1493
              KN ST  C F I +
Sbjct  439   DKNASTRGCLFPIQV  453



>ref|XP_009336372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=480

 Score =   424 bits (1089),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 299/442 (68%), Gaps = 12/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + GLGVNWG +SSHPLPP  VVKMLK NGIKKVKLF+     + AL+GTGI+VM+G PN 
Sbjct  21    VQGLGVNWGQMSSHPLPPNDVVKMLKDNGIKKVKLFDADPTTMKALSGTGIDVMVGIPNE  80

Query  363   LLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPA  536
              L  + + Y  A+ +VK+NVT+Y      GV I+ V VGNEPFL  Y   G F K  YP+
Sbjct  81    KLNKIAHDYATARKWVKQNVTAY--LHDGGVTISYVAVGNEPFLTSY--NGTFVKDVYPS  136

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             + N+QKAL+EAG+G  +K  VPFNADVY SP  +  PS G FR DI   + +I+E L  +
Sbjct  137   VKNVQKALDEAGVGGKIKCVVPFNADVYESP--SNKPSDGRFRKDIKKSMMEILEYLRTH  194

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              +PF++N+YPFLSL  S   FP +FAFFDG  KP+ DNG  Y+NVFDANYDT + AL + 
Sbjct  195   KSPFVVNIYPFLSLSQSSG-FPKEFAFFDGGGKPVRDNGARYSNVFDANYDTLLWALKKA  253

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 + +V+GE+GWPTDG +F N+ +A +FY+G +K LA + GTP+R G  ++VY+FGL+
Sbjct  254   GVPNLDIVIGEVGWPTDGHDFGNSRLAKKFYDGLLKKLASEVGTPLRKGY-LEVYLFGLF  312

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED+KS  PG+FE HWGI  YDG+ KF +DLSG+    +++ GVEG++YL KKWC L ++
Sbjct  313   DEDEKSIAPGDFERHWGIFRYDGKPKFPMDLSGQASGHQMLKGVEGVKYLEKKWCVLNSD  372

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
              + L+   A  +YAC +ADCT +    SC+ L   +++SY FN ++Q  DQ    CDF G
Sbjct  373   VRNLSRALAEFNYACSQADCTSLGGKRSCD-LEMHDRISYAFNEFYQKGDQDYRKCDFSG  431

Query  1434  LGEVTTKNLSTPSCRFNIGIKL  1499
             +G   T++ S   C F + I L
Sbjct  432   MGTKVTRDPSKGDCLFRVQIDL  453



>ref|XP_008392630.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=477

 Score =   423 bits (1087),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 294/437 (67%), Gaps = 12/437 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SH LPPK VV+MLK NGIKKVKLF+     LNALAG+GI+VM+G PN  L
Sbjct  23    GLGVNWGAMASHQLPPKNVVQMLKDNGIKKVKLFDAEPSTLNALAGSGIQVMVGIPNEKL  82

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + L + Y  A+ +VKENVT +  +    V I+ V VGNEP+L  Y      K TYPAL N
Sbjct  83    EKLADSYSEAQQWVKENVTKWLGS----VSISYVAVGNEPYLTSYNGS-YVKTTYPALKN  137

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKA+ E G G  VKATVPFNADVY S   +  PS G FR DI + + +I+  L  N +P
Sbjct  138   IQKAIREXGAGDKVKATVPFNADVYESS--SSKPSDGRFRKDIKNNMVEILRHLRDNKSP  195

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ S D FP +FAFF+G  KP+ DN   Y NVFDAN DT + AL +E  G
Sbjct  196   FVVNIYPFLSLYQSPD-FPKEFAFFEGGSKPVSDNNIEYKNVFDANCDTLINALKKEGFG  254

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +++++GE GWPTDGD  AN   A +FY+G +K L   +GTP+R G  ++VY+FGL+DED
Sbjct  255   NMEIIIGEAGWPTDGDKNANIKNAKKFYDGLLKKLGKXEGTPLRKGK-LEVYLFGLFDED  313

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             QKS  PG+FE HWGI  YDGQ KF +DLSGKG   +++  V+G+EYL K+WC L ++ K 
Sbjct  314   QKSIAPGDFERHWGIFRYDGQPKFPMDLSGKGNGDQMLKAVKGVEYLEKQWCVLNSDVKN  373

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++   A  +YAC  +DCT +  G SC+ L    KVSY FN+YFQ +DQ   +C+F G+  
Sbjct  374   MSQTDAELNYACAGSDCTSLGTGRSCD-LDQHGKVSYAFNSYFQNRDQDVRTCNFNGMAT  432

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T  N S   C F + I
Sbjct  433   ITKNNPSVGDCLFPVQI  449



>ref|NP_001183732.1| uncharacterized protein LOC100502325 precursor [Zea mays]
 gb|ACR38156.1| unknown [Zea mays]
 gb|AFW87159.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=488

 Score =   423 bits (1087),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 226/436 (52%), Positives = 294/436 (67%), Gaps = 12/436 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG   SHPL P +VVKMLKAN I +VK+F+     + AL  +GIEVM+G PN +L+
Sbjct  38    VGVNWGSQLSHPLLPGSVVKMLKANRIARVKMFDADSWPVGALVDSGIEVMLGIPNDMLE  97

Query  372   DLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              + + Y  A+ +VKENVT+Y     D +K+  V VGNEPFLK Y      K T+PAL N+
Sbjct  98    TMSSSYGNAQDWVKENVTAYG----DKLKLKYVAVGNEPFLKAYNGS-FMKTTFPALKNI  152

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKAL+EAG+G TVKA VP NADVY+SP   P  S+G FR DI   +  +V+ L  +GAPF
Sbjct  153   QKALDEAGVGNTVKAVVPLNADVYVSPDDKP--SSGAFRPDINGLMTDMVKFLHDHGAPF  210

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y  D FP +FAFFDG     D  G TY+NVFDANYDT V AL +     
Sbjct  211   VVNIYPFLSL-YQSDNFPFEFAFFDGGKNIQDKGGVTYSNVFDANYDTLVHALKKAGVPD  269

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +KV+VGE GWPTDG+ +AN  +A RFY+G ++ LA  +GTPVR G  ++VY+FGL+DED 
Sbjct  270   LKVIVGEAGWPTDGNKYANFKLARRFYDGLLRKLAKNEGTPVRKGK-MEVYLFGLFDEDM  328

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PGNFE HWGI  YDG+ KF +DL+G+G + K+++ V  ++YLP +WC     A+  
Sbjct  329   KSIAPGNFERHWGIFTYDGKPKFPIDLTGQGHE-KLLSPVTDVKYLPNQWCVFDDGAEDK  387

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
             + L +N  YAC   DCT +  G SCNGL +   +SY FN YFQ QDQ   +CDF+GL ++
Sbjct  388   SKLPSNVQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACDFEGLAKI  447

Query  1446  TTKNLSTPSCRFNIGI  1493
             T KN ST  C F + I
Sbjct  448   TDKNASTRGCLFPVQI  463



>ref|NP_001152213.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 gb|ACG46412.1| glucan endo-1,3-beta-glucosidase 5 precursor [Zea mays]
 gb|ACN35266.1| unknown [Zea mays]
 gb|AFW78871.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=481

 Score =   422 bits (1085),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 217/436 (50%), Positives = 288/436 (66%), Gaps = 11/436 (3%)
 Frame = +3

Query  195   GVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKD  374
             GVNWG + SHP+ P AVV+ML+ANG+ +VKLF+     ++ALAG+G++ M+  PN  L  
Sbjct  31    GVNWGTMMSHPIHPSAVVEMLRANGVDRVKLFDADPWTVSALAGSGVQAMLAAPNDQLAS  90

Query  375   LV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQ  551
             L  +   A+ +V++NVT+       GV +  V VGNEPFLK Y       +T+PAL NMQ
Sbjct  91    LARDPRRARDWVRQNVTA---NINAGVDVRYVAVGNEPFLKSYNGS-FINITFPALKNMQ  146

Query  552   KALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFM  731
             +A++EAG G+ +K  VP NAD+Y SP   PVPSAG FR DI   +  IV  L  N APF+
Sbjct  147   RAIDEAGFGQHIKVVVPLNADIYSSPENKPVPSAGTFRKDINTLMVDIVNYLHANDAPFV  206

Query  732   INVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkv  911
             +N+YPFLSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L +     +
Sbjct  207   VNIYPFLSL-YQNPNFPLNFSFFDGATKPVYDQGMVYTNVFDANFDTLVWSLRKAGVPDM  265

Query  912   kvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQK  1091
             +++VGE+GWP+DGD  AN   A RFYNGF+K +    GTP+RPG  ++VY+F L DE+QK
Sbjct  266   RIIVGEVGWPSDGDKNANTKYAQRFYNGFLKKMTKNVGTPLRPGR-MEVYLFALIDENQK  324

Query  1092  STLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--KL  1265
             S LPG FE HWG+  YDG+ KF++DLSG  GKG +   V+G++YLP +WC    +   K 
Sbjct  325   SVLPGRFERHWGLFTYDGKPKFSMDLSGN-GKGSVAE-VKGVQYLPPQWCVFNKDTKDKY  382

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
              +L A+ +YAC  ADCTP+  GSSCNGLS    +SY FN YFQ  DQ   +C F GL ++
Sbjct  383   KDLPASVNYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAKI  442

Query  1446  TTKNLSTPSCRFNIGI  1493
             TT N S   C F + I
Sbjct  443   TTTNASQGGCLFPVQI  458



>ref|XP_004164948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus]
Length=483

 Score =   422 bits (1085),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 289/442 (65%), Gaps = 9/442 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG +SSHPL P  VVK+LK NGIKKVKLF++    +++L+G+ IE +IG PN  L
Sbjct  28    GIGVNWGILSSHPLRPNIVVKLLKDNGIKKVKLFDSDAWTVSSLSGSKIETIIGIPNDQL  87

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K    +Y+ AK +VKENVTS+      GV +  V VGNE FL  Y      KVT+PA+ N
Sbjct  88    KKFAKSYDDAKDWVKENVTSH--MFEGGVDLRYVSVGNEAFLTAYNGS-FVKVTFPAMQN  144

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKA++ AG GK +K T   NADVY S     +PS G FR DI   +K IV  LD+N AP
Sbjct  145   IQKAIDAAGHGKKIKVTTALNADVYESS--TNLPSDGEFRPDIYSTMKDIVHFLDRNKAP  202

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             FM+N+YPFLSL Y    FP+D+AFFDG  K  +D  K+YTNVFDANYDT + +L +    
Sbjct  203   FMVNIYPFLSL-YQNPNFPLDYAFFDGGGKATNDKDKSYTNVFDANYDTLIWSLKKLGVS  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG+ FAN ++A RFY+G  K LA   GTP+RP    +VY+FGL DED
Sbjct  262   DMKIIVGEVGWPTDGNKFANVNLAKRFYDGLFKKLASGDGTPMRPKEKFEVYLFGLLDED  321

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS LPG FE HWGI  +DG+ KF +D SGKG   K++   +G++YL KKWC LK N K+
Sbjct  322   MKSVLPGFFERHWGIFLFDGKPKFPMDSSGKGND-KMLVAAKGVQYLEKKWCVLKKNVKV  380

Query  1266  -TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
               ++    DYAC  +DCT +  GSSCN L     +SY FN Y+Q QDQ+ ++C F G  E
Sbjct  381   FDDISPQVDYACSLSDCTSLGYGSSCNNLDRRGNISYAFNMYYQMQDQSVEACVFNGSAE  440

Query  1443  VTTKNLSTPSCRFNIGIKLGAE  1508
             +   N S  SC F I I    E
Sbjct  441   IVKNNASVGSCLFPIQIVSAGE  462



>ref|XP_006299509.1| hypothetical protein CARUB_v10015679mg [Capsella rubella]
 gb|EOA32407.1| hypothetical protein CARUB_v10015679mg [Capsella rubella]
Length=498

 Score =   422 bits (1086),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 223/440 (51%), Positives = 284/440 (65%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG ++SH LPP+ VVKML+ NG  K+KLF   + +L+AL G+ IEVMIG PN  L
Sbjct  36    SVGVNWGTMASHQLPPEKVVKMLQDNGFTKLKLFEADQNILDALVGSDIEVMIGIPNRFL  95

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K++  +  VA ++V+ENVT+Y  +   GV I  + VGNEPFL+ Y    + + T PAL N
Sbjct  96    KEVAQDTSVAASWVEENVTAY--SYHGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVN  152

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL EA + K VK TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +P
Sbjct  153   IQRALEEADL-KNVKVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSP  211

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FP+DFAFFDG +KPL D    YTNVFDAN DT + A+ R    
Sbjct  212   FTVNIYPFLSL-YGNAYFPLDFAFFDGTNKPLRDGSLVYTNVFDANLDTLICAMERYSFL  270

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  AN   A RF  G +KH     GTP R G  +DVY+F L DED
Sbjct  271   GMKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVVMDVYLFSLVDED  330

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PG FE HWGI G+DG+ K+ LDLSGKG    ++  VE ++YLPK WC L  NA  
Sbjct  331   AKSIAPGTFERHWGIFGFDGRPKYELDLSGKGNDNPLVP-VEDVKYLPKTWCVLDPNASN  389

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L +L  N DYAC  +DCT +  GSSCN L+     SY FN Y+Q  DQ    CDF GLG 
Sbjct  390   LDDLPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQETWDCDFLGLGL  449

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             +T ++ S   C F + I  G
Sbjct  450   ITDEDPSDELCEFPVMIDTG  469



>ref|XP_009102513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Brassica rapa]
Length=494

 Score =   421 bits (1083),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 284/440 (65%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG ++SH LPP+ VVKMLK NG  K+KLF   + +LNAL G+ IEVMIG PN LL
Sbjct  36    SVGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRLL  95

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K++  +  +A ++V+ENVT+Y+     GV I  + VGNEPFL+ Y    + + T PAL N
Sbjct  96    KEVAQDPALAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVN  152

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL EAG+ K V+ TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +P
Sbjct  153   IQKALEEAGL-KNVRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSP  211

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FPVDFAFFDG +  L D    Y NVFDAN DT V A+ R    
Sbjct  212   FTVNIYPFLSL-YGNAYFPVDFAFFDGSNNSLRDGDLVYNNVFDANLDTLVCAMERYSFL  270

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  ANA  A RF  G +KH     GTP R G  +DVY+F L DED
Sbjct  271   GMKIIVGEVGWPTDGDKNANAKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDED  330

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-K  1262
              KS  PG FE HWGI  +DG+ K+ LDLSGK G  K +  V+ ++YLPK WC L  NA  
Sbjct  331   AKSIAPGTFERHWGIFEFDGRPKYELDLSGK-GDDKTLVPVQDVKYLPKTWCVLDTNAFN  389

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L +L  N DYAC  +DCT +  GSSCN L++    SY FN Y+Q  DQ    CDF GLG 
Sbjct  390   LDDLADNVDYACSLSDCTALGYGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGL  449

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             +T ++ S   C F + I  G
Sbjct  450   ITDEDPSDDLCEFPVMIDTG  469



>ref|XP_010513396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=498

 Score =   421 bits (1083),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 284/440 (65%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG ++SH LPP+ VVKML+ NG  K+KLF   + +L+AL G+ IEVMIG PN  L
Sbjct  36    SVGVNWGTMASHQLPPENVVKMLQDNGFTKLKLFEADQNILDALIGSDIEVMIGIPNRFL  95

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K++  +  VA ++V+ENVT+Y  +   GVKI  + VGNEPFL+ Y    + + T PAL N
Sbjct  96    KEMAQDTAVAASWVEENVTAY--SYHGGVKIKYIAVGNEPFLQTYNGTYV-EFTLPALIN  152

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL EA + KTVK TVPFNAD+Y SP   PVPS G FR ++ D   +I+  L  + +P
Sbjct  153   IQRALEEADL-KTVKVTVPFNADIYFSPEANPVPSTGDFRPELRDATIEIINFLYSHDSP  211

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FP+DFAFFDG +KPL D    YTNVFDAN DT + AL R    
Sbjct  212   FTVNIYPFLSL-YGNAYFPLDFAFFDGTNKPLRDGNLVYTNVFDANLDTLICALERYSFL  270

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  AN   A RF  G +KH     GTP R G  +DVY+F L +ED
Sbjct  271   GMKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLINED  330

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-K  1262
              KS  PG FE HWGI  +DG+ K+ LDLSGKG   K +  VE ++YLPK WC L  NA  
Sbjct  331   AKSIAPGTFERHWGIFEFDGRPKYELDLSGKGND-KPLVPVEDVKYLPKTWCVLDPNAYN  389

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L +L  N DYAC  +DCT +  GSSCN L+     SY FN Y+Q  DQ    CDF GLG 
Sbjct  390   LDDLPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLGLGL  449

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             VT ++ S   C F + I  G
Sbjct  450   VTDEDPSDELCEFPVMIDTG  469



>emb|CDY66442.1| BnaCnng50870D [Brassica napus]
Length=493

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 284/439 (65%), Gaps = 8/439 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP+ VVKMLK NG  K+KLF   + +LNAL G+ IEVMIG PN LLK
Sbjct  36    VGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRLLK  95

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             ++  +  +A ++V+ENVT+Y+     GV I  + VGNEPFL+ Y    + + T PAL N+
Sbjct  96    EVAQDPALAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNI  152

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKAL EAG+ K V+ TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +PF
Sbjct  153   QKALEEAGL-KNVRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSPF  211

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y    FPVDFAFFDG +  L D    YTNVFDAN DT V A+ R     
Sbjct  212   TVNIYPFLSL-YGNAYFPVDFAFFDGSNNSLRDGDLVYTNVFDANLDTLVCAMERYSFLG  270

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDGD  ANA  A RF  G +KH     GTP R G  +DVY+F L DED 
Sbjct  271   MKIIVGEVGWPTDGDKNANAKSAKRFNEGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDA  330

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-KL  1265
             KS  PG FE HWGI  +DG+ K+ LDLSGK G  K +  V+ ++YLPK WC L  NA   
Sbjct  331   KSIAPGTFERHWGIFEFDGRPKYELDLSGK-GDDKTLVPVQDVKYLPKTWCVLDTNAFNQ  389

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
              +L  N DYAC  +DCT +  GSSCN L++    SY FN Y+Q  DQ    CDF GLG +
Sbjct  390   DDLADNVDYACSLSDCTALGFGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGLI  449

Query  1446  TTKNLSTPSCRFNIGIKLG  1502
             T ++ S   C F + I  G
Sbjct  450   TDEDPSDDFCEFPVMIDTG  468



>ref|XP_010088872.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB37069.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=490

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 227/448 (51%), Positives = 289/448 (65%), Gaps = 9/448 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V     +GVNWG I+SH LPP  VVKM+K NG  KVKLF   + +L AL GT IEVM+G 
Sbjct  30    VCSCSSVGVNWGTIASHKLPPGKVVKMMKENGFTKVKLFEADEWILEALMGTNIEVMVGI  89

Query  354   PNALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L+++  N +VA  +V+ NVT Y  T   GV I  V VGNEPFL+ Y        T+
Sbjct  90    PNIMLQEISENPKVAADWVEANVTDYLYTG--GVHIKYVAVGNEPFLEAYNGS-YTHTTF  146

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q+ALN+ G+G  VKATVPFNADVY SP   PVPSAG FR  + D   +I++ L 
Sbjct  147   PALKNIQQALNDQGVGSKVKATVPFNADVYFSPDSNPVPSAGDFRPQVRDITIEIIQYLH  206

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAAL  887
              N APF +N+YPFLSL YS D FP+DFAFFDG + KP+ D  + Y NVFDAN+DT V A+
Sbjct  207   ANDAPFTVNIYPFLSL-YSNDYFPLDFAFFDGTNYKPVRDGDRVYNNVFDANFDTLVEAI  265

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
             ++     +K++VGE+GWPTDGD  AN   A RF  G ++H     GTP + G  I+VY+F
Sbjct  266   NKAGFPDMKIIVGEVGWPTDGDRHANVKNAKRFNQGMLQHALSGNGTPAQKGK-IEVYLF  324

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DED KS  PGNFE HWGI  YDG+ K+ LDLSG   + K +  V+G+EY+ K+WC L
Sbjct  325   SLIDEDAKSIEPGNFERHWGIYEYDGKPKYELDLSGS-KRNKGLVAVDGVEYMLKRWCVL  383

Query  1248  KANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
               +A+ L +L  + DYAC  +DCT +  GSSCN LS     SY FN Y+Q   Q   SCD
Sbjct  384   NPDAEYLDDLPDSIDYACSLSDCTALGFGSSCNNLSAQGNASYAFNMYYQVNGQNSRSCD  443

Query  1425  FQGLGEVTTKNLSTPSCRFNIGIKLGAE  1508
             F GL  V+ K+ S   C+F + I  G +
Sbjct  444   FSGLAVVSDKDPSVGDCQFPVMISRGGQ  471



>ref|XP_002440138.1| hypothetical protein SORBIDRAFT_09g026690 [Sorghum bicolor]
 gb|EES18568.1| hypothetical protein SORBIDRAFT_09g026690 [Sorghum bicolor]
Length=486

 Score =   420 bits (1080),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 216/437 (49%), Positives = 286/437 (65%), Gaps = 11/437 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG + SHP+ P AVV+ML+ANG+ +VKLF+     + ALAG+G++ M+  PN  L 
Sbjct  31    VGVNWGTMMSHPIHPSAVVEMLRANGVDRVKLFDADPWTVAALAGSGVQAMLAAPNDQLA  90

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L  +   A+ +V+ NVT+       GV +  V VGNEPFLK Y       +T+PAL NM
Sbjct  91    SLARDPRRAREWVRHNVTA---NVNAGVDVRYVAVGNEPFLKSYNGS-FINITFPALKNM  146

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+AL+EAG G+ +K  VP NAD+Y SP   PVPSAG FR DI   +  IV  L  N APF
Sbjct  147   QRALDEAGFGQRIKVVVPLNADIYSSPENKPVPSAGSFRKDINTLMVDIVNYLHANDAPF  206

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L +     
Sbjct  207   VVNIYPFLSL-YQNPNFPLNFSFFDGATKPVFDQGMVYTNVFDANFDTLVWSLRKAGVPD  265

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             ++++VGE+GWPTDGD  AN   A RFYNGF++ +A   GTP+RPG  ++VY+F L DE+Q
Sbjct  266   MRIIVGEVGWPTDGDKNANIKYAQRFYNGFLRKVAKNIGTPLRPG-RMEVYLFALIDENQ  324

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--K  1262
             KS LPG FE HWG+  YDG+ KF++DLSG  GKG  +  ++G++YLP +WC    +   K
Sbjct  325   KSVLPGRFERHWGLFTYDGKPKFSMDLSGN-GKGN-LAEIKGVQYLPSQWCVFNKDTKDK  382

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
               +L A+ +YAC  ADCTP+  G+SCNGLS    +SY FN YFQ  DQ   +C F GL  
Sbjct  383   YKDLPASVNYACSNADCTPLGYGASCNGLSHDGNISYAFNIYFQTMDQDVRACSFGGLAM  442

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T  N S   C F + I
Sbjct  443   ITATNASQGGCLFPVQI  459



>ref|XP_008338633.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
 ref|XP_008361504.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Malus domestica]
Length=480

 Score =   420 bits (1079),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 298/442 (67%), Gaps = 12/442 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + G GVNWG +SSHPLPP  VVKMLK NGIKKVKLF+     + AL+GTGI+VM+G PN 
Sbjct  21    VQGFGVNWGQMSSHPLPPNNVVKMLKDNGIKKVKLFDADPTTMKALSGTGIDVMVGIPNE  80

Query  363   LLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPA  536
              L  + + Y  A+ +VK+NVT+Y      GV I+ V VGNEPFL  Y   G F K  YP+
Sbjct  81    KLNKIAHDYATARKWVKQNVTAY--LHDGGVTISYVAVGNEPFLTGY--NGTFVKDVYPS  136

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             + N+QKAL+EAG+G  +K  VPFNADVY SP  +  PS G FR DI   + +I+E L  +
Sbjct  137   VKNVQKALDEAGVGGKIKCVVPFNADVYESP--SNKPSDGRFRKDIKKSMSQILEFLRTH  194

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              +PF++N+YPFLSL  S   FP +FAFFDG  KP+ DNG  Y+NVFDANYDT + AL + 
Sbjct  195   KSPFVVNIYPFLSLSLSSG-FPKEFAFFDGGGKPVRDNGAQYSNVFDANYDTLLWALKKA  253

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 + +V+GE+GWPTDG ++ N+ +A +FY+G +K LA + GTP+R G  ++VY+FGL+
Sbjct  254   GVPNLDIVIGEVGWPTDGHDYGNSRLAKKFYDGLLKKLASQVGTPLRKGY-LEVYLFGLF  312

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED+KS  PG+FE HWGI  YDG+ KF +DLSG+    +++ GVEG++YL K+WC L ++
Sbjct  313   DEDEKSIAPGDFERHWGIFRYDGKPKFPMDLSGQASGHQMLKGVEGVKYLQKQWCVLNSD  372

Query  1257  AK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
              + L+   A  +YAC +ADCT +    SC+ L   +++S+ FN ++Q  DQ    CDF G
Sbjct  373   VRNLSRALAEFNYACSQADCTSLGGKRSCD-LEMHDRISFAFNEFYQKGDQDYRKCDFSG  431

Query  1434  LGEVTTKNLSTPSCRFNIGIKL  1499
             +G   T++ S   C F I I L
Sbjct  432   MGTKVTRDPSKGDCLFRIQIDL  453



>ref|XP_004961391.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Setaria italica]
Length=450

 Score =   418 bits (1075),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 284/430 (66%), Gaps = 10/430 (2%)
 Frame = +3

Query  213   ISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV-NYE  389
             + SHP+ P AVV ML+ANG+ +VKLF+     + ALAG+G++ M+  PN  L+ L  +  
Sbjct  1     MMSHPIHPSAVVGMLRANGVDRVKLFDADPWTVAALAGSGVQAMLAAPNDQLESLARDPR  60

Query  390   VAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEA  569
              A+ +V+ NVT+       GV +  V VGNEPFLK Y       +T+PAL NMQ+AL+EA
Sbjct  61    RARDWVRHNVTA---NLNAGVDVRYVAVGNEPFLKSYNGS-FINITFPALKNMQRALDEA  116

Query  570   GIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPF  749
             G G+ +K  VP NAD+Y SP   PVPSAG FR DI   +  IV  L  N APF++N+YPF
Sbjct  117   GFGQRIKVVVPLNADIYSSPENKPVPSAGSFRKDINALMVDIVNFLHVNDAPFVVNIYPF  176

Query  750   LSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgE  929
             LSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L +     ++++VGE
Sbjct  177   LSL-YQNPNFPLNFSFFDGATKPVYDQGMVYTNVFDANFDTLVWSLRKAGVPDMRIIVGE  235

Query  930   IGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGN  1109
             +GWPTDGD  AN   A RFY+GF+K++A   GTP+RPG  +DVY+F L DE+QKS LPG 
Sbjct  236   VGWPTDGDKNANVKYAQRFYSGFLKNMAKNVGTPLRPG-HMDVYLFALIDENQKSVLPGR  294

Query  1110  FEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--KLTNLKAN  1283
             FE HWG+  YDG+ KF++DLSG  GK   +  V+G++YLP +WC    +A  K  +L A+
Sbjct  295   FERHWGLFTYDGKPKFSMDLSGN-GKDNYLAEVKGVQYLPSQWCVFNKDAKDKYKDLPAS  353

Query  1284  TDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLS  1463
              +YAC  ADCTP+  GSSCNGLS  E +SY FN YFQ  DQ   +C F GL ++TT N S
Sbjct  354   VNYACSNADCTPLGYGSSCNGLSHDENISYAFNIYFQTMDQDVRACSFGGLAKITTTNAS  413

Query  1464  TPSCRFNIGI  1493
                C F + I
Sbjct  414   QGGCMFPVQI  423



>ref|XP_009769717.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Nicotiana sylvestris]
Length=470

 Score =   419 bits (1077),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 291/441 (66%), Gaps = 9/441 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++  LPPK+VVKMLK NG  KVKLF   + +LNAL GT I+VM+  PN +L 
Sbjct  11    VGVNWGTMATQQLPPKSVVKMLKDNGFDKVKLFEADENILNALVGTDIQVMLAIPNFMLH  70

Query  372   DL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             D+  +  +A A+V+ENV++Y  T   GVKI  V VGNEPFL+ Y    L  +  PAL N+
Sbjct  71    DMSADPLMAAAWVQENVSAYAYTG--GVKIRYVAVGNEPFLRTYNGTYLPYIL-PALKNI  127

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+A+N+AG+G  VKAT+PFNAD+Y SP   PVPSAG FR ++ D   +IV+ L  N APF
Sbjct  128   QEAINKAGLGSEVKATIPFNADIYFSPESNPVPSAGDFRPEVRDLTIQIVQYLYSNDAPF  187

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YP+LSL Y    FP+DFAFFDG +KP+ D    YTNVFDAN+DT V +L +    +
Sbjct  188   VVNIYPYLSL-YGNIYFPLDFAFFDGSNKPVRDGDYVYTNVFDANFDTLVWSLKKAGFPE  246

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             VK+VVGE+GWPTDGD  AN   A RF  G I+H    +GTP R G  I+VY+F L DE+ 
Sbjct  247   VKIVVGEVGWPTDGDKNANIENAMRFNQGLIQHCLTGQGTPARKGR-IEVYLFSLIDENA  305

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA---  1259
             KS  PGNFE HWGI  +DG+ K+ LDLSGK  K K +  VEG+ Y+ K+WC LK +A   
Sbjct  306   KSIAPGNFERHWGIFEFDGKPKYELDLSGKMQKDKGLVAVEGVNYMHKRWCVLKPDAVDN  365

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
                +L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q ++Q    CDF GL 
Sbjct  366   AEEDLPKNIDYACSLSDCTALGYGSSCNHLSAKGNASYAFNMYYQFKNQNSWDCDFDGLA  425

Query  1440  EVTTKNLSTPSCRFNIGIKLG  1502
              VT  + S   C F + I +G
Sbjct  426   VVTNDDPSDDKCHFLVMISVG  446



>ref|XP_006418767.1| hypothetical protein EUTSA_v10002822mg [Eutrema salsugineum]
 gb|ESQ37203.1| hypothetical protein EUTSA_v10002822mg [Eutrema salsugineum]
Length=545

 Score =   421 bits (1083),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 285/436 (65%), Gaps = 8/436 (2%)
 Frame = +3

Query  201   NWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV  380
             NWG ++SH LPP+ VVKMLK NG  K+KLF   + +L+AL G+ IEVMIG PN LLK++ 
Sbjct  87    NWGTMASHQLPPQNVVKMLKDNGFTKLKLFEADQNILDALIGSEIEVMIGIPNRLLKEVA  146

Query  381   -NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKA  557
              + +VA ++V+ENVT+Y      GV I  + VGNEPFL+ Y    + + T PAL N+Q+A
Sbjct  147   QDPDVAASWVEENVTAY--YYHGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVNIQRA  203

Query  558   LNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMIN  737
             L EA + KTVK TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +PF +N
Sbjct  204   LEEADL-KTVKVTVPFNADIYFSPESNPVPSAGDFRPELRDATIEIINFLYTHDSPFTVN  262

Query  738   VYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkv  917
             +YPFLSL Y    FP+DFAFFDG +KPL D    YTNVFDAN DT V A+ R     +K+
Sbjct  263   IYPFLSL-YGNAYFPLDFAFFDGTNKPLRDGDLVYTNVFDANLDTLVCAMERYSFLGMKI  321

Query  918   vvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKST  1097
             +VGE+GWPTDGD  AN+  A RF  G +KH     GTP R G  +DVY+F L DED KS 
Sbjct  322   IVGEVGWPTDGDKNANSKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDAKSI  381

Query  1098  LPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-KLTNL  1274
              PG FE HWGI G+DG+ K+ LDLSG+ GK   +  VE ++YLPK WC L  NA  L +L
Sbjct  382   APGTFERHWGIFGFDGRPKYELDLSGQ-GKDYPLVPVEDVKYLPKTWCVLDPNAFNLDDL  440

Query  1275  KANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTK  1454
               N DYAC  +DCT +  GSSCN L++    SY FN Y+Q  DQ    CDF GLG +T +
Sbjct  441   ADNVDYACSLSDCTSLGYGSSCNHLTNIGNASYAFNMYYQMHDQNTWECDFLGLGLITDE  500

Query  1455  NLSTPSCRFNIGIKLG  1502
             + S   C F + I  G
Sbjct  501   DPSDELCEFPVMIDTG  516



>emb|CDX77431.1| BnaA07g05690D [Brassica napus]
Length=494

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 224/440 (51%), Positives = 283/440 (64%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG ++SH LPP+ VVKMLK NG  K+KLF   + +LNAL G+ IEVMIG PN LL
Sbjct  36    SVGVNWGTMASHQLPPENVVKMLKDNGFTKLKLFEADQNILNALTGSDIEVMIGIPNRLL  95

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K++  +  +A ++V+ENVT+Y+     GV I  + VGNEPFL+ Y    + + T PAL N
Sbjct  96    KEVAQDPALAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALVN  152

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL EAG+ K V+ TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +P
Sbjct  153   IQKALEEAGL-KNVRVTVPFNADIYFSPESNPVPSAGDFRPELRDVTIEIINFLYTHDSP  211

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FPVDFAFFDG +  L D    Y NVFDAN DT V A+ R    
Sbjct  212   FTVNIYPFLSL-YGNAYFPVDFAFFDGSNNSLRDGDLVYNNVFDANLDTLVCAMERYSFL  270

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  ANA  A RF  G +KH     GTP R G  +DVY+F L DED
Sbjct  271   GMKIIVGEVGWPTDGDKNANAKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLIDED  330

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-K  1262
              KS  PG FE HWGI  +DG+ K+ LDLSGK G  K +  V+ ++YLPK WC L  NA  
Sbjct  331   AKSIAPGTFERHWGIFEFDGRPKYELDLSGK-GDDKTLVPVQDVKYLPKTWCVLDTNAFN  389

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
               +L  N DYAC  +DCT +  GSSCN L++    SY FN Y+Q  DQ    CDF GLG 
Sbjct  390   QDDLADNVDYACSLSDCTALGYGSSCNHLTNVGNASYAFNMYYQMHDQKTWDCDFLGLGL  449

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             +T ++ S   C F + I  G
Sbjct  450   ITDEDPSDDLCEFPVMIDTG  469



>ref|XP_010086919.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
 gb|EXB24800.1| Glucan endo-1,3-beta-glucosidase 8 [Morus notabilis]
Length=483

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 297/442 (67%), Gaps = 10/442 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SHPL P  VV +LK NGIKKVKLF+     +++LAG+GIEVM+  PN  L
Sbjct  28    GLGVNWGTMASHPLHPTIVVNLLKDNGIKKVKLFDADDWTVSSLAGSGIEVMVAIPNDQL  87

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
               L + Y  AK +VKENVT +      GV I  VGVGNEPFL  Y    L K T+PAL N
Sbjct  88    NKLASSYNHAKDWVKENVTKH-LRDNGGVDIRYVGVGNEPFLSSYNGSFL-KPTFPALKN  145

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKALN+AG+G  +KAT+P NAD+Y S   +  PS G FR DI D + +IV  L+ N +P
Sbjct  146   VQKALNKAGVGDKIKATIPLNADIYDSS--SNTPSDGNFRDDIRDLMIQIVRFLNDNKSP  203

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             FM+N+YPFLSL Y    FP +FAFFDG  K ++D    Y NVFDAN+DT V +L +    
Sbjct  204   FMVNIYPFLSL-YQNSNFPQEFAFFDG-SKTINDKNTQYDNVFDANHDTLVWSLRKAGVP  261

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  AN  +A +FY+G +K LA  KGTP+RPG  I+ Y+F L DED
Sbjct  262   DLKILVGEVGWPTDGDKNANVGLAKKFYDGLLKKLAKNKGTPLRPGR-IETYLFSLLDED  320

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PG+FE HWGI  YDGQ KF +D +G+ G+ K++   +G++YL KKWC L ++ K 
Sbjct  321   IKSVAPGHFERHWGIFRYDGQPKFAMDFTGQ-GQDKMLVVAKGVQYLEKKWCVLGSDVKN  379

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++ + +  +YAC  +DCT +  G+SC  L++ +  SY FN YFQ  DQ+ ++CDF G+ +
Sbjct  380   MSAVGSEVNYACSMSDCTSLGPGTSCGELNEKQTASYAFNMYFQMNDQSVEACDFSGMAK  439

Query  1443  VTTKNLSTPSCRFNIGIKLGAE  1508
             + T+N S  +C F I I+  AE
Sbjct  440   IVTQNASHGNCLFPIQIESCAE  461



>ref|XP_010049931.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
Length=489

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 221/440 (50%), Positives = 284/440 (65%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG  S+H LPP+ VVKMLK NGIKK+KLF   + +L ALAG+ IEVM+  PN +L
Sbjct  29    SVGVNWGTQSNHQLPPEKVVKMLKENGIKKLKLFEYDEKILGALAGSKIEVMLAVPNYML  88

Query  369   KDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + + V+   A ++V  NVTSY  T   GV I  + VGNEPFL+ Y  + + +V  PAL N
Sbjct  89    EIMSVDPSFAASWVDTNVTSYRYTG--GVNIKYIAVGNEPFLQSYNHKYVRQVL-PALRN  145

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             + +AL+ A +   VK TVPFNADVY SPP    PS+G FR ++ D   +I+  L  N +P
Sbjct  146   IHEALHRARLSSKVKVTVPFNADVYYSPPPNEYPSSGDFRPEVRDAAIEIIHFLYINDSP  205

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FPVDFAFFDG  +P+ D  + YTNVFDAN+D  V+AL++  + 
Sbjct  206   FTVNIYPFLSL-YQNQNFPVDFAFFDGTTEPVKDGDRVYTNVFDANFDILVSALTKAGYS  264

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              ++++VGEIGWPTDGD FAN   A RF  G +KH     GTP R G  IDVY+F L DED
Sbjct  265   DMEILVGEIGWPTDGDKFANIKNAQRFNQGLLKHALSGDGTPARKGV-IDVYLFSLIDED  323

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              K+  PGNFE HWG+  YDG+ K+ LDLSG   K   +  V G+ Y+P++WC L      
Sbjct  324   TKNIDPGNFERHWGLFEYDGKPKYELDLSG-SEKDTRLVPVMGVSYMPRRWCILNPELND  382

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             LT+L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q  DQ   +CDFQGL E
Sbjct  383   LTDLGENIDYACKSSDCTALGYGSSCNNLSSQGNASYAFNRYYQMNDQRIMACDFQGLAE  442

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             VT  + ST  C+F + +  G
Sbjct  443   VTENDPSTEECQFPLMLASG  462



>ref|XP_002991155.1| hypothetical protein SELMODRAFT_132967 [Selaginella moellendorffii]
 gb|EFJ07801.1| hypothetical protein SELMODRAFT_132967 [Selaginella moellendorffii]
Length=503

 Score =   418 bits (1075),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 217/436 (50%), Positives = 288/436 (66%), Gaps = 7/436 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG ++SH LP K VV+ML+ANGI KVKLF+    V+ +L GT +E+MI  PN +L
Sbjct  13    GIGVNWGTMASHRLPNKTVVQMLRANGISKVKLFDADPGVMESLRGTDMELMIAIPNEML  72

Query  369   KDLVNY-EVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + +      A+ +V++NVT Y  T+ +GVKI  V VGNEPFLK Y       + YPAL N
Sbjct  73    ELVATLPAAARNWVRKNVTRYR-TAKNGVKIKYVAVGNEPFLKAYNGS-YDNLAYPALKN  130

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q AL  AG+G+++KAT+P N DV LS   + +PS G+FR DIA QV K+VE L ++ AP
Sbjct  131   VQDALVSAGLGESIKATIPLNGDV-LSNGDSTLPSGGIFRPDIAPQVLKVVEALGEHNAP  189

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F+INVYPFLSL      FP DFAFFDG D PL D   +YTNVFDA+YD  VAAL++  + 
Sbjct  190   FVINVYPFLSL-QQDPHFPRDFAFFDGTDFPLVDGNLSYTNVFDASYDLLVAALTKAGYS  248

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + +++GEIGWPTDGD  AN + A RF   FI+H+  + GTP+R    ++ Y+F L DED
Sbjct  249   NMTIIIGEIGWPTDGDINANVANAVRFNQAFIRHVL-QSGTPLR-RPPLEAYLFSLLDED  306

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
             QK+ LPGNFE HWGI GYDG+ K+ LDL G G     +     ++YLP++WC L  +  +
Sbjct  307   QKTILPGNFERHWGIFGYDGKAKYRLDLQGSGNVTANLVNASSVKYLPRQWCVLDPSGDI  366

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               L  N DYAC  +DCT +  GSSC+G+    K SY FN+Y+Q  DQ   SC F GL  +
Sbjct  367   ARLGNNMDYACSHSDCTSIVPGSSCDGMGSDAKASYAFNSYYQLYDQLNTSCYFDGLATI  426

Query  1446  TTKNLSTPSCRFNIGI  1493
             T  + S+ +C+F I I
Sbjct  427   TKTSPSSGTCQFKIQI  442



>ref|XP_008232612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Prunus mume]
Length=469

 Score =   416 bits (1070),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 213/441 (48%), Positives = 295/441 (67%), Gaps = 11/441 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG +SSHPLPP  VVKMLK NGIKKVKLF+     + ALAG+G++VM+G PN  L
Sbjct  11    GLGVNWGQMSSHPLPPTDVVKMLKVNGIKKVKLFDADPKTMKALAGSGLDVMVGIPNDKL  70

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
               L + YE A+ +VKENVT Y      GV I+ V VGNEPFL  Y    + K  +P++ N
Sbjct  71    DKLSHDYEFAQKWVKENVTEY--LYEGGVSISYVAVGNEPFLSSYNGSYV-KTLFPSMKN  127

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL+EAG+G+ +K  VPFNADVY SP  +  PS G FR DI   + +I+       AP
Sbjct  128   IQRALDEAGVGQKIKCVVPFNADVYESP--SNKPSDGRFRKDIMKHMLEILHFFRAKKAP  185

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL Y    FP +FAFFD    P+ DNG  Y+NVFDANYDT + AL +    
Sbjct  186   FVVNIYPFLSL-YQSTGFPQEFAFFDN-GSPIRDNGAQYSNVFDANYDTLLWALKKVGVA  243

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + +V+GE+GWPTDG+ + N  +A +FY+G +K LA K+GTP+R G  ++VY+FGL+DED
Sbjct  244   NLDIVIGEVGWPTDGNGYCNNRLAKKFYDGLLKKLASKEGTPLRKGY-LEVYLFGLFDED  302

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             QKS  PG+FE HWGI  YDG+ KF +DL+G+    +++  VEG++YL ++WC L ++ + 
Sbjct  303   QKSIAPGDFERHWGIFRYDGKPKFPMDLAGQNSGHQMLKDVEGVKYLERQWCVLNSDVRN  362

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L+  +   +YAC  ADCT +    SC+ L   +++SY FN ++Q++DQ   +CDF G+G 
Sbjct  363   LSKAQVELNYACSLADCTSLGKQRSCD-LELHDRISYAFNEFYQSRDQDVRACDFNGMGT  421

Query  1443  VTTKNLSTPSCRFNIGIKLGA  1505
               T++ S   C F + + L A
Sbjct  422   KMTQDPSIGDCIFRVQVALSA  442



>gb|KHN10411.1| Glucan endo-1,3-beta-glucosidase 8 [Glycine soja]
Length=466

 Score =   416 bits (1070),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 283/441 (64%), Gaps = 8/441 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LPP  VVKML+ N I K+KLF+  + ++ AL GT IEVM+  PN +L
Sbjct  7     GVGVNWGTMATHKLPPNKVVKMLQENRIDKLKLFDAEEWIMAALMGTDIEVMLAIPNNML  66

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +++  N +VA ++V ENVT Y    P G+ I  + VGNEPFLK Y    L + T PAL N
Sbjct  67    EEMSRNPQVADSWVYENVTGY--MYPGGLNIKYIAVGNEPFLKEYNGAYL-QSTLPALKN  123

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q ALN  G G  +K TVPFNADVY SP    VPSAG FR ++ DQ  +IV+ L  N AP
Sbjct  124   IQTALNSWGFGSQIKVTVPFNADVYYSPDSNQVPSAGDFRPEVRDQTIEIVQFLYANNAP  183

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y  D FP DFAFFDG ++PL D    YTNVFDAN DT + AL +  + 
Sbjct  184   FTVNIYPFLSL-YGNDHFPFDFAFFDGSNRPLIDGNSAYTNVFDANLDTLLWALEKSGYP  242

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              ++V+VGE+GWPTDGD  AN   A RF  G +KH     GTP R G  ID+Y+F L DE+
Sbjct  243   DIEVIVGEVGWPTDGDKNANVQNAKRFNMGLLKHALSGNGTPKRKGI-IDIYLFSLVDEN  301

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI  +DG+ K+ LDL G      ++  VEGI Y+ K+WC L +N K 
Sbjct  302   AKSIAPGNFERHWGIFEFDGKPKYELDLRGLEENNGLVP-VEGIRYMEKQWCILDSNVKD  360

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L NL  + DYAC ++DCT +  GSSCN LS     SY FN Y+Q  +Q    CDF GL  
Sbjct  361   LHNLAESIDYACSKSDCTALGYGSSCNSLSLQGNASYAFNMYYQVNNQKDWDCDFSGLAT  420

Query  1443  VTTKNLSTPSCRFNIGIKLGA  1505
             VT ++ S   C+F I I  G+
Sbjct  421   VTDEDPSEKGCQFPIMISYGS  441



>ref|NP_189076.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB02933.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAY78755.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76890.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=500

 Score =   417 bits (1073),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 223/439 (51%), Positives = 282/439 (64%), Gaps = 8/439 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG ++SH LPP+ VVKML  N   K+KLF   + +L+AL G+ IEVMIG PN  LK
Sbjct  39    VGVNWGIMASHQLPPEKVVKMLMDNSFTKLKLFEADQNILDALIGSDIEVMIGIPNRFLK  98

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             ++  +  VA ++V+ENVT+Y+     GV I  + VGNEPFL+ Y    + + T PAL N+
Sbjct  99    EMAQDTSVAASWVEENVTAYSYNG--GVNIKYIAVGNEPFLQTYNGTYV-EFTLPALINI  155

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+AL EA + K VK TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +PF
Sbjct  156   QRALEEADL-KNVKVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSPF  214

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y    FP+DFAFFDG +K L D    YTNVFDAN DT + A+ R     
Sbjct  215   TVNIYPFLSL-YGNAYFPLDFAFFDGTNKSLRDGNLVYTNVFDANLDTLICAMERYSFLG  273

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDGD  AN   A RF  G +KH     GTP R G  +DVY+F L DED 
Sbjct  274   MKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDA  333

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-KL  1265
             KS  PG FE HWGI  +DG+ K+ LDLSGKG   K +  VE ++YLPK WC L  NA  L
Sbjct  334   KSIAPGTFERHWGIFEFDGRPKYELDLSGKGND-KPLVPVEDVKYLPKTWCILDPNAYNL  392

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
              +L  N DYAC  +DCT +  GSSCN L+ T  VSY FN Y+Q  DQ    CDF GLG +
Sbjct  393   DDLPDNIDYACSLSDCTALGYGSSCNHLTATGNVSYAFNMYYQMHDQKTWDCDFLGLGLI  452

Query  1446  TTKNLSTPSCRFNIGIKLG  1502
             T ++ S   C F + I  G
Sbjct  453   TDEDPSDELCEFPVMIDTG  471



>ref|XP_003550844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Glycine max]
Length=487

 Score =   417 bits (1072),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 223/441 (51%), Positives = 283/441 (64%), Gaps = 8/441 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LPP  VVKML+ N I K+KLF+  + ++ AL GT IEVM+  PN +L
Sbjct  28    GVGVNWGTMATHKLPPNKVVKMLQENRIDKLKLFDAEEWIMAALMGTDIEVMLAIPNNML  87

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +++  N +VA ++V ENVT Y    P G+ I  + VGNEPFLK Y    L + T PAL N
Sbjct  88    EEMSRNPQVADSWVYENVTGY--MYPGGLNIKYIAVGNEPFLKEYNGAYL-QSTLPALKN  144

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q ALN  G G  +K TVPFNADVY SP    VPSAG FR ++ DQ  +IV+ L  N AP
Sbjct  145   IQTALNSWGFGSQIKVTVPFNADVYYSPDSNQVPSAGDFRPEVRDQTIEIVQFLYANNAP  204

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y  D FP DFAFFDG ++PL D    YTNVFDAN DT + AL +  + 
Sbjct  205   FTVNIYPFLSL-YGNDHFPFDFAFFDGSNRPLIDGNSAYTNVFDANLDTLLWALEKSGYP  263

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              ++V+VGE+GWPTDGD  AN   A RF  G +KH     GTP R G  ID+Y+F L DE+
Sbjct  264   DIEVIVGEVGWPTDGDKNANVQNAKRFNMGLLKHALSGNGTPKRKGI-IDIYLFSLVDEN  322

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI  +DG+ K+ LDL G      ++  VEGI Y+ K+WC L +N K 
Sbjct  323   AKSIAPGNFERHWGIFEFDGKPKYELDLRGLEENNGLVP-VEGIRYMEKQWCILDSNVKD  381

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L NL  + DYAC ++DCT +  GSSCN LS     SY FN Y+Q  +Q    CDF GL  
Sbjct  382   LHNLAESIDYACSKSDCTALGYGSSCNSLSLQGNASYAFNMYYQVNNQKDWDCDFSGLAT  441

Query  1443  VTTKNLSTPSCRFNIGIKLGA  1505
             VT ++ S   C+F I I  G+
Sbjct  442   VTDEDPSEKGCQFPIMISYGS  462



>ref|XP_010669543.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Beta vulgaris 
subsp. vulgaris]
Length=510

 Score =   417 bits (1073),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 289/442 (65%), Gaps = 14/442 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             + +G NWG  ++HPL  + VV+MLK NGI KVKLF      L AL  +G+EVMIG PN L
Sbjct  38    NSIGANWGTQATHPLDGEIVVQMLKDNGISKVKLFEPDVNALKALGKSGVEVMIGIPNDL  97

Query  366   LKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPAL  539
             L  L N    A+ +V +N++SY   S  GV +  V VGNEPFLK     G +  +T PAL
Sbjct  98    LAALSNDVSAAEKWVSKNLSSY--VSSHGVNVRYVAVGNEPFLK--TLNGTYDAMTLPAL  153

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q AL +AG+   VK T+P NADVY +   + VPS G FR DI D + KIV+ L+ N 
Sbjct  154   QNIQSALIKAGLANQVKVTIPLNADVYQTS--SNVPSGGDFRSDINDLMLKIVKFLNDNA  211

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
              P  IN+YPF+SL Y+   FP D+AFFDG   PLDDNGKTYTNVFDANYDT V +L +  
Sbjct  212   CPITINIYPFISL-YNDPNFPADYAFFDGFSSPLDDNGKTYTNVFDANYDTLVWSLQKNG  270

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
                + ++VGEIGWPTDGDN AN + A RF  G + HL+  KGTP+RP   IDVY+F L D
Sbjct  271   FPNMSIIVGEIGWPTDGDNNANPTTARRFNQGLVNHLSAGKGTPMRPSGPIDVYLFSLID  330

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS LPGNFE HWGI  YDG  K+ L+L G    G +M   +G++YL KKWC + ++A
Sbjct  331   EDDKSILPGNFERHWGIFNYDGTPKYQLNL-GLAKIGSVMPA-KGVQYLEKKWCVMSSSA  388

Query  1260  KLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF-Q  1430
              LT+  + ++  YAC RADCT + DG+SC+ L     +SY FN+Y+Q Q+Q   +C F  
Sbjct  389   NLTDPQIASSVSYACERADCTSLGDGTSCSNLDIQGNISYAFNSYYQEQNQQDKACQFPN  448

Query  1431  GLGEVTTKNLSTPSCRFNIGIK  1496
             GL  +TTK+ S+ +CRF + IK
Sbjct  449   GLSTITTKDPSSGTCRFIVQIK  470



>gb|KCW82758.1| hypothetical protein EUGRSUZ_C04137 [Eucalyptus grandis]
Length=558

 Score =   419 bits (1077),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 221/440 (50%), Positives = 284/440 (65%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG  S+H LPP+ VVKMLK NGIKK+KLF   + +L ALAG+ IEVM+  PN +L
Sbjct  98    SVGVNWGTQSNHQLPPEKVVKMLKENGIKKLKLFEYDEKILGALAGSKIEVMLAVPNYML  157

Query  369   KDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + + V+   A ++V  NVTSY  T   GV I  + VGNEPFL+ Y  + + +V  PAL N
Sbjct  158   EIMSVDPSFAASWVDTNVTSYRYTG--GVNIKYIAVGNEPFLQSYNHKYVRQVL-PALRN  214

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             + +AL+ A +   VK TVPFNADVY SPP    PS+G FR ++ D   +I+  L  N +P
Sbjct  215   IHEALHRARLSSKVKVTVPFNADVYYSPPPNEYPSSGDFRPEVRDAAIEIIHFLYINDSP  274

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FPVDFAFFDG  +P+ D  + YTNVFDAN+D  V+AL++  + 
Sbjct  275   FTVNIYPFLSL-YQNQNFPVDFAFFDGTTEPVKDGDRVYTNVFDANFDILVSALTKAGYS  333

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              ++++VGEIGWPTDGD FAN   A RF  G +KH     GTP R G  IDVY+F L DED
Sbjct  334   DMEILVGEIGWPTDGDKFANIKNAQRFNQGLLKHALSGDGTPARKGV-IDVYLFSLIDED  392

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              K+  PGNFE HWG+  YDG+ K+ LDLSG   K   +  V G+ Y+P++WC L      
Sbjct  393   TKNIDPGNFERHWGLFEYDGKPKYELDLSG-SEKDTRLVPVMGVSYMPRRWCILNPELND  451

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             LT+L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q  DQ   +CDFQGL E
Sbjct  452   LTDLGENIDYACKSSDCTALGYGSSCNNLSSQGNASYAFNRYYQMNDQRIMACDFQGLAE  511

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             VT  + ST  C+F + +  G
Sbjct  512   VTENDPSTEECQFPLMLASG  531



>gb|EPS65796.1| hypothetical protein M569_08979 [Genlisea aurea]
Length=480

 Score =   416 bits (1069),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 290/440 (66%), Gaps = 14/440 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +G+NWG +S+HPLPP  VV MLK NG K+VKLF   K ++ AL+GTGIEVM+  PNA+L+
Sbjct  23    VGINWGTMSTHPLPPINVVNMLKQNGFKRVKLFEADKSIMEALSGTGIEVMLAIPNAMLR  82

Query  372   DL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              + ++   A A+V+ NVT Y      G+ I  V VGNEPFLK Y    L + T PAL N+
Sbjct  83    RMSLDSGAAAAWVEANVTGYG----GGLDIRYVAVGNEPFLKTYNGSYL-QYTLPALRNI  137

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+ALN AG+G  +KATVPFNAD+Y SP   PVPSAG FR +I D   +IV+ L  N APF
Sbjct  138   QEALNRAGLGSRIKATVPFNADIYNSPESNPVPSAGDFRPEIRDLTLQIVQFLHSNAAPF  197

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y    FPVDFAFFDG +  L D  + YTNVFDAN+DT V +L+R     
Sbjct  198   VVNIYPFLSL-YQNPFFPVDFAFFDGGNSSLRDGDRVYTNVFDANFDTLVWSLARYGFPD  256

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDGD  AN   A RF  G ++H A   GTP R  +++++++F L DE+ 
Sbjct  257   MKIIVGEVGWPTDGDLHANVDYARRFNQGLLRHAATAGGTPARK-SELEIFLFSLIDENS  315

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLT  1268
             KS  PG+FE HWGI  YDG+ K+ LDL    G  + +  VEG++Y+ ++WC L  +   +
Sbjct  316   KSIEPGSFERHWGIFEYDGRPKYELDL----GANRGLAAVEGVQYMVRRWCILNPSTPDS  371

Query  1269  NLK--ANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             +++  AN DYAC ++DCT M  GSSCN L+     SY FN Y+Q + Q    CDF GL  
Sbjct  372   DVEIPANVDYACKQSDCTAMGYGSSCNHLNFQGNASYAFNMYYQMKSQKGWDCDFSGLAT  431

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             +T ++ S  SCRF + I  G
Sbjct  432   ITYEDPSDGSCRFPVMIADG  451



>ref|XP_007208233.1| hypothetical protein PRUPE_ppa017706mg [Prunus persica]
 gb|EMJ09432.1| hypothetical protein PRUPE_ppa017706mg [Prunus persica]
Length=462

 Score =   415 bits (1066),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 296/440 (67%), Gaps = 11/440 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG +SSHPLPP  VVKMLK NGI KVKLF+     + ALAG+G++VM+G PN  L 
Sbjct  5     LGVNWGQMSSHPLPPTNVVKMLKVNGIMKVKLFDADPKTMKALAGSGLDVMVGIPNEKLD  64

Query  372   DLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              L + YE+A+ +VKENVT Y      GV I+ V VGNEPFL  Y    + K  +P++ N+
Sbjct  65    KLSHDYELAQKWVKENVTEY--LYKGGVSISSVAVGNEPFLSSYNGSYV-KTLFPSVKNI  121

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+AL+EAG+G  +K  VPFNADVY SP  +  PS G FR +I  ++ +I+  L    APF
Sbjct  122   QRALDEAGVGGKIKCVVPFNADVYESP--SNKPSDGRFRKNIMKEMMEILHFLRAKKAPF  179

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y    FP +FAFFD    P+ D G  Y+NVFDANYDT + AL +     
Sbjct  180   VVNIYPFLSL-YQSSGFPQEFAFFDN-GSPIRDKGAQYSNVFDANYDTLLWALKKVGFAN  237

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + +V+GE+GWPTDG+ + N  +A +FY+G +K LA K+GTP+R G  ++VY+FGL+DEDQ
Sbjct  238   LDIVIGEVGWPTDGNGYCNNRLAKKFYDGLLKKLASKEGTPLRKGY-LEVYLFGLFDEDQ  296

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PG+FE HWGI  YDG+ KF +DL+G+    +++ GVEG++YL ++WC L ++ + L
Sbjct  297   KSIAPGDFERHWGIFRYDGKPKFPMDLAGQKSGHQMLKGVEGVKYLERQWCVLNSDVRNL  356

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
             +N +   +YAC  ADCT +    SC+ L   +++SY FN ++Q +DQ   +CDF G+G  
Sbjct  357   SNAQVELNYACSMADCTSLGKQRSCD-LELHDRISYAFNEFYQNRDQDVRACDFSGMGTK  415

Query  1446  TTKNLSTPSCRFNIGIKLGA  1505
              T++ ST  C F + + L A
Sbjct  416   VTQDPSTGDCIFPVQVALSA  435



>ref|XP_002275701.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera]
Length=481

 Score =   415 bits (1067),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 226/443 (51%), Positives = 295/443 (67%), Gaps = 10/443 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LGVNWG  +SH L P  VV++LK NGI KVKLF+     +NALAG+GIEVM+G PN  
Sbjct  25    DALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVNALAGSGIEVMVGIPNKD  84

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L+   +Y+ AK +V++NVT +      GV I  V VGNEPFL  Y    L   T+PAL+N
Sbjct  85    LQRYNSYKKAKHWVEKNVTKH--LYDGGVDIRYVAVGNEPFLTSYNGSFL-NTTFPALSN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+EAG G  +KAT+P NADVY S    P  S G FR DI D + KIV++L +  + 
Sbjct  142   IQKALDEAGHGDKIKATIPLNADVYESATNKP--SDGQFRKDIKDLMIKIVKLLHEKKSA  199

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ + D FP+DFAFF+G   P +D G  YTNVFDAN+DT V AL +    
Sbjct  200   FVVNIYPFLSLYQNPD-FPLDFAFFNGGGNPTEDKGVQYTNVFDANHDTLVWALRKAGVP  258

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGEIGWPTDGD  AN  +A RFY+G +K LA  KGTP+RPG  +DVY+FGL DE+
Sbjct  259   DLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGR-LDVYLFGLIDEN  317

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--  1259
              KS  PG+FE HWGI  +DG+ KF +D SGK G  K +   +G+ YL  KWC L  +A  
Sbjct  318   MKSVAPGSFERHWGIFFFDGKPKFPMDFSGK-GLDKFLEPAKGVIYLEPKWCVLNRDAVK  376

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              +T ++   +YAC  +DCT +  GSSCN L     VSY FN YFQ Q+Q  ++C+F G+G
Sbjct  377   NMTQVEPFVNYACSNSDCTSLGYGSSCNNLDQNGNVSYAFNMYFQMQNQDVEACNFNGMG  436

Query  1440  EVTTKNLSTPSCRFNIGIKLGAE  1508
             ++TTKN ST +C F + +    E
Sbjct  437   KITTKNASTGTCLFPVQMMSAGE  459



>emb|CDP03371.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   415 bits (1066),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 292/445 (66%), Gaps = 8/445 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V+ +  LGVNWG ++SH LPP+ VV+M+  NG  KVKLF   + +L AL GT +EVM+G 
Sbjct  2     VSRVSSLGVNWGTMASHQLPPENVVQMMLDNGFDKVKLFEADEKILGALIGTDLEVMLGI  61

Query  354   PNALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L+++  + E A ++V  NVT+Y      GV I  V VGNEPFLK Y        T 
Sbjct  62    PNNMLREISQDPEAAASWVDANVTAY--CFKGGVNIRYVAVGNEPFLKSY-NNSFLPYTL  118

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
              AL N+Q+A+N AG+G  VKAT+PFNADVY SP   PVPSAG FR +I D   +I++ L 
Sbjct  119   SALKNIQEAINHAGLGTVVKATIPFNADVYNSPESNPVPSAGDFRPEIRDLTVQIIQYLH  178

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
              N APF++N+YPFLSL Y    FP+D+AFFDG +KP+ D    YTNVFDAN+DT V++LS
Sbjct  179   SNDAPFVVNIYPFLSL-YGNIYFPLDYAFFDGSNKPIKDGDYLYTNVFDANFDTLVSSLS  237

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
             R  + ++K+++GE+GWPTDGD  AN   A RF  G I+H++G  GTP R G+ IDVY+F 
Sbjct  238   RAGYPEMKIIIGEVGWPTDGDKNANIQNAKRFNQGLIQHVSGGVGTPARNGS-IDVYLFS  296

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DE+ KS  PG+FE HWG+  +DG+ K+ LDLSG   + K +  VEG+ Y+ ++WC L 
Sbjct  297   LIDENAKSIEPGSFERHWGLFEFDGKPKYELDLSGS-REEKGLVAVEGVRYMLRRWCILD  355

Query  1251  ANAK-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
               AK L  L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q ++Q    CDF
Sbjct  356   PRAKELEELPKNIDYACSLSDCTSLGYGSSCNHLSAKGNASYAFNMYYQFKNQNGWDCDF  415

Query  1428  QGLGEVTTKNLSTPSCRFNIGIKLG  1502
              GL  VT ++ S   C+F + I  G
Sbjct  416   SGLAVVTDEDPSDDECQFPVMIADG  440



>ref|XP_002970933.1| hypothetical protein SELMODRAFT_267465 [Selaginella moellendorffii]
 gb|EFJ28259.1| hypothetical protein SELMODRAFT_267465 [Selaginella moellendorffii]
Length=476

 Score =   414 bits (1065),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 216/437 (49%), Positives = 287/437 (66%), Gaps = 9/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG ++SH LP K VV+ML+ANGI KVKLF+    V+ +  GT +E+MI  PN +L
Sbjct  13    GIGVNWGTMASHRLPNKTVVQMLRANGISKVKLFDADPGVMESFRGTDMELMIAIPNEML  72

Query  369   KDLVNY-EVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             + +      A+ +V+ NVT Y  T+ +GVKI  V VGNEPFLK Y   G +  + YPAL 
Sbjct  73    ELVATLPAAARNWVRRNVTRYR-TAKNGVKIKYVAVGNEPFLKAY--NGSYDNLAYPALK  129

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q AL  AG+G+++KAT+P N DV LS   + +PS G+FR DIA QV K+VE L ++ A
Sbjct  130   NVQDALVSAGLGESIKATIPLNGDV-LSNGDSTLPSGGIFRPDIAPQVLKVVEALAEHNA  188

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF+INVYPFLSL      FP DFAFFDG D PL D   +YTNVFDA+YD  VAAL++  +
Sbjct  189   PFVINVYPFLSL-QQDPHFPRDFAFFDGTDFPLVDGNLSYTNVFDASYDLLVAALTKAGY  247

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
               + +++GEIGWPTDGD  AN + A RF   FI+H+  + GTP+R    ++ Y+F L DE
Sbjct  248   SNMTIIIGEIGWPTDGDINANVANAVRFNQAFIRHVL-QSGTPLR-RPPLEAYLFSLLDE  305

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             DQK+  PGNFE HWGI GYDG+ K+ LDL G G     +     ++YLP++WC L  +  
Sbjct  306   DQKTISPGNFERHWGIFGYDGKAKYRLDLQGSGNATANLVNASSVKYLPRQWCVLDPSGD  365

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             +  L  N DYAC  +DCT +  GSSC+G+    K SY FN+Y+Q  DQ   SC F GL  
Sbjct  366   IARLGNNMDYACSHSDCTSIVPGSSCDGMGSDAKASYAFNSYYQLYDQLNTSCYFDGLAT  425

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T  + S+ +C+F I I
Sbjct  426   ITKTSPSSGTCQFKIQI  442



>ref|XP_008787369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Phoenix dactylifera]
Length=466

 Score =   414 bits (1064),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 217/443 (49%), Positives = 292/443 (66%), Gaps = 10/443 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             +G+GVNWG +++H LP   VVKML  NG  KVKLF+     L ALAGT IEVM+  PN +
Sbjct  6     NGVGVNWGKMATHQLPSDMVVKMLLDNGFDKVKLFDADADSLTALAGTDIEVMVAIPNYM  65

Query  366   LKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPAL  539
             L+ L  N + A  +V ENVTS+N T   GV I  V VGNEPFL+ Y  +G++ ++T PAL
Sbjct  66    LEGLSSNPQAAVDWVDENVTSWNYTG--GVNIRYVAVGNEPFLQTY--KGIYDELTLPAL  121

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+QKAL++AG+G  +KATVPFNAD+Y SP  AP+PSAG FR DI D   +I++ L +N 
Sbjct  122   VNIQKALDDAGVGGRIKATVPFNADIYDSPGSAPIPSAGDFRSDIRDLAIQIIQFLSEND  181

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF++N+YPFLS+      FP+DFAFF+G ++ + D    YTNVFDAN+DT V +L +  
Sbjct  182   APFVVNIYPFLSVV-GDQHFPMDFAFFEGTNRSIKDGDAVYTNVFDANFDTLVWSLKKAG  240

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             +  + ++VGE+GWPTDGD  AN  MA  F  G ++HL   KGTP R G+ IDVY+F L D
Sbjct  241   YPDMPIIVGEVGWPTDGDRNANIEMAEDFNQGLLRHLMSSKGTPARKGS-IDVYLFSLID  299

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  YDG+ K+ L+LSG      +++   G++YL ++WC +  +A
Sbjct  300   EDAKSIAPGNFERHWGIFEYDGKPKYGLNLSGHEEDMNLVSA-HGVKYLERRWCIIDPDA  358

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               L +L  + D+AC  +DCT +S GSSCN L      SY FN Y+Q ++Q    CDF  L
Sbjct  359   TDLASLPRSMDFACTFSDCTSLSYGSSCNHLDLCGNASYAFNMYYQVRNQKAGDCDFSDL  418

Query  1437  GEVTTKNLSTPSCRFNIGIKLGA  1505
               +T ++ S   CRF + I  G+
Sbjct  419   AMITDRDPSDEKCRFPVMIAYGS  441



>emb|CAN62816.1| hypothetical protein VITISV_031885 [Vitis vinifera]
Length=481

 Score =   415 bits (1066),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 226/443 (51%), Positives = 294/443 (66%), Gaps = 10/443 (2%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LGVNWG  +SH L P  VV++LK NGI KVKLF+     +NALAG+GIEVM+G PN  
Sbjct  25    DALGVNWGTQASHILQPSIVVRLLKDNGINKVKLFDADSWTVNALAGSGIEVMVGIPNKD  84

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             L+   +Y+ AK +V++NVT +      GV I  V VGNEPFL  Y    L   T+PAL+N
Sbjct  85    LQRYNSYKKAKHWVEKNVTKH--LYDGGVDIRYVAVGNEPFLTSYNGSFL-NTTFPALSN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+EAG G  +KAT+P NADVY S    P  S G FR DI D + KIV++L +  + 
Sbjct  142   IQKALDEAGHGDKIKATIPLNADVYESATNKP--SDGQFRKDIKDLMIKIVKLLHEKKSA  199

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ + D FP+DFAFF+G   P +D G  YTNVFDAN+DT V AL +    
Sbjct  200   FVVNIYPFLSLYQNPD-FPLDFAFFNGGGNPTEDKGVQYTNVFDANHDTLVWALRKAGVP  258

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGEIGWPTDGD  AN  +A RFY+G +K LA  KGTP+RPG  +DVY+FGL DE+
Sbjct  259   DLKILVGEIGWPTDGDKNANLKLARRFYDGLLKKLADGKGTPLRPGR-LDVYLFGLIDEN  317

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--  1259
              KS  PG+FE HWGI  +DG+ KF +D SGK G  K +   +G+ YL  KWC L  +A  
Sbjct  318   MKSVAPGSFERHWGIFFFDGKPKFPMDFSGK-GLDKFLEPAKGVIYLEPKWCVLNRDAVK  376

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              +T +    +YAC  +DCT +  GSSCN L     VSY FN YFQ Q+Q  ++C+F G+G
Sbjct  377   NMTQVXPFVNYACSNSDCTSLGYGSSCNNLDQNGNVSYAFNMYFQMQNQDVEACNFNGMG  436

Query  1440  EVTTKNLSTPSCRFNIGIKLGAE  1508
             ++TTKN ST +C F + +    E
Sbjct  437   KITTKNASTGTCLFPVQMMSAGE  459



>ref|XP_003565994.2| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Brachypodium 
distachyon]
Length=477

 Score =   414 bits (1065),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 222/447 (50%), Positives = 293/447 (66%), Gaps = 12/447 (3%)
 Frame = +3

Query  177   AGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTP  356
             A   G+GVNWG + SHP+ P AVV+ML ANG+ +VK+F+     ++ALAG+G++ M+  P
Sbjct  18    AAASGVGVNWGTMMSHPMHPAAVVRMLAANGVDRVKMFDADPWTVSALAGSGVQAMLAVP  77

Query  357   N-ALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYP  533
             N  L     +   A+ +V++NVT       DGV I  V VGNEPFLK Y       +T+P
Sbjct  78    NDHLASVARDRRRARDWVRDNVTR---NLHDGVDIRYVAVGNEPFLKSYNGS-FINITFP  133

Query  534   ALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDK  713
             AL N+Q+AL+EAG+   VKA VP NADVY SP   PVPSAG FR DI   +  IV  L +
Sbjct  134   ALKNIQRALDEAGL--LVKAVVPLNADVYNSPENNPVPSAGNFRRDINALMVDIVNFLHR  191

Query  714   NGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSR  893
             N APF++N+YP+LSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L +
Sbjct  192   NDAPFVVNIYPYLSL-YQNANFPLNFSFFDGGSKPVYDKGMVYTNVFDANFDTLVWSLRK  250

Query  894   EKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGL  1073
                  +K++VGEIGWPTDGD  AN   A +FY+GF+K ++   GTP+RPG  ++ Y+F L
Sbjct  251   AGVPDMKIIVGEIGWPTDGDKNANVKYAQKFYDGFLKKISKNVGTPLRPGR-MEAYLFAL  309

Query  1074  YDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA  1253
              DE+QKS LPG FE HWG+  YDG+ KF++DLSG  G+ K + GVEG++YLP +WC    
Sbjct  310   IDENQKSVLPGRFERHWGLFTYDGKPKFSMDLSGN-GQNKFLFGVEGVQYLPSQWCVFNK  368

Query  1254  NA--KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
             +A  K  +L A+ +YAC  ADCTP+  GSSCNGLS    +SY FN YFQ  DQ   +C F
Sbjct  369   DAKDKYRDLPASVNYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSF  428

Query  1428  QGLGEVTTKNLSTPSCRFNIGIKLGAE  1508
              GL ++ T N S   C F + I   +E
Sbjct  429   GGLAKIVTTNASQGGCVFPVQILSASE  455



>gb|KFK39737.1| hypothetical protein AALP_AA3G281400 [Arabis alpina]
Length=455

 Score =   414 bits (1063),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 281/432 (65%), Gaps = 8/432 (2%)
 Frame = +3

Query  213   ISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV-NYE  389
             ++SH LPP+ VVKMLK NG  K+KLF   + +L+AL G+ IEVMIG PN LLK++  +  
Sbjct  1     MASHQLPPENVVKMLKDNGFTKLKLFEADQNILDALIGSQIEVMIGIPNRLLKEVAQDPS  60

Query  390   VAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEA  569
             VA ++V+ENVT+Y  +   GV I  + VGNEPFL+ Y    + + T PAL N+Q+AL EA
Sbjct  61    VAGSWVEENVTAY--SYQGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALINIQRALEEA  117

Query  570   GIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPF  749
              + KTVK TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +PF +N+YPF
Sbjct  118   NL-KTVKVTVPFNADIYFSPESNPVPSAGDFRPELRDATIEIINFLYSHDSPFTVNIYPF  176

Query  750   LSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgE  929
             LSL Y    FP+DFAFFDG +KPL D    YTNVFDAN DT + A+ R    ++K++VGE
Sbjct  177   LSL-YGNAYFPLDFAFFDGTNKPLRDGDLVYTNVFDANLDTLICAMERYSFLEMKIIVGE  235

Query  930   IGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGN  1109
             +GWPTDGD  AN   A RF  G +KH     GTP R G  +DVY+F L DED KS  PG 
Sbjct  236   VGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLVDEDTKSIAPGT  295

Query  1110  FEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-KLTNLKANT  1286
             FE HWGI  +DG+ K+ LDLSGKG  G ++  VE ++YLPK WC L  NA  L +L  N 
Sbjct  296   FERHWGIFEFDGRPKYELDLSGKGNGGALVP-VEDVKYLPKTWCVLDPNAYNLDDLADNI  354

Query  1287  DYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLST  1466
             DYAC  +DCT +  GSSCN L+     SY FN Y+Q  DQ    CDF GLG +T +N S 
Sbjct  355   DYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLGLGLITDENPSD  414

Query  1467  PSCRFNIGIKLG  1502
               C F + I  G
Sbjct  415   DLCEFPVMIDTG  426



>ref|XP_007204529.1| hypothetical protein PRUPE_ppa017632mg [Prunus persica]
 gb|EMJ05728.1| hypothetical protein PRUPE_ppa017632mg [Prunus persica]
Length=486

 Score =   414 bits (1065),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 281/439 (64%), Gaps = 8/439 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VVKMLK NG  K+KLF   + +L AL GT IEVM+  PN +L+
Sbjct  26    FGVNWGTMATHQLPPEKVVKMLKDNGFNKLKLFEAEEKILAALMGTQIEVMLAVPNVMLQ  85

Query  372   DLVNYEVAKA-FVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             ++    VA A +V  NVTSY   S  GV I  V VGNEPFLK Y    L K T PAL N+
Sbjct  86    EMSQDPVAAATWVDANVTSY--CSNGGVNIKYVSVGNEPFLKTYNGTYL-KTTLPALKNI  142

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+ALN AG+G  VKATVPFNAD+Y SP   PVPS G FR +I D + +I++ L  N APF
Sbjct  143   QEALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSLIEIIQYLHTNDAPF  202

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y    FP  FAFFDG  KP+ D    YTNVFDAN+DT V +L++    +
Sbjct  203   TVNIYPFLSL-YGNTYFPFGFAFFDGTTKPMKDGDLLYTNVFDANFDTLVWSLTKAGFPE  261

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDGD  AN   A RF  G I+H     GTP R G  IDVY+F L DED 
Sbjct  262   MKIMVGEVGWPTDGDINANIRNARRFNQGMIQHSLSGNGTPARKGK-IDVYLFSLIDEDA  320

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PGNFE HWG+  YDG+ K+NLDL+G   + K +  VE ++Y+ K+WC L  +AK L
Sbjct  321   KSIAPGNFERHWGLFEYDGKPKYNLDLTGS-LENKGLAAVEDVDYMLKRWCVLDKDAKDL  379

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               L  + DYAC  +DCT +  G SCN LS     SY FN Y+Q   Q   +CDF GL  V
Sbjct  380   EVLVKSIDYACTLSDCTALGYGCSCNNLSLRGNASYAFNMYYQVNSQKSWTCDFSGLAVV  439

Query  1446  TTKNLSTPSCRFNIGIKLG  1502
             T +N S   C+F + I  G
Sbjct  440   TDENPSVGDCQFPVMISYG  458



>ref|XP_002438620.1| hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
 gb|EER89987.1| hypothetical protein SORBIDRAFT_10g022940 [Sorghum bicolor]
Length=492

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 290/437 (66%), Gaps = 14/437 (3%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNT-PKPVLNALAGTGIEVMIGTPNALL  368
             +GVNWG   SHPL P +VVKMLK NGI +VKLF+  P PV  AL  +GIEVM+G PN +L
Sbjct  41    VGVNWGSQLSHPLLPDSVVKMLKKNGIARVKLFDADPWPV-GALVDSGIEVMLGIPNDML  99

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + + + Y  A+ +V ENVTSY     D +K+  V VGNEPFLK Y      K T+PAL N
Sbjct  100   ETMSSSYGNAQDWVNENVTSYG----DKLKLKYVAVGNEPFLKAYNGS-FMKTTFPALKN  154

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+EAG+G  VKA VP NADVY+SP   P  S+G FR DI D +  +V+ L  +GAP
Sbjct  155   IQKALDEAGVGDKVKAVVPLNADVYVSPDDKP--SSGAFRPDIDDLMTDMVKFLHDHGAP  212

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL+ S + FP +FAFFDG     D  G  Y NVFDANYDT V AL +    
Sbjct  213   FVVNIYPFLSLYQSSN-FPFEFAFFDGGKNINDKGGVNYDNVFDANYDTLVHALKKAGVP  271

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +KV+VGE GWPTDG+  AN  +A RFY+G +K LA  +GTPVR G  ++VY+FGL+DED
Sbjct  272   NLKVIVGEAGWPTDGNKNANLKLARRFYDGLLKKLAKNEGTPVRKGK-MEVYLFGLFDED  330

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PGNFE HWGI  YDG+ KF +DL+G+ G  K+++ V  ++YLP +WC     AK 
Sbjct  331   MKSIAPGNFERHWGIFTYDGKPKFPIDLTGQ-GHDKLLSPVTDVKYLPSQWCVFDDGAKD  389

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
              + L  N  YAC   DCT +  G SCNGL +   +SY FN YFQ QDQ   +C+F GL +
Sbjct  390   KSKLPGNLQYACASGDCTALGYGCSCNGLDEKSNISYAFNMYFQMQDQDVRACEFDGLAK  449

Query  1443  VTTKNLSTPSCRFNIGI  1493
             +T KN ST  C F + I
Sbjct  450   ITDKNASTRGCLFPVQI  466



>ref|XP_009626950.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Nicotiana 
tomentosiformis]
Length=513

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 290/442 (66%), Gaps = 11/442 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++  LPPK+VVKMLK NG  KVKLF     +LNAL GT I+VM+  PN +L 
Sbjct  11    VGVNWGTMATQQLPPKSVVKMLKDNGFDKVKLFEADDSILNALVGTDIQVMLAIPNYMLH  70

Query  372   DL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             D+  +  +A A+V+ENV++Y  T    VKI  V VGNEPFL+ Y    L  +  PAL N+
Sbjct  71    DMSADPLMATAWVQENVSAYVYTGV--VKIRYVAVGNEPFLRTYNGTYLPYIL-PALKNI  127

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+A+N+AG+G  VKAT+PFNAD+Y SP   PVPSAG FR ++ D   +IV+ L  N APF
Sbjct  128   QEAINKAGLGSEVKATIPFNADIYFSPESTPVPSAGDFRPEVRDLTIQIVQYLYSNDAPF  187

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YP+LSL Y    FP+DFAFFDG +KP+ D    YTNVFDAN+DT V +L +    +
Sbjct  188   VVNIYPYLSL-YGNIYFPLDFAFFDGSNKPVRDGEYVYTNVFDANFDTLVWSLKKAGFPE  246

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             VK+VVGE+GWPTDGD  AN   A RF  G I+H    +GTP R G  I+VY+F L DE+ 
Sbjct  247   VKIVVGEVGWPTDGDKNANIENAMRFNQGLIQHCLSGQGTPARKGK-IEVYLFSLIDENA  305

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKA----N  1256
             KS  PGNFE HWGI  +DG+ K+ LDLSGK  K K +  VEG+ Y+ K+WC LK     N
Sbjct  306   KSIAPGNFERHWGIFEFDGKPKYELDLSGKMQKDKGLVAVEGVNYMHKRWCVLKPEGVDN  365

Query  1257  AKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
             A+  +L  N DYAC  +DCT +  GSSCN LS     SY FN Y+Q ++Q    CDF GL
Sbjct  366   AE-EDLPKNIDYACSLSDCTALGYGSSCNHLSAKGNASYAFNMYYQFKNQNSWDCDFDGL  424

Query  1437  GEVTTKNLSTPSCRFNIGIKLG  1502
               VT  + S   C F + I +G
Sbjct  425   AVVTNDDPSDDKCHFPLMISVG  446



>ref|XP_010688142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/436 (49%), Positives = 293/436 (67%), Gaps = 8/436 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG I++H LPP+ VV+MLK NG  K+KLF     +L+AL GT IEVM+  PN +L+
Sbjct  28    VGVNWGTIATHQLPPEMVVQMLKNNGFDKLKLFEADDRILSALIGTQIEVMLAIPNNMLE  87

Query  372   DLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             ++ +  + A ++V+ NVT+Y  +   GV I  V VGNEP L+ Y    L K   PAL N+
Sbjct  88    EMSSSVDAAVSWVEANVTTYYYSG--GVNINYVAVGNEPTLQTYNGTYL-KYMLPALKNI  144

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+ALN AG G  +KAT+PFNADVY SP   PVPSAG FR ++ D   +I++ L +N APF
Sbjct  145   QEALNHAGYGDQIKATIPFNADVYYSPDSNPVPSAGDFRAEVRDLTLEILQFLHENNAPF  204

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL+ +K+ FP+D+AFF+G + P+ D G  YTNVFDAN+DT V+AL++  +  
Sbjct  205   TVNIYPFLSLYGNKN-FPIDYAFFEGSNVPIRDQGVVYTNVFDANFDTLVSALNKAGYPD  263

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + ++VGE+GWPTDGD +AN   A RF  G ++H+   +GTP+R G  IDVY+F L DE+ 
Sbjct  264   MDIIVGEVGWPTDGDIYANVENAKRFNQGLLQHILSGEGTPLRKGK-IDVYLFSLIDENA  322

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PGNFE HWGI  +DG  K+ LDL+G   + +++  VEG++Y+ K+WC L  +A  L
Sbjct  323   KSVAPGNFERHWGIFEFDGMPKYELDLAGM-QEDRVLIPVEGVQYMVKRWCVLNPDATGL  381

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
              NL  N +YAC  +DCT +  G SCN LS     SY FN Y+Q + Q   +CDF GL  +
Sbjct  382   GNLADNINYACSLSDCTSLGYGCSCNHLSVQGNASYAFNMYYQIKSQDTWNCDFDGLAMI  441

Query  1446  TTKNLSTPSCRFNIGI  1493
             T ++ S  +C+F I I
Sbjct  442   TDQDPSDSTCQFPIMI  457



>ref|XP_004498612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Cicer arietinum]
Length=481

 Score =   413 bits (1062),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 287/440 (65%), Gaps = 15/440 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG  S+HPLPP  VVKMLK NGI+KVKLF+    +LNAL  +GI+VM+G PN LL
Sbjct  30    GIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPDILNALKKSGIQVMVGIPNDLL  89

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VTYPALA  542
               + N  + A+ +V +NV+++   S  GV I  V VGNEPFL  Y   G F+  T PAL 
Sbjct  90    YTMANSLQAAEKWVSKNVSAH--VSSGGVDIRYVAVGNEPFLSTYN--GTFEATTLPALK  145

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q AL +AG+G +V+ TVP NADVY S   +  PS G FR DI D + +IV+ L +N A
Sbjct  146   NIQSALVKAGLGNSVRVTVPLNADVYQSS--SDKPSDGDFRTDIHDLMLQIVKFLSQNNA  203

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YPF+SL Y+   FPVD+AFF+G   PL DNG  Y NVFDANYDT V AL +   
Sbjct  204   PFAVNIYPFISL-YADPNFPVDYAFFNGFGSPLTDNGNIYDNVFDANYDTLVWALQKNGF  262

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + ++VGEIGWPTDGD  AN  +A RF  GF+      KGTP+RPG  ID Y+F L DE
Sbjct  263   GNLPIIVGEIGWPTDGDRNANVLLAQRFNQGFMSRFVAGKGTPMRPGP-IDAYLFSLVDE  321

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWG+  +DG+ K+ L+L   G +   + G  G+ +LPKKWC LK +A 
Sbjct  322   DDKSIQPGNFERHWGLFYFDGRPKYQLNL---GLRSSGLVGATGVAHLPKKWCILKPSAN  378

Query  1263  LTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
             L +  L  +  YAC  ADCT +  G+SC+GL     +SY FN+Y+Q  DQ   +C F GL
Sbjct  379   LNSDQLAESVSYACQNADCTSLGYGTSCSGLDVRGNISYAFNSYYQVNDQIDSACKFPGL  438

Query  1437  GEVTTKNLSTPSCRFNIGIK  1496
               VT K+ STP C F I I+
Sbjct  439   SVVTDKDPSTPDCIFKIMIQ  458



>ref|XP_010488537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Camelina 
sativa]
Length=499

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 221/440 (50%), Positives = 282/440 (64%), Gaps = 8/440 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG ++SH LPP+ VVKML+ NG  K+KLF   + +L+AL G+ IEVMIG PN  L
Sbjct  37    SVGVNWGTMASHQLPPENVVKMLQDNGFTKLKLFEADQNILDALIGSDIEVMIGIPNRFL  96

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K++  +  VA ++V+ENVT+Y  +   GV I  + VGNEPFL+ Y    + + T PAL N
Sbjct  97    KEMAQDTAVAASWVEENVTAY--SYHGGVNIKYIAVGNEPFLQTYNGTYV-EFTLPALIN  153

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+AL EA + K+V+ TVPFNAD+Y SP   PVPSAG FR ++ D   +I+  L  + +P
Sbjct  154   IQRALEEADL-KSVEVTVPFNADIYFSPEANPVPSAGDFRPELRDATIEIINFLYSHDSP  212

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y    FP+DFAFFDG +KPL D    YTNVFDAN DT + AL R    
Sbjct  213   FTVNIYPFLSL-YGNAYFPLDFAFFDGTNKPLRDGNLVYTNVFDANLDTLICALERYSFL  271

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  AN   A RF  G +KH     GTP R G  +DVY+F L +ED
Sbjct  272   GMKIIVGEVGWPTDGDKNANVKSAKRFNQGMVKHAMSGNGTPARKGVIMDVYLFSLINED  331

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA-K  1262
              KS  PG FE HWGI  +DG+ K+ LDLSGKG   K +  VE ++YLPK WC L  NA  
Sbjct  332   AKSIAPGTFERHWGIFEFDGRPKYELDLSGKGND-KPLVPVEDVKYLPKTWCVLDPNAYN  390

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L +L  N DYAC  +DCT +  GSSCN L+     SY FN Y+Q  DQ    CDF  LG 
Sbjct  391   LDDLPDNIDYACSLSDCTALGYGSSCNHLTAIGNASYAFNMYYQMHDQKTWDCDFLVLGL  450

Query  1443  VTTKNLSTPSCRFNIGIKLG  1502
             V  ++ S   C F + I  G
Sbjct  451   VIDEDPSDELCEFPVMIDTG  470



>gb|EMS57429.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=473

 Score =   412 bits (1060),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 284/439 (65%), Gaps = 27/439 (6%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNT-PKPVLNALAGTGIEVMIGTPNALL  368
             LGVNWG   +H L P  VVKMLKANGI KVKLF+  P PV  AL  +GIEVM+G PN +L
Sbjct  29    LGVNWGSQCTHQLDPSEVVKMLKANGIMKVKLFDADPWPV-GALLDSGIEVMLGIPNDML  87

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             + + +Y  A+ +V EN TSY     D +K+  V VGNEPFLK Y      + T PAL N+
Sbjct  88    EAMTSYGNAEDWVAENATSYG----DRLKLRYVAVGNEPFLKSYNGS-FMENTVPALKNI  142

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             QKAL+EAGIG  VKATVP NADVY+       PS G FR DI D +  +V+ +  +GAPF
Sbjct  143   QKALDEAGIGDKVKATVPLNADVYVGDK----PSEGKFRPDIDDVMTDMVKFMHDHGAPF  198

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
             ++N+YPFLSL Y  D FP D           D  G +Y+NVFDANYDT V+AL +     
Sbjct  199   VVNIYPFLSL-YQSDNFPFDIQ---------DTGGVSYSNVFDANYDTLVSALKKAGVPS  248

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +KVVVGEIGWPTDG+  AN  +A RFY+G +K LA  +GT +RPG  +DVY+FGL+DED 
Sbjct  249   LKVVVGEIGWPTDGNKNANPKLARRFYDGLLKKLAKNEGTHLRPGK-MDVYLFGLFDEDM  307

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA---  1259
             KS  PGNFE HWGIL YDG+ KF++DLSG+G   + +  V G+EYLPK+WC     A   
Sbjct  308   KSIAPGNFERHWGILTYDGKPKFSMDLSGQGNDRR-LAAVSGVEYLPKQWCVFDDEAAKD  366

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
               +  L  N  YAC   DCT +  G SCNGL +   +SY FN YFQ QDQ   +CDF GL
Sbjct  367   EDMDKLGGNIQYACASGDCTALGYGCSCNGLDEMSNISYAFNMYFQMQDQDVRACDFDGL  426

Query  1437  GEVTTKNLSTPSCRFNIGI  1493
              +++ KN ST +C F + I
Sbjct  427   AKISDKNASTKTCLFPVQI  445



>ref|NP_001056153.1| Os05g0535100 [Oryza sativa Japonica Group]
 gb|AAT39206.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAF18067.1| Os05g0535100 [Oryza sativa Japonica Group]
Length=488

 Score =   413 bits (1061),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 288/446 (65%), Gaps = 12/446 (3%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G   +GVNWG ++SHP+ P  VV+ML ANG+ +VK+F+        LA TGI+VM+  PN
Sbjct  29    GRAAVGVNWGTMTSHPILPCEVVRMLAANGVARVKMFDADPWTAAPLAHTGIQVMLAVPN  88

Query  360   ALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
               L  L  +   A  + ++NV++Y      GV +  V VGNEPFLK Y    L  VT+PA
Sbjct  89    DQLARLAGDPRRAYRWAEQNVSAYLEA---GVDVRYVAVGNEPFLKSYNGS-LINVTFPA  144

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L NMQ+AL++ G+G  VKA VP NADVY SP   PVPSAG FR DI   +  IV  L+ N
Sbjct  145   LKNMQRALDKLGLGDHVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLNMN  204

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF++N+YPFLSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L + 
Sbjct  205   NAPFVVNIYPFLSL-YQNPNFPLNFSFFDGGSKPVYDKGVVYTNVFDANFDTLVWSLRKA  263

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +K++VGE+GWPTDGD  AN   A +FY+GF+K +    GTP+RPG  ++VY+F L 
Sbjct  264   GVPDMKIIVGEVGWPTDGDKHANVRYAQKFYDGFLKKMVRNIGTPLRPGW-MEVYLFALI  322

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DE+QKS LPG FE HWG+L YDG+ KF++DLSG G     + GVE +EYLP +WC    +
Sbjct  323   DENQKSVLPGRFERHWGLLTYDGKPKFSMDLSGDGLDN--LVGVE-VEYLPAQWCVFNKD  379

Query  1257  A--KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A  K  +L A  +YAC  ADCTP+  GSSCN LS    +SY FN YFQ  DQ   +C F+
Sbjct  380   AKDKFKDLPAAVNYACSNADCTPLGYGSSCNNLSHDGNISYAFNIYFQTMDQDVRACSFE  439

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLGAE  1508
             GL ++TT N S   C F + I   +E
Sbjct  440   GLAKITTINASQGGCLFPVQILSASE  465



>gb|EMS60021.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=616

 Score =   417 bits (1072),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 218/420 (52%), Positives = 277/420 (66%), Gaps = 10/420 (2%)
 Frame = +3

Query  249   KMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLKDLV-NYEVAKAFVKENVTS  425
             ++LK NGI KVKLF T    + ALAG+G+EVM+  PN +L  +  +   A+ +VK NV  
Sbjct  145   RLLKDNGINKVKLFETNPEAMKALAGSGVEVMLAIPNDMLHRIAGDSAAARDWVKRNVKR  204

Query  426   YNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANMQKALNEAGIGKTVKATVPF  605
             ++     GV I  V VGNEPFL  Y K    KVT PAL N+Q ALN+AGIG  +KATVP 
Sbjct  205   FDFDG--GVVIKYVAVGNEPFLAAY-KGSFMKVTLPALENIQNALNDAGIGDRIKATVPL  261

Query  606   NADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFLSLFYSKDQFPV  785
             NADVY SP   PVPSAG FR +I+  +  +V+ L KN APF +N+YPFLSL Y  D FP+
Sbjct  262   NADVYNSPARNPVPSAGRFRAEISGVMTDMVKFLAKNKAPFTVNIYPFLSL-YLDDNFPL  320

Query  786   DFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEIGWPTDGDNFAN  965
             DFAFFDG   P++DNG  YTNV+DAN+DT VAAL+   HG + ++VGE+GWPTDGD  A 
Sbjct  321   DFAFFDGGATPVNDNGVMYTNVYDANFDTLVAALAAVGHGDMPIIVGEVGWPTDGDRHAK  380

Query  966   ASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNFEPHWGILGYDG  1145
             AS A RFY+G +K LA  +GTP RP   I+ Y+FG+ DE ++S  PG+FE HWGI  YDG
Sbjct  381   ASYARRFYDGLLKRLAANRGTPARPNRQIETYLFGVGDEGRESVQPGSFERHWGIFRYDG  440

Query  1146  QTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLTNLK----ANTDYACGRADC  1313
             Q KF +DLSG+ G+  ++   +G++YL + WCAL   A   +L     A  DYAC  ADC
Sbjct  441   QPKFAMDLSGQ-GRNTMLVPAKGVQYLSRTWCALNPKASRDDLNKLLGAKIDYACSNADC  499

Query  1314  TPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             T +  GSSCNG+      SY FNAY+Q Q Q  ++CDFQGL   T  + ST +C F I I
Sbjct  500   TTLGYGSSCNGMDARGNASYAFNAYYQTQSQEDEACDFQGLALPTQTDPSTATCNFTIQI  559



>ref|XP_010027756.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Eucalyptus grandis]
Length=478

 Score =   412 bits (1060),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 282/437 (65%), Gaps = 10/437 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG + SHPL P  VV MLK N I KVKLF+     ++ALAGT +EV++G PN  L
Sbjct  24    GIGVNWGAMMSHPLSPSIVVGMLKDNHINKVKLFDADSWTVSALAGTNMEVIVGIPNDQL  83

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K L + Y+ AK +VKENVT +      GV I  V VGNEPFLK Y      K T PAL N
Sbjct  84    KKLADSYDHAKDWVKENVTKH--LYDGGVDIRYVAVGNEPFLKSYNGSNT-KTTLPALEN  140

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+ AG+G  +KATVP NADVY SP  +  PS  +FR DI   +  +V+ L  N AP
Sbjct  141   IQKALDAAGLGDKIKATVPNNADVYESP--SNKPSDAVFRKDIRGIMIDMVKFLRDNKAP  198

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             FM+N+YPFLSL+ + D FP DFAF DG  K + D G  YTNVFDANYDT V AL +    
Sbjct  199   FMVNIYPFLSLYLNSD-FPFDFAFCDGNAKSIHDKGTEYTNVFDANYDTLVWALKKAGAP  257

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG   A+A +A RFY+GF+K +A  KGTP+RPG  +DVY+FGL DED
Sbjct  258   DLKIIVGEVGWPTDGGKNADAKLAQRFYDGFMKKMAANKGTPLRPG-HLDVYLFGLLDED  316

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS  PG FE HWGI  YDGQ KF +D +GKG   K+    +G++YLP +WC    N   
Sbjct  317   TKSIEPGMFERHWGIFRYDGQPKFPVDFTGKGND-KMPVAAKGVQYLPSQWCVFNGNNTD  375

Query  1266  TNLKANT-DYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
              +   N   YAC  ADC+ +  G+SCN L     VSY FN YFQ +DQ  +SC F G  E
Sbjct  376   KDAVVNELSYACANADCSILGYGASCNNLDANGNVSYAFNMYFQVRDQDVESCTFNGFAE  435

Query  1443  VTTKNLSTPSCRFNIGI  1493
             + T+N S  SC F + I
Sbjct  436   IVTRNFSKGSCLFPVQI  452



>ref|XP_002968123.1| hypothetical protein SELMODRAFT_231117 [Selaginella moellendorffii]
 gb|EFJ30377.1| hypothetical protein SELMODRAFT_231117 [Selaginella moellendorffii]
Length=469

 Score =   411 bits (1057),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 210/447 (47%), Positives = 288/447 (64%), Gaps = 11/447 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             + G+D +GVNWG ++SH LP K +VK+L+ + I KVKLF+    V+ A AGT +E+M+  
Sbjct  1     MTGVDSVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAV  60

Query  354   PNALLKDLVNYE-VAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VT  527
             PN LL+D+   E  A+ FV+ N+T +  +  DGV I  + VGNEPFLK Y   G ++ VT
Sbjct  61    PNDLLEDMAFSEKAARRFVRRNITKF-LSHQDGVNIRYIAVGNEPFLKAY--NGSYEDVT  117

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PA+ NMQ+A+ +AGI   V   VP NAD+  S   +  PS G  R DI   ++ I+E L
Sbjct  118   IPAIRNMQQAIEQAGIQHKVTLVVPLNADILTSSGNSGKPSQGAIRPDIRRLMRTILEFL  177

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             DK+ APF+IN+YPFLSL      FP DFAFFDG    L D    Y+NVFDA+YD  V+AL
Sbjct  178   DKHKAPFVINMYPFLSL-QQDSHFPSDFAFFDGTAHVLSDGRNIYSNVFDASYDLLVSAL  236

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
             +RE    +++VVGE+GWPTDGD +AN   A RF    I+H+   +GTP+RPG  I++Y+F
Sbjct  237   AREGFPDMEIVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGIPIEIYIF  296

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKI----MTGVEGIEYLPKK  1235
             GL DED+KS LPGNFE HWG+  YDG+ K++LD+SG+GG G      +  V G+ YLP +
Sbjct  297   GLVDEDRKSVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSR  356

Query  1236  WCALKANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAK  1412
             WC L      L+ L A   YAC  ADC+ ++ G SCN +  T   SY FN+++Q  +Q  
Sbjct  357   WCVLNPEVDDLSKLPATISYACSYADCSTLAYGGSCNHIGRTGNASYAFNSFYQMNNQRT  416

Query  1413  DSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             +SC F GLG +T  + S+ +C+F + I
Sbjct  417   ESCHFGGLGMITETDPSSGNCQFRVEI  443



>ref|XP_011078347.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Sesamum indicum]
Length=494

 Score =   412 bits (1059),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 217/447 (49%), Positives = 289/447 (65%), Gaps = 11/447 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             +     +GVNWG ++SH LP + VV MLK NG  KVKLF   + +L AL GT IEVM+  
Sbjct  26    IMATSSVGVNWGTMASHQLPARNVVDMLKDNGFDKVKLFEADEGILEALCGTDIEVMLAV  85

Query  354   PNALLKDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L+++ ++   A ++V+ N+T+Y    P GV I  V VGNEPFLK Y    L + T 
Sbjct  86    PNYMLEEMSLDPGAAASWVEANLTAY--AYPGGVNIRYVAVGNEPFLKTYNGTYL-QHTL  142

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q+A+N AG+G  +KA VPFNAD+Y SP    VPSAG FR +I D   +IV+ L 
Sbjct  143   PALRNIQEAINRAGLGSEIKAIVPFNADIYYSPESNQVPSAGDFRPEIRDLTVQIVQYLY  202

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
              N APF++N+YPFLSL Y    FP+DFAFFDG ++P  D    YTNVFDAN+DT V AL+
Sbjct  203   SNAAPFVVNIYPFLSL-YQNTYFPLDFAFFDGSNRPFRDGNYVYTNVFDANFDTLVWALT  261

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
             +  +  +K++VGE+GWPTDGD  AN   A RF  G ++H    +GTP R G +IDVY+F 
Sbjct  262   KAGYPDIKIIVGEVGWPTDGDKHANIENAKRFNQGLVRHALSGEGTPARKG-EIDVYLFS  320

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSG-KGGKGKIMTGVEGIEYLPKKWCAL  1247
             L DE+ KS  PG+FE HWGI  +DG+ K+ LDLSG +  KG  +  V+G+ Y+ ++WC L
Sbjct  321   LVDENAKSIDPGSFERHWGIFEFDGKPKYELDLSGVQANKG--LVAVQGVRYMVRRWCIL  378

Query  1248  KANAKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
               + K T+  L+ N DYAC  +DCT +  GSSCN LS     SY FN Y+Q ++Q +  C
Sbjct  379   NPHVKDTDQELRGNIDYACSLSDCTSLGYGSSCNHLSVRGNASYAFNMYYQFRNQNEWDC  438

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGIKLG  1502
             DF GL  +T K+ S   C F + I  G
Sbjct  439   DFSGLAMITEKDPSDDRCHFPVMIAYG  465



>gb|KCW54346.1| hypothetical protein EUGRSUZ_I00311, partial [Eucalyptus grandis]
Length=449

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 226/433 (52%), Positives = 280/433 (65%), Gaps = 10/433 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG + SHPL P  VV MLK N I KVKLF+     ++ALAGT +EV++G PN  L
Sbjct  24    GIGVNWGAMMSHPLSPSIVVGMLKDNHINKVKLFDADSWTVSALAGTNMEVIVGIPNDQL  83

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             K L + Y+ AK +VKENVT +      GV I  V VGNEPFLK Y      K T PAL N
Sbjct  84    KKLADSYDHAKDWVKENVTKH--LYDGGVDIRYVAVGNEPFLKSYNGSNT-KTTLPALEN  140

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+ AG+G  +KATVP NADVY SP  +  PS  +FR DI   +  +V+ L  N AP
Sbjct  141   IQKALDAAGLGDKIKATVPNNADVYESP--SNKPSDAVFRKDIRGIMIDMVKFLRDNKAP  198

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             FM+N+YPFLSL+ + D FP DFAF DG  K + D G  YTNVFDANYDT V AL +    
Sbjct  199   FMVNIYPFLSLYLNSD-FPFDFAFCDGNAKSIHDKGTEYTNVFDANYDTLVWALKKAGAP  257

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG   A+A +A RFY+GF+K +A  KGTP+RPG  +DVY+FGL DED
Sbjct  258   DLKIIVGEVGWPTDGGKNADAKLAQRFYDGFMKKMAANKGTPLRPG-HLDVYLFGLLDED  316

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
              KS  PG FE HWGI  YDGQ KF +D +GKG   K+    +G++YLP +WC    N   
Sbjct  317   TKSIEPGMFERHWGIFRYDGQPKFPVDFTGKGND-KMPVAAKGVQYLPSQWCVFNGNNTD  375

Query  1266  TNLKANT-DYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
              +   N   YAC  ADC+ +  G+SCN L     VSY FN YFQ +DQ  +SC F G  E
Sbjct  376   KDAVVNELSYACANADCSILGYGASCNNLDANGNVSYAFNMYFQVRDQDVESCTFNGFAE  435

Query  1443  VTTKNLSTPSCRF  1481
             + T+N S  SC F
Sbjct  436   IVTRNFSKGSCLF  448



>gb|ACN32122.1| unknown [Zea mays]
 tpg|DAA42176.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=525

 Score =   412 bits (1060),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 223/479 (47%), Positives = 288/479 (60%), Gaps = 51/479 (11%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             LGVNWG +S+  LPPK + ++L  NG  KVK+F+  +  +  LAGT IE MI  PN +L 
Sbjct  27    LGVNWGTMSARRLPPKVMARLLTDNGFTKVKIFDADERTMKGLAGTSIETMIAVPNDMLA  86

Query  372   DLVNYEVAKAFVKENVTSYNPTSPDGVKI-------------------------------  458
              + +Y+ A+ +V++NVT Y  T   GV I                               
Sbjct  87    AVADYDRARRWVRDNVTKY--TFDGGVNIKCVALGPSARVYIYAVHRHWHGPVRFSAGAE  144

Query  459   ----------TLVGVGNEPFLKFYEKQGLF-KVTYPALANMQKALNEAGIGKTVKATVPF  605
                         V VGNEPFL+ Y   G F  VT PAL N+Q+AL+EAG G  VKATVP 
Sbjct  145   TFSIVRVRPSRFVAVGNEPFLRAY--NGSFDHVTVPALRNIQRALDEAGHGAAVKATVPV  202

Query  606   NADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPFMINVYPFLSLFYSKDQFPV  785
             NADVY SP   PVPSAG FR D+A  +  +V  L+++GAP  +N+YPFLSL Y  D FP+
Sbjct  203   NADVYDSPASNPVPSAGRFRSDVARVMADMVRFLNRSGAPLTVNIYPFLSL-YGNDDFPL  261

Query  786   DFAFFDG-VDKPLDDNGKTYTNVFDANYDTAVAALSREKHgkvkvvvgEIGWPTDGDNFA  962
             D+AFFDG    P+ D    YTNVFDAN+DT V+AL R   G + V++GE+GWPTDGD  A
Sbjct  262   DYAFFDGGAGAPVVDGRAVYTNVFDANFDTLVSALKRVGLGHLPVMIGEVGWPTDGDRHA  321

Query  963   NASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQKSTLPGNFEPHWGILGYD  1142
              A++A RFY G ++ LA ++GTP+RPGA I+ Y+FGL DED KS  PGNFE HWGI  +D
Sbjct  322   TAALAERFYAGLLQRLAARRGTPLRPGARIEAYLFGLVDEDAKSVAPGNFERHWGIFTFD  381

Query  1143  GQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK--ANAKLTNLKANTDYACGRADCT  1316
             G+ KF LDL G  G+  +     G+EYLP++WC L   + A    L  N  YAC RADCT
Sbjct  382   GRPKFPLDLRGD-GRPAMPVPARGVEYLPRRWCVLNPISIAGDGRLADNVAYACSRADCT  440

Query  1317  PMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
              +  G SC  L      SY FNAY+QAQ Q + +CDFQGL  V  ++ S  +C F++ +
Sbjct  441   ALGYGCSCGALDPRGNASYAFNAYYQAQGQVESACDFQGLAVVVDEDASQGACNFSVQL  499



>emb|CCH47219.1| similar to glucan endo-1,3-beta-glucosidase [Lupinus angustifolius]
Length=485

 Score =   411 bits (1056),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 290/445 (65%), Gaps = 15/445 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             +  + G+GVNWG  S+H LPP  VVKMLK NGI+KVKLF+    +L+AL  +GI+VM+G 
Sbjct  23    LGSVSGIGVNWGTQSTHLLPPSTVVKMLKDNGIQKVKLFDADSSILDALKKSGIQVMVGI  82

Query  354   PNALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VT  527
             PN +L  L N  + A+ +V +N++++   S  GV I  V VGNEPFL  Y   G F+  T
Sbjct  83    PNDMLYMLANSVQAAEKWVSKNISAH--VSSGGVDIRYVAVGNEPFLSTYN--GTFESTT  138

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PAL N+Q AL ++G+G  VK TVP NADVYLS   +  PS G FR DI D + +IV+ L
Sbjct  139   LPALQNIQSALVKSGLGNQVKVTVPMNADVYLSA--SDKPSDGNFRPDIHDLMLQIVKFL  196

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
              +N APF +N+YPF+SL YS   FPVDFAFF+G   P++DNG+ Y NV DAN+DT V AL
Sbjct  197   SQNNAPFTVNIYPFISL-YSDANFPVDFAFFNGFQSPINDNGRIYDNVLDANHDTLVWAL  255

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
              +   G + +VVGEIGWPTDGD+ AN   A RF  GF+      KGTP+RPG  ID Y+F
Sbjct  256   QKNGFGNLPIVVGEIGWPTDGDHNANLQYAQRFNQGFMSRFVAGKGTPMRPGP-IDAYLF  314

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DED KS  PGNFE HWG+  YDG+ K+ L+L   G +   + G  G+ YLPKKWC L
Sbjct  315   SLIDEDDKSIQPGNFERHWGLFYYDGKPKYPLNL---GTRTNGLVGASGVAYLPKKWCIL  371

Query  1248  KANAKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
             + +A L +  +  +  YAC  ADCT +  G+SC GL     +SY FN+Y+Q  DQ   +C
Sbjct  372   QPSANLNSDQVAPSVSYACQNADCTSLGYGTSCGGLDVRGNLSYAFNSYYQVNDQMDSAC  431

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGIK  1496
              F GL  VT K+ STPSC+F I I+
Sbjct  432   KFPGLSVVTDKDPSTPSCKFIIMIQ  456



>ref|XP_006655526.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like, partial [Oryza 
brachyantha]
Length=492

 Score =   411 bits (1057),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 287/446 (64%), Gaps = 12/446 (3%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G   +GVNWG + SHP+ P  VV ML ANG+ +VK+F+       ALA TGI+VM   PN
Sbjct  33    GRAAVGVNWGTMMSHPISPCQVVAMLVANGVDRVKMFDADPWTALALADTGIQVMFAVPN  92

Query  360   ALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
               L+ L  +   A  + ++NV++Y      GV +  V VGNEPFLK Y    L  VT+PA
Sbjct  93    DQLEYLAGDPRRAYLWAEQNVSAYLEA---GVDVRYVAVGNEPFLKSYNGS-LINVTFPA  148

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L NMQ+AL++  + + VKA VP NADVY SP   PVPSAG FR DI   +  IV  L  N
Sbjct  149   LKNMQRALDKLRLSEQVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLHMN  208

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF++N+YPFLSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L + 
Sbjct  209   DAPFVVNIYPFLSL-YQNPNFPLNFSFFDGGSKPVYDKGMVYTNVFDANFDTLVWSLRKA  267

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +KVVVGE+GWPTDGD  AN   A RFY+GF+K + G  GTP+RPG  ++VY+F L 
Sbjct  268   GVPDMKVVVGEVGWPTDGDKNANVRYAQRFYDGFLKKMVGNIGTPLRPGW-MEVYLFALI  326

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DE+QKS LPG FE HWG+L YDG+ KF++DLSG G     + G+E ++YLP +WC    +
Sbjct  327   DENQKSVLPGRFERHWGLLTYDGKPKFSMDLSGDGLDN--LVGIE-VDYLPAQWCVFNKD  383

Query  1257  A--KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A  K  +L A+ DYAC  ADCTP+  GSSCNGLS    +SY FN YFQ  DQ   +C F 
Sbjct  384   AKDKYKDLAASVDYACSNADCTPLGYGSSCNGLSHDGNISYAFNIYFQTMDQDVRACSFG  443

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLGAE  1508
             GL ++TT N S   C F + I   +E
Sbjct  444   GLAKITTINASQGGCLFPVQIISASE  469



>ref|XP_006355982.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Solanum tuberosum]
Length=492

 Score =   410 bits (1055),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 218/442 (49%), Positives = 284/442 (64%), Gaps = 14/442 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
              +GVNWG ++SH L  ++VVKMLK NG  KVKLF     +L+AL G+ IEVM+  PN +L
Sbjct  32    SVGVNWGTMASHQLAAESVVKMLKENGFDKVKLFEADDKILSALIGSDIEVMLAIPNYML  91

Query  369   KDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +D+  N E+A +++  NV++Y  T   GVKI  V VGNEPFL+ Y    L   T+PAL N
Sbjct  92    QDMSTNPEMAASWIDANVSTYAYTH--GVKIRYVAVGNEPFLQTYNGTYLHS-TFPALRN  148

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q+A+N AG+G  VKA VP NAD+Y SP   PVPSAG FR +I D   +IV+ LD N AP
Sbjct  149   VQEAINHAGLGPEVKAVVPLNADIYYSPDSNPVPSAGDFRPEIRDLAIQIVQYLDSNDAP  208

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL Y+ + FP ++AFF+G +KP+ D    YTNVFDAN+DT   +L +    
Sbjct  209   FVVNIYPFLSL-YANNYFPFEYAFFNGSNKPMKDGDNLYTNVFDANFDTLAWSLKKAGFP  267

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG+ +AN   A RF  G ++H    +GTP R G  IDVY+F L DE+
Sbjct  268   NMKIIVGEVGWPTDGNKYANIENAKRFNQGLVQHALSGEGTPARKG-KIDVYLFSLIDEN  326

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA--  1259
              KS  PGNFE HWGI  +DGQ K+ LDLS K      +  VEG+ Y+ KKWC LK +   
Sbjct  327   TKSIAPGNFERHWGIFEFDGQPKYELDLSEKP-----LAAVEGVTYMHKKWCVLKPHLPK  381

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
                  L  + DYAC R+DCT +  GSSCN LS+    SY FN Y+Q  +Q    CDFQGL
Sbjct  382   DAQIYLAKSVDYACSRSDCTALGYGSSCNHLSERGNTSYAFNMYYQFNNQNSLDCDFQGL  441

Query  1437  GEVTTKNLSTPSCRFNIGIKLG  1502
               VT  + S   C F + I  G
Sbjct  442   AMVTHNDPSNDKCHFPLMIADG  463



>ref|XP_010914019.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Elaeis guineensis]
Length=468

 Score =   409 bits (1052),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 218/438 (50%), Positives = 289/438 (66%), Gaps = 9/438 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LP   VV+ML  +G  KVKLF+     L ALAGT IEVM+  PN +L
Sbjct  8     GVGVNWGKMATHQLPSDMVVRMLIDSGFDKVKLFDADADTLAALAGTDIEVMVAIPNYML  67

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             + L  + + A  +V ENVTS+N T   GV I  V VGNEPFL+ Y  +G++ ++T PAL 
Sbjct  68    EGLSGDPQAAVDWVDENVTSWNYTG--GVNIRYVAVGNEPFLQTY--KGIYNELTLPALM  123

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+QKALN+AG+G  +KATVPFNAD+Y SP   P+PSAG FR DI D   +I+  L +N A
Sbjct  124   NIQKALNDAGLGGRIKATVPFNADIYNSPGSNPIPSAGDFRSDIRDSAIQIIRFLSENDA  183

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF++N+YPFLSL Y  D FP+DFAFF+G +K + D    YTNVFDAN+DT V +L +  +
Sbjct  184   PFVVNIYPFLSL-YDDDHFPMDFAFFEGTNKTIKDGDAVYTNVFDANFDTLVWSLKKAGY  242

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
               + ++VGE+GWPTDGD  AN  MA  F  G ++HL    GTP R G++IDVY+F L DE
Sbjct  243   PDMPIIVGEVGWPTDGDKNANTEMAKEFNQGLLQHLMSGMGTPARKGSNIDVYLFSLIDE  302

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PGNFE HWGI  YDG+ K+ LDLSG      +M+   G++YL ++WC L  +A 
Sbjct  303   DAKSIAPGNFERHWGIFEYDGKPKYELDLSGHEEDDNLMSA-HGVKYLQRRWCILDPDAT  361

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              LT+L  + ++AC  +DCT +  GSSCN L      SY FN Y+Q ++Q    CDF  L 
Sbjct  362   DLTSLPGSINFACTFSDCTSLGYGSSCNHLDLRGNASYAFNMYYQVRNQKAGDCDFSDLA  421

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              +T ++ S   CRF + I
Sbjct  422   MITDEDPSDEKCRFPVMI  439



>ref|XP_008242583.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Prunus mume]
Length=489

 Score =   410 bits (1054),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 224/439 (51%), Positives = 279/439 (64%), Gaps = 8/439 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VVKMLK N   K+KLF   + +L AL GT IEVM+  PN +L+
Sbjct  29    FGVNWGTMATHQLPPEKVVKMLKDNEFNKLKLFEAEEKILAALMGTQIEVMLAVPNVMLQ  88

Query  372   DLVNYEVAKA-FVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             ++    VA A +V  NVTSY      GV I  V VGNEPFLK Y    L K T PAL N+
Sbjct  89    EMSQDPVAAATWVDANVTSY--CDNGGVNIKYVAVGNEPFLKTYNGTYL-KTTLPALKNI  145

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+ALN AG+G  VKATVPFNAD+Y SP   PVPS G FR +I D + +I++ L  N APF
Sbjct  146   QEALNNAGLGSQVKATVPFNADIYFSPDSDPVPSTGDFRPEIRDSLIEIIQYLHTNDAPF  205

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y    FP  FAFFDG  KP+ D    YTNVFDAN+DT V +L++    +
Sbjct  206   TVNIYPFLSL-YGNTYFPFGFAFFDGTTKPIKDGDLLYTNVFDANFDTLVWSLTKAGFPE  264

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDGD  AN   A RF  G I+H     GTP R G  IDVY+F L DED 
Sbjct  265   MKIMVGEVGWPTDGDINANIRNAKRFNQGMIQHSLSGNGTPARKGK-IDVYLFSLIDEDA  323

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PGNFE HWG+  YDG+ K+NLDL+G   + K +  VE ++Y+ K+WC L  +AK L
Sbjct  324   KSIAPGNFERHWGLFEYDGKPKYNLDLTG-SLENKGLAAVEDVDYMLKRWCVLDKDAKDL  382

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
               L  + DYAC  +DCT +  G SCN LS     SY FN Y+Q   Q   +CDF GL  V
Sbjct  383   EVLAKSIDYACTLSDCTALGYGCSCNNLSLQGNASYAFNMYYQMNSQKSWTCDFSGLAVV  442

Query  1446  TTKNLSTPSCRFNIGIKLG  1502
             T +N S   C+F + I  G
Sbjct  443   TDENPSVGDCQFPVMISYG  461



>ref|XP_010681060.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score =   410 bits (1053),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 293/444 (66%), Gaps = 12/444 (3%)
 Frame = +3

Query  168   NGVAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMI  347
             NG      +GVNWG I+SHPLPP  VV MLK NG+KKVKLF+     L ALAGTGI+VM+
Sbjct  20    NGADNSYSIGVNWGSIASHPLPPSNVVGMLKDNGLKKVKLFDADASTLEALAGTGIDVMV  79

Query  348   GTPNALLKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-V  524
               PN +L+ +  Y+ AK +VK+NVT +      GV I  V VGNEPFL  Y     FK  
Sbjct  80    AIPNDMLERMNKYKHAKDWVKKNVTKH--LYDGGVNIKYVAVGNEPFLASYNDS--FKYT  135

Query  525   TYPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEV  704
             T+PAL N+ KAL EAG G  +KA++P NADVY     +  PS+G FRGDI D +  IV  
Sbjct  136   TFPALQNIVKALEEAGHGD-IKASIPLNADVY--ESSSTSPSSGDFRGDIKDLMLDIVAF  192

Query  705   LDKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAA  884
             L   GAPF++N+YPFLSL+ + D FP +FAFFDG  K ++DN  +Y NVFDAN+DT V A
Sbjct  193   LKDKGAPFIVNIYPFLSLYQNPD-FPENFAFFDGGGKSINDNSHSYNNVFDANFDTLVWA  251

Query  885   LSREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYM  1064
             L +  +G +K++VGEIGWPTDG   AN   A +FY+G +K LA  KGTP+R G  ++VY+
Sbjct  252   LKKNGYGDLKIIVGEIGWPTDGHIQANTKNAKKFYDGLLKKLAANKGTPMRSG-QLEVYL  310

Query  1065  FGLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCA  1244
             FGL DE+ KS  PGNFE HWGI  YDGQ KF +DLSGKG   K+  G +G++YL  KWC 
Sbjct  311   FGLLDENMKSIAPGNFERHWGIFRYDGQPKFQMDLSGKGND-KMPIGAKGVQYLESKWCI  369

Query  1245  LKANAKLTN-LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
                +AK  + ++ + +YAC R+DCT +  GSSCN L     +SY FN +FQ  DQ+ ++C
Sbjct  370   YNQDAKNQDKVQGSIEYACSRSDCTALEYGSSCNNLDVKGNISYAFNMFFQMNDQSVEAC  429

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGI  1493
              F GLG +++ N S   C F I +
Sbjct  430   QFDGLGMISSTNASQQGCLFPIEV  453



>gb|KDO80436.1| hypothetical protein CISIN_1g047337mg [Citrus sinensis]
Length=490

 Score =   410 bits (1054),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 219/446 (49%), Positives = 286/446 (64%), Gaps = 8/446 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V+  DG+GVNWG +S+H LP   VV+ML+ N   K+KLF   K +L+AL G+ IEVM+  
Sbjct  24    VSSGDGVGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAI  83

Query  354   PNALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L ++  +   A ++V  NV+SY  T   GV I  V VGNEPFL+ Y     + +T 
Sbjct  84    PNYMLLEMSEDPGAAASWVYANVSSYFYTG--GVNIKYVAVGNEPFLRTYNDTYRY-ITL  140

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q+ALN+AG+G  +KATVPFNAD+Y SP   PVPSAG FR ++ D    I++ L 
Sbjct  141   PALKNIQQALNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLH  200

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
              N APF +N+YPFLSL Y  D FPVDFAFF+G +KP+ D    YTNVFDAN+DT V +L 
Sbjct  201   LNNAPFTVNIYPFLSL-YGNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLD  259

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
             +  +  + ++VGE+GWPTDGD  AN   A +F  G +KH+    GTP R G  IDVY+F 
Sbjct  260   KAGYPDMHIIVGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGT-IDVYLFS  318

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DE+ KS  PGNFE HWGI  YDG+ K+ LDLSGK  K K +  VEG+ Y+P++WC L 
Sbjct  319   LLDENAKSIAPGNFERHWGIFEYDGKPKYELDLSGK-MKNKGLAPVEGVAYMPRRWCVLN  377

Query  1251  ANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              +A     L  + DYAC  +DCT +  GSSCN L+     SY FN Y+Q   Q   +CDF
Sbjct  378   PHADDFEELPDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDF  437

Query  1428  QGLGEVTTKNLSTPSCRFNIGIKLGA  1505
              GL  VT  + S   C+F + I  G+
Sbjct  438   SGLAMVTDGDPSDDHCQFPVMIAHGS  463



>ref|XP_011082117.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Sesamum indicum]
Length=484

 Score =   409 bits (1052),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 219/448 (49%), Positives = 281/448 (63%), Gaps = 16/448 (4%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V  +  +G NWG  ++HPL P  VVK+LK NGI+KVKLF+    VLNAL+G+GIEVM+G 
Sbjct  21    VNTVQSIGANWGTQATHPLHPSIVVKLLKDNGIQKVKLFDAEATVLNALSGSGIEVMVGI  80

Query  354   PNALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VT  527
             PN +L  L N  + A+ +V+ NV+++   S + V I  V VGNEPFL  Y   G F+  T
Sbjct  81    PNDMLSTLANSVDAAERWVERNVSAH--VSSNSVDIRYVAVGNEPFLSTYN--GTFQATT  136

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PAL N+Q AL +AG+G  VK TVP NADVY S      PS G FR +I D + +IV  L
Sbjct  137   LPALQNIQAALIKAGLGNRVKVTVPLNADVYQSS--TEQPSTGDFRANIHDLMVQIVSFL  194

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
               NGAPF +N+YPF+SL Y+   FPVD+AFFDG   P+ DNG+TYTNVFDANYDT V AL
Sbjct  195   SLNGAPFTVNIYPFISL-YNDPNFPVDYAFFDGYSSPIVDNGRTYTNVFDANYDTLVWAL  253

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
              +   G + ++VGEIGWPTDGD  AN   A RF  GF+ H+    GTP+RPG  ID Y+F
Sbjct  254   QKNGFGNMTIIVGEIGWPTDGDRNANIGYAQRFNQGFMSHM--NAGTPMRPGP-IDAYLF  310

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DED KS  PGNFE HWGI  YDG  K+NL L         +     + YLP++WC L
Sbjct  311   SLIDEDAKSIQPGNFERHWGIFNYDGTPKYNLSLGSSNSHS--LVPASNVHYLPRRWCVL  368

Query  1248  KANAKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
               +A L +  +  +  YAC   DCT +  G+SC  L     +SY FN+Y+Q  +Q + +C
Sbjct  369   SPSANLEDPQVALSVSYACANGDCTSLGYGTSCGNLDAQRNISYAFNSYYQINNQLESAC  428

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGIKLGA  1505
              F  L  +TT + S  +CRFNI I+  A
Sbjct  429   RFPNLSVITTTDPSVGTCRFNIMIQTAA  456



>ref|XP_002970359.1| hypothetical protein SELMODRAFT_231628 [Selaginella moellendorffii]
 gb|EFJ28489.1| hypothetical protein SELMODRAFT_231628 [Selaginella moellendorffii]
Length=469

 Score =   409 bits (1050),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 209/447 (47%), Positives = 288/447 (64%), Gaps = 11/447 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             + G+D +GVNWG ++SH LP K +VK+L+ + I KVKLF+    V+ A AGT +E+M+  
Sbjct  1     MTGVDSVGVNWGTVTSHRLPDKMIVKLLQESRISKVKLFDADPSVIRAFAGTDLELMVAV  60

Query  354   PNALLKDLVNYE-VAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VT  527
             PN LL+D+   E  A+ FV+ N+T +  +  DGV I  + VGNEPFLK Y   G ++ VT
Sbjct  61    PNDLLEDMAFSEKAARRFVRRNITKF-LSHQDGVNIRYIAVGNEPFLKAY--NGSYEDVT  117

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PA+ NMQ+A+ +AGI   V   VP NAD+  +   +  PS G  R DI   ++ I+E L
Sbjct  118   IPAIRNMQQAIEQAGIQHKVTLVVPLNADILTNSGNSGKPSQGAIRPDIRRLMRTILEFL  177

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
             DK+ APF+IN+YPFLSL      FP DFAFFDG    L D    Y+NVFDA+YD  V+AL
Sbjct  178   DKHKAPFVINMYPFLSL-QQDSHFPSDFAFFDGSAHVLSDGRNFYSNVFDASYDLLVSAL  236

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
             +RE    +++VVGE+GWPTDGD +AN   A RF    I+H+   +GTP+RPG  I++Y+F
Sbjct  237   AREGFPDMEIVVGEVGWPTDGDIYANIPNAQRFNQQLIRHVTSNRGTPLRPGIPIEIYIF  296

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKI----MTGVEGIEYLPKK  1235
             GL DED+KS LPGNFE HWG+  YDG+ K++LD+SG+GG G      +  V G+ YLP +
Sbjct  297   GLVDEDRKSVLPGNFERHWGLYRYDGKPKYSLDVSGRGGNGLSSPINLMSVSGVTYLPSR  356

Query  1236  WCALKANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAK  1412
             WC L      L+ L A   YAC  ADC+ ++ G SCN +  T   SY FN+++Q  +Q  
Sbjct  357   WCVLNPEVDDLSKLPATISYACSYADCSTLAYGGSCNHIGQTGNASYAFNSFYQMNNQRT  416

Query  1413  DSCDFQGLGEVTTKNLSTPSCRFNIGI  1493
             +SC F GLG +T  + S+ +C+F + I
Sbjct  417   ESCHFGGLGMITETDPSSGNCQFRVEI  443



>ref|XP_006476105.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Citrus sinensis]
Length=490

 Score =   409 bits (1052),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 218/446 (49%), Positives = 286/446 (64%), Gaps = 8/446 (2%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V+  DG+GVNWG +S+H LP   VV+ML+ N   K+KLF   K +L+AL G+ IEVM+  
Sbjct  24    VSSGDGVGVNWGTMSTHHLPADNVVQMLRENRFNKLKLFEADKKILDALIGSDIEVMLAI  83

Query  354   PNALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L ++  +   A ++V  NV+SY      GV I  V VGNEPFL+ Y     + +T 
Sbjct  84    PNYMLLEMSEDPGAAASWVYANVSSYFYNG--GVNIKYVAVGNEPFLRTYNDTYRY-ITL  140

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q+ALN+AG+G  +KATVPFNAD+Y SP   PVPSAG FR ++ D    I++ L 
Sbjct  141   PALKNIQQALNDAGLGSKIKATVPFNADIYNSPESNPVPSAGGFRDEVKDLTIGIIQFLH  200

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
              N APF +N+YPFLSL Y  D FPVDFAFF+G +KP+ D    YTNVFDAN+DT V +L 
Sbjct  201   LNNAPFTVNIYPFLSL-YGNDYFPVDFAFFEGTNKPIRDGSLLYTNVFDANFDTLVWSLD  259

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
             +  +  + ++VGE+GWPTDGD  AN   A +F  G +KH+    GTP R G  IDVY+F 
Sbjct  260   KAGYPDMHIIVGEVGWPTDGDKNANIENAKKFSQGLLKHVLSGAGTPARKGT-IDVYLFS  318

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DE+ KS  PGNFE HWGI  YDG+ K+ LDLSGK  K K +  VEG+ Y+P++WC L 
Sbjct  319   LLDENAKSIAPGNFERHWGIFEYDGKPKYELDLSGK-MKNKGLAPVEGVAYMPRRWCVLN  377

Query  1251  ANA-KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDF  1427
              +A     L  + DYAC  +DCT +  GSSCN L+     SY FN Y+Q   Q   +CDF
Sbjct  378   PHADDFEELPDSIDYACSLSDCTALGYGSSCNHLTVEGNASYAFNMYYQMNSQESWNCDF  437

Query  1428  QGLGEVTTKNLSTPSCRFNIGIKLGA  1505
              GL  VT ++ S   C+F + I  G+
Sbjct  438   SGLAMVTDEDPSDDHCQFPVMIAHGS  463



>ref|XP_007048158.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOX92315.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=478

 Score =   409 bits (1051),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 291/444 (66%), Gaps = 13/444 (3%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D +GVNWG +SSHPL P  VV++LK NG+KKVKLF+     +  LAGTGIEVM+G PN  
Sbjct  23    DNIGVNWGLMSSHPLHPSIVVRLLKDNGMKKVKLFDADPWAVGYLAGTGIEVMLGIPNDQ  82

Query  366   LKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPAL  539
             LK + N Y  A+ +VKEN+T +      GV I  V VGNEPFL  Y   G F + T+PAL
Sbjct  83    LKTMANDYGAAEDWVKENLTRH--LHDGGVNIKYVAVGNEPFLSSY--NGSFTEYTFPAL  138

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+QKALN+AGIG  +KATVP NADVY S   + +PS G FR DI D + +IV    + G
Sbjct  139   RNVQKALNDAGIGDKIKATVPLNADVYESG--SNIPSEGAFRSDIKDPLTQIVHFYKEQG  196

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
              PF+IN+YPFLSL Y    FP DFAFFDG   PL+D    Y NVFDAN+DT V AL +  
Sbjct  197   CPFVINIYPFLSL-YQNTNFPRDFAFFDG-GHPLNDKNVQYDNVFDANHDTLVWALKKAG  254

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
                +K++VGE+GWPTDG+ FA    A +FY+G  K LA  KGTP+RPG  ++VY+F L+D
Sbjct  255   VPDLKIIVGEVGWPTDGNKFATKDNAKKFYDGLFKKLASNKGTPLRPGK-MEVYVFSLFD  313

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             ED KS  PGNFE HWGI  +DG+ KF +D SG  G  K +   +G++YLPK+WC    +A
Sbjct  314   EDMKSVQPGNFERHWGIFTFDGKPKFPMDFSGN-GTDKPLVAAKGVQYLPKQWCVYDEDA  372

Query  1260  -KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
                  L +   +AC  ADCT + +GSSC   +   K+SY FN+Y+Q  DQ  ++C+F+GL
Sbjct  373   MNQQALPSQMSWACSHADCTCLQEGSSCFTGNTNFKISYAFNSYYQTNDQDVEACNFEGL  432

Query  1437  GEVTTKNLSTPSCRFNIGIKLGAE  1508
             G++  ++ S  +C+F I IK   E
Sbjct  433   GKIVNEDPSKGTCQFPIRIKSAGE  456



>gb|EEE64491.1| hypothetical protein OsJ_19341 [Oryza sativa Japonica Group]
Length=488

 Score =   409 bits (1051),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 220/446 (49%), Positives = 287/446 (64%), Gaps = 12/446 (3%)
 Frame = +3

Query  180   GLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPN  359
             G   +GVNWG ++SHP+ P  VV++L ANG+ +VK+F+         A TGI+VM+  PN
Sbjct  29    GRAAVGVNWGTMTSHPIIPCEVVRILAANGVARVKMFDADPWTAAPFAQTGIQVMLAVPN  88

Query  360   ALLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPA  536
               L  L  +   A  + ++NV++Y      GV +  V VGNEPFLK Y    L  VT+PA
Sbjct  89    DQLAGLAGDPRRAYRWAEQNVSAYLEA---GVDVRYVAVGNEPFLKSYNGS-LINVTFPA  144

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L NMQ+AL++ G+G  VKA VP NADVY SP   PVPSAG FR DI   +  IV  L+ N
Sbjct  145   LKNMQRALDKLGLGDHVKAVVPLNADVYNSPENKPVPSAGSFRKDINALMVDIVNFLNMN  204

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF++N+YPFLSL Y    FP++F+FFDG  KP+ D G  YTNVFDAN+DT V +L + 
Sbjct  205   NAPFVVNIYPFLSL-YQNPNFPLNFSFFDGGSKPVYDKGVVYTNVFDANFDTLVWSLRKA  263

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
                 +K++VGE+GWPTDGD  AN   A +FY+GF+K +    GTP+RPG  ++VY+F L 
Sbjct  264   GVPDMKIIVGEVGWPTDGDKHANVRYAQKFYDGFLKKMVRNIGTPLRPGW-MEVYLFALI  322

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DE+QKS LPG FE HWG+L YDG+ KF++DLSG G     + GVE +EYLP +WC    +
Sbjct  323   DENQKSVLPGRFERHWGLLTYDGKPKFSMDLSGDGLDN--LVGVE-VEYLPAQWCVFNKD  379

Query  1257  A--KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A  K  +L A  +YAC  ADCTP+  GSSCN LS    +SY FN YFQ  DQ   +C F+
Sbjct  380   AKDKFKDLPAAVNYACSNADCTPLGYGSSCNNLSHDGNISYAFNIYFQTMDQDVRACSFE  439

Query  1431  GLGEVTTKNLSTPSCRFNIGIKLGAE  1508
             GL ++TT N S   C F + I   +E
Sbjct  440   GLAKITTINASQGGCLFPVQILSASE  465



>ref|XP_009781628.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Nicotiana 
sylvestris]
Length=484

 Score =   409 bits (1050),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 220/438 (50%), Positives = 286/438 (65%), Gaps = 11/438 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+G NWG  S+H LPP+ +VKMLK NG +KVKLF+     L AL  + IEVM+G PN +L
Sbjct  29    GIGANWGTQSTHNLPPEILVKMLKDNGFQKVKLFDADYDTLKALGNSDIEVMVGIPNDML  88

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
               L + + A+ +V +NV+ +   S + V I  V VGNEPFL+ Y    L + T+PAL N+
Sbjct  89    TTLGSLKAAEKWVSKNVSIH--LSDNNVNIRYVAVGNEPFLETYNGSYL-RTTFPALQNI  145

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q AL +AG G  VK TVP NADVY S   + +PS G FR +I D V +IV+ L  NG PF
Sbjct  146   QTALVKAGHGNQVKVTVPLNADVYESA--SSLPSGGDFRAEIHDFVIQIVKFLSDNGCPF  203

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              IN+YPF+SL Y    FPV++AFFDG   PL+D G  YTN+FDAN+DT V AL +   G 
Sbjct  204   TINIYPFISL-YIDSNFPVEYAFFDGNATPLNDGGTIYTNMFDANHDTLVWALKKNGFGN  262

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + ++VGEIGWPTDGD  AN  +A RF  GF+ H++  KGTP+RPG  +D Y+F L DED 
Sbjct  263   LPIIVGEIGWPTDGDRNANLQLAQRFNQGFMAHISEGKGTPMRPGP-VDAYLFSLIDEDA  321

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKLT  1268
             KS  PGNFE HWGI  YDG+ K+ L+L G    G ++     ++YL +KWC LK +AKL 
Sbjct  322   KSIQPGNFERHWGIFAYDGRPKYLLNL-GTTNSGSLVPA-SNVKYLERKWCVLKPDAKLD  379

Query  1269  N--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             +  +  +  YAC RADCT +  G+SC GL     VSY FN+Y+Q  DQ  D+C F GLG 
Sbjct  380   DPQIAPSVSYACARADCTSLGYGTSCGGLDARGNVSYAFNSYYQINDQLDDACKFSGLGT  439

Query  1443  VTTKNLSTPSCRFNIGIK  1496
             +T  + STPSC+F I I+
Sbjct  440   ITKSDPSTPSCKFGITIE  457



>ref|XP_004237474.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Solanum lycopersicum]
Length=476

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 222/438 (51%), Positives = 287/438 (66%), Gaps = 10/438 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG  ++  LPP  +V+MLK N I KVKLF++    +   AGTGIEVM+G PN  L
Sbjct  22    GLGVNWGTQAAQTLPPSTIVQMLKDNKIDKVKLFDSDHWTVKYFAGTGIEVMLGLPNNQL  81

Query  369   KDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +   N Y+ AK +VK NV+++      GV I  V VGNEPFLK Y    L K T+PAL N
Sbjct  82    EKFANDYDFAKEWVKNNVSAH--LYNGGVDIKFVAVGNEPFLKAYNGSFL-KTTFPALQN  138

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKALN AG+G  +KAT+P NADVY S    P  S G FR DI D ++KI      N AP
Sbjct  139   VQKALNSAGLGDKIKATIPQNADVYESGNSGP--SQGDFRSDIRDLMQKICRFFKDNNAP  196

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F++N+YPFLSL  +K  FP++FAFFDG  K + DNG +YTN+FDAN DT V +L +    
Sbjct  197   FLVNIYPFLSLHENK-HFPLEFAFFDGQTKAVRDNGISYTNMFDANLDTLVVSLKKASCS  255

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              VK++VGEIGWPTDGD + N ++A RFY+GF K +A KKGTP+ PG  I+ Y+F L DE+
Sbjct  256   GVKIIVGEIGWPTDGDLYGNVTLAKRFYSGFFKKMATKKGTPLYPGF-IEYYLFSLTDEN  314

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
             QKS LPG+FE HWGI  YDG+ KF +D++G+G +  +  G + ++YL  KWC L   A+ 
Sbjct  315   QKSILPGSFERHWGIFRYDGKPKFPMDITGQGHE-TMPIGAKNVKYLENKWCVLNKYAED  373

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             +  L ++  YAC R+DCT +  G SCN L     VSY FN YFQ   Q  +SC F GL +
Sbjct  374   IGKLPSSVQYACSRSDCTAVDYGGSCNKLDGDGNVSYAFNMYFQMNGQDVESCVFDGLAK  433

Query  1443  VTTKNLSTPSCRFNIGIK  1496
             +  KN S  SC F IG++
Sbjct  434   IVEKNASVDSCLFPIGLE  451



>ref|XP_010913808.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6-like [Elaeis guineensis]
Length=484

 Score =   408 bits (1049),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 220/448 (49%), Positives = 290/448 (65%), Gaps = 14/448 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V  + G+GVNWG  +SHPLPP  VV+ML+ NGI++VKLF+    V+ AL+ +GI+VM+G 
Sbjct  18    VGVVSGIGVNWGTQASHPLPPGTVVRMLRDNGIQQVKLFDPEDSVMGALSKSGIQVMVGI  77

Query  354   PNALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L  L +  + A+ +V +NV+SY     DGV I  V VGNEPFL+ Y      + T+
Sbjct  78    PNEMLAGLASSMKAAEDWVSKNVSSY---IKDGVDIRYVAVGNEPFLETYNGS-FLQTTF  133

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q AL +AG+   VK T+P NADVY S   +  PS G FR +I D +  I++ L 
Sbjct  134   PALQNIQGALIKAGVSSQVKVTIPLNADVYESS--SGKPSDGDFRMNIHDLMVSIIKFLS  191

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGV-DKPLDDNGKTYTNVFDANYDTAVAAL  887
              NGAPF +N+YPF+SL Y+   FPVD+AFFDG    P+ D   TYTNVFDAN+DT V AL
Sbjct  192   DNGAPFTVNIYPFISL-YNDPNFPVDYAFFDGQPASPVVDGSITYTNVFDANHDTLVWAL  250

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
              +  +G + ++VGEIGWPTDGD  AN   A RF  GF+K +A  +GTP+RPG  ID Y+F
Sbjct  251   QKNGYGNLSIIVGEIGWPTDGDMNANIQYAQRFNQGFLKRVASGQGTPMRPGP-IDAYLF  309

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DEDQKS  PGNFE HWGI  YDGQTK+ L +S    K   + G + ++YL KKWC  
Sbjct  310   SLIDEDQKSIQPGNFERHWGIFYYDGQTKYQLSISTS--KSGTLVGAKNVKYLDKKWCVF  367

Query  1248  KANAKLTNLKA--NTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
             K +  L + +      YAC +ADCT +   +SC  L     VSY FN+Y+Q  DQ   +C
Sbjct  368   KPSVNLDDSRVPPAVSYACAKADCTSLGYKTSCGDLDARGNVSYAFNSYYQVNDQDNRAC  427

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGIKLGA  1505
             DFQG+G  T ++ ST +CRF I I+ G+
Sbjct  428   DFQGIGTTTDRDPSTSTCRFEIMIEAGS  455



>gb|EMT04543.1| Glucan endo-1,3-beta-glucosidase 8 [Aegilops tauschii]
Length=450

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 213/438 (49%), Positives = 274/438 (63%), Gaps = 43/438 (10%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             GLGVNWG ++SH LPP  VV+ML+ NGIKKVKLF+     L ALAG+GIEVM+  PN +L
Sbjct  26    GLGVNWGTMASHQLPPSTVVRMLQDNGIKKVKLFDADAEPLGALAGSGIEVMVAIPNKML  85

Query  369   KDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALAN  545
               + +Y+ A+ +V +NV++YN     GV I  V VGNEPFL      G F  VT PAL N
Sbjct  86    DMMTDYDTAREWVHKNVSAYNFGG--GVNIRYVAVGNEPFLS--SLNGTFLNVTLPALQN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +QKAL+EAG+G TVKATVP NADVY SP    VPSAG FR +I+  + +IV+ L+++GAP
Sbjct  142   IQKALDEAGVGDTVKATVPLNADVYQSPKDNQVPSAGRFRPEISGLMTEIVQFLNQSGAP  201

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YP+LSL Y  D FP+DFAFFDG   P+ D    YTNVFDAN+DT           
Sbjct  202   FTVNIYPYLSL-YGNDDFPLDFAFFDGASSPVVDGNIQYTNVFDANFDT-----------  249

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
                                      RFY G  + LAG  GTP+RP   I++Y+F L DED
Sbjct  250   ------------------------LRFYTGLFRKLAGNAGTPLRPNQYIEIYLFSLIDED  285

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN-AK  1262
              KS  PG FE HWG++ YDGQ K+ +D +G+ G+   + G  G+EYLP+ WC L AN A 
Sbjct  286   VKSVDPGYFERHWGVMRYDGQPKYAMDPTGQ-GRNTALVGARGVEYLPRVWCVLNANAAN  344

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             ++ L  +  YAC  ADCT +S GS+CNG+      SY FNAYFQ QDQ + +C F GL  
Sbjct  345   MSKLADSVGYACTNADCTSLSLGSTCNGMDAAGNASYAFNAYFQVQDQDEVACGFDGLAV  404

Query  1443  VTTKNLSTPSCRFNIGIK  1496
              T ++ ST +C F I ++
Sbjct  405   STRQDPSTGTCNFTIQLE  422



>gb|KEH41651.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=486

 Score =   408 bits (1049),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 276/441 (63%), Gaps = 7/441 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPPK VVKMLK NG +K+KLF+    +L AL GT IEVM+  PN +L 
Sbjct  30    VGVNWGTMTTHQLPPKKVVKMLKDNGFRKLKLFDADDTILTALMGTDIEVMVAIPNVMLS  89

Query  372   DLVNYEV-AKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              + N  + A ++V ENVT+Y      GV I  V VGNEPFLK Y    L K T PAL N+
Sbjct  90    KISNSPMDADSWVYENVTAY--LFRGGVNIKYVAVGNEPFLKAYNGSYLNK-TLPALKNI  146

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q +LN AG+   VK TVPFNAD+Y SP   PVPSAG FR ++ D   +IV+ L    + F
Sbjct  147   QTSLNNAGLESKVKVTVPFNADIYYSPDSNPVPSAGDFRPELRDITIEIVQFLYSTNSTF  206

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL+Y +D FP DFAFFDG ++PL D    Y NVFDAN DT + AL +  +  
Sbjct  207   TVNIYPFLSLYYGQDNFPFDFAFFDGKNEPLRDGKAVYNNVFDANLDTLMWALEKAGYPD  266

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             + V VGE+GWPTDGD  ANA  A RF  GFIKH     GTP R G  +D Y+F L DE+ 
Sbjct  267   LHVTVGEVGWPTDGDKNANAKNAKRFNQGFIKHALRGNGTPKRKGM-MDFYLFSLIDEND  325

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PGNFE HWGI  +DG+ K+ LD+ G   K K +  VEGI+YL KKWC L   A  L
Sbjct  326   KSVAPGNFERHWGIYEFDGKPKYELDIRGN-HKEKGLVSVEGIKYLEKKWCVLDPEATDL  384

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
              +L  N DYAC  +DCT +  G SC+ L+     SY FN Y+Q  DQ    CDF GL  V
Sbjct  385   DDLGKNVDYACSHSDCTALGYGCSCSNLNVQGNASYAFNMYYQVNDQMDWDCDFSGLAMV  444

Query  1446  TTKNLSTPSCRFNIGIKLGAE  1508
             T ++ S   C F + +  G+ 
Sbjct  445   THEDPSENGCNFPLMVASGSR  465



>gb|EMS47593.1| Glucan endo-1,3-beta-glucosidase 8 [Triticum urartu]
Length=473

 Score =   407 bits (1046),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 217/438 (50%), Positives = 287/438 (66%), Gaps = 26/438 (6%)
 Frame = +3

Query  186   DGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNAL  365
             D LG+NWG  ++HPL P+ VV++L+ NGIKKVKLF+  +  LNALAGT IEVM+  PN L
Sbjct  25    DALGMNWGTQATHPLSPRIVVQLLRDNGIKKVKLFDADQGTLNALAGTDIEVMVAIPNNL  84

Query  366   LKDLVNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLF-KVTYPALA  542
             L  + + + A+ +V+ NV+ Y+     GV I  V VGNEPFL  Y   G F KVT+PAL 
Sbjct  85    LDIMNDKDNARDWVRHNVSRYHFDG--GVNIKYVAVGNEPFLASYN--GTFDKVTFPALQ  140

Query  543   NMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGA  722
             N+Q ALN+AG  + +KATVP NADVY SP +                  ++V+ L  N A
Sbjct  141   NIQNALNDAGFSE-IKATVPLNADVYNSPAH-----------------NQMVQFLANNSA  182

Query  723   PFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKH  902
             PF +N+YP+LSL+ S+D FPVDFAFFDG+ KPL D   TYTNVFDAN+DT V+AL+   H
Sbjct  183   PFTVNIYPYLSLYLSED-FPVDFAFFDGLAKPLVDGVNTYTNVFDANFDTLVSALAAVGH  241

Query  903   gkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDE  1082
             G + +V+GE+GWPTDGD  A  ++A RFY+G +  LA   GTP+RP   ++VY+FGL DE
Sbjct  242   GDLPIVIGEVGWPTDGDKHATNALAKRFYDGLLPRLAANTGTPLRPKQYMEVYLFGLLDE  301

Query  1083  DQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK  1262
             D KS  PG FE HWG+L +DGQ KF +DL+G  G+  ++   +G++YLP+ WC    NA+
Sbjct  302   DVKSVAPGAFERHWGVLRFDGQPKFPMDLTGN-GQNTMLVPAKGVQYLPRTWCVYNPNAE  360

Query  1263  -LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
               + L  N +YAC  ADCT +  GS+C G+      SY FN YFQ Q+Q  ++CDFQ L 
Sbjct  361   DKSKLVENVNYACTFADCTALGLGSTCYGMDANGNASYAFNMYFQVQNQKDEACDFQALA  420

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               T  + ST +C F I I
Sbjct  421   VPTQTDPSTAACNFPIQI  438



>ref|XP_004504006.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cicer arietinum]
Length=490

 Score =   407 bits (1047),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 292/442 (66%), Gaps = 10/442 (2%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + G+GVNWG ++++PL P  VV MLK NGIK+VK+F+T   +L A  GT IE+M+G PN 
Sbjct  32    VSGVGVNWGLLATNPLDPSIVVNMLKDNGIKRVKIFDTDPWILGAFTGTDIELMVGIPND  91

Query  363   LLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
              LK L +  + AK +VK NV+ +      GVKI  V VGNE FLK Y    + K T+PA+
Sbjct  92    QLKKLSHSMDFAKDWVKHNVSKH--MHDGGVKIRYVSVGNEAFLKSYNGSYI-KTTFPAM  148

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q AL++AG G  +K T   NADVY S   +  PS G FR DI D +K+IV+ LD+  
Sbjct  149   QNIQTALDKAGFGDKIKVTTALNADVYESS--SDKPSGGNFRADIHDVMKQIVQFLDERK  206

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             +PF++N+YPFLSL+ ++D FP D+AFFD   + ++DN   YTNVF+AN+DT V +L +  
Sbjct  207   SPFLVNIYPFLSLYQNED-FPQDYAFFDSSSRTINDNNHQYTNVFEANFDTLVWSLKKVG  265

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
             H  V ++VGEIGWPTDGD  AN + A RFYNGF+K +A KKG+P+RPG  ++VY+F L D
Sbjct  266   HPDVSIMVGEIGWPTDGDKRANLNNAKRFYNGFLKKMASKKGSPLRPGP-MNVYLFSLVD  324

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             E+ KS LPGNFE HWGI  YDG+ KF++DLSG+ G+ K+  G +G+ YL  KWC L+   
Sbjct  325   ENLKSVLPGNFERHWGIFRYDGKPKFSIDLSGR-GEDKMPIGAKGVRYLENKWCVLRKEV  383

Query  1260  K-LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGL  1436
             K ++ +     YAC   DCT +  G SC+ L      S++FN +FQ  +Q+ ++CDF GL
Sbjct  384   KNMSEVYGAVSYACALGDCTSLGTGCSCSNLDVAGNTSFSFNQFFQMNEQSVEACDFNGL  443

Query  1437  GEVTTKNLSTPSCRFNIGIKLG  1502
               + T++ S   C F I I  G
Sbjct  444   ATIVTQDPSHKGCSFPIEIYSG  465



>gb|KFK28168.1| hypothetical protein AALP_AA8G481200 [Arabis alpina]
Length=485

 Score =   407 bits (1046),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 280/442 (63%), Gaps = 10/442 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G GVNWG+I+SHPL P  VV+MLK N I KVKLF+     +NALAGTG+EVM+G PN LL
Sbjct  27    GFGVNWGNIASHPLNPDIVVRMLKENKINKVKLFDADSWTMNALAGTGMEVMVGIPNNLL  86

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             + L  +Y+ AK +VKENVT+Y      GV I  V VGNEPFL  Y    L K T+PAL N
Sbjct  87    ETLAEDYDNAKDWVKENVTAY--LRKGGVDIKYVAVGNEPFLSAYNGSFL-KTTFPALKN  143

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             + KAL EAG    +KAT+P NA+VY S      PS G FR D+   +  IV     N  P
Sbjct  144   IHKALKEAGHTNILKATIPQNAEVYQSA--NDKPSEGDFRSDVKKTMLDIVNFFHDNDLP  201

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y  + FPV+FAF DG  K + DNGK Y NVFDANYDT V +L +    
Sbjct  202   FTVNIYPFLSL-YLNEHFPVEFAFLDGDGKTITDNGKNYDNVFDANYDTLVYSLRKAGIK  260

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDG  +A+  +A +FY G +K LA   GTP RP   ++VY+FGL DED
Sbjct  261   DMKIIVGEVGWPTDGHKYASPKLAEKFYAGLMKRLAEDGGTPSRP-ERLEVYLFGLLDED  319

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL-KANAK  1262
              KS LPG FE HWGI  YDG  KF LD +G+G K  +    +G++YL K+WC + K    
Sbjct  320   MKSILPGPFERHWGIFRYDGTPKFMLDFTGQGRK-MVPVAAKGVQYLEKQWCVVNKDTVN  378

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
             L  +  + DYAC   DCT M  GS+C+ L   + +SY FN YFQ QDQ   +CDF+G   
Sbjct  379   LDEVGPDLDYACYHGDCTAMQGGSTCSNLDKIQNISYAFNMYFQIQDQDVRACDFKGAAM  438

Query  1443  VTTKNLSTPSCRFNIGIKLGAE  1508
             +T  N S  SC F + I  G++
Sbjct  439   ITKTNASVGSCLFPVQIVSGSD  460



>dbj|BAK03700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   407 bits (1046),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 221/438 (50%), Positives = 279/438 (64%), Gaps = 12/438 (3%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG   SHPLP   VV++LK NG  +VKLF+    +L AL G+GI+VM+G PN +L
Sbjct  26    GMGVNWGTQLSHPLPASTVVRLLKDNGFDRVKLFDAEDGILGALKGSGIQVMVGIPNDML  85

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
              DL  + + A+ +V  NV+ +     DGV I LV VGNEPFL+ +    L   T+PA+ N
Sbjct  86    SDLAGSTKAAERWVAANVSKH---INDGVDIRLVAVGNEPFLQTFNGTYL-NTTFPAMQN  141

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q AL  AG+G  VK TV  NADVY S   +  PS G FR DI   +  IV+ L  +GAP
Sbjct  142   VQAALMAAGLGGQVKVTVALNADVYQSA--SGKPSDGDFRADIHGLMLNIVQFLASSGAP  199

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F+ NVYPF+SL Y+   FP+D+AFF G   P+ D G TY N FDAN+DT VAAL R    
Sbjct  200   FVANVYPFISL-YADPNFPLDYAFFQGSTSPVVDGGVTYQNTFDANHDTLVAALRRNGFP  258

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              V VVVGE+GWPTDGD  AN   A RF  G I H+A  KGTP+ PGA ID Y+F L DED
Sbjct  259   NVTVVVGEVGWPTDGDANANPDYARRFNQGLIDHVASGKGTPLAPGAPIDAYLFSLVDED  318

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAKL  1265
             +KS  PGNFE HWGI  YDG+ K+ L L G G  G ++    G+EYL ++WC LK  A L
Sbjct  319   RKSIQPGNFERHWGIFFYDGKPKYQLGLRGSG--GGMLVPARGVEYLQRRWCVLKPGADL  376

Query  1266  TNLKA--NTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              + K   +  YACG ADCT +   +SC GL     VSY FN+Y+Q +DQ   +CDF+GL 
Sbjct  377   ADQKVGDSVSYACGSADCTSLGYKTSCGGLDAKGNVSYAFNSYYQTEDQDDRACDFRGLA  436

Query  1440  EVTTKNLSTPSCRFNIGI  1493
               TT + S+ +CRF +GI
Sbjct  437   TTTTVDPSSGTCRFIVGI  454



>ref|XP_010520102.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Tarenaya hassleriana]
Length=483

 Score =   407 bits (1045),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 221/444 (50%), Positives = 285/444 (64%), Gaps = 12/444 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             + G GVNWG+I+SHPL P  VV MLK N I KVKLF+     +  LAGTGIEVM+G PN 
Sbjct  24    VQGFGVNWGNIASHPLNPNFVVGMLKDNNINKVKLFDADPWTMETLAGTGIEVMVGIPNN  83

Query  363   LLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
             +L+DL  +Y  A+ +VKENVT Y      GV I  V VGNEPFL  Y    L K T+PA 
Sbjct  84    MLEDLAKDYGYAEDWVKENVTKY--MRDGGVNIKYVAVGNEPFLSAYNGSFL-KTTFPAF  140

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+ KAL +AG G  ++AT+P NA+VY S   +  PS G FR D+ + +  IV     NG
Sbjct  141   KNIHKALRKAGHGDKMQATIPQNAEVYHSD--SDKPSDGDFRSDVKELMLDIVNFFKDNG  198

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
              PF +N+YPFLSL Y    FPV+FAFF+G  + + D G+TY +VFDANYDT V AL +  
Sbjct  199   NPFTVNIYPFLSL-YQNQHFPVEFAFFNGNGQAITDKGRTYDSVFDANYDTLVWALKKAG  257

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
                +K+++GE+GWPTDG  +A+ S+A +FY+G +K LA  +GTP+RPG  +DVY+FGL D
Sbjct  258   ISNMKIIIGEVGWPTDGHIYASPSLAEKFYSGLMKKLANDEGTPLRPGK-LDVYLFGLLD  316

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIM-TGVEGIEYLPKKWCAL-KA  1253
             ED KS LPG FE HWGI  YDGQ KF LD +G+G   KIM  G +G+EY+ K+WC + K 
Sbjct  317   EDMKSILPGPFERHWGIFRYDGQPKFVLDFTGQG--RKIMPVGAKGVEYMEKQWCVVNKE  374

Query  1254  NAKLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
                L N+  + DYAC   DCT +  GS+CN L     +SY FN YFQ Q Q   +CDF+G
Sbjct  375   TINLDNVGPDLDYACYHGDCTALLYGSTCNKLDSIGNISYAFNMYFQMQSQDVRACDFRG  434

Query  1434  LGEVTTKNLSTPSCRFNIGIKLGA  1505
                +   N S  +C F + I  G+
Sbjct  435   AASIVKTNASVGTCLFPVQIVSGS  458



>ref|XP_010669627.1| PREDICTED: glucan endo-1,3-beta-glucosidase 6 [Beta vulgaris 
subsp. vulgaris]
Length=488

 Score =   406 bits (1044),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 220/441 (50%), Positives = 281/441 (64%), Gaps = 12/441 (3%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G+G NWG  SSHPL P  VV+ML+ N I+KVKLF+     L+AL  TGIEVM+G PN 
Sbjct  27    VNGIGANWGTQSSHPLSPAVVVRMLRENRIQKVKLFDAAYDTLHALGSTGIEVMVGIPND  86

Query  363   LLKDL-VNYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPAL  539
             +L  L  +   A+ +V EN+T +   S + V I  V VGNEPFL  Y    L + T+PAL
Sbjct  87    MLSTLATSSRAAEKWVSENITEH--ISNNKVNIRYVAVGNEPFLATYNGSFL-RTTFPAL  143

Query  540   ANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNG  719
              N+Q AL  AG G  VK TVP NADVY SP  + +PS G FR DI D + +IV+ L  NG
Sbjct  144   QNIQNALLRAGHGNQVKVTVPSNADVYASP--SSMPSGGDFRSDINDYMIQIVKFLSDNG  201

Query  720   APFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREK  899
             APF +N+YPF+SL Y+   FPV++AFFDG   PL+D G  Y N+FDANYDT + AL +  
Sbjct  202   APFTVNIYPFISL-YTDANFPVEYAFFDGNATPLNDGGTNYYNMFDANYDTLIWALQKNG  260

Query  900   HgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYD  1079
              G + ++VGEIGWPTDGD  AN   A RF  GF+ H+A  KGTP+R G  ID Y+F L D
Sbjct  261   FGNMPIIVGEIGWPTDGDMNANVKFAQRFNQGFMSHIANGKGTPMRAGP-IDAYLFSLID  319

Query  1080  EDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANA  1259
             EDQKS  PGNFE HWGI  +DG  K+ L+L G    G ++   +G+ Y  ++WC LK + 
Sbjct  320   EDQKSIQPGNFERHWGIFTFDGLPKYQLNL-GTTNLGTLVKA-KGVTYEQRQWCVLKPSV  377

Query  1260  KL--TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQG  1433
             KL  + L  +  YAC RADCT +  G+SC  L     VSY FN+Y+Q  DQ  ++C F G
Sbjct  378   KLDDSRLAPSVSYACARADCTSLGYGTSCGSLDIQGNVSYAFNSYYQINDQVDEACKFDG  437

Query  1434  LGEVTTKNLSTPSCRFNIGIK  1496
             L  VT  + S  SCRF I I+
Sbjct  438   LAAVTKSDPSRDSCRFEIMIE  458



>ref|XP_008458070.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Cucumis melo]
Length=496

 Score =   407 bits (1045),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 219/437 (50%), Positives = 286/437 (65%), Gaps = 9/437 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
             +GVNWG +++H LPP+ VVKML+ NG  K+KLF     +L AL GT IEVM+  PN++L 
Sbjct  27    VGVNWGTMATHQLPPEKVVKMLQENGFHKLKLFEADDRILEALIGTDIEVMLAIPNSMLF  86

Query  372   DLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
              +  + + A ++V  NVT+Y  T   GVKI  V VGNEPFLK Y    L ++T PAL N+
Sbjct  87    LMSQDPQAAASWVDSNVTAY--TYHGGVKIKYVAVGNEPFLKSYNGTYL-QLTLPALRNI  143

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+ALN+AG+G  VKAT+PFNAD+Y SP   PVPSAG FR D+ D   +I+  L  N APF
Sbjct  144   QQALNDAGLGSKVKATIPFNADIYNSPDSNPVPSAGEFRPDVRDLAIEILHYLSINNAPF  203

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVD-KPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
              +N+YPFLSL Y  D FP+DFAFFDG   KP+ D   TYTNVFDAN+DT V+AL++  + 
Sbjct  204   TVNIYPFLSL-YGNDYFPIDFAFFDGTAYKPIKDRDLTYTNVFDANFDTLVSALAKAGYP  262

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              +K++VGE+GWPTDGD  AN   A RF  G ++H    +GTP R G  ID+Y+F L DE+
Sbjct  263   DMKIIVGEVGWPTDGDKHANIQNAKRFNQGLLRHALSGEGTPARVGI-IDIYLFSLIDEN  321

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-  1262
              KS  PG+FE HWGI  +DG+ K+ LDL+G   + K +  VEG+ Y+ K+WC L  N   
Sbjct  322   AKSIEPGSFERHWGIFEFDGKPKYELDLAGT-EEEKGLIPVEGVRYMGKRWCVLNPNVND  380

Query  1263  LTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGE  1442
                L  + DYAC  +DCT +  GSSCN L+     SY FN Y+Q  +Q   +CDF GL  
Sbjct  381   WEGLADSVDYACSLSDCTALEYGSSCNQLTAQGNASYAFNMYYQVNNQKSWNCDFDGLAV  440

Query  1443  VTTKNLSTPSCRFNIGI  1493
             VT ++ S  +C F I I
Sbjct  441   VTQQDPSYGNCLFPIMI  457



>gb|EYU37424.1| hypothetical protein MIMGU_mgv1a005873mg [Erythranthe guttata]
Length=466

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 280/444 (63%), Gaps = 15/444 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V  +  +G NWG  ++HPL P  +VK+LK NGI+KVKLF+    VLNA +G+GIEVM+G 
Sbjct  2     VNSVHSIGANWGTQATHPLAPSIIVKLLKDNGIQKVKLFDAEARVLNAFSGSGIEVMVGI  61

Query  354   PNALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTY  530
             PN +L  L N    A+ +V+ NV+++   S + V I  V VGNEPFL  Y    L   TY
Sbjct  62    PNEMLSLLANSVSAAERWVERNVSAH--VSANSVDIRYVAVGNEPFLSSYNGTFL-ATTY  118

Query  531   PALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLD  710
             PAL N+Q AL +AG+G  VK TVP NADVY S      PS G F  DI   + +IV  L 
Sbjct  119   PALQNIQAALIKAGLGNKVKVTVPLNADVYQSS--TAQPSTGDFHADIHSLMLEIVNFLS  176

Query  711   KNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALS  890
              NGAPF +N+YPF+SL Y+   FP+D+AFFDG   P++DNGK YTNVFDANYDT V AL 
Sbjct  177   LNGAPFTVNIYPFISL-YNDPNFPIDYAFFDGYPSPIEDNGKIYTNVFDANYDTLVWALQ  235

Query  891   REKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFG  1070
             +     + ++VGEIGWPTDGD  ANA+ A RF  GFI  L   +GTP+RPG  +D Y+F 
Sbjct  236   KNGFSNLTIIVGEIGWPTDGDRNANAASAQRFNQGFISRL--NQGTPMRPGP-VDAYLFS  292

Query  1071  LYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALK  1250
             L DED KS  PGNFE HWGI  YDG  K+NL L   GG  + +     + YLP++WC + 
Sbjct  293   LVDEDAKSIQPGNFERHWGIFNYDGTPKYNLSL---GGNSRGLVPATNVRYLPRRWCVMS  349

Query  1251  ANAKLTNLKA--NTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCD  1424
               A L + +   +  YAC RADCT +  G+SC+ L     +SY FN+Y+Q  +Q + +C 
Sbjct  350   PTASLEDPQVGLSVSYACARADCTKLGFGTSCSNLDARGNISYAFNSYYQINNQLETACR  409

Query  1425  FQGLGEVTTKNLSTPSCRFNIGIK  1496
             F  L  VTT + S  +C+F + I+
Sbjct  410   FPNLSVVTTSDPSVGTCKFGLMIE  433



>ref|XP_009127212.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5 [Brassica rapa]
Length=483

 Score =   406 bits (1043),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 286/442 (65%), Gaps = 16/442 (4%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  +SHPLPP  VV++L+ NGI+KVKLF     +L AL+ +GI+VM+G PN 
Sbjct  24    VEGIGVNWGSQASHPLPPATVVRLLRENGIQKVKLFEADSQILRALSRSGIQVMVGIPND  83

Query  363   LLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VTYPA  536
             LL  +  +  VA+ +V +NV+++   S +GV I  V VGNEPFLK +   G F+ +T PA
Sbjct  84    LLAPIAGSVAVAERWVSQNVSAH--VSSNGVDIRYVAVGNEPFLKSFN--GTFESITLPA  139

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q AL +AG+   VK TVP NADVY S   + +PSAG FR +I D +  IV+ L  N
Sbjct  140   LQNIQSALIKAGLASQVKVTVPLNADVYESA--SNLPSAGDFRAEIRDLMISIVKFLSDN  197

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF IN+YPF+SL Y+   FPV+FAFFDG   P++DNG+ Y NV DANYDT V +L + 
Sbjct  198   QAPFTINIYPFISL-YNDPHFPVEFAFFDGTGSPINDNGRIYDNVLDANYDTLVWSLQKN  256

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
               G + ++VGE+GWPTDGD  AN   A R+  GF+      +GTP+RPG  +D Y+F L 
Sbjct  257   GFGNMSIIVGEVGWPTDGDKNANMQYARRYNQGFMNRQKAGRGTPMRPGP-MDAYLFSLI  315

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI   DGQ K+ L L    G G  +   +G+ ++ KKWC L A+
Sbjct  316   DEDAKSIQPGNFERHWGIFYIDGQPKYQLSL----GNGNGLVPAKGVRHMAKKWCVLAAS  371

Query  1257  AKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A L +  L  +  YAC  ADCT +  GSSC  L+  + VSY FN+Y+Q  DQ   +C F 
Sbjct  372   ANLQDPQLGPSVSYACDHADCTSLGYGSSCGSLNLAQNVSYAFNSYYQVSDQLDSACKFP  431

Query  1431  GLGEVTTKNLSTPSCRFNIGIK  1496
             GL  +TT + S  SC+F I IK
Sbjct  432   GLSVITTNDPSVGSCKFKIMIK  453



>gb|KEH39797.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=476

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 220/445 (49%), Positives = 287/445 (64%), Gaps = 15/445 (3%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V  + G+GVNWG  S+HPLPP  VVKMLK NGI+KVKLF+    +L+AL  +GI+VM+G 
Sbjct  20    VLEVGGIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADPNILDALKKSGIQVMVGI  79

Query  354   PNALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VT  527
             PN LL  + N  + A+ +V +NV+++   S  GV I  + VGNEPFL  Y   G F+  T
Sbjct  80    PNDLLYTMANSRQAAEKWVAKNVSAH--VSSGGVDIRYIAVGNEPFLSTYN--GTFEATT  135

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PAL N+Q AL +AG+G ++K TVP NADVY S   +  PS G FR DI D + +IV+ L
Sbjct  136   LPALVNIQNALIKAGLGSSIKVTVPSNADVYQSS--SGNPSDGDFRTDIHDLMVQIVKFL  193

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
              +N APF +N+YPF+SL Y    FPVD+AFF+G   PL+DNGK Y NVFDANYDT V AL
Sbjct  194   SQNNAPFTVNIYPFISL-YEDPNFPVDYAFFNGFSDPLNDNGKIYDNVFDANYDTLVWAL  252

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
             ++   G + ++VGEIGWPTDGD   N  +A RF  GF+      KGTP+RPG  +D Y+F
Sbjct  253   NKNGFGNMPIIVGEIGWPTDGDRNGNLQLAQRFNQGFMTRFIAGKGTPLRPGP-MDAYLF  311

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DED KS  PGNFE HWG+  YDG+ K+ L +   G +   + G  G+ +LPKKWC L
Sbjct  312   SLVDEDNKSIQPGNFERHWGLFYYDGRPKYQLTI---GSRTNGLVGATGVAHLPKKWCIL  368

Query  1248  KANAKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
             K +A L +  +  +  YAC  ADCT +  G+SC GL     +SY FN+Y+Q  DQ   +C
Sbjct  369   KPSANLNSDQVAPSVSYACQNADCTSLGYGTSCGGLDIRGNISYAFNSYYQVNDQVDGAC  428

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGIK  1496
              F GL  VT ++ ST  C F I I+
Sbjct  429   KFPGLSTVTDRDPSTQDCTFQIMIQ  453



>gb|KEH32093.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=521

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 219/438 (50%), Positives = 285/438 (65%), Gaps = 10/438 (2%)
 Frame = +3

Query  189   GLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALL  368
             G+GVNWG +++H LPPK VVKML+ NG  K+KLF+  + V+ AL GT IEVM+  PN +L
Sbjct  30    GVGVNWGTMATHQLPPKNVVKMLQENGFDKLKLFDADEWVMAALLGTDIEVMLAIPNNML  89

Query  369   KDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALAN  545
             +++  + +VA ++V ENVTSY    P G+ I  + VGNEPFLK Y    L   T PAL N
Sbjct  90    EEISKDPKVADSWVYENVTSY--LYPGGLNIKYIAVGNEPFLKEYNGTYLM-YTLPALKN  146

Query  546   MQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAP  725
             +Q +LN AG+G ++KATVPFNAD Y SP    VPSAG FR ++ D   +I+  L  N AP
Sbjct  147   IQTSLNNAGLGSSIKATVPFNADAYYSPDSNLVPSAGDFRPEVRDLTIEIINYLYTNNAP  206

Query  726   FMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHg  905
             F +N+YPFLSL Y  D FP DFAFFDG +KPL D    YTNVFDAN DT + AL +  + 
Sbjct  207   FTVNIYPFLSL-YGNDHFPFDFAFFDGNNKPLVDGNLLYTNVFDANLDTLLYALEKAGYP  265

Query  906   kvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDED  1085
              + V++GE+GWPTDGD  AN   A RF NG +KH     GTP R G  ID+Y+F L DE+
Sbjct  266   DMHVIIGEVGWPTDGDKNANIQNAKRFNNGLLKHCLSGNGTPKRKGI-IDIYLFSLIDEN  324

Query  1086  QKSTLPGNFEPHWGILGYDGQTKFNLDLSG-KGGKGKIMTGVEGIEYLPKKWCALKAN-A  1259
              KS  PGNFE HWGI  +DG+ K+ LDL G +G +G  +  VEG++Y+ K+WC L  + +
Sbjct  325   AKSIAPGNFERHWGIFEFDGKPKYELDLKGFQGDEG--LVAVEGVKYMEKQWCILDPDIS  382

Query  1260  KLTNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLG  1439
              L  L  + DYAC  +DCT +  GSSCNGLS     SY FN Y+Q  +Q    CDF GL 
Sbjct  383   DLHYLAGSIDYACSLSDCTALGYGSSCNGLSLEGNASYAFNMYYQVHNQKDWDCDFSGLA  442

Query  1440  EVTTKNLSTPSCRFNIGI  1493
              ++ ++ S   C+F + I
Sbjct  443   ILSDQDPSEKGCQFPVMI  460



>ref|XP_006596135.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Glycine max]
 gb|KHN09382.1| Glucan endo-1,3-beta-glucosidase 5 [Glycine soja]
Length=483

 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 220/445 (49%), Positives = 286/445 (64%), Gaps = 16/445 (4%)
 Frame = +3

Query  174   VAGLDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGT  353
             V  ++G+GVNWG   +HPLP   +VKMLK NGI+KVKLF+    +LNAL  +GI+VM+G 
Sbjct  23    VGLVNGIGVNWGTQLTHPLPASTIVKMLKDNGIQKVKLFDADPDILNALKKSGIQVMVGI  82

Query  354   PNALLKDLVN-YEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VT  527
             PN +L  L N  + A+ +V +NV+++   S  GV I  V VGNEPFL  Y   G F+ +T
Sbjct  83    PNDMLYTLANNMQAAEKWVSKNVSAH--VSSGGVDIRYVAVGNEPFLSTYN--GTFEAIT  138

Query  528   YPALANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVL  707
              PAL N+Q AL +AG+G  VK TVP NADVY S     VPS G FR +I D + +IV+ L
Sbjct  139   LPALQNIQSALVKAGLGNQVKVTVPLNADVYQS---TQVPSDGDFRQNIHDLMVQIVKFL  195

Query  708   DKNGAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAAL  887
              +N APF +N+YPF+SL YS   FPVD+AFF+G   P++DNG+ Y NVFDAN+DT V AL
Sbjct  196   SQNNAPFTVNIYPFISL-YSDSNFPVDYAFFNGFQSPINDNGRIYDNVFDANHDTLVWAL  254

Query  888   SREKHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMF  1067
              +   G + ++VGE+GWPTDGD  AN   A RF  GF+      KGTP+RPG  +D Y+F
Sbjct  255   QKNGFGNMPIIVGEVGWPTDGDRNANLQYAQRFNQGFMSRYIAGKGTPMRPGP-MDAYLF  313

Query  1068  GLYDEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCAL  1247
              L DED KS  PGNFE HWG+  YDGQ K+ L++   G +   +    G+ YLPKKWC L
Sbjct  314   SLIDEDFKSIQPGNFERHWGLFYYDGQPKYMLNI---GSRANGLVAATGVAYLPKKWCIL  370

Query  1248  KANAKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSC  1421
             K +A L +  +  +  YAC  ADCT +   +SC GL     +SY FN+YFQ  DQ   +C
Sbjct  371   KTSANLNSDQVAPSVSYACQNADCTSLGYQTSCGGLDARGNLSYAFNSYFQVNDQIDSAC  430

Query  1422  DFQGLGEVTTKNLSTPSCRFNIGIK  1496
              F GL  VT K+ ST  C+F I I+
Sbjct  431   KFPGLSVVTDKDPSTGDCKFKIMIQ  455



>ref|XP_009336879.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Pyrus x bretschneideri]
Length=489

 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 218/440 (50%), Positives = 282/440 (64%), Gaps = 8/440 (2%)
 Frame = +3

Query  192   LGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNALLK  371
              GVNWG +++H LPP+ VV++L+ NG+ KVKLF   + +L AL GT IEVM+  PN +L+
Sbjct  28    FGVNWGTMATHQLPPEKVVRILEDNGLDKVKLFEADERILAALTGTKIEVMLAIPNVMLQ  87

Query  372   DLVNYEVAKA-FVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFKVTYPALANM  548
             ++    VA A +V  NVTSY  +   GV I  V VGNEPFLK Y    L + T PAL N+
Sbjct  88    EMSQDPVAAATWVDANVTSYCYSG--GVVIKYVAVGNEPFLKTYNGTYL-RTTLPALKNI  144

Query  549   QKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKNGAPF  728
             Q+ALN AG+G  VKATVPFNAD+Y SP   PVPS G FR ++ D + +I++ L    APF
Sbjct  145   QEALNNAGLGSKVKATVPFNADIYFSPDSDPVPSTGDFRPEVRDSIIEIIQYLYTYEAPF  204

Query  729   MINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSREKHgk  908
              +N+YPFLSL Y    FP  FAFFDG  KP+ D    YTNVFDAN+DT V +L++    +
Sbjct  205   TVNIYPFLSL-YGNSYFPFGFAFFDGKSKPIKDGDLLYTNVFDANFDTLVWSLTKAGFPE  263

Query  909   vkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLYDEDQ  1088
             +K++VGE+GWPTDGD  AN   A RF  G I+H     GTP R G  +DVY+F L DE+ 
Sbjct  264   MKIIVGEVGWPTDGDINANIRNAKRFNQGMIQHAMSGNGTPARTG-KLDVYLFSLIDENT  322

Query  1089  KSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKANAK-L  1265
             KS  PGNFE HWGI  YDG+ K++LDLSG   + K +   E +EY+ + WC L  +AK L
Sbjct  323   KSIAPGNFERHWGIFEYDGKPKYDLDLSG-AMRNKGLAAAEDVEYMQRSWCVLDPDAKYL  381

Query  1266  TNLKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQGLGEV  1445
              NL  + DYAC  +DCT +  GSSCN L+     SY FN Y+QA  Q   +CDF GL  V
Sbjct  382   DNLAKSIDYACTLSDCTSLGYGSSCNNLTLQGNASYAFNMYYQANSQKSGTCDFSGLAVV  441

Query  1446  TTKNLSTPSCRFNIGIKLGA  1505
             T ++ S   C++ + I   A
Sbjct  442   TDEDPSVGDCKYPVMISYAA  461



>emb|CDY28246.1| BnaA01g06030D [Brassica napus]
Length=483

 Score =   405 bits (1041),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 285/442 (64%), Gaps = 16/442 (4%)
 Frame = +3

Query  183   LDGLGVNWGDISSHPLPPKAVVKMLKANGIKKVKLFNTPKPVLNALAGTGIEVMIGTPNA  362
             ++G+GVNWG  +SHPLPP  VV++L+ NGI+KVKLF     +L AL+ +GI+VM+G PN 
Sbjct  24    VEGIGVNWGSQASHPLPPATVVRLLRENGIQKVKLFEADSQILRALSRSGIQVMVGIPND  83

Query  363   LLKDLV-NYEVAKAFVKENVTSYNPTSPDGVKITLVGVGNEPFLKFYEKQGLFK-VTYPA  536
             LL  +  +  VA+ +V +NV+++   S +GV I  V VGNEPFLK +   G F+ +T PA
Sbjct  84    LLAPIAGSVAVAERWVSQNVSAH--VSSNGVDIRYVAVGNEPFLKSFN--GTFESITLPA  139

Query  537   LANMQKALNEAGIGKTVKATVPFNADVYLSPPYAPVPSAGMFRGDIADQVKKIVEVLDKN  716
             L N+Q AL +AG+   VK TVP NADVY S   + +PSAG FR +I D +  IV+ L  N
Sbjct  140   LQNIQSALIKAGLASQVKVTVPLNADVYESA--SNLPSAGDFRAEIRDLMISIVKFLSDN  197

Query  717   GAPFMINVYPFLSLFYSKDQFPVDFAFFDGVDKPLDDNGKTYTNVFDANYDTAVAALSRE  896
              APF IN+YPF+SL Y+   FPV+FAFFDG   P++DNG+ Y NV DANYDT V +L + 
Sbjct  198   QAPFTINIYPFISL-YNDPHFPVEFAFFDGTGSPINDNGRIYDNVLDANYDTLVWSLQKN  256

Query  897   KHgkvkvvvgEIGWPTDGDNFANASMAARFYNGFIKHLAGKKGTPVRPGADIDVYMFGLY  1076
               G + ++VGE+GWPTDGD  AN   A R+  GF+      +GTP+RPG  +D Y+F L 
Sbjct  257   GFGNMSIIVGEVGWPTDGDKNANMQYARRYNQGFMNRQKAGRGTPMRPGP-MDAYLFSLI  315

Query  1077  DEDQKSTLPGNFEPHWGILGYDGQTKFNLDLSGKGGKGKIMTGVEGIEYLPKKWCALKAN  1256
             DED KS  PGNFE HWGI   DGQ K+ L L    G    +   +G+ ++ KKWC L A+
Sbjct  316   DEDAKSIQPGNFERHWGIFYIDGQPKYQLSLGNANG----LVPAKGVRHMAKKWCVLAAS  371

Query  1257  AKLTN--LKANTDYACGRADCTPMSDGSSCNGLSDTEKVSYTFNAYFQAQDQAKDSCDFQ  1430
             A L +  L  +  YAC  ADCT +  GSSC  L+  + VSY FN+Y+Q  DQ   +C F 
Sbjct  372   ANLQDPQLGPSVSYACDHADCTSLGYGSSCGSLNLAQNVSYAFNSYYQVSDQLDSACKFP  431

Query  1431  GLGEVTTKNLSTPSCRFNIGIK  1496
             GL  +TT + S  SC+F I IK
Sbjct  432   GLSVITTNDPSVGSCKFKIMIK  453



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5180161682960