BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24703_g2_i1 len=2353 path=[3205:0-1172 4378:1173-1204
10438:1205-1293 4499:1294-1324 9586:1325-1461 4667:1462-1486
15504:1487-1681 4887:1682-1717 6432:1718-2352]

Length=2353
                                                                      Score     E

ref|XP_006350708.1|  PREDICTED: 2-isopropylmalate synthase B-like      1003   0.0      
ref|XP_004240995.1|  PREDICTED: 2-isopropylmalate synthase B            994   0.0      
ref|XP_009800501.1|  PREDICTED: 2-isopropylmalate synthase A            992   0.0      
ref|XP_009604558.1|  PREDICTED: 2-isopropylmalate synthase A            992   0.0      
gb|ACF17660.1|  putative isopropylmalate synthase                       991   0.0      Capsicum annuum
ref|XP_009776176.1|  PREDICTED: 2-isopropylmalate synthase B            989   0.0      
ref|XP_009602443.1|  PREDICTED: 2-isopropylmalate synthase B            985   0.0      
ref|XP_010324700.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    983   0.0      
sp|O04973.1|LEU1A_SOLPN  RecName: Full=2-isopropylmalate synthase...    982   0.0      Solanum pennellii
ref|XP_011084168.1|  PREDICTED: 2-isopropylmalate synthase A-like       972   0.0      
sp|O04974.1|LEU1B_SOLPN  RecName: Full=2-isopropylmalate synthase...    969   0.0      Solanum pennellii
gb|EYU26034.1|  hypothetical protein MIMGU_mgv1a003059mg                968   0.0      
ref|XP_011073908.1|  PREDICTED: 2-isopropylmalate synthase A-like       944   0.0      
emb|CDP16992.1|  unnamed protein product                                922   0.0      
ref|XP_002268942.2|  PREDICTED: 2-isopropylmalate synthase A-like       920   0.0      Vitis vinifera
ref|XP_006478856.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    905   0.0      
gb|KDO41314.1|  hypothetical protein CISIN_1g0069691mg                  904   0.0      
ref|XP_002530549.1|  isopropylmalate synthase, putative                 897   0.0      Ricinus communis
ref|XP_007034042.1|  2-isopropylmalate synthase 1 isoform 2             896   0.0      
gb|KHG02682.1|  2-isopropylmalate synthase 2, chloroplastic -like...    893   0.0      
gb|KDP42866.1|  hypothetical protein JCGZ_23808                         892   0.0      
ref|NP_177544.1|  2-isopropylmalate synthase 2                          889   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428367.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    888   0.0      
gb|AAW81741.1|  Putative 2-isopropylmalate synthase                     888   0.0      Brassica oleracea
ref|XP_010539993.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    887   0.0      
gb|KGN57885.1|  hypothetical protein Csa_3G363180                       887   0.0      
ref|XP_008232677.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    886   0.0      
ref|XP_010672456.1|  PREDICTED: 2-isopropylmalate synthase A-like...    886   0.0      
ref|XP_008457079.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    886   0.0      
ref|XP_010471495.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    885   0.0      
ref|XP_004165080.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    885   0.0      
ref|XP_011021916.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    884   0.0      
gb|ABA26446.1|  2-isopropylmalate synthase 1                            884   0.0      Brassica insularis
ref|XP_008232670.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    883   0.0      
ref|XP_006390475.1|  hypothetical protein EUTSA_v10018267mg             883   0.0      
ref|XP_010274930.1|  PREDICTED: 2-isopropylmalate synthase A-like       882   0.0      
ref|XP_006300309.1|  hypothetical protein CARUB_v10019832mg             882   0.0      
ref|XP_010416235.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    881   0.0      
ref|XP_006416598.1|  hypothetical protein EUTSA_v10007073mg             880   0.0      
ref|XP_010097501.1|  2-isopropylmalate synthase 2                       880   0.0      
gb|KFK44007.1|  hypothetical protein AALP_AA1G202700                    879   0.0      
ref|XP_009411766.1|  PREDICTED: 2-isopropylmalate synthase A-like       879   0.0      
ref|XP_004149446.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    878   0.0      
emb|CDY19217.1|  BnaC05g14180D                                          877   0.0      
ref|XP_007034041.1|  2-isopropylmalate synthase 1 isoform 1             877   0.0      
ref|XP_008786904.1|  PREDICTED: 2-isopropylmalate synthase A-like       876   0.0      
gb|KHF98529.1|  2-isopropylmalate synthase 2, chloroplastic -like...    875   0.0      
ref|XP_010672455.1|  PREDICTED: 2-isopropylmalate synthase A-like...    874   0.0      
ref|XP_010064504.1|  PREDICTED: 2-isopropylmalate synthase A-like       874   0.0      
ref|XP_009149293.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    873   0.0      
emb|CDY26154.1|  BnaA06g12630D                                          872   0.0      
ref|XP_004289267.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    872   0.0      
ref|NP_001066116.1|  Os12g0138900                                       872   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664321.1|  PREDICTED: 2-isopropylmalate synthase A-like       872   0.0      
gb|ABA91408.1|  2-isopropylmalate synthase B, putative, expressed       871   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663190.1|  PREDICTED: 2-isopropylmalate synthase A-like       870   0.0      
ref|XP_010477031.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    867   0.0      
ref|NP_173285.2|  2-isopropylmalate synthase                            867   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBX25286.1|  hypothetical_protein                                   867   0.0      
ref|XP_010459471.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    866   0.0      
gb|AFW64772.1|  2-isopropylmalate synthase B                            865   0.0      
ref|XP_010931990.1|  PREDICTED: 2-isopropylmalate synthase A-like       865   0.0      
ref|XP_010498246.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    864   0.0      
ref|XP_009117611.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    864   0.0      
emb|CDY21704.1|  BnaA09g44550D                                          863   0.0      
ref|NP_001146593.1|  uncharacterized protein LOC100280189               863   0.0      Zea mays [maize]
dbj|BAJ93533.1|  predicted protein                                      863   0.0      
ref|XP_002890281.1|  hypothetical protein ARALYDRAFT_472070             863   0.0      
gb|EMT05050.1|  2-isopropylmalate synthase A                            863   0.0      
emb|CDX81876.1|  BnaC08g37250D                                          862   0.0      
gb|ACB59195.1|  2-isopropylmalate synthase                              862   0.0      Brassica oleracea
ref|XP_003578949.1|  PREDICTED: 2-isopropylmalate synthase A-like       861   0.0      
gb|KHG05648.1|  2-isopropylmalate synthase 2, chloroplastic -like...    860   0.0      
gb|ACR35826.1|  unknown                                                 857   0.0      Zea mays [maize]
ref|XP_003556565.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    857   0.0      
ref|XP_009336349.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    857   0.0      
ref|XP_003592827.1|  2-isopropylmalate synthase                         855   0.0      
ref|NP_001147962.1|  LOC100281571                                       855   0.0      Zea mays [maize]
gb|KCW87847.1|  hypothetical protein EUGRSUZ_A00248                     855   0.0      
ref|XP_004978642.1|  PREDICTED: 2-isopropylmalate synthase A-like       855   0.0      
ref|XP_004977502.1|  PREDICTED: 2-isopropylmalate synthase A-like       855   0.0      
ref|XP_002448963.1|  hypothetical protein SORBIDRAFT_05g002540          854   0.0      Sorghum bicolor [broomcorn]
ref|XP_004497478.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    850   0.0      
ref|XP_010498244.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    850   0.0      
ref|XP_006858638.1|  hypothetical protein AMTR_s00066p00043610          849   0.0      
gb|ACG29264.1|  2-isopropylmalate synthase B                            847   0.0      Zea mays [maize]
ref|XP_003536802.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    845   0.0      
emb|CBX25373.1|  hypothetical_protein                                   842   0.0      
gb|AAF26002.1|AC013354_21  F15H18.3                                     844   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001146891.1|  2-isopropylmalate synthase B                       839   0.0      Zea mays [maize]
gb|ACN29300.1|  unknown                                                 838   0.0      Zea mays [maize]
ref|XP_002442681.1|  hypothetical protein SORBIDRAFT_08g001160          835   0.0      Sorghum bicolor [broomcorn]
emb|CBX24424.1|  hypothetical_protein                                   833   0.0      
gb|ABG21878.1|  2-isopropylmalate synthase B, putative, expressed       832   0.0      
ref|XP_001775199.1|  predicted protein                                  832   0.0      
ref|XP_002887519.1|  hypothetical protein ARALYDRAFT_476544             829   0.0      
ref|XP_009368425.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    825   0.0      
ref|XP_001761198.1|  predicted protein                                  821   0.0      
gb|EEC67654.1|  hypothetical protein OsI_35067                          820   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010035134.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    811   0.0      
gb|KCW87848.1|  hypothetical protein EUGRSUZ_A00249                     808   0.0      
emb|CBX25469.1|  hypothetical_protein                                   795   0.0      
gb|EMS63121.1|  2-isopropylmalate synthase A                            791   0.0      
ref|XP_002980035.1|  hypothetical protein SELMODRAFT_111991             793   0.0      
ref|XP_002992921.1|  hypothetical protein SELMODRAFT_187069             792   0.0      
gb|KCW87662.1|  hypothetical protein EUGRSUZ_A00052                     783   0.0      
gb|KHN27115.1|  2-isopropylmalate synthase 2, chloroplastic             784   0.0      
gb|KHN37280.1|  2-isopropylmalate synthase 2, chloroplastic             778   0.0      
ref|XP_010064495.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    769   0.0      
dbj|BAH20374.1|  AT1G74040                                              762   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207420.1|  hypothetical protein PRUPE_ppa004868mg             761   0.0      
ref|XP_002307122.2|  hypothetical protein POPTR_0005s08480g             760   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010546232.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    761   0.0      
dbj|BAI49592.1|  homocitrate synthase                                   739   0.0      Lotus japonicus
ref|XP_010546219.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    743   0.0      
ref|XP_005648878.1|  2-isopropylmalate synthase                         730   0.0      
ref|XP_002945733.1|  2-isopropylmalate synthase                         728   0.0      
gb|KHN34615.1|  Putative 2-isopropylmalate synthase                     717   0.0      
ref|XP_006604280.1|  PREDICTED: probable 2-isopropylmalate syntha...    716   0.0      
ref|XP_006443113.1|  hypothetical protein CICLE_v10020218mg             698   0.0      
ref|XP_003521867.1|  PREDICTED: probable 2-isopropylmalate syntha...    701   0.0      
ref|XP_003554069.1|  PREDICTED: probable 2-isopropylmalate syntha...    700   0.0      
ref|NP_001237749.1|  probable 2-isopropylmalate synthase                699   0.0      
ref|XP_006307272.1|  hypothetical protein CARUB_v10008887mg             692   0.0      
ref|XP_003538074.1|  PREDICTED: probable 2-isopropylmalate syntha...    684   0.0      
ref|XP_002508720.1|  2-isopropylmalate synthase                         672   0.0      Micromonas commoda
gb|KFM22835.1|  2-isopropylmalate synthase A                            664   0.0      
ref|XP_008392601.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    660   0.0      
ref|WP_013558760.1|  2-isopropylmalate synthase                         662   0.0      
gb|ACJ85684.1|  unknown                                                 655   0.0      Medicago truncatula
ref|XP_008342849.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    656   0.0      
gb|EPS60107.1|  hypothetical protein M569_14697                         651   0.0      
ref|XP_001415634.1|  predicted protein                                  659   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_003063010.1|  2-isopropylmalate synthase                         657   0.0      
ref|XP_005851963.1|  hypothetical protein CHLNCDRAFT_133663             650   0.0      
ref|XP_009768817.1|  PREDICTED: 2-isopropylmalate synthase A-like       661   0.0      
ref|XP_003074581.1|  Putative 2-isopropylmalate synthase (ISS)          648   0.0      
gb|KCW87846.1|  hypothetical protein EUGRSUZ_A00246                     644   0.0      
gb|KHN42168.1|  Putative 2-isopropylmalate synthase                     643   0.0      
emb|CEF96841.1|  2-isopropylmalate synthase, bacterial-type             647   0.0      
gb|KDO41316.1|  hypothetical protein CISIN_1g0069691mg                  638   0.0      
ref|XP_002178632.1|  2-isopropylmalate synthase                         645   0.0      Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002286323.1|  predicted protein                                  642   0.0      Thalassiosira pseudonana CCMP1335
ref|XP_007508841.1|  2-isopropylmalate synthase                         635   0.0      
gb|KDO41315.1|  hypothetical protein CISIN_1g0069691mg                  624   0.0      
ref|XP_009351137.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    622   0.0      
ref|WP_012236363.1|  2-isopropylmalate synthase                         611   0.0      
gb|KFK41842.1|  hypothetical protein AALP_AA2G178400                    609   0.0      
ref|XP_007142640.1|  hypothetical protein PHAVU_007G004600g             604   0.0      
ref|WP_020736424.1|  2-isopropylmalate synthase                         608   0.0      
gb|EJK57969.1|  hypothetical protein THAOC_21945                        609   0.0      
gb|KHN34617.1|  Putative 2-isopropylmalate synthase                     604   0.0      
ref|WP_026370668.1|  2-isopropylmalate synthase                         606   0.0      
ref|XP_009039595.1|  hypothetical protein AURANDRAFT_54528              604   0.0      
ref|XP_009040112.1|  hypothetical protein AURANDRAFT_38625              604   0.0      
ref|XP_010324707.1|  PREDICTED: 2-isopropylmalate synthase A-like       595   0.0      
ref|XP_006366147.1|  PREDICTED: 2-isopropylmalate synthase A-like       595   0.0      
ref|WP_014434671.1|  2-isopropylmalate synthase                         601   0.0      
ref|WP_022848903.1|  2-isopropylmalate synthase                         588   0.0      
ref|XP_006366146.1|  PREDICTED: 2-isopropylmalate synthase A-like       578   0.0      
gb|KCW44560.1|  hypothetical protein EUGRSUZ_L01927                     573   0.0      
ref|XP_004513503.1|  PREDICTED: probable 2-isopropylmalate syntha...    575   0.0      
gb|KEH22097.1|  2-isopropylmalate synthase                              574   0.0      
ref|XP_004244758.2|  PREDICTED: 2-isopropylmalate synthase A-like       573   0.0      
dbj|BAL52895.1|  2-isopropylmalate synthase                             566   0.0      
ref|XP_007034043.1|  2-isopropylmalate synthase 1 isoform 3             560   0.0      
ref|XP_010534037.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    553   0.0      
ref|WP_013324885.1|  2-isopropylmalate synthase                         558   0.0      
ref|WP_012598523.1|  2-isopropylmalate synthase                         557   0.0      
ref|WP_015147156.1|  2-isopropylmalate synthase                         556   0.0      
ref|WP_012594190.1|  MULTISPECIES: 2-isopropylmalate synthase           556   0.0      
gb|AAV25874.1|  2-isopropylmalate synthase                              549   0.0      Brassica oleracea
gb|AAR36908.1|  isopropylmalate synthase                                548   0.0      Brassica oleracea
ref|WP_017296798.1|  2-isopropylmalate synthase                         550   0.0      
ref|WP_007306993.1|  2-isopropylmalate synthase                         549   0.0      
emb|CAQ56039.1|  2-isopropylmalate synthase, A genome specific 1        547   0.0      Brassica juncea [brown mustard]
gb|ACH41738.1|  glucosinolate GS-Elong                                  546   0.0      Brassica rapa subsp. rapa
emb|CAJ55512.1|  methylthioalkylmalate synthase a                       547   0.0      Boechera divaricarpa
ref|WP_002794932.1|  2-isopropylmalate synthase                         548   0.0      
ref|WP_021829821.1|  2-isopropylmalate synthase                         548   0.0      
ref|WP_021832269.1|  2-isopropylmalate synthase                         548   0.0      
ref|XP_009130133.1|  PREDICTED: methylthioalkylmalate synthase 1,...    548   0.0      
ref|WP_002803918.1|  2-isopropylmalate synthase                         547   0.0      
dbj|GAL93306.1|  2-isopropylmalate synthase                             546   0.0      
ref|XP_006289820.1|  hypothetical protein CARUB_v10003425mg             544   0.0      
ref|WP_035985134.1|  2-isopropylmalate synthase                         545   0.0      
ref|WP_009543901.1|  MULTISPECIES: 2-isopropylmalate synthase           545   0.0      
ref|WP_008198795.1|  2-isopropylmalate synthase                         545   0.0      
sp|P94907.1|LEU1_MICAE  RecName: Full=2-isopropylmalate synthase;...    545   0.0      Microcystis aeruginosa
ref|WP_002758694.1|  2-isopropylmalate synthase                         545   0.0      
ref|WP_002746244.1|  2-isopropylmalate synthase                         544   0.0      
ref|WP_002765307.1|  2-isopropylmalate synthase                         544   0.0      
ref|XP_006367400.1|  PREDICTED: 2-isopropylmalate synthase A-like       538   0.0      
ref|WP_009556473.1|  2-isopropylmalate synthase                         544   0.0      
ref|WP_023073959.1|  2-isopropylmalate synthase                         544   0.0      
ref|WP_002783894.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_035153322.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_002736592.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_006509230.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_017293571.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_016516646.1|  2-isopropylmalate synthase                         543   0.0      
ref|XP_003541255.1|  PREDICTED: probable 2-isopropylmalate syntha...    538   0.0      
ref|WP_012267775.1|  2-isopropylmalate synthase                         543   0.0      
ref|XP_001696603.1|  isopropylmalate synthase                           539   0.0      Chlamydomonas reinhardtii
ref|WP_011956698.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_002796207.1|  2-isopropylmalate synthase                         543   0.0      
ref|WP_024544389.1|  2-isopropylmalate synthase                         543   0.0      
emb|CAJ55506.1|  methylthioalkylmalate synthase a                       541   0.0      Arabidopsis lyrata subsp. petraea
ref|WP_002773852.1|  2-isopropylmalate synthase                         542   0.0      
ref|WP_006622399.1|  MULTISPECIES: 2-isopropylmalate synthase           542   0.0      
ref|XP_006290200.1|  hypothetical protein CARUB_v10003885mg             540   0.0      
ref|WP_017714000.1|  2-isopropylmalate synthase                         542   0.0      
ref|WP_002786970.1|  2-isopropylmalate synthase                         541   0.0      
emb|CAQ56035.1|  2-isopropylmalate synthase, B genome specific 1        540   0.0      Brassica juncea [brown mustard]
ref|WP_018399927.1|  2-isopropylmalate synthase                         541   0.0      
gb|KDR56307.1|  2-isopropylmalate synthase                              541   0.0      
emb|CAJ55510.1|  methylthioalkylmalate synthase b                       540   0.0      Arabidopsis cebennensis
ref|XP_009144531.1|  PREDICTED: methylthioalkylmalate synthase 1,...    539   0.0      
ref|WP_006618368.1|  2-isopropylmalate synthase                         541   1e-180   
ref|WP_017750120.1|  2-isopropylmalate synthase                         540   1e-180   
ref|WP_008276101.1|  2-isopropylmalate synthase                         541   1e-180   
ref|XP_009137065.1|  PREDICTED: methylthioalkylmalate synthase 2,...    537   1e-180   
ref|WP_015116700.1|  2-isopropylmalate synthase                         540   1e-180   
ref|WP_024970954.1|  2-isopropylmalate synthase                         540   1e-180   
ref|WP_026797078.1|  2-isopropylmalate synthase                         540   2e-180   
gb|AGS49163.1|  methylthioalkylmalate synthase                          538   2e-180   
ref|WP_015224126.1|  2-isopropylmalate synthase                         540   2e-180   
ref|WP_002755985.1|  2-isopropylmalate synthase                         540   2e-180   
ref|XP_002872029.1|  methylthioalkylmalate synthase a                   539   2e-180   
dbj|BAP17925.1|  2-isopropylmalate synthase                             540   2e-180   
ref|WP_015202275.1|  2-isopropylmalate synthase                         540   2e-180   
ref|WP_017661774.1|  2-isopropylmalate synthase                         540   3e-180   
ref|WP_036001000.1|  2-isopropylmalate synthase                         539   4e-180   
ref|WP_015219510.1|  2-isopropylmalate synthase                         539   4e-180   
ref|XP_006394566.1|  hypothetical protein EUTSA_v10003976mg             539   6e-180   
ref|WP_026788800.1|  MULTISPECIES: 2-isopropylmalate synthase           539   6e-180   
emb|CAJ55509.1|  methylthioalkylmalate synthase a                       537   1e-179   Arabidopsis cebennensis
ref|XP_010493409.1|  PREDICTED: methylthioalkylmalate synthase 2,...    537   1e-179   
ref|WP_017323659.1|  2-isopropylmalate synthase                         538   1e-179   
ref|XP_009515886.1|  hypothetical protein PHYSODRAFT_552331             539   2e-179   
ref|XP_010421098.1|  PREDICTED: methylthioalkylmalate synthase 2,...    536   2e-179   
emb|CAJ55507.1|  methylthioalkylmalate synthase b                       536   2e-179   Arabidopsis lyrata subsp. petraea
ref|XP_010493410.1|  PREDICTED: methylthioalkylmalate synthase 3,...    536   2e-179   
ref|XP_008907606.1|  2-isopropylmalate synthase                         539   2e-179   
ref|WP_026794579.1|  MULTISPECIES: 2-isopropylmalate synthase           537   3e-179   
emb|CAQ56037.1|  2-isopropylmalate synthase, B genome specific 2        536   3e-179   Brassica juncea [brown mustard]
emb|CAC80103.1|  hypothetical protein                                   536   3e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358943.1|  PREDICTED: 2-isopropylmalate synthase A-like       535   3e-179   
ref|XP_010454580.1|  PREDICTED: methylthioalkylmalate synthase 1,...    535   3e-179   
ref|WP_006560911.1|  2-isopropylmalate synthase                         537   4e-179   
ref|WP_012120074.1|  2-isopropylmalate synthase                         537   4e-179   
gb|ADO16128.1|  alpha isopropylmalate synthase                          526   6e-179   
gb|KFK27623.1|  hypothetical protein AALP_AA8G407500                    534   7e-179   
ref|WP_015174514.1|  2-isopropylmalate synthase                         536   7e-179   
emb|CDY02195.1|  BnaA03g39720D                                          535   8e-179   
emb|CAD31201.1|  methylthioalkylmalate synthase-like protein            535   8e-179   Arabidopsis thaliana [mouse-ear cress]
ref|WP_010873307.1|  2-isopropylmalate synthase                         536   9e-179   
emb|CAD31197.1|  methylthioalkylmalate synthase-like protein            535   9e-179   Arabidopsis thaliana [mouse-ear cress]
emb|CAD31205.1|  methylthioalkylmalate synthase-like protein            535   9e-179   Arabidopsis thaliana [mouse-ear cress]
ref|WP_017304848.1|  2-isopropylmalate synthase                         536   9e-179   
ref|WP_023652298.1|  2-isopropylmalate synthase                         535   1e-178   
gb|ADO16127.1|  alpha isopropylmalate synthase                          525   1e-178   
ref|NP_197693.1|  methylthioalkylmalate synthase 3                      535   1e-178   Arabidopsis thaliana [mouse-ear cress]
ref|WP_006633076.1|  2-isopropylmalate synthase                         536   1e-178   
ref|NP_197692.1|  methylthioalkylmalate synthase 1                      534   1e-178   Arabidopsis thaliana [mouse-ear cress]
ref|WP_012306975.1|  2-isopropylmalate synthase                         535   1e-178   
emb|CAD31140.1|  methylthioalkylmalate synthase                         534   1e-178   Arabidopsis thaliana [mouse-ear cress]
emb|CAD31141.1|  methylthioalkylmalate synthase                         534   1e-178   Arabidopsis thaliana [mouse-ear cress]
emb|CAD31198.1|  methylthioalkylmalate synthase-like protein            534   2e-178   Arabidopsis thaliana [mouse-ear cress]
ref|WP_011611850.1|  2-isopropylmalate synthase                         535   2e-178   
gb|AIE73388.1|  2-isopropylmalate synthase                              535   2e-178   
ref|WP_011863123.1|  2-isopropylmalate synthase                         535   2e-178   
ref|WP_008190372.1|  2-isopropylmalate synthase                         536   2e-178   
gb|ADO16114.1|  alpha isopropylmalate synthase                          525   2e-178   
ref|XP_006289994.1|  hypothetical protein CARUB_v10003624mg             533   2e-178   
ref|XP_002872030.1|  methylthioalkylmalate synthase b                   533   2e-178   
gb|ADO16122.1|  alpha isopropylmalate synthase                          525   2e-178   
ref|WP_011057237.1|  2-isopropylmalate synthase                         535   2e-178   
gb|ADO16125.1|  alpha isopropylmalate synthase                          524   3e-178   
gb|ADO16129.1|  alpha isopropylmalate synthase                          524   3e-178   
gb|ADO16117.1|  alpha isopropylmalate synthase                          524   3e-178   
ref|WP_010936558.1|  2-isopropylmalate synthase                         533   5e-178   
ref|XP_002906784.1|  2-isopropylmalate synthase                         535   5e-178   
ref|XP_006289473.1|  hypothetical protein CARUB_v10003002mg             532   6e-178   
ref|WP_009787534.1|  2-isopropylmalate synthase                         533   7e-178   
gb|ADO16115.1|  alpha isopropylmalate synthase                          523   7e-178   
ref|XP_006394567.1|  hypothetical protein EUTSA_v10004072mg             532   7e-178   
ref|WP_024124257.1|  2-isopropylmalate synthase LeuA                    533   7e-178   
gb|ADO16130.1|  alpha isopropylmalate synthase                          523   7e-178   
ref|WP_012191970.1|  2-isopropylmalate synthase                         534   8e-178   
ref|WP_012882024.1|  2-isopropylmalate synthase                         532   1e-177   
ref|WP_015738274.1|  2-isopropylmalate synthase                         532   1e-177   
gb|ADO16119.1|  alpha isopropylmalate synthase                          523   1e-177   
ref|XP_009128497.1|  PREDICTED: methylthioalkylmalate synthase 1,...    531   2e-177   
ref|XP_005704188.1|  2-isopropylmalate synthase                         537   2e-177   
ref|WP_008312613.1|  2-isopropylmalate synthase                         533   2e-177   
ref|WP_015191686.1|  2-isopropylmalate synthase                         532   2e-177   
ref|XP_010421099.1|  PREDICTED: methylthioalkylmalate synthase 3,...    531   2e-177   
ref|WP_016868266.1|  2-isopropylmalate synthase                         532   2e-177   
gb|ADO16120.1|  alpha isopropylmalate synthase                          522   2e-177   
gb|ADO16116.1|  alpha isopropylmalate synthase                          522   3e-177   
ref|WP_006101349.1|  2-isopropylmalate synthase                         532   3e-177   
gb|ADO16132.1|  alpha isopropylmalate synthase                          521   3e-177   
gb|AAG52883.1|AF327648_1  2-isopropylmalate synthase                    530   4e-177   
ref|WP_039728505.1|  2-isopropylmalate synthase                         532   4e-177   
ref|WP_015172715.1|  2-isopropylmalate synthase                         532   4e-177   
emb|CCA14652.1|  unnamed protein product                                534   5e-177   
ref|WP_037220324.1|  2-isopropylmalate synthase                         531   6e-177   
ref|XP_008346777.1|  PREDICTED: 2-isopropylmalate synthase A-like       529   6e-177   
emb|CAJ55513.1|  methylthioalkylmalate synthase b                       530   7e-177   
gb|AII57910.1|  2-isopropylmalate synthase                              530   7e-177   
gb|ADO16121.1|  alpha isopropylmalate synthase                          521   8e-177   
gb|ADO16118.1|  alpha isopropylmalate synthase                          520   9e-177   
emb|CDN13429.1|  2-isopropylmalate synthase                             530   1e-176   
gb|ADO16126.1|  alpha isopropylmalate synthase                          520   1e-176   
gb|ADO16131.1|  alpha isopropylmalate synthase                          520   1e-176   
ref|WP_016860676.1|  2-isopropylmalate synthase                         530   1e-176   
ref|WP_038653566.1|  2-isopropylmalate synthase                         530   1e-176   
ref|WP_009454099.1|  MULTISPECIES: 2-isopropylmalate synthase           529   3e-176   
emb|CAD18966.1|  2-isopropylmalate synthase                             528   3e-176   
ref|WP_007353498.1|  MULTISPECIES: 2-isopropylmalate synthase           530   3e-176   
ref|WP_015163372.1|  2-isopropylmalate synthase                         530   4e-176   
emb|CCI41999.1|  unnamed protein product                                531   4e-176   
emb|CAD31151.1|  methylthioalkylmalate synthase                         528   4e-176   
ref|XP_005715553.1|  2-isopropylmalate synthase                         530   4e-176   
ref|WP_011309308.1|  2-isopropylmalate synthase                         528   5e-176   
ref|WP_011431034.1|  2-isopropylmalate synthase                         529   5e-176   
emb|CAD31150.1|  methylthioalkylmalate synthase                         528   5e-176   
ref|XP_010454581.1|  PREDICTED: methylthioalkylmalate synthase 3,...    527   5e-176   
ref|WP_015143878.1|  2-isopropylmalate synthase                         528   6e-176   
ref|WP_015229714.1|  2-isopropylmalate synthase                         528   6e-176   
ref|WP_026731425.1|  2-isopropylmalate synthase                         528   7e-176   
gb|ADO16123.1|  alpha isopropylmalate synthase                          518   8e-176   
ref|WP_036920316.1|  2-isopropylmalate synthase                         528   8e-176   
ref|XP_010454582.1|  PREDICTED: methylthioalkylmalate synthase 3,...    527   1e-175   
ref|WP_036530787.1|  2-isopropylmalate synthase                         528   1e-175   
ref|WP_017311976.1|  2-isopropylmalate synthase                         527   2e-175   
emb|CDY51627.1|  BnaCnng21190D                                          526   2e-175   
ref|WP_015114632.1|  2-isopropylmalate synthase                         527   2e-175   
ref|WP_006518723.1|  2-isopropylmalate synthase                         527   2e-175   
ref|WP_015160320.1|  2-isopropylmalate synthase, bacterial type         527   2e-175   
ref|WP_012625838.1|  2-isopropylmalate synthase                         527   3e-175   
ref|WP_015199746.1|  2-isopropylmalate synthase                         526   3e-175   
ref|WP_011318900.1|  2-isopropylmalate synthase                         526   3e-175   
ref|WP_010998968.1|  2-isopropylmalate synthase                         526   4e-175   
ref|WP_015137916.1|  2-isopropylmalate synthase                         526   4e-175   
emb|CAD31157.1|  methylthioalkylmalate synthase                         525   5e-175   
gb|EDX84870.1|  2-isopropylmalate synthase                              527   5e-175   
ref|WP_036906618.1|  2-isopropylmalate synthase                         526   6e-175   
sp|Q8VX04.1|MAM2_ARATH  RecName: Full=Methylthioalkylmalate synth...    525   6e-175   
ref|XP_010421100.1|  PREDICTED: methylthioalkylmalate synthase 3,...    525   6e-175   
emb|CAJ55514.1|  methylthioalkylmalate synthase c                       523   1e-174   
ref|WP_038018887.1|  2-isopropylmalate synthase                         525   1e-174   
ref|WP_031460254.1|  2-isopropylmalate synthase                         526   1e-174   
ref|WP_015227231.1|  2-isopropylmalate synthase                         525   2e-174   
ref|WP_011294775.1|  2-isopropylmalate synthase                         525   2e-174   
ref|XP_006394565.1|  hypothetical protein EUTSA_v10003976mg             523   2e-174   
gb|KDD73024.1|  HMGL-like protein                                       521   2e-174   
ref|XP_010472038.1|  PREDICTED: methylthioalkylmalate synthase 3,...    522   2e-174   
ref|WP_011824098.1|  2-isopropylmalate synthase                         525   2e-174   
ref|WP_012616515.1|  2-isopropylmalate synthase                         525   3e-174   
ref|WP_016876245.1|  2-isopropylmalate synthase                         524   4e-174   
ref|WP_026723592.1|  2-isopropylmalate synthase                         524   4e-174   
ref|WP_038074986.1|  2-isopropylmalate synthase                         524   4e-174   
ref|WP_027843027.1|  2-isopropylmalate synthase                         524   5e-174   
ref|WP_038296223.1|  2-isopropylmalate synthase [                       523   5e-174   
emb|CAJ55508.1|  methylthioalkylmalate synthase c                       522   5e-174   
ref|WP_038027097.1|  2-isopropylmalate synthase                         524   5e-174   
ref|WP_025906611.1|  MULTISPECIES: 2-isopropylmalate synthase           524   5e-174   
ref|WP_015135498.1|  2-isopropylmalate synthase                         523   5e-174   
ref|WP_032515048.1|  2-isopropylmalate synthase                         523   7e-174   
ref|WP_036917966.1|  MULTISPECIES: 2-isopropylmalate synthase           523   7e-174   
emb|CAQ56043.1|  2-isopropylmalate synthase, A genome specific 4        520   8e-174   
ref|WP_012407682.1|  2-isopropylmalate synthase                         523   8e-174   
ref|WP_019491763.1|  2-isopropylmalate synthase                         523   9e-174   
ref|WP_015128970.1|  2-isopropylmalate synthase                         523   1e-173   
emb|CAQ56042.1|  2-isopropylmalate synthase, A genome specific 4        520   1e-173   
ref|WP_012256076.1|  MULTISPECIES: 2-isopropylmalate synthase           524   1e-173   
emb|CDY43640.1|  BnaA04g20510D                                          520   1e-173   
ref|WP_012007891.1|  2-isopropylmalate synthase                         523   1e-173   
ref|WP_028459375.1|  2-isopropylmalate synthase                         523   2e-173   
ref|WP_025952902.1|  2-isopropylmalate synthase                         522   3e-173   
ref|WP_025942957.1|  MULTISPECIES: 2-isopropylmalate synthase           522   3e-173   
ref|WP_025979794.1|  2-isopropylmalate synthase                         522   3e-173   
ref|WP_006528662.1|  2-isopropylmalate synthase                         521   3e-173   
ref|WP_025964335.1|  2-isopropylmalate synthase                         522   3e-173   
ref|WP_025961265.1|  2-isopropylmalate synthase                         522   3e-173   
ref|WP_006278854.1|  2-isopropylmalate synthase                         521   3e-173   
ref|WP_025888605.1|  MULTISPECIES: 2-isopropylmalate synthase           522   4e-173   
ref|WP_022608838.1|  2-isopropylmalate synthase, bacterial type         521   4e-173   
gb|KFK27841.1|  hypothetical protein AALP_AA8G436800                    519   4e-173   
ref|WP_025959797.1|  2-isopropylmalate synthase                         521   5e-173   
ref|WP_009626407.1|  2-isopropylmalate synthase                         521   5e-173   
ref|WP_032525700.1|  2-isopropylmalate synthase                         521   6e-173   
ref|WP_032519091.1|  2-isopropylmalate synthase                         521   7e-173   
ref|WP_011818602.1|  2-isopropylmalate synthase                         521   8e-173   
ref|WP_032514184.1|  2-isopropylmalate synthase                         521   8e-173   
ref|WP_025945235.1|  MULTISPECIES: 2-isopropylmalate synthase           521   9e-173   
ref|WP_011132699.1|  2-isopropylmalate synthase                         521   9e-173   
ref|WP_010473417.1|  2-isopropylmalate synthase                         521   1e-172   
ref|WP_025980981.1|  2-isopropylmalate synthase                         521   1e-172   
ref|XP_010416806.1|  PREDICTED: methylthioalkylmalate synthase 3,...    518   1e-172   
ref|WP_025881676.1|  MULTISPECIES: 2-isopropylmalate synthase           520   1e-172   
ref|WP_025923337.1|  2-isopropylmalate synthase                         520   1e-172   
ref|WP_017286267.1|  2-isopropylmalate synthase                         520   1e-172   
ref|XP_008881007.1|  2-isopropylmalate synthase                         522   1e-172   
ref|WP_002808360.1|  2-isopropylmalate synthase                         520   1e-172   
ref|WP_025925376.1|  MULTISPECIES: 2-isopropylmalate synthase           520   1e-172   
ref|WP_011376627.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_025933674.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_025932038.1|  2-isopropylmalate synthase                         520   2e-172   
gb|AFK79173.1|  2-isopropylmalate synthase                              519   2e-172   
ref|WP_023069584.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_015185786.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_032524611.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_025893380.1|  MULTISPECIES: 2-isopropylmalate synthase           520   2e-172   
ref|WP_025958418.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_011125286.1|  MULTISPECIES: 2-isopropylmalate synthase           520   2e-172   
ref|WP_006910464.1|  2-isopropylmalate synthase                         520   2e-172   
ref|WP_025954704.1|  2-isopropylmalate synthase                         520   3e-172   
ref|WP_025924598.1|  2-isopropylmalate synthase                         520   3e-172   
ref|XP_010428949.1|  PREDICTED: methylthioalkylmalate synthase 3,...    516   3e-172   
ref|WP_025928497.1|  2-isopropylmalate synthase                         520   3e-172   
ref|WP_025894669.1|  MULTISPECIES: 2-isopropylmalate synthase           520   3e-172   
emb|CAA87005.1|  alpha-isopropylmalate synthase                         519   3e-172   
ref|WP_025969887.1|  MULTISPECIES: 2-isopropylmalate synthase           520   3e-172   
ref|WP_025963775.1|  2-isopropylmalate synthase                         520   3e-172   
ref|WP_011393738.1|  2-isopropylmalate synthase                         518   4e-172   
ref|WP_011433057.1|  2-isopropylmalate synthase                         519   4e-172   
ref|WP_025939136.1|  2-isopropylmalate synthase                         519   4e-172   
ref|WP_025900661.1|  MULTISPECIES: 2-isopropylmalate synthase           519   4e-172   
ref|WP_006196799.1|  2-isopropylmalate synthase                         518   5e-172   
emb|CAJ55517.1|  methylthioalkylmalate synthase c                       517   5e-172   
ref|WP_015205803.1|  2-isopropylmalate synthase                         518   5e-172   
ref|WP_025956776.1|  2-isopropylmalate synthase                         519   5e-172   
gb|AIQ95218.1|  2-isopropylmalate synthase                              519   6e-172   
ref|XP_009830853.1|  2-isopropylmalate synthase                         520   7e-172   
ref|WP_009342763.1|  2-isopropylmalate synthase                         518   7e-172   
ref|WP_036946315.1|  2-isopropylmalate synthase                         517   9e-172   
ref|WP_025940727.1|  2-isopropylmalate synthase                         518   1e-171   
ref|WP_017315896.1|  2-isopropylmalate synthase                         518   1e-171   
ref|WP_028089828.1|  2-isopropylmalate synthase                         517   1e-171   
ref|WP_008235779.1|  2-isopropylmalate synthase                         517   2e-171   
ref|WP_025973354.1|  2-isopropylmalate synthase                         518   2e-171   
ref|XP_002872031.1|  methylthioalkylmalate synthase c                   516   2e-171   
ref|XP_010493411.1|  PREDICTED: methylthioalkylmalate synthase 3,...    516   2e-171   
gb|KFK27840.1|  hypothetical protein AALP_AA8G436700                    516   2e-171   
ref|WP_012161337.1|  2-isopropylmalate synthase                         517   2e-171   
gb|AGS49164.2|  methylthioalkylmalate synthase                          512   2e-171   
ref|WP_027402275.1|  2-isopropylmalate synthase                         516   2e-171   
ref|WP_025748724.1|  2-isopropylmalate synthase                         516   3e-171   
ref|WP_032516706.1|  2-isopropylmalate synthase                         517   3e-171   
ref|WP_039200304.1|  2-isopropylmalate synthase                         516   3e-171   
ref|WP_028084518.1|  2-isopropylmalate synthase                         516   3e-171   
emb|CAJ55511.1|  methylthioalkylmalate synthase c                       515   4e-171   
ref|XP_007140775.1|  hypothetical protein PHAVU_008G140900g             510   4e-171   
ref|WP_015079696.1|  2-isopropylmalate synthase                         516   5e-171   
ref|WP_025968117.1|  2-isopropylmalate synthase                         516   7e-171   
ref|WP_007098257.1|  2-isopropylmalate synthase                         516   7e-171   
ref|WP_011820463.1|  2-isopropylmalate synthase                         516   7e-171   
ref|WP_025955862.1|  2-isopropylmalate synthase                         516   8e-171   
ref|WP_025935950.1|  2-isopropylmalate synthase                         516   8e-171   
ref|WP_013782329.1|  2-isopropylmalate synthase                         514   1e-170   
ref|WP_011142287.1|  2-isopropylmalate synthase                         515   1e-170   
ref|WP_038543869.1|  2-isopropylmalate synthase                         514   2e-170   
ref|WP_025930492.1|  2-isopropylmalate synthase                         514   2e-170   
ref|WP_013218122.1|  2-isopropylmalate synthase                         513   2e-170   
ref|WP_016951502.1|  2-isopropylmalate synthase                         513   3e-170   
ref|WP_009790250.1|  2-isopropylmalate synthase                         514   4e-170   
ref|WP_008410938.1|  2-isopropylmalate synthase                         513   4e-170   
ref|WP_029983484.1|  2-isopropylmalate synthase                         514   4e-170   
ref|WP_015217059.1|  2-isopropylmalate synthase                         513   4e-170   
ref|WP_011935163.1|  2-isopropylmalate synthase                         513   5e-170   
ref|WP_011876672.1|  2-isopropylmalate synthase                         511   1e-169   
gb|AII45788.1|  2-isopropylmalate synthase                              513   1e-169   
ref|WP_025926651.1|  2-isopropylmalate synthase                         510   1e-169   
ref|WP_039737559.1|  2-isopropylmalate synthase                         512   1e-169   
ref|WP_028951563.1|  2-isopropylmalate synthase                         513   1e-169   
ref|WP_025778890.1|  2-isopropylmalate synthase                         511   2e-169   
ref|WP_023174923.1|  2-isopropylmalate synthase                         512   2e-169   
ref|WP_006041761.1|  2-isopropylmalate synthase                         512   2e-169   
ref|WP_018205329.1|  MULTISPECIES: hypothetical protein                 510   3e-169   
ref|WP_034108196.1|  2-isopropylmalate synthase                         510   3e-169   
ref|WP_013565527.1|  2-isopropylmalate synthase                         510   5e-169   
ref|WP_011933489.1|  2-isopropylmalate synthase                         511   6e-169   
ref|WP_027363979.1|  2-isopropylmalate synthase                         509   7e-169   
ref|WP_013840433.1|  2-isopropylmalate synthase                         509   8e-169   
ref|WP_006524016.1|  2-isopropylmalate synthase                         509   1e-168   
ref|WP_013192687.1|  2-isopropylmalate synthase                         509   1e-168   
ref|XP_009136399.1|  PREDICTED: methylthioalkylmalate synthase 1,...    508   1e-168   
ref|WP_013119272.1|  2-isopropylmalate synthase                         509   2e-168   
ref|WP_019507644.1|  2-isopropylmalate synthase                         509   2e-168   
ref|WP_011364889.1|  2-isopropylmalate synthase                         509   2e-168   
ref|WP_011196809.1|  2-isopropylmalate synthase                         509   2e-168   
ref|WP_015187314.1|  2-isopropylmalate synthase                         509   2e-168   
ref|WP_032522624.1|  2-isopropylmalate synthase                         509   2e-168   
ref|WP_003544154.1|  MULTISPECIES: 2-isopropylmalate synthase           508   2e-168   
ref|WP_006421503.1|  2-isopropylmalate synthase                         508   3e-168   
ref|WP_029716816.1|  2-isopropylmalate synthase                         507   4e-168   
ref|WP_034416693.1|  2-isopropylmalate synthase                         508   4e-168   



>ref|XP_006350708.1| PREDICTED: 2-isopropylmalate synthase B-like [Solanum tuberosum]
Length=612

 Score =  1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/588 (83%), Positives = 532/588 (90%), Gaps = 7/588 (1%)
 Frame = +1

Query  166   QLRFSISGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQS  345
             Q  F+   ++ + S  SFS   VRC      RRPEY PN I DPNYVRIFDTTLRDGEQS
Sbjct  28    QTLFNFKPSNPKHSNSSFSIPIVRCSIR---RRPEYTPNHIPDPNYVRIFDTTLRDGEQS  84

Query  346   PGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVI  519
             PGATMTTKEKL VARQLA+LGVDIIEAGFPASSEADLEAV+LIA+EVG G  E  HVPVI
Sbjct  85    PGATMTTKEKLDVARQLAKLGVDIIEAGFPASSEADLEAVKLIAKEVGNGVYEEGHVPVI  144

Query  520   CGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYAR  699
             CGLARCNK+DIDKAWEAVK+AKKPRIHTFIATSEIHMNYKLKMSR QVVEKA SMVAYAR
Sbjct  145   CGLARCNKKDIDKAWEAVKYAKKPRIHTFIATSEIHMNYKLKMSRVQVVEKARSMVAYAR  204

Query  700   SLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKA  879
             S+GC DVEFSPEDAGRSD EFLY ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA IKA
Sbjct  205   SIGCEDVEFSPEDAGRSDPEFLYHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIAKIKA  264

Query  880   NTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  1059
             NTPG+E+VIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK
Sbjct  265   NTPGVEDVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  324

Query  1060  CRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKH  1239
             CRGEQVLGGLYTGINTQ I+M+SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQDGMLKH
Sbjct  325   CRGEQVLGGLYTGINTQHILMSSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKH  384

Query  1240  KDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVA  1419
             KDTYEIISPEDIGL RAN+SGIVLGKLSGRHALQAKMLELGYEIEGKEL+DLFWRFKSVA
Sbjct  385   KDTYEIISPEDIGLNRANKSGIVLGKLSGRHALQAKMLELGYEIEGKELDDLFWRFKSVA  444

Query  1420  ERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSV  1599
             E+KKK+TDDDLIAL+SDEVFQPQ  W+L +VQVTCGSLGLSTATVKLIDADG+EH++CSV
Sbjct  445   EKKKKITDDDLIALMSDEVFQPQFVWQLQNVQVTCGSLGLSTATVKLIDADGQEHISCSV  504

Query  1600  GTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGS  1773
             GTGPVDAAYKAVDL+ KVPVTLLEYSMNAVT+GIDAIASTRVLIR +    S H  TG +
Sbjct  505   GTGPVDAAYKAVDLIVKVPVTLLEYSMNAVTQGIDAIASTRVLIRGENGHTSTHALTGET  564

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
              +R+F+GTGA MD+VISSVRAYVGALNK++ F+ L+++ NK +G+ VI
Sbjct  565   VHRTFSGTGADMDIVISSVRAYVGALNKMMSFRKLLAKNNKPEGSAVI  612



>ref|XP_004240995.1| PREDICTED: 2-isopropylmalate synthase B [Solanum lycopersicum]
Length=612

 Score =   994 bits (2571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/588 (82%), Positives = 529/588 (90%), Gaps = 7/588 (1%)
 Frame = +1

Query  166   QLRFSISGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQS  345
             Q  F+   +  + S  SFS   VRC      RRPEY P+ I DPNYVRIFDTTLRDGEQS
Sbjct  28    QTLFNFKPSISKHSNSSFSIPVVRCSIR---RRPEYTPSHIPDPNYVRIFDTTLRDGEQS  84

Query  346   PGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVI  519
             PGATMTTKEKL VARQLA+LGVDIIEAGFPASSEADLEAV+LIA+EVG G  E  +VPVI
Sbjct  85    PGATMTTKEKLDVARQLAKLGVDIIEAGFPASSEADLEAVKLIAKEVGNGVYEEGYVPVI  144

Query  520   CGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYAR  699
             CGLARCNK+DIDKAWEAVK+AKKPRIHTFIATSEIHMNYKLKMSR+QVVEKA SMVAYAR
Sbjct  145   CGLARCNKKDIDKAWEAVKYAKKPRIHTFIATSEIHMNYKLKMSRDQVVEKARSMVAYAR  204

Query  700   SLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKA  879
             S+GC DVEFSPEDAGRSD EFLY ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA IKA
Sbjct  205   SIGCEDVEFSPEDAGRSDPEFLYHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIAKIKA  264

Query  880   NTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  1059
             NTPG+E+VIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK
Sbjct  265   NTPGVEDVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  324

Query  1060  CRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKH  1239
             CRGEQVLGGLYTGINTQ I+M+SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQDGMLKH
Sbjct  325   CRGEQVLGGLYTGINTQHILMSSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKH  384

Query  1240  KDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVA  1419
             KDTYEIISPEDIGL RANESGIVLGKLSGRHALQAKMLELGYEIEGKEL+DLFWRFKSVA
Sbjct  385   KDTYEIISPEDIGLNRANESGIVLGKLSGRHALQAKMLELGYEIEGKELDDLFWRFKSVA  444

Query  1420  ERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSV  1599
             E+KKK+TDDDL+AL+SDEVFQPQ  W+L +VQVT GSLGLSTATVKLIDADG EH++CSV
Sbjct  445   EKKKKITDDDLVALMSDEVFQPQFVWQLQNVQVTSGSLGLSTATVKLIDADGREHISCSV  504

Query  1600  GTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGS  1773
             GTGPVDAAYKAVDL+ KVPVTLLEYSMNAVT+GIDAIASTRVLIR +    S H  TG +
Sbjct  505   GTGPVDAAYKAVDLIVKVPVTLLEYSMNAVTQGIDAIASTRVLIRGENGHTSTHAVTGET  564

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
              +R+F+GTGA MD+VISSVRAYVGALNK++ F+ L+++ NK + + V+
Sbjct  565   IHRTFSGTGADMDIVISSVRAYVGALNKMMSFRKLMAKNNKPESSAVV  612



>ref|XP_009800501.1| PREDICTED: 2-isopropylmalate synthase A [Nicotiana sylvestris]
Length=608

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/604 (80%), Positives = 534/604 (88%), Gaps = 18/604 (3%)
 Frame = +1

Query  148   ATSFSKQLRFSISGASRRPSFQSFSA--AAVRCESSPP--------ARRPEYIPNRILDP  297
             AT+ S  + F     S+ P F +      +++  S  P         +RPEYIP++I + 
Sbjct  9     ATTLSSNISFQ----SKNPLFHTIFTFFPSIKTHSYSPYTVIRCSIQKRPEYIPSKISNH  64

Query  298   NYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIA  477
              YVRIFDTTLRDGEQSPGATMTTKEKL VARQLA+LGVDIIEAGFPASSEAD EAVRLIA
Sbjct  65    KYVRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPASSEADFEAVRLIA  124

Query  478   EEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMS  651
             EE+G    +GD+VPVICGL+RCNKRDIDKAWEAVK AK+PR+HTFIATSEIHM YKLKMS
Sbjct  125   EEIGNNNSDGDYVPVICGLSRCNKRDIDKAWEAVKCAKRPRVHTFIATSEIHMKYKLKMS  184

Query  652   REQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVG  831
             +E+VVEKA SMVAYARSLGC DVEFSPEDAGRS+REFLY ILGEVIKAGATTLNIPDTVG
Sbjct  185   KEEVVEKARSMVAYARSLGCEDVEFSPEDAGRSEREFLYHILGEVIKAGATTLNIPDTVG  244

Query  832   YTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIG  1011
             YT+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ+EVTINGIG
Sbjct  245   YTVPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQVEVTINGIG  304

Query  1012  ERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGAN  1191
             ERAGNASLEEVVMALKCRGE+VLGGLYTGINTQ II  SKMVEEYTGL VQPHKAIVGAN
Sbjct  305   ERAGNASLEEVVMALKCRGEKVLGGLYTGINTQHIIPTSKMVEEYTGLQVQPHKAIVGAN  364

Query  1192  AFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEI  1371
             AFAHESGIHQDGMLKHKDTYEIISPEDIGL RANE+GIVLGKLSGRHAL++KMLELGY+I
Sbjct  365   AFAHESGIHQDGMLKHKDTYEIISPEDIGLSRANEAGIVLGKLSGRHALKSKMLELGYDI  424

Query  1372  EGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTAT  1551
             EGKELEDLFWRFKSVAE+KKK+TDDD+IAL+SDEVFQPQV W+L DVQ+ CGSLGLSTAT
Sbjct  425   EGKELEDLFWRFKSVAEKKKKITDDDIIALMSDEVFQPQVVWQLADVQIACGSLGLSTAT  484

Query  1552  VKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLI  1731
             VKLID+DG+EHVACSVGTGPVDAAYKAVDL+ KVP+TLLEYSMNAVTEGIDAIASTRVLI
Sbjct  485   VKLIDSDGQEHVACSVGTGPVDAAYKAVDLIVKVPITLLEYSMNAVTEGIDAIASTRVLI  544

Query  1732  R--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQG  1905
             R  +D A  +GS G + +R F+GTGA MDVVISSVRAY+GALNK+L F  LVSRY K +G
Sbjct  545   RGEDDHAITNGSIGPTHHRIFSGTGADMDVVISSVRAYIGALNKMLSFGKLVSRYKKPEG  604

Query  1906  TVVI  1917
             +VV+
Sbjct  605   SVVV  608



>ref|XP_009604558.1| PREDICTED: 2-isopropylmalate synthase A [Nicotiana tomentosiformis]
Length=607

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/570 (84%), Positives = 524/570 (92%), Gaps = 6/570 (1%)
 Frame = +1

Query  217   FSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQL  396
             F    +RC      +RPEYIP++I D  YVRIFDTTLRDGEQSPGATMTTKEKL VAR+L
Sbjct  41    FPYTVIRCSIQ---KRPEYIPSKISDHKYVRIFDTTLRDGEQSPGATMTTKEKLDVARKL  97

Query  397   ARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG-EGDHVPVICGLARCNKRDIDKAWEAV  573
             A+LGVDIIEAGFPASSEAD EAVRLIAEE+G   +GD+VPVICGLARCNKRDIDKAWEAV
Sbjct  98    AKLGVDIIEAGFPASSEADFEAVRLIAEEIGNNSDGDYVPVICGLARCNKRDIDKAWEAV  157

Query  574   KHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSD  753
             K AK+PR+HTFIATSEIHM YKLKMS+E+VVEKA SMVAYARSLGC DVEFSPEDAGRS+
Sbjct  158   KCAKRPRVHTFIATSEIHMKYKLKMSKEEVVEKARSMVAYARSLGCEDVEFSPEDAGRSE  217

Query  754   REFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDL  933
             REFLY ILGEVIKAGATTLNIPDTVGYT+P EFGQLIADIKANTPGIENVIISTHCQNDL
Sbjct  218   REFLYHILGEVIKAGATTLNIPDTVGYTVPTEFGQLIADIKANTPGIENVIISTHCQNDL  277

Query  934   GLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQ  1113
             GLSTANTLAGACAGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIN+Q 
Sbjct  278   GLSTANTLAGACAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINSQH  337

Query  1114  IIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRAN  1293
             I+  SKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGL RAN
Sbjct  338   IVPTSKMVEEYTGLQVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRAN  397

Query  1294  ESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDE  1473
             E+GIVLGKLSGRHAL++KMLELGY+IEGKELED+FWRFKSVAE+KKK+TDDD+IAL+SDE
Sbjct  398   EAGIVLGKLSGRHALKSKMLELGYDIEGKELEDIFWRFKSVAEKKKKITDDDIIALMSDE  457

Query  1474  VFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKV  1653
             +FQPQV W+L DVQ+TCGSLGLSTATVKLID+DG++HVACSVGTGPVDAAYKAVDL+ KV
Sbjct  458   IFQPQVVWQLADVQITCGSLGLSTATVKLIDSDGQDHVACSVGTGPVDAAYKAVDLIVKV  517

Query  1654  PVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISS  1827
             P+TLLEYSMNAVTEGIDAIASTRVLIR  +D A  +GS G + +R+F+GTGA MDVVISS
Sbjct  518   PITLLEYSMNAVTEGIDAIASTRVLIRGEDDHAITNGSIGPTLHRTFSGTGADMDVVISS  577

Query  1828  VRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
             VRAY+GALNK+L F  LVSRY K +G+VV+
Sbjct  578   VRAYIGALNKMLSFGKLVSRYKKPEGSVVV  607



>gb|ACF17660.1| putative isopropylmalate synthase [Capsicum annuum]
Length=602

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/579 (83%), Positives = 527/579 (91%), Gaps = 9/579 (2%)
 Frame = +1

Query  199   RPSF--QSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKE  372
             +PS    SFS   VRC       RPEY P+ I DPNY+RIFDTTLRDGEQSPGATMTTKE
Sbjct  27    KPSIPTHSFSIPIVRCSIRC---RPEYTPSHISDPNYIRIFDTTLRDGEQSPGATMTTKE  83

Query  373   KLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKR  546
             KL VARQLA+LGVDIIEAGFPASSEADLEAV+LIA+EVG G  E  HVPVICGLARCNKR
Sbjct  84    KLDVARQLAKLGVDIIEAGFPASSEADLEAVKLIAKEVGNGVYEEGHVPVICGLARCNKR  143

Query  547   DIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEF  726
             DIDKAWEAVK+AKKPRIHTFIATSEIHM +KLKMSR++V+EKA SMVAYARS+GC DVEF
Sbjct  144   DIDKAWEAVKYAKKPRIHTFIATSEIHMKFKLKMSRDEVIEKARSMVAYARSIGCQDVEF  203

Query  727   SPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVI  906
             SPEDAGRSD EFLY ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA+IKANTPG+E+VI
Sbjct  204   SPEDAGRSDPEFLYHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIANIKANTPGVEDVI  263

Query  907   ISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG  1086
             ISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG
Sbjct  264   ISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG  323

Query  1087  LYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISP  1266
             LYTGINTQ I+M+SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SP
Sbjct  324   LYTGINTQHILMSSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSP  383

Query  1267  EDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDD  1446
             EDIGL RANESGIVLGKLSGRHALQAKMLELGYEIEGKEL+DLFWRFKSVAE+KKK+TDD
Sbjct  384   EDIGLNRANESGIVLGKLSGRHALQAKMLELGYEIEGKELDDLFWRFKSVAEKKKKITDD  443

Query  1447  DLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAY  1626
             DLIAL+SDEVFQPQ  W+L +VQVTCGSLGLSTATVKLIDADG+EH++CSVGTGPVDAAY
Sbjct  444   DLIALMSDEVFQPQFVWQLQNVQVTCGSLGLSTATVKLIDADGKEHISCSVGTGPVDAAY  503

Query  1627  KAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGSANRSFNGTG  1800
             KAVDL+ K+PVTLLEYSMNAVT+GIDAIASTRVLIR +    S H  TG + +R+F+GTG
Sbjct  504   KAVDLIVKIPVTLLEYSMNAVTQGIDAIASTRVLIRGENGHTSTHALTGETVHRTFSGTG  563

Query  1801  AAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
             A MD+VISSVRAY+GALNK++ F+ L+++  K +G+ VI
Sbjct  564   ADMDIVISSVRAYIGALNKMMSFRKLLAKNTKAEGSAVI  602



>ref|XP_009776176.1| PREDICTED: 2-isopropylmalate synthase B [Nicotiana sylvestris]
Length=606

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/606 (81%), Positives = 538/606 (89%), Gaps = 18/606 (3%)
 Frame = +1

Query  142   TIATSFSKQLRFSISGASRRPSFQS-----FSAAAVRCESSPPA-----RRPEYIPNRIL  291
             TI  SFS+    +IS   + P  Q+     F  +  +C  SP       RRPEY P+ I 
Sbjct  5     TINHSFSRNP--NISFHPQNPLIQTQALFNFKPSISKC--SPIIHCAIRRRPEYTPSHIP  60

Query  292   DPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRL  471
             DPNY+RIFDTTLRDGEQSPGATMTTKEKL VARQLA+LGVDIIEAGFPASSEADLEAV+L
Sbjct  61    DPNYIRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPASSEADLEAVKL  120

Query  472   IAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLK  645
             IA+EVG G  E  HVPVICGLARCNKRDIDKAWEAVK+AKKPRIHTFIATSEIHM +KLK
Sbjct  121   IAKEVGNGVNEEGHVPVICGLARCNKRDIDKAWEAVKYAKKPRIHTFIATSEIHMKFKLK  180

Query  646   MSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDT  825
             MSR++VVEKA SMVAYARS+GC DVEFSPEDAGRSD EFLY ILGEVIKAGATTLNIPDT
Sbjct  181   MSRDEVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFLYHILGEVIKAGATTLNIPDT  240

Query  826   VGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTING  1005
             VGYT+P+EFG+LIADIKANTPGI +VIISTHCQNDLGLSTANTLAGACAGARQ+EVTING
Sbjct  241   VGYTVPSEFGKLIADIKANTPGIGDVIISTHCQNDLGLSTANTLAGACAGARQVEVTING  300

Query  1006  IGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVG  1185
             IGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQ I+M+SKMVEEYTGLHVQPHKAIVG
Sbjct  301   IGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMSSKMVEEYTGLHVQPHKAIVG  360

Query  1186  ANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGY  1365
             ANAFAHESGIHQDGMLKHKDTYEIISPEDIGL R NESGIVLGKLSGRHALQAKMLELGY
Sbjct  361   ANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRVNESGIVLGKLSGRHALQAKMLELGY  420

Query  1366  EIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLST  1545
             +IEGKELEDLFWRFKSVAE+KKK+TDDDLIAL+SDEVFQPQ  W+L +VQVTCGSLGLST
Sbjct  421   DIEGKELEDLFWRFKSVAEKKKKITDDDLIALMSDEVFQPQFVWQLENVQVTCGSLGLST  480

Query  1546  ATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRV  1725
             ATVKLIDADG+EHV+CSVGTGPVDAAYKAVDL+ KVPV LLEYS+NAVTEGIDAIASTRV
Sbjct  481   ATVKLIDADGQEHVSCSVGTGPVDAAYKAVDLIVKVPVALLEYSLNAVTEGIDAIASTRV  540

Query  1726  LIRED--QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKT  1899
             LIR +    S H  TG + +RSF+GTGA MD+VISSVRAY+GALNK+L F+ LVS+++K 
Sbjct  541   LIRGENGHTSTHALTGETVHRSFSGTGADMDIVISSVRAYIGALNKMLSFRKLVSKHSKP  600

Query  1900  QGTVVI  1917
             +G+ V+
Sbjct  601   EGSAVV  606



>ref|XP_009602443.1| PREDICTED: 2-isopropylmalate synthase B [Nicotiana tomentosiformis]
Length=606

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/557 (85%), Positives = 519/557 (93%), Gaps = 4/557 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRP+Y P+ I DP Y+RIFDTTLRDGEQSPGATMTTKEKL VARQLA+LGVDIIEAGFPA
Sbjct  50    RRPDYTPSHIPDPKYIRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  109

Query  439   SSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             SSEADLEAV+LIA+EVG G  E  HVPVICGLARCNKRDIDKAWEAVK+AKKPRIHTFIA
Sbjct  110   SSEADLEAVKLIAKEVGNGVYEEGHVPVICGLARCNKRDIDKAWEAVKYAKKPRIHTFIA  169

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIHM +KLKMSR++VVEKA SMVAYARS+GC DVEFSPEDAGRSD EFLY ILGEVIK
Sbjct  170   TSEIHMKFKLKMSRDEVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFLYHILGEVIK  229

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVGYT+P+EFG+LIADIKANTPGI +VIISTHCQNDLGLSTANTLAGACA
Sbjct  230   AGATTLNIPDTVGYTVPSEFGKLIADIKANTPGIGDVIISTHCQNDLGLSTANTLAGACA  289

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQ I+M+SKMVEEYTG
Sbjct  290   GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMSSKMVEEYTG  349

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGL RANESGIVLGKLSGRH
Sbjct  350   LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRANESGIVLGKLSGRH  409

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             ALQAKMLELGY+IEGKELEDLFWRFKSVAE+KKK+TDDDLIAL+SDEVFQPQ  W+L +V
Sbjct  410   ALQAKMLELGYDIEGKELEDLFWRFKSVAEKKKKITDDDLIALMSDEVFQPQFVWQLENV  469

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QVTCGSLGLSTATVKLIDADG+EHV+CSVGTGPVDAAYKAVDL+ KVPV LLEYS+NAVT
Sbjct  470   QVTCGSLGLSTATVKLIDADGQEHVSCSVGTGPVDAAYKAVDLIVKVPVALLEYSLNAVT  529

Query  1693  EGIDAIASTRVLIRED--QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             EGIDAIASTRVLIR +    S H  TG + +RSF+GTGA MD+VISSVRAY+GALNK+L 
Sbjct  530   EGIDAIASTRVLIRGENGHTSTHALTGETVHRSFSGTGADMDIVISSVRAYIGALNKMLS  589

Query  1867  FQNLVSRYNKTQGTVVI  1917
             F+ LVS++++ +G+ V+
Sbjct  590   FRKLVSKHSRPEGSAVV  606



>ref|XP_010324700.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase A-like 
[Solanum lycopersicum]
Length=589

 Score =   983 bits (2540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/587 (81%), Positives = 531/587 (90%), Gaps = 6/587 (1%)
 Frame = +1

Query  169   LRFSISGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSP  348
             L+F +   S     + + +  +RC  S   RRPEY+P++I DP YVRIFDTTLRDGEQSP
Sbjct  5     LQFLVPIISVFQXKKHYYSTFIRCSIS--NRRPEYVPSKISDPKYVRIFDTTLRDGEQSP  62

Query  349   GATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVIC  522
             GATMTTKEKL VARQLA+LGVDIIEAGFPASSEAD E+V+LIAEE+G    E   VPVIC
Sbjct  63    GATMTTKEKLDVARQLAKLGVDIIEAGFPASSEADFESVKLIAEEIGNNTDENGFVPVIC  122

Query  523   GLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARS  702
             GL+RCNK DIDKAWEAVK+AKKPR+HTFIATSEIHM YKLKMSREQVVEKA SMVAYARS
Sbjct  123   GLSRCNKSDIDKAWEAVKYAKKPRVHTFIATSEIHMKYKLKMSREQVVEKARSMVAYARS  182

Query  703   LGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKAN  882
             LGC DVEFSPEDAGRSDREFLY ILGEVIKAGATTLNIPDTVGYT+P+EFGQLIADIKAN
Sbjct  183   LGCEDVEFSPEDAGRSDREFLYDILGEVIKAGATTLNIPDTVGYTVPSEFGQLIADIKAN  242

Query  883   TPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKC  1062
             TPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKC
Sbjct  243   TPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKC  302

Query  1063  RGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK  1242
             RGEQVLGGLYTGINTQ I+ +SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHK
Sbjct  303   RGEQVLGGLYTGINTQHIVPSSKMVEEYSGLQVQPHKAIVGANAFAHESGIHQDGMLKHK  362

Query  1243  DTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAE  1422
             DTYEIISP+D+GL R+NE+GIVLGKLSGRHAL++KMLELGY+I+GKELEDLFWRFKSVAE
Sbjct  363   DTYEIISPDDVGLSRSNEAGIVLGKLSGRHALKSKMLELGYDIDGKELEDLFWRFKSVAE  422

Query  1423  RKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVG  1602
             +KKK+TDDDLIAL+SDEV QP V+W+LGDVQ+ CGSLGLSTATVKLI+ DG+EH+ACSVG
Sbjct  423   KKKKITDDDLIALMSDEVLQPNVYWKLGDVQIMCGSLGLSTATVKLINTDGQEHIACSVG  482

Query  1603  TGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRE-DQASI-HGSTGGSA  1776
             TGPVDAAYKAVDL+ KVP+TLLEYSMNAVTEGIDAIASTRV I   D+ +I +GSTG + 
Sbjct  483   TGPVDAAYKAVDLIVKVPITLLEYSMNAVTEGIDAIASTRVSICSIDRHTIMNGSTGQTI  542

Query  1777  NRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
             +R+F+GTGA MDVVISSVRAY+GALNK+L ++ LVSRY+K + +VV+
Sbjct  543   HRTFSGTGADMDVVISSVRAYIGALNKMLSYEKLVSRYSKPEDSVVV  589



>sp|O04973.1|LEU1A_SOLPN RecName: Full=2-isopropylmalate synthase A; AltName: Full=Alpha-IPM 
synthase A; AltName: Full=Alpha-isopropylmalate synthase 
A [Solanum pennellii]
 gb|AAB61598.1| 2-isopropylmalate synthase [Solanum pennellii]
Length=589

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/577 (82%), Positives = 527/577 (91%), Gaps = 9/577 (2%)
 Frame = +1

Query  208   FQS---FSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKL  378
             FQS   + +  +RC  S   RRPEY+P++I DP YVRIFDTTLRDGEQSPGATMTTKEKL
Sbjct  15    FQSKKHYYSTFIRCSIS--NRRPEYVPSKISDPKYVRIFDTTLRDGEQSPGATMTTKEKL  72

Query  379   AVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDI  552
              VARQLA+LGVDIIEAGFPASSEAD E+V+LIAEE+G    E   VPVICGL+RCNK DI
Sbjct  73    DVARQLAKLGVDIIEAGFPASSEADFESVKLIAEEIGNNTDENGFVPVICGLSRCNKSDI  132

Query  553   DKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSP  732
             DKAWEAVK+AKKPR+HTFIATSEIHM YKLKMSREQVVEKA SMVAYARSLGC DVEFSP
Sbjct  133   DKAWEAVKYAKKPRVHTFIATSEIHMKYKLKMSREQVVEKARSMVAYARSLGCEDVEFSP  192

Query  733   EDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIIS  912
             EDAGRSDREFLY ILGEVIKAGATTLNIPDTVGYT+P+EFGQLI DIKANTPGIENVIIS
Sbjct  193   EDAGRSDREFLYDILGEVIKAGATTLNIPDTVGYTVPSEFGQLITDIKANTPGIENVIIS  252

Query  913   THCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLY  1092
             THCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLY
Sbjct  253   THCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLY  312

Query  1093  TGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPED  1272
             TGINTQ I+ +SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISP+D
Sbjct  313   TGINTQHIVPSSKMVEEYSGLQVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPDD  372

Query  1273  IGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDL  1452
             +GL R+NE+GIVLGKLSGRHAL++KMLELGY+I+GKELEDLFWRFKSVAE+KKK+TDDDL
Sbjct  373   VGLSRSNEAGIVLGKLSGRHALKSKMLELGYDIDGKELEDLFWRFKSVAEKKKKITDDDL  432

Query  1453  IALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKA  1632
             IAL+SDEV QP V+W+LGDVQ+ CGSLGLSTATVKLI+ DG+EH+ACSVGTGPVDAAYKA
Sbjct  433   IALMSDEVLQPNVYWKLGDVQIMCGSLGLSTATVKLINTDGQEHIACSVGTGPVDAAYKA  492

Query  1633  VDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRE-DQASI-HGSTGGSANRSFNGTGAA  1806
             VDL+ KVP+TLLEYSMNAVTEGIDAIASTRV I   D+ +I +GSTG + +R+F+GTGA 
Sbjct  493   VDLIVKVPITLLEYSMNAVTEGIDAIASTRVSICSIDRHTIMNGSTGQTIHRTFSGTGAD  552

Query  1807  MDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
             MDVVISSVRAY+GALNK+L ++ LVSRY+K + +VV+
Sbjct  553   MDVVISSVRAYIGALNKMLSYEKLVSRYSKPEDSVVV  589



>ref|XP_011084168.1| PREDICTED: 2-isopropylmalate synthase A-like [Sesamum indicum]
Length=607

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/610 (79%), Positives = 533/610 (87%), Gaps = 20/610 (3%)
 Frame = +1

Query  94    ITP-PESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPPARRPE  270
             ITP P+  + C  +P+ +          F I    +  +  + +A AVRC      RRPE
Sbjct  11    ITPSPKISFRCNRVPLRS----------FYIF---KHTNGATPTATAVRCS----VRRPE  53

Query  271   YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEA  450
             YIPNRI D  YVRIFDTTLRDGEQSPGATMTTKEKL +ARQLARLGVDIIEAGFPASS+A
Sbjct  54    YIPNRIPDSKYVRIFDTTLRDGEQSPGATMTTKEKLDIARQLARLGVDIIEAGFPASSDA  113

Query  451   DLEAVRLIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHM  630
             D EAV+LIA EVG  + DHVPVICGLARCNKRDID+AWEAVK AKKPRIHTFIATSEIHM
Sbjct  114   DFEAVKLIAREVGNVDSDHVPVICGLARCNKRDIDRAWEAVKFAKKPRIHTFIATSEIHM  173

Query  631   NYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTL  810
              +KLKM+ EQV+EKA SMVA+ARSLGC+DVEFSPEDAGRSDREFLYQILGEVIKAGATTL
Sbjct  174   KFKLKMTPEQVLEKARSMVAHARSLGCNDVEFSPEDAGRSDREFLYQILGEVIKAGATTL  233

Query  811   NIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLE  990
             NIPDTVGYT+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA AGARQLE
Sbjct  234   NIPDTVGYTLPSEFGRLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAHAGARQLE  293

Query  991   VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPH  1170
             VTINGIGERAGNASLEEVVMALKCRGEQVL GLYTGINTQ I+MASKMVEEY+GL +QPH
Sbjct  294   VTINGIGERAGNASLEEVVMALKCRGEQVLDGLYTGINTQHIVMASKMVEEYSGLRIQPH  353

Query  1171  KAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKM  1350
             KAIVGANAFAHESGIHQDGMLK+K+TYEIISPEDIGL R+NESGIVLGKLSGRHAL+AKM
Sbjct  354   KAIVGANAFAHESGIHQDGMLKNKNTYEIISPEDIGLLRSNESGIVLGKLSGRHALKAKM  413

Query  1351  LELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGS  1530
             LELGY+I+GKEL+DLF RFK VA  KK +TDDDLIALVSDEVFQP V W+L DVQVTCGS
Sbjct  414   LELGYDIDGKELDDLFARFKDVAGNKKIITDDDLIALVSDEVFQPLVVWKLEDVQVTCGS  473

Query  1531  LGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAI  1710
             LGLSTATVKLIDA+G+EH++CSVGTGPVDAAYKAVDL+ KVPVTLLEY+MNAVTEGIDAI
Sbjct  474   LGLSTATVKLIDANGDEHISCSVGTGPVDAAYKAVDLIVKVPVTLLEYTMNAVTEGIDAI  533

Query  1711  ASTRVLIR-EDQ-ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVS  1884
             A+TRVLIR ED   S H  TG + NR+F+GTGAAMD+VISSVRAYVGALNKLLGF+N V 
Sbjct  534   ATTRVLIRGEDSITSTHALTGETINRAFSGTGAAMDIVISSVRAYVGALNKLLGFKNRVE  593

Query  1885  RYNKTQGTVV  1914
               + +Q  V+
Sbjct  594   TEDPSQSKVL  603



>sp|O04974.1|LEU1B_SOLPN RecName: Full=2-isopropylmalate synthase B; AltName: Full=Alpha-IPM 
synthase B; AltName: Full=Alpha-isopropylmalate synthase 
B [Solanum pennellii]
 gb|AAB61599.1| 2-isopropylmalate synthase [Solanum pennellii]
Length=612

 Score =   969 bits (2505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/588 (81%), Positives = 520/588 (88%), Gaps = 7/588 (1%)
 Frame = +1

Query  166   QLRFSISGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQS  345
             Q  F+   +  + S  SFS   VRC      R PEY P+ I DPNYVRIFDTTLRDGEQS
Sbjct  28    QTLFNFKPSISKHSNSSFSIPVVRCSIR---RIPEYTPSHIPDPNYVRIFDTTLRDGEQS  84

Query  346   PGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVI  519
             PGATMTTKEKL VARQ A+LGVDIIEAGFPASSEADLEAV+LIA+EVG G  E ++VPVI
Sbjct  85    PGATMTTKEKLDVARQSAKLGVDIIEAGFPASSEADLEAVKLIAKEVGNGVYEEEYVPVI  144

Query  520   CGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYAR  699
             CGLARCNK+DIDKAWEAVK+AKKPRIHTFIATSE+HMNYKLKMSR+QVVEKA SMVAYAR
Sbjct  145   CGLARCNKKDIDKAWEAVKYAKKPRIHTFIATSEVHMNYKLKMSRDQVVEKARSMVAYAR  204

Query  700   SLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKA  879
             S+GC DVEFSPEDAGRSD EFLY ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA IKA
Sbjct  205   SIGCEDVEFSPEDAGRSDPEFLYHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIAKIKA  264

Query  880   NTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  1059
             NTPG+E+VIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK
Sbjct  265   NTPGVEDVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  324

Query  1060  CRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKH  1239
             CRGEQVLGGLYTGINTQ I+M+SKMVE  +GLHVQPHKAIVGANAF HESGIHQDGMLKH
Sbjct  325   CRGEQVLGGLYTGINTQHILMSSKMVEGISGLHVQPHKAIVGANAFVHESGIHQDGMLKH  384

Query  1240  KDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVA  1419
             KDTYEIISPEDIGL RANESGIV GKLSG    + KMLELGYEIEGKEL+DLFWRFKSVA
Sbjct  385   KDTYEIISPEDIGLNRANESGIVFGKLSGVMLCKPKMLELGYEIEGKELDDLFWRFKSVA  444

Query  1420  ERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSV  1599
             E+KKK+TDDDL+AL+SDEVFQPQ  W+L +VQVTCGSLGLSTATVKLIDADG EH++CSV
Sbjct  445   EKKKKITDDDLVALMSDEVFQPQFVWQLQNVQVTCGSLGLSTATVKLIDADGREHISCSV  504

Query  1600  GTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGS  1773
             GTGPVDAAYKAVDL+ KVPVTLLEYSMNAVT+GIDAIASTRVLIR +    S H  TG +
Sbjct  505   GTGPVDAAYKAVDLIVKVPVTLLEYSMNAVTQGIDAIASTRVLIRGENGHTSTHALTGET  564

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
              +R+F+GTGA MD+VISSVRAYVGALNK++ F+ L+++ NK + + VI
Sbjct  565   VHRTFSGTGADMDIVISSVRAYVGALNKMMSFRKLMAKNNKPESSAVI  612



>gb|EYU26034.1| hypothetical protein MIMGU_mgv1a003059mg [Erythranthe guttata]
Length=611

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/592 (81%), Positives = 521/592 (88%), Gaps = 12/592 (2%)
 Frame = +1

Query  121   CKYLPIHTIATSFSKQLRFSISGASRRP------SFQSFSAAAVRCESSPPARRPEYIPN  282
             CK +PI+   T+ +     S +  S RP      S    S AA+RC      RRPEYIPN
Sbjct  6     CKRIPINPSPTTTTTSRLPSSTRISLRPFHLVRQSNAPRSTAAIRCS----IRRPEYIPN  61

Query  283   RILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEA  462
              I DP YVRIFDTTLRDGEQSPGATMTTKEKL +ARQLARLGVDIIEAGFPASS+AD E 
Sbjct  62    HIPDPKYVRIFDTTLRDGEQSPGATMTTKEKLDIARQLARLGVDIIEAGFPASSDADFEG  121

Query  463   VRLIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKL  642
             V+LIA EVG  + DHVPVICGLARCNKRDID+AWEAVK AKKPRIHTFIATSEIHM +KL
Sbjct  122   VKLIAREVGNADSDHVPVICGLARCNKRDIDRAWEAVKEAKKPRIHTFIATSEIHMEFKL  181

Query  643   KMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  822
             KMSR+QVVEKATSMVAYARSLGC+DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD
Sbjct  182   KMSRQQVVEKATSMVAYARSLGCNDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  241

Query  823   TVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTIN  1002
             TVGYT+P EFGQLIAD+KANTPGIENVIISTHCQNDLGLSTANTL+GA AGARQLEVTIN
Sbjct  242   TVGYTLPTEFGQLIADLKANTPGIENVIISTHCQNDLGLSTANTLSGAHAGARQLEVTIN  301

Query  1003  GIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             GIGERAGNASLEEVVMALKCRGEQVL GLYTGINTQ I+MASKMVEEY+GL +QPHKAIV
Sbjct  302   GIGERAGNASLEEVVMALKCRGEQVLDGLYTGINTQHIVMASKMVEEYSGLRIQPHKAIV  361

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDGMLK+K+TYEIISPEDIGL R+NESGIVLGKLSGRHAL+AKMLELG
Sbjct  362   GANAFAHESGIHQDGMLKNKNTYEIISPEDIGLLRSNESGIVLGKLSGRHALKAKMLELG  421

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             Y+I+GK L+DLF RFK VA  KK +TDDDLIALVSDEVFQP V W++ DVQVTCGSLGLS
Sbjct  422   YDIDGKGLDDLFARFKGVAGNKKIITDDDLIALVSDEVFQPVVIWKVEDVQVTCGSLGLS  481

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATVKLIDADG E+++CSVGTGPVDAAYKAVDLV KVPV LLEYSMNAVTEGIDAIA+TR
Sbjct  482   TATVKLIDADGAEYISCSVGTGPVDAAYKAVDLVVKVPVRLLEYSMNAVTEGIDAIATTR  541

Query  1723  VLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             VLIR + +  + H  TG + NR+F+GTGAAMD+VISSVRAYVGALNKL+GF 
Sbjct  542   VLIRAEDSVTATHAMTGETVNRAFSGTGAAMDIVISSVRAYVGALNKLIGFN  593



>ref|XP_011073908.1| PREDICTED: 2-isopropylmalate synthase A-like [Sesamum indicum]
Length=605

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/566 (82%), Positives = 505/566 (89%), Gaps = 13/566 (2%)
 Frame = +1

Query  202   PSFQSF-------SAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATM  360
             P F+SF        A  +RC      RRPEYIPN I DP YVRIFDTTLRDGEQSPGATM
Sbjct  26    PLFRSFYFRNASSGAVGIRCS----LRRPEYIPNHIPDPKYVRIFDTTLRDGEQSPGATM  81

Query  361   TTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDHVPVICGLARCN  540
             TTKEKL +ARQLARLGVDIIEAGFPASS+AD EAV LIA EVG  + DHVPVIC L+RCN
Sbjct  82    TTKEKLDIARQLARLGVDIIEAGFPASSDADFEAVTLIAREVGNADADHVPVICALSRCN  141

Query  541   KRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDV  720
             KRDI+KAWEAVK+AKKPRIHTFIATSEIHM YKL+M+ EQV++KA SMVAYARSLGC DV
Sbjct  142   KRDIEKAWEAVKYAKKPRIHTFIATSEIHMKYKLRMTPEQVIDKARSMVAYARSLGCDDV  201

Query  721   EFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIEN  900
             EFSPEDAGRS+REFLYQIL EVI AGATTLNIPDTVGYT+PNEFGQLIADIKANT GI+N
Sbjct  202   EFSPEDAGRSEREFLYQILEEVINAGATTLNIPDTVGYTLPNEFGQLIADIKANTRGIDN  261

Query  901   VIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVL  1080
             VIISTHCQNDLGLSTANTLAGA AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQ+L
Sbjct  262   VIISTHCQNDLGLSTANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQLL  321

Query  1081  GGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEII  1260
              GLYTGINTQ IIMASKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLK+K+TYEII
Sbjct  322   DGLYTGINTQHIIMASKMVEEYSGLRVQPHKAIVGANAFAHESGIHQDGMLKNKNTYEII  381

Query  1261  SPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVT  1440
             +PEDIGL R+NESGIVLGKLSGRHAL+AKMLELGY+I+GKEL+DLF RFK+VA  KK +T
Sbjct  382   APEDIGLLRSNESGIVLGKLSGRHALKAKMLELGYDIDGKELDDLFSRFKNVAGNKKIIT  441

Query  1441  DDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDA  1620
             DDDLIALVSDEVFQPQV W+L DVQVTCG+LGLSTATVKL  ADG++H+ACSVGTGPVDA
Sbjct  442   DDDLIALVSDEVFQPQVVWKLEDVQVTCGTLGLSTATVKLSGADGKKHIACSVGTGPVDA  501

Query  1621  AYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR-EDQ-ASIHGSTGGSANRSFNG  1794
             AYKAVDL+ KVPVTL+EYSMNAVTEGIDAIASTRVLIR ED   S    TG +  R+F+G
Sbjct  502   AYKAVDLIVKVPVTLVEYSMNAVTEGIDAIASTRVLIRGEDSVTSTDAPTGETVKRTFSG  561

Query  1795  TGAAMDVVISSVRAYVGALNKLLGFQ  1872
             TGAAMD+VISSVRAY+ ALNK+LG+Q
Sbjct  562   TGAAMDIVISSVRAYISALNKMLGYQ  587



>emb|CDP16992.1| unnamed protein product [Coffea canephora]
Length=621

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/575 (79%), Positives = 514/575 (89%), Gaps = 21/575 (4%)
 Frame = +1

Query  199   RPSFQSFSAAAVRCE---SSPPAR-------RPEYIPNRILDPNYVRIFDTTLRDGEQSP  348
             +PSF       VRC    S+PP         RPEYIPNRI DPNYVRIFDTTLRDGEQSP
Sbjct  45    KPSF------LVRCSIRSSAPPISTLKQSCPRPEYIPNRISDPNYVRIFDTTLRDGEQSP  98

Query  349   GATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR----GEGDHVPV  516
             GATMTTK+KL +ARQLA+LGVDIIEAGFPASSEADLEAV+LIA+EVG     G   H+PV
Sbjct  99    GATMTTKQKLDIARQLAKLGVDIIEAGFPASSEADLEAVKLIAKEVGNVSPEGADGHLPV  158

Query  517   ICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYA  696
             ICGL+RCNKRDIDKAWEAVK+AKKPRIHTFIATSEIH+ +KLK ++EQV+E A SMVAYA
Sbjct  159   ICGLSRCNKRDIDKAWEAVKYAKKPRIHTFIATSEIHLKHKLKKTKEQVLETARSMVAYA  218

Query  697   RSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIK  876
             RSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGATTLNIPDTVG  + +EF QLIADIK
Sbjct  219   RSLGCPDVEFSPEDAGRSDREFLYEILGEVIKAGATTLNIPDTVGILVHDEFEQLIADIK  278

Query  877   ANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMAL  1056
             ANTPGI+NVIISTHCQNDLGL+TAN++ GA AGARQLEVTINGIGERAGNASLEEVVMA+
Sbjct  279   ANTPGIDNVIISTHCQNDLGLATANSIGGAIAGARQLEVTINGIGERAGNASLEEVVMAI  338

Query  1057  KCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLK  1236
             KCRGEQV+GGLYTGINTQ I++ SKMVEE +GLH+QPHKAIVGANAFAHESGIHQDGMLK
Sbjct  339   KCRGEQVMGGLYTGINTQHIVVTSKMVEECSGLHIQPHKAIVGANAFAHESGIHQDGMLK  398

Query  1237  HKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSV  1416
             +KDTYEI+SPEDIGL R+NESGIVLGKLSGRHAL+AK+LELGY+I+GKEL+DLF RFKSV
Sbjct  399   NKDTYEIMSPEDIGLLRSNESGIVLGKLSGRHALKAKLLELGYDIDGKELDDLFPRFKSV  458

Query  1417  AERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACS  1596
             AE KK +TD+DLIALVSDEVFQPQVFW+LGDVQVTCG+LGLSTATVKLIDADG+EH+ CS
Sbjct  459   AENKKNITDEDLIALVSDEVFQPQVFWKLGDVQVTCGTLGLSTATVKLIDADGKEHIECS  518

Query  1597  VGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED-QASIHGSTGGS  1773
             VGTGPVDAAYKA+DL+TKVP+ LLEYS++AVTEGIDAIA+TRVLIR D Q + H  TG +
Sbjct  519   VGTGPVDAAYKAIDLITKVPLILLEYSLSAVTEGIDAIATTRVLIRGDSQTATHALTGEA  578

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
              +R+F+GTGAAMD+V+SSVRAY+GALNK L F+ L
Sbjct  579   MSRTFSGTGAAMDIVVSSVRAYLGALNKKLSFKKL  613



>ref|XP_002268942.2| PREDICTED: 2-isopropylmalate synthase A-like [Vitis vinifera]
Length=628

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/544 (80%), Positives = 496/544 (91%), Gaps = 4/544 (1%)
 Frame = +1

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
             A RPEYIPNRI DPNYVRIFDTTLRDGEQSPGATMT+KEKL +ARQLA+LGVDIIEAGFP
Sbjct  70    ALRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFP  129

Query  436   ASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             A+S+ DL+AV++IA+EVG    E  HVPVICGLARCN+ DI  AWEAVK+AK+PRIHTFI
Sbjct  130   AASKDDLDAVKIIAKEVGNAVDENGHVPVICGLARCNRNDISTAWEAVKYAKRPRIHTFI  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATSEIHM YKLK S ++V+E A  MV YARSLGC DVEFSPEDAGRS+REFLY+ILGEVI
Sbjct  190   ATSEIHMKYKLKKSEKEVIEIAREMVKYARSLGCDDVEFSPEDAGRSEREFLYKILGEVI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVGYT+PNEFGQLIADIK+NTPGIENVIISTHCQNDLGLSTANT+AGAC
Sbjct  250   KAGATTLNIPDTVGYTVPNEFGQLIADIKSNTPGIENVIISTHCQNDLGLSTANTIAGAC  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGERAGNASLEEVVMALKCRGE+ LGGLYTGIN + I+  SKMV EY+
Sbjct  310   AGARQVEVTINGIGERAGNASLEEVVMALKCRGEKALGGLYTGINIRHIVKTSKMVAEYS  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL VQPHKAIVGANAFAHESGIHQDGMLKHK+TYEIISPEDIGLFR+NESGIVLGKLSGR
Sbjct  370   GLQVQPHKAIVGANAFAHESGIHQDGMLKHKETYEIISPEDIGLFRSNESGIVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGD  1509
             HAL++++LELGYEIEG EL+D+FWRFK VAE+KK +TD D+IALVSDE+FQP+VFW+LGD
Sbjct  430   HALKSRLLELGYEIEGMELDDIFWRFKEVAEKKKNLTDVDVIALVSDEIFQPKVFWKLGD  489

Query  1510  VQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
             +QVTCG+LGLSTATVKLIDADG++HVACSVGTGPVD+AYKA+DL+ K  VTLLEY +NAV
Sbjct  490   LQVTCGTLGLSTATVKLIDADGQKHVACSVGTGPVDSAYKAIDLLVKEQVTLLEYGLNAV  549

Query  1690  TEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             TEGIDAIA+TRVLIR  ++    +  TG + +RSF+GTGA MD+V+SSVRAY+ ALNK+L
Sbjct  550   TEGIDAIATTRVLIRGEKNHTLTNALTGETVHRSFSGTGAGMDIVVSSVRAYISALNKML  609

Query  1864  GFQN  1875
             GF++
Sbjct  610   GFKD  613



>ref|XP_006478856.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Citrus 
sinensis]
Length=620

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/620 (71%), Positives = 517/620 (83%), Gaps = 29/620 (5%)
 Frame = +1

Query  91    VITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPP-----  255
             +++PP++K     L  H                 + +P F++  + ++  +  PP     
Sbjct  16    ILSPPKTKVNASQLFFHC---------------NNSKPFFKTTISCSL--QKPPPSLYPR  58

Query  256   --ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAG  429
               A RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAG
Sbjct  59    ITASRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAG  118

Query  430   FPASSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIH  600
             FPA+S+ D EAVR IA+EVG     E  +VPVICGL+RCN+RDI  AWEAVK+AK+PRIH
Sbjct  119   FPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIH  178

Query  601   TFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  780
             TFIATS IHM +KL+ +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILG
Sbjct  179   TFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILG  238

Query  781   EVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  960
             EVIK GATTLNIPDTVG T+P EFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+A
Sbjct  239   EVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIA  298

Query  961   GACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVE  1140
             GACAGARQ+EVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+ I+MASKMVE
Sbjct  299   GACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVE  358

Query  1141  EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R++E+GIVLGKL
Sbjct  359   EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKL  418

Query  1321  SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWR  1500
             SGRHAL+ ++ ELGYE+  ++L  +FW FK+VAE+KK+VTD DLIALVSDEVFQP+V W+
Sbjct  419   SGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEVFQPEVVWK  478

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             L D+QVTCG+LGLSTATVKL+DA+GEEHVACS GTGPVD+AYKAVDL+ K P TLLEYSM
Sbjct  479   LLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSM  538

Query  1681  NAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALN  1854
             NAVT GIDAIA+TRVLIR  + Q S H STG +  R+F+GTGA MD+V+SSV+AY+GALN
Sbjct  539   NAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALN  598

Query  1855  KLLGFQNLVSRYNKTQGTVV  1914
             K+LGF++ +   +  + T V
Sbjct  599   KMLGFKDQLPAKDSVERTSV  618



>gb|KDO41314.1| hypothetical protein CISIN_1g0069691mg [Citrus sinensis]
Length=620

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/620 (71%), Positives = 517/620 (83%), Gaps = 29/620 (5%)
 Frame = +1

Query  91    VITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPP-----  255
             +++PP++K     L  H                 + +P F++  + ++  +  PP     
Sbjct  16    ILSPPKTKVNASQLFFHC---------------NNSKPFFKTTISCSL--QKPPPSLYPR  58

Query  256   --ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAG  429
               A RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAG
Sbjct  59    ITASRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAG  118

Query  430   FPASSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIH  600
             FPA+S+ D EAVR IA+EVG     E  +VPVICGL+RCN+RDI  AWEAVK+AK+PRIH
Sbjct  119   FPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIH  178

Query  601   TFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  780
             TFIATS IHM +KL+ +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILG
Sbjct  179   TFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILG  238

Query  781   EVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  960
             EVIK GATTLNIPDTVG T+P EFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+A
Sbjct  239   EVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIA  298

Query  961   GACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVE  1140
             GACAGARQ+EVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+ I+MASKMVE
Sbjct  299   GACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVE  358

Query  1141  EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R++E+GIVLGKL
Sbjct  359   EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKL  418

Query  1321  SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWR  1500
             SGRHAL+ ++ ELGYE+  ++L  +FW FK+VAE+KK+VTD DLIALVSDE+FQP+V W+
Sbjct  419   SGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWK  478

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             L D+QVTCG+LGLSTATVKL+DA+GEEHVACS GTGPVD+AYKAVDL+ K P TLLEYSM
Sbjct  479   LLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSM  538

Query  1681  NAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALN  1854
             NAVT GIDAIA+TRVLIR  + Q S H STG +  R+F+GTGA MD+V+SSV+AY+GALN
Sbjct  539   NAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALN  598

Query  1855  KLLGFQNLVSRYNKTQGTVV  1914
             K+LGF++ +   +  + T V
Sbjct  599   KMLGFKDQLPAKDSVERTSV  618



>ref|XP_002530549.1| isopropylmalate synthase, putative [Ricinus communis]
 gb|EEF31840.1| isopropylmalate synthase, putative [Ricinus communis]
Length=632

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/629 (70%), Positives = 521/629 (83%), Gaps = 20/629 (3%)
 Frame = +1

Query  55    TMACLRASPNPPVITPPESKYT---CKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSA  225
             +++ + + P+PP I+     +T   C++      + SF    RF           +S +A
Sbjct  13    SISQITSKPSPPRISHSLLHFTPTRCRFFSNSKFSVSFPSNSRF-----------KSSTA  61

Query  226   AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARL  405
              +    ++P +RRPEYIP+ I DP+YVRIFDTTLRDGEQSPGAT+T+KEKL +ARQL++L
Sbjct  62    ISCSSSAAPLSRRPEYIPSHIPDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLSKL  121

Query  406   GVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKH  579
             GVDIIEAGFPA+S+ D EAV+ IA+EVG    E  +VPVICGL+RCN++DI  AWEAVK+
Sbjct  122   GVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDEDGYVPVICGLSRCNEKDIRTAWEAVKY  181

Query  580   AKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  759
             AK+PRIHTFIATS IHM YKL+ S+E+VVE A SMV +ARSLGC DVEFSPEDAGRSDRE
Sbjct  182   AKRPRIHTFIATSAIHMEYKLRKSKEEVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRE  241

Query  760   FLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGL  939
             FLY ILGEVIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGI+ VIISTHCQNDLGL
Sbjct  242   FLYHILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIDKVIISTHCQNDLGL  301

Query  940   STANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQII  1119
             STANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMA+KCRGE +LGGLYTGIN +QI 
Sbjct  302   STANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMAIKCRGEHILGGLYTGINPRQIT  361

Query  1120  MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANES  1299
             MASKMVEEYTGLH+QPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R+N++
Sbjct  362   MASKMVEEYTGLHLQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNDA  421

Query  1300  GIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVF  1479
             GIVLGKLSGRHAL+ ++ ELGYE+  ++L  +FWRFK+VAE KK+VTD DLIALVSDEVF
Sbjct  422   GIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWRFKAVAETKKRVTDADLIALVSDEVF  481

Query  1480  QPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPV  1659
             QP++ W+LGD+QVTCG+LGLSTATVKLI+ADGEEH+ACSVG+GPVDA YKAVDL+ K PV
Sbjct  482   QPEIVWKLGDLQVTCGTLGLSTATVKLINADGEEHIACSVGSGPVDAGYKAVDLIVKEPV  541

Query  1660  TLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVR  1833
              LLEYSMNAVTEGIDAIA+TRVLIR  ++  S H  TG    R+F+G+GA MD+V+SSV+
Sbjct  542   ELLEYSMNAVTEGIDAIATTRVLIRREDNHTSTHALTGEPFQRTFSGSGAGMDIVVSSVK  601

Query  1834  AYVGALNKLLGF--QNLVSRYNKTQGTVV  1914
             AYVGALNK+L    Q L  R + T  T V
Sbjct  602   AYVGALNKMLALKQQFLTKRVSSTDRTPV  630



>ref|XP_007034042.1| 2-isopropylmalate synthase 1 isoform 2 [Theobroma cacao]
 gb|EOY04968.1| 2-isopropylmalate synthase 1 isoform 2 [Theobroma cacao]
Length=624

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/589 (75%), Positives = 510/589 (87%), Gaps = 14/589 (2%)
 Frame = +1

Query  190   ASRRPSFQSFSA----------AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGE  339
             +S+ PSF SF +          +++      P+RRP +IPN I DPNYVR+FDTTLRDGE
Sbjct  34    SSKLPSFPSFPSKSCSKTFLISSSLTPNPPSPSRRPPFIPNHIPDPNYVRVFDTTLRDGE  93

Query  340   QSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVP  513
             QSPGATMT+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG    E  +VP
Sbjct  94    QSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDEDGYVP  153

Query  514   VICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAY  693
             VICGL+RCN++DI  AWEAVK+AK+PRIHTFIATS IHM YKL+ S+ +VV+ A SMV +
Sbjct  154   VICGLSRCNEKDIKAAWEAVKYAKRPRIHTFIATSGIHMEYKLRKSKAEVVDIARSMVRF  213

Query  694   ARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADI  873
             ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGATTLNIPDTVG  +P+EFGQLIADI
Sbjct  214   ARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGATTLNIPDTVGINLPSEFGQLIADI  273

Query  874   KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMA  1053
             KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ+EVTINGIGERAGNASLEEVVMA
Sbjct  274   KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQVEVTINGIGERAGNASLEEVVMA  333

Query  1054  LKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGML  1233
             LKCRGE VLGGLYTGINT+ I+MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGML
Sbjct  334   LKCRGEHVLGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGML  393

Query  1234  KHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKS  1413
             KHK TYEIISPEDIGL R+NE+GIVLGKLSGRHAL  ++ ELGYE++ ++L ++FWRFK+
Sbjct  394   KHKGTYEIISPEDIGLERSNEAGIVLGKLSGRHALSDRLKELGYELDQEQLGNIFWRFKA  453

Query  1414  VAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVAC  1593
             VAE+KK+VTD DLIALVSDEVFQP+V W+L D+QVTCG+LGLSTATVKLI ADGEEHVAC
Sbjct  454   VAEQKKRVTDADLIALVSDEVFQPEVVWKLHDLQVTCGTLGLSTATVKLISADGEEHVAC  513

Query  1594  SVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA--SIHGSTG  1767
             SVGTGPVD+AYKAVDL+TK  VTLLEYS+ AVTEGIDAIA+TRVLIR +++  S H  TG
Sbjct  514   SVGTGPVDSAYKAVDLITKEAVTLLEYSLIAVTEGIDAIATTRVLIRTEKSHMSTHALTG  573

Query  1768  GSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVV  1914
                +R+F+GTGA MD+V+SSV+AY+GA+NK+LGF+  +      + T +
Sbjct  574   EITHRTFSGTGAGMDIVVSSVKAYIGAINKMLGFKEQIPTKGSAERTTI  622



>gb|KHG02682.1| 2-isopropylmalate synthase 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=627

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/538 (79%), Positives = 490/538 (91%), Gaps = 4/538 (1%)
 Frame = +1

Query  271   YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEA  450
             YIPN I DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+ 
Sbjct  74    YIPNHIPDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKD  133

Query  451   DLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEI  624
             D EAV  IA+EVG  E +  +VPVICGL+RCN+ DI  AWEAVK+AK+PRIHTFIATS I
Sbjct  134   DFEAVTAIAKEVGNAEDENGYVPVICGLSRCNENDIKAAWEAVKYAKRPRIHTFIATSGI  193

Query  625   HMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  804
             H+ YKL+ S+E+V++ A SMV +ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  194   HLEYKLRKSKEEVLDIARSMVRFARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGAT  253

Query  805   TLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  984
             TLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ
Sbjct  254   TLNIPDTVGITMPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  313

Query  985   LEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             +EVTINGIGERAGNASLEEVVMA+KCRGE VLGGLYTGINTQ I+M+SKMVE+YTGLH+Q
Sbjct  314   VEVTINGIGERAGNASLEEVVMAIKCRGEHVLGGLYTGINTQHIVMSSKMVEDYTGLHIQ  373

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             PHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R+NE+GIVLGKLSGRHAL+ 
Sbjct  374   PHKAIVGANAFAHESGIHQDGMLKHKSTYEIISPEDIGLERSNEAGIVLGKLSGRHALKD  433

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELGYE++ ++L ++FWRFK+VAE+KK+V D DLIALVSDEVFQP+V W+L D+QVTC
Sbjct  434   RLKELGYELDDEQLGNIFWRFKAVAEQKKRVIDADLIALVSDEVFQPEVVWKLHDLQVTC  493

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+LGLSTATVKLI ADGEEHVACSVGTGPVD+AYKA+DL+TK PVTLLEYSMNAVTEGID
Sbjct  494   GTLGLSTATVKLIGADGEEHVACSVGTGPVDSAYKAIDLITKEPVTLLEYSMNAVTEGID  553

Query  1705  AIASTRVLIREDQASIHGS--TGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             AIA+TRVLIR +++ I  +  TG    R+F+G GA MD+V+SSV+AY+GALNK+LGF+
Sbjct  554   AIATTRVLIRAEKSRISTNILTGEIVQRTFSGNGAGMDIVVSSVKAYIGALNKMLGFK  611



>gb|KDP42866.1| hypothetical protein JCGZ_23808 [Jatropha curcas]
Length=634

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/613 (72%), Positives = 512/613 (84%), Gaps = 14/613 (2%)
 Frame = +1

Query  94    ITPPESKYTCKYLPIHTIATSFS-----KQLRFSISGASRRPSFQSFSAAAVRCESSPPA  258
             ++PP   +T K+   H+  TSFS       LR +IS +    +  S S AA R       
Sbjct  23    LSPPLLHFTSKWSDFHS-NTSFSFPSSKSLLRTTISCSQSSSAVPSPSPAAPR------R  75

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEYIPN I DP YVR+FDTTLRDGEQSPGAT+T+KEKL +AR L++LGVDIIEAGFPA
Sbjct  76    RRPEYIPNHIPDPFYVRVFDTTLRDGEQSPGATLTSKEKLDIARHLSKLGVDIIEAGFPA  135

Query  439   SSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             +S  D EAV+ IA+EVG    D  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIA
Sbjct  136   ASNDDFEAVKTIAKEVGNAVDDEGYVPVICGLSRCNEKDIKTAWEAVKYAKRPRIHTFIA  195

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIHM YKL+ S+E+VVE AT+MV +ARSLGC DVEFSPEDAGRSDREFLY ILGEVIK
Sbjct  196   TSEIHMQYKLRKSKEEVVEIATNMVKFARSLGCDDVEFSPEDAGRSDREFLYHILGEVIK  255

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVG T+P+EFGQLIADI+ANTPGIENVIISTHCQNDLGLSTANTLAG  A
Sbjct  256   AGATTLNIPDTVGITLPSEFGQLIADIRANTPGIENVIISTHCQNDLGLSTANTLAGTYA  315

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQ+EVT+NGIGERAGNASLEEVVMA+KCRGE VLGGLYTGIN++ I MASKMVEEYTG
Sbjct  316   GARQVEVTVNGIGERAGNASLEEVVMAIKCRGEHVLGGLYTGINSKHITMASKMVEEYTG  375

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             LHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL RAN++GIVLGKLSGRH
Sbjct  376   LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEDIGLERANDAGIVLGKLSGRH  435

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL+ ++ ELGYE+  ++L ++FWRFKSVAE KK+VTD DL+ALVSDEVFQP++ W+LGD+
Sbjct  436   ALKDRLKELGYELSDEQLGNIFWRFKSVAENKKRVTDADLLALVSDEVFQPEIVWQLGDL  495

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             Q+TCG+LGLSTATVKLIDA+GE+H+ACSVGTGPVDAAYKAVDL+ K PV LLEYSM AVT
Sbjct  496   QITCGTLGLSTATVKLIDANGEQHIACSVGTGPVDAAYKAVDLIVKEPVELLEYSMTAVT  555

Query  1693  EGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
              GIDAIA+TRVLI  D   I   TG  + R+F+G+GA MD+V+SSV+AY+GALNK+L   
Sbjct  556   GGIDAIATTRVLICGDNHKIDAITGEPSRRTFSGSGAGMDIVVSSVKAYIGALNKMLAVN  615

Query  1873  NLVSRYNKTQGTV  1911
             +      KT  TV
Sbjct  616   SQQLSTTKTVSTV  628



>ref|NP_177544.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana]
 sp|Q9C550.1|LEU12_ARATH RecName: Full=2-isopropylmalate synthase 2, chloroplastic; AltName: 
Full=2-isopropylmalate synthase 1; AltName: Full=Methylthioalkylmalate 
synthase-like 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG52530.1|AC016662_24 putative 2-isopropylmalate synthase; 30920-27612 [Arabidopsis 
thaliana]
 gb|AAG52882.1|AF327647_1 2-isopropylmalate synthase [Arabidopsis thaliana]
 gb|AAL15290.1| At1g74040/F2P9_9 [Arabidopsis thaliana]
 gb|AAN33190.1| At1g74040/F2P9_9 [Arabidopsis thaliana]
 gb|AEE35540.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana]
Length=631

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/553 (76%), Positives = 493/553 (89%), Gaps = 4/553 (1%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P RRP YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGF
Sbjct  70    PRRRPNYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGF  129

Query  433   PASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             PA+S+ D EAV+ IAE VG    E  +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTF
Sbjct  130   PAASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTF  189

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS+IH+ YKLK S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEV
Sbjct  190   IATSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEV  249

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA
Sbjct  250   IKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGA  309

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEY
Sbjct  310   HSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEY  369

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             TG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPE+IGL R+N++GIVLGKLSG
Sbjct  370   TGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNDAGIVLGKLSG  429

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHAL+ ++ ELGY ++  +L +LFWRFK+VAE+KK+VTD DLIALVSDEVFQP+  W+L 
Sbjct  430   RHALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLL  489

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             D+Q+TCG+LGLST+TVKL D+DG+EHVACSVGTGPVDAAYKAVDL+ K P TLLEYSMNA
Sbjct  490   DMQITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNA  549

Query  1687  VTEGIDAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             VTEGIDAIA+TRVLIR D   +S +  TG S  R+F+GTGA MD+V+SSV+AYVGALNK+
Sbjct  550   VTEGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKM  609

Query  1861  LGFQNLVSRYNKT  1899
             LGF+   S  +KT
Sbjct  610   LGFKEHTSTLSKT  622



>ref|XP_010428367.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic [Camelina 
sativa]
Length=627

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/586 (73%), Positives = 506/586 (86%), Gaps = 9/586 (2%)
 Frame = +1

Query  166   QLRFSISGASRRPSFQSFSAAAVRCESSP-PA----RRPEYIPNRILDPNYVRIFDTTLR  330
              LR    GA    + + F  +    +SSP P+    RRP+YIPNRI DPNYVRIFDTTLR
Sbjct  32    HLRSHHHGAVSLCTAEKFRVSCSISDSSPLPSHSHRRRPDYIPNRISDPNYVRIFDTTLR  91

Query  331   DGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR--GEGD  504
             DGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IAE VG    E  
Sbjct  92    DGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAETVGNTVDENG  151

Query  505   HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSM  684
             +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTFIATS+IH+ YKLK S+++V+E A +M
Sbjct  152   YVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIATSDIHLKYKLKKSKDEVIEIARNM  211

Query  685   VAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLI  864
             VA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGATTLNIPDTVG T+P+EFGQLI
Sbjct  212   VAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLI  271

Query  865   ADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEV  1044
             ADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA +GARQ+EVTINGIGERAGNASLEEV
Sbjct  272   ADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEV  331

Query  1045  VMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQD  1224
             VMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  QPHKAIVGANAFAHESGIHQD
Sbjct  332   VMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQD  391

Query  1225  GMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWR  1404
             GMLKHK TYEI+SPE+IGL R+NE+GIVLGKLSGRHAL+ ++ ELGY ++  +L +LFWR
Sbjct  392   GMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSGRHALKDRLNELGYVLDDGQLSNLFWR  451

Query  1405  FKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEH  1584
             FK+VAE+KK+VTD DLIALVSDEVFQP+  W+L D+Q+TCG+LGLST+TVKL D+DG+EH
Sbjct  452   FKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEH  511

Query  1585  VACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQ--ASIHG  1758
             VACSVGTGPVDAAYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR D   +S + 
Sbjct  512   VACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDNNYSSTNA  571

Query  1759  STGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNK  1896
              TG S  R+F+GTGA MD+V+SSV+AYVGALNK+LGF+   S   K
Sbjct  572   VTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLGFKEHSSTLRK  617



>gb|AAW81741.1| Putative 2-isopropylmalate synthase [Brassica oleracea]
Length=623

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/603 (71%), Positives = 510/603 (85%), Gaps = 18/603 (3%)
 Frame = +1

Query  76    SPNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPP  255
             +P+ P  +   S  + ++ P H  ++   K LR S S +   P  +       RC     
Sbjct  19    TPSLPSFSSKPSPLSFRFPPSHHRSSLRIKSLRLSCSLSDPSPPLR-------RC-----  66

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
               RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVD+IEAGFP
Sbjct  67    --RPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFP  124

Query  436   ASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             A+S+ D EAV+ IAE VG   +GD +VPVICGL+RCNKRDI+ AWEAVK+AK+PRIHTFI
Sbjct  125   AASKDDFEAVKTIAETVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFI  184

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IH+ YKLK S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLYQILGEVI
Sbjct  185   ATSDIHLEYKLKKSKDEVIEFARNMVKFARSLGCEDVEFSPEDAGRSEREFLYQILGEVI  244

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA 
Sbjct  245   KAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAH  304

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+YT
Sbjct  305   SGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYT  364

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGR
Sbjct  365   GMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGR  424

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGD  1509
             HAL+ ++ ELGY ++ ++L  +FWRFKSVAERKK+VTD D+IALVSDEVFQP+  W+L D
Sbjct  425   HALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWKLLD  484

Query  1510  VQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
             +Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAV
Sbjct  485   IQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAV  544

Query  1690  TEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             TEGIDAIA+TRVLIR   + ++ +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L
Sbjct  545   TEGIDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKML  604

Query  1864  GFQ  1872
              F+
Sbjct  605   DFK  607



>ref|XP_010539993.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic [Tarenaya 
hassleriana]
Length=626

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/557 (76%), Positives = 496/557 (89%), Gaps = 4/557 (1%)
 Frame = +1

Query  214   SFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQ  393
             S SA A    S    RRP+YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T KEK+ +ARQ
Sbjct  54    SASADASPLPSHSLRRRPQYIPNRIPDPNYVRIFDTTLRDGEQSPGATLTAKEKIDIARQ  113

Query  394   LARLGVDIIEAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWE  567
             LA+LGVDIIEAGFPA+S+ D +AV+ IAE +G    E  +VPVICGL+RCNK+DI+ AWE
Sbjct  114   LAKLGVDIIEAGFPAASKEDFQAVKTIAEIIGNTVDESGYVPVICGLSRCNKKDIETAWE  173

Query  568   AVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  747
             AVK+AK+PRIHTFIATS+IH+ YKLK S+E+V+E A SMV +ARSLGC DVEFSPEDAGR
Sbjct  174   AVKYAKRPRIHTFIATSDIHLKYKLKKSKEEVIEIARSMVRFARSLGCEDVEFSPEDAGR  233

Query  748   SDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQN  927
             SDREFLY+ILGEVIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQN
Sbjct  234   SDREFLYRILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQN  293

Query  928   DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1107
             DLGLSTANTLAG+ AGARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ +LGGL+TGI+T
Sbjct  294   DLGLSTANTLAGSYAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHILGGLFTGIDT  353

Query  1108  QQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFR  1287
             + I+M SKMVE+YTGLH+QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R
Sbjct  354   RHIVMTSKMVEDYTGLHLQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLER  413

Query  1288  ANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
             +NE+GIVLGKLSGRHAL+ ++ ELGYE++ ++L ++FWRFK+VAE+KK+VTD D+IALVS
Sbjct  414   SNEAGIVLGKLSGRHALRDRLNELGYELDEEQLNNIFWRFKAVAEQKKRVTDADIIALVS  473

Query  1468  DEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVT  1647
             DEVFQP+V W+L DVQVTCG+LGLSTATVKL +A+G+EHVACS GTGPVDAAYKA+DL+ 
Sbjct  474   DEVFQPEVVWKLLDVQVTCGTLGLSTATVKLAEANGKEHVACSTGTGPVDAAYKAIDLIV  533

Query  1648  KVPVTLLEYSMNAVTEGIDAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVI  1821
             K PVTLLEYSMNAVTEGIDAIA+TRVLIR D   +S +  TG    R+F+GTGA MD+V+
Sbjct  534   KEPVTLLEYSMNAVTEGIDAIATTRVLIRGDNNFSSTNALTGEVVQRTFSGTGAGMDIVV  593

Query  1822  SSVRAYVGALNKLLGFQ  1872
             SSV+AYVGA+NK+LGF+
Sbjct  594   SSVKAYVGAVNKMLGFE  610



>gb|KGN57885.1| hypothetical protein Csa_3G363180 [Cucumis sativus]
Length=633

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/583 (73%), Positives = 508/583 (87%), Gaps = 11/583 (2%)
 Frame = +1

Query  160   SKQLRFSISGASR----RPSFQSFSAAAVRCESSPPA--RRPEYIPNRILDPNYVRIFDT  321
             S+ L F  + AS      P +   + + V   S P A  RRP YIPNRI DP+YVR+FDT
Sbjct  40    SRSLSFKTAAASAPHNVSPVYSCLTESIV-SNSVPKASIRRPPYIPNRIPDPSYVRVFDT  98

Query  322   TLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--  495
             TLRDGEQSPGA++T KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV++IA+E+G    
Sbjct  99    TLRDGEQSPGASLTVKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVKMIAKEIGNAVD  158

Query  496   EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKA  675
             E  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIATSEIHM +KL+ ++E+V+E A
Sbjct  159   EDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSEIHMEHKLRKTKEEVIEIA  218

Query  676   TSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFG  855
              +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT+P EFG
Sbjct  219   RNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTMPFEFG  278

Query  856   QLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASL  1035
             +LIADIK+NTPGIENVIIS+HCQNDLGL+TANT+AGACAGARQ+EVTINGIGERAGNASL
Sbjct  279   KLIADIKSNTPGIENVIISSHCQNDLGLATANTVAGACAGARQVEVTINGIGERAGNASL  338

Query  1036  EEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGI  1215
             EEVVMAL+CRGE VLGGL+TGIN++ I + SKMVEE+TGL+VQPHKAIVGANAFAH SGI
Sbjct  339   EEVVMALQCRGEHVLGGLHTGINSRHIFLTSKMVEEFTGLNVQPHKAIVGANAFAHASGI  398

Query  1216  HQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDL  1395
             HQDGMLKHK TYEI++PEDIG  R+N++GIVLGKLSGRHAL++ +LELGYE++G+ L+++
Sbjct  399   HQDGMLKHKGTYEIMAPEDIGYERSNDAGIVLGKLSGRHALKSLLLELGYELDGENLDNV  458

Query  1396  FWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADG  1575
             FWRFK+VAE+KK+VTD DL ALVSDEVFQP V W+L D+QVTCG+LGLSTATVKL+DADG
Sbjct  459   FWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDMQVTCGTLGLSTATVKLLDADG  518

Query  1576  EEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA--S  1749
             +EH+ACSVGTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR D++  S
Sbjct  519   KEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDKSYTS  578

Query  1750  IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
              +  TG +  R+F+G GA MD+V+SSV+AY+GALNK+LGFQ +
Sbjct  579   TNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLGFQGI  621



>ref|XP_008232677.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform 
X2 [Prunus mume]
 ref|XP_008232686.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform 
X2 [Prunus mume]
Length=632

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/550 (77%), Positives = 489/550 (89%), Gaps = 6/550 (1%)
 Frame = +1

Query  241   ESSPP--ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVD  414
             +S+ P  ARRP+YIPNRI DPNYVRIFDTTLRDGEQSPGA++T+KEKL +ARQLA+LGVD
Sbjct  67    QSTNPKAARRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARQLAKLGVD  126

Query  415   IIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKK  588
             IIEAGFPA+S  D EAV++IA+EVG    +  +VPVICGL+RCNK+DI +AW+AV+ AK+
Sbjct  127   IIEAGFPAASNDDFEAVKMIAKEVGNSVDKDGYVPVICGLSRCNKKDIKRAWDAVECAKR  186

Query  589   PRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  768
             PRIHTFIATS IHM +KL+ ++EQVVE A  MV+YARSLGC DVEFSPEDAGRSDREFLY
Sbjct  187   PRIHTFIATSAIHMEHKLRKTKEQVVEIARDMVSYARSLGCDDVEFSPEDAGRSDREFLY  246

Query  769   QILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  948
             QILGEVIKAGATTLNIPDTVGY +P+E+ QLI+DIK+NT GIENVIISTHCQNDLGLSTA
Sbjct  247   QILGEVIKAGATTLNIPDTVGYNVPSEYSQLISDIKSNTTGIENVIISTHCQNDLGLSTA  306

Query  949   NTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMAS  1128
             NT+AGA AGARQLEVTINGIGERAGNASLEEVVM L CRG+ VLGGLYTGIN + I + S
Sbjct  307   NTIAGASAGARQLEVTINGIGERAGNASLEEVVMTLDCRGDHVLGGLYTGINARHIYITS  366

Query  1129  KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIV  1308
             KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIG  R+NE+GIV
Sbjct  367   KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIV  426

Query  1309  LGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQ  1488
             LGKLSGRHAL+ ++ ELGYE+   +LE +FWRFK+VA++KK+VTD DL ALVSDEVFQP+
Sbjct  427   LGKLSGRHALKKRLEELGYELADDQLETIFWRFKAVADQKKRVTDADLRALVSDEVFQPE  486

Query  1489  VFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLL  1668
             V W+L D+QVTCG+LGLSTATVKLIDADG EHVAC++GTGPVD+AYKAVDL+ K PVTLL
Sbjct  487   VVWKLHDLQVTCGTLGLSTATVKLIDADGREHVACAIGTGPVDSAYKAVDLIVKEPVTLL  546

Query  1669  EYSMNAVTEGIDAIASTRVLIREDQASI--HGSTGGSANRSFNGTGAAMDVVISSVRAYV  1842
             EYSMNAVTEGIDAIA+TRVLIR + ++I  H  TG +  R+F+G GA MD+V+SSV+AYV
Sbjct  547   EYSMNAVTEGIDAIATTRVLIRGENSNITTHAFTGETVQRTFSGIGAGMDIVVSSVKAYV  606

Query  1843  GALNKLLGFQ  1872
             GALNK+LGF+
Sbjct  607   GALNKMLGFK  616



>ref|XP_010672456.1| PREDICTED: 2-isopropylmalate synthase A-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=631

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/614 (72%), Positives = 511/614 (83%), Gaps = 10/614 (2%)
 Frame = +1

Query  58    MACLRASPNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVR  237
             MA L +S   P  TP  SK      P  T+ +  S +   S+S  S+ P+ +  S   +R
Sbjct  1     MATLTSSNLSPTYTP-FSKPIFPKTPFTTLLSLSSPKPSVSLS--SKTPTTKPTSI--IR  55

Query  238   CES-SPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVD  414
             C + SP  RRP+YIPN+I DPNYVRIFDTTLRDGEQSPGA+MT K+KL +AR LARLGVD
Sbjct  56    CSTTSPLQRRPDYIPNKIPDPNYVRIFDTTLRDGEQSPGASMTPKQKLEIARHLARLGVD  115

Query  415   IIEAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKK  588
             IIEAGFPASS ADLEAV+ IA EVG    E  +VPVICGL+RCNK DID AWEAVK+AK+
Sbjct  116   IIEAGFPASSNADLEAVKTIAIEVGNFVDEFGYVPVICGLSRCNKADIDAAWEAVKYAKR  175

Query  589   PRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  768
             PRIHTFIATSEIHM +KL  +RE+V+E A SMV+YARSLGC DVEFSPEDAGRSDREFLY
Sbjct  176   PRIHTFIATSEIHMQHKLNKTREEVIEIAKSMVSYARSLGCDDVEFSPEDAGRSDREFLY  235

Query  769   QILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  948
             QILGEVI+AGATTLNIPDTVGYT+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTA
Sbjct  236   QILGEVIRAGATTLNIPDTVGYTVPKEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  295

Query  949   NTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMAS  1128
             NT++GACAGARQLEVTINGIGERAGNASLEEVVM +KCRG Q LGGL+TGI T+ I+ AS
Sbjct  296   NTVSGACAGARQLEVTINGIGERAGNASLEEVVMTIKCRG-QSLGGLHTGIQTEHIVKAS  354

Query  1129  KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIV  1308
             KMV EYTGL VQPHKAIVGANAF HESGIHQ GMLKHK TYEI+SPEDIGL RA+ESG+V
Sbjct  355   KMVAEYTGLLVQPHKAIVGANAFKHESGIHQHGMLKHKGTYEIMSPEDIGLQRADESGLV  414

Query  1309  LGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQ  1488
             LGKLSGRHALQ ++ +LGY  EGKEL+D+FWRFKSVAE+KK V D+D+ ALV DE+FQP 
Sbjct  415   LGKLSGRHALQKRLEQLGYFFEGKELDDVFWRFKSVAEKKKHVLDEDIEALVVDELFQPD  474

Query  1489  VFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLL  1668
               W LGD+QVTCG+LGLSTATVKLI ADG+EHVAC+VGTGPVD+AYKAVD + K+PVTLL
Sbjct  475   SVWSLGDLQVTCGTLGLSTATVKLICADGKEHVACAVGTGPVDSAYKAVDSIVKMPVTLL  534

Query  1669  EYSMNAVTEGIDAIASTRVLIR-EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVG  1845
             EYS++AVTEGIDA+A+TRVLIR E+  +   + G    RSF+G+G+ MD+V+SSVRAYV 
Sbjct  535   EYSLSAVTEGIDALATTRVLIRGENGFTSTQANGEQIRRSFSGSGSEMDIVVSSVRAYVS  594

Query  1846  ALNKLLGFQNLVSR  1887
             ALNK+L F N  S+
Sbjct  595   ALNKMLAFNNKSSQ  608



>ref|XP_008457079.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis 
melo]
Length=641

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/544 (77%), Positives = 492/544 (90%), Gaps = 4/544 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRP YIPNRI DP+YVRIFDTTLRDGEQSPGA++TTKEKL +ARQLA+LGVDIIEAGFPA
Sbjct  80    RRPPYIPNRIPDPSYVRIFDTTLRDGEQSPGASLTTKEKLDIARQLAKLGVDIIEAGFPA  139

Query  439   SSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             +S+ D EAV++IA+E+G    E  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIA
Sbjct  140   ASKEDFEAVKMIAKEIGSAVDEDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  199

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIHM +KL+ +REQV+E A +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIK
Sbjct  200   TSEIHMEHKLRKTREQVIEIARNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIK  259

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVGYT+P EFG+LIADIK+NTPGIENVIISTHCQNDLGL+TANT+AGACA
Sbjct  260   AGATTLNIPDTVGYTMPFEFGKLIADIKSNTPGIENVIISTHCQNDLGLATANTVAGACA  319

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQ+EVTINGIGERAGNASLEEVVMAL+CRGE VLGGL+TGIN + I + SKMVEE+TG
Sbjct  320   GARQVEVTINGIGERAGNASLEEVVMALQCRGEHVLGGLHTGINPRHIFLTSKMVEEFTG  379

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             L+VQPHKAIVGANAFAH SGIHQDGMLKHK TYEI++PEDIG  R+N++GIVLGKLSGRH
Sbjct  380   LNVQPHKAIVGANAFAHASGIHQDGMLKHKGTYEIMAPEDIGYERSNDAGIVLGKLSGRH  439

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL++++LELGYE++ + L ++FWRFK+VAE+KK+VTD DL ALVSDEVFQP V W+L D+
Sbjct  440   ALKSRLLELGYELDSENLHNVFWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDL  499

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QVTCG+LGLSTATVKL+DADG+EH+ACSVGTGPVD+AYKAVDL+ K P TLLEYSMNAVT
Sbjct  500   QVTCGTLGLSTATVKLLDADGKEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  559

Query  1693  EGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             EGIDAIA+TRVLIR D++  S +  TG +  R+F+G GA MD+V+SSV+AY+GALNK+LG
Sbjct  560   EGIDAIATTRVLIRGDKSYTSTNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLG  619

Query  1867  FQNL  1878
             FQ +
Sbjct  620   FQGI  623



>ref|XP_010471495.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Camelina 
sativa]
Length=627

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/586 (73%), Positives = 507/586 (87%), Gaps = 9/586 (2%)
 Frame = +1

Query  166   QLRFSISGASRRPSFQSFSAAAVRCESSP-PA----RRPEYIPNRILDPNYVRIFDTTLR  330
              LR    GA    + + F  +    +SSP P+    RRP+YIPNRI DPNYVRIFDTTLR
Sbjct  32    HLRSHHHGAVSLCTAEKFRVSCSISDSSPLPSHSHRRRPDYIPNRISDPNYVRIFDTTLR  91

Query  331   DGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR--GEGD  504
             DGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+ VG    E  
Sbjct  92    DGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKTVGNTVDENG  151

Query  505   HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSM  684
             +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTFIATS+IH+ YKLK S+++V+E A +M
Sbjct  152   YVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIATSDIHLMYKLKKSKDEVIEIARNM  211

Query  685   VAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLI  864
             VA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGATTLNIPDTVG T+P+EFGQLI
Sbjct  212   VAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLI  271

Query  865   ADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEV  1044
             ADIKANTPGI+NV+ISTHCQNDLGLSTANTL+GA +GARQ+EVTINGIGERAGNASLEEV
Sbjct  272   ADIKANTPGIQNVVISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEV  331

Query  1045  VMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQD  1224
             VMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  QPHKAIVGANAFAHESGIHQD
Sbjct  332   VMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQD  391

Query  1225  GMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWR  1404
             GMLKHK TYEI+SPE+IGL R+NE+GIVLGKLSGRHAL+ ++ ELGY ++  +L +LFWR
Sbjct  392   GMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSGRHALKDRLNELGYVLDDGQLSNLFWR  451

Query  1405  FKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEH  1584
             FK+VAE+KK+VTD DLIALVSDEVFQP+  W+L D+Q+TCG+LGLST+TVKL D+DG+EH
Sbjct  452   FKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEH  511

Query  1585  VACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQ--ASIHG  1758
             VACSVGTGPVDAAYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR D+  +S + 
Sbjct  512   VACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDKNYSSTNA  571

Query  1759  STGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNK  1896
              TG S  R+F+GTGA MD+V+SSV+AYVGALNK+LGF+   S   K
Sbjct  572   VTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLGFKEHSSTLRK  617



>ref|XP_004165080.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis 
sativus]
Length=639

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/583 (73%), Positives = 508/583 (87%), Gaps = 11/583 (2%)
 Frame = +1

Query  160   SKQLRFSISGASR----RPSFQSFSAAAVRCESSPPA--RRPEYIPNRILDPNYVRIFDT  321
             S+ L F  + AS      P +   + + V   S P +  RRP YIPNRI DP+YVR+FDT
Sbjct  40    SRSLSFKTAAASAPHNVSPVYSCLTESIV-SNSVPKSSIRRPPYIPNRIPDPSYVRVFDT  98

Query  322   TLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--  495
             TLRDGEQSPGA++T KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV++IA+E+G    
Sbjct  99    TLRDGEQSPGASLTVKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVKMIAKEIGNAVD  158

Query  496   EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKA  675
             E  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIATSEIHM +KL+ ++E+V+E A
Sbjct  159   EDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSEIHMEHKLRKTKEEVIEIA  218

Query  676   TSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFG  855
              +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT+P EFG
Sbjct  219   RNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTMPFEFG  278

Query  856   QLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASL  1035
             +LIADIK+NTPGIENVIIS+HCQNDLGL+TANT+AGACAGARQ+EVTINGIGERAGNASL
Sbjct  279   KLIADIKSNTPGIENVIISSHCQNDLGLATANTVAGACAGARQVEVTINGIGERAGNASL  338

Query  1036  EEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGI  1215
             EEVVMAL+CRGE VLGGL+TGIN++ I + SKMVEE+TGL+VQPHKAIVGANAFAH SGI
Sbjct  339   EEVVMALQCRGEHVLGGLHTGINSRHIFLTSKMVEEFTGLNVQPHKAIVGANAFAHASGI  398

Query  1216  HQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDL  1395
             HQDGMLKHK TYEI++PEDIG  R+N++GIVLGKLSGRHAL++ +LELGYE++G+ L+++
Sbjct  399   HQDGMLKHKGTYEIMAPEDIGYERSNDAGIVLGKLSGRHALKSLLLELGYELDGENLDNV  458

Query  1396  FWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADG  1575
             FWRFK+VAE+KK+VTD DL ALVSDEVFQP V W+L D+QVTCG+LGLSTATVKL+DADG
Sbjct  459   FWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDMQVTCGTLGLSTATVKLLDADG  518

Query  1576  EEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA--S  1749
             +EH+ACSVGTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR D++  S
Sbjct  519   KEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDKSYTS  578

Query  1750  IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
              +  TG +  R+F+G GA MD+V+SSV+AY+GALNK+LGFQ +
Sbjct  579   TNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLGFQGI  621



>ref|XP_011021916.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Populus 
euphratica]
Length=621

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/542 (79%), Positives = 486/542 (90%), Gaps = 6/542 (1%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP Y+PN+I DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+
Sbjct  64    RPVYVPNKIPDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA  123

Query  442   SEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             S+ D EAV++IA EVG     EG +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIA
Sbjct  124   SKDDFEAVKMIANEVGNQVDSEG-YVPVICGLSRCNEKDIRAAWEAVKNAKRPRIHTFIA  182

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TS IHM YKL+ S+E+VVE A+SMV +ARSLGC DVEFSPEDAGRS+REFLY ILGEVIK
Sbjct  183   TSGIHMEYKLRKSKEEVVEIASSMVRFARSLGCDDVEFSPEDAGRSEREFLYHILGEVIK  242

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVG   P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GACA
Sbjct  243   AGATTLNIPDTVGINTPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGACA  302

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQ+EVTINGIGERAGNASLEEVVM +KCRGE VLGGLYTGINT+ I MASKMVEEYTG
Sbjct  303   GARQVEVTINGIGERAGNASLEEVVMVIKCRGEHVLGGLYTGINTRHITMASKMVEEYTG  362

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             LHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R+N++GIVLGKLSGRH
Sbjct  363   LHVQPHKAIVGANAFAHESGIHQDGMLKHKSTYEIISPEDIGLERSNDAGIVLGKLSGRH  422

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL+ ++ ELGYE++  +L ++FWRFK+VAE KK+VTD DLIALVSDEVFQP+  W+L D+
Sbjct  423   ALKDRLNELGYELDDAQLGNIFWRFKAVAETKKRVTDADLIALVSDEVFQPENVWKLHDL  482

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QVTCG+LGLSTATVKL+ ADGEEHVACS+GTGPVD+AYKAVDL+ K PVTLLEYSMNAVT
Sbjct  483   QVTCGTLGLSTATVKLLSADGEEHVACSLGTGPVDSAYKAVDLIVKEPVTLLEYSMNAVT  542

Query  1693  EGIDAIASTRVLIR-EDQ-ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             EGIDAIA+TRV+IR E+Q A  H  T     R+F+G+GA MD+V+SSV+AY+GALNK+L 
Sbjct  543   EGIDAIATTRVVIRGENQHAPTHALTDEPFQRTFSGSGAGMDIVVSSVKAYIGALNKMLA  602

Query  1867  FQ  1872
             F+
Sbjct  603   FK  604



>gb|ABA26446.1| 2-isopropylmalate synthase 1 [Brassica insularis]
Length=623

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/605 (71%), Positives = 510/605 (84%), Gaps = 22/605 (4%)
 Frame = +1

Query  76    SPNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPP  255
             +P+ P  +   S  + ++ P H  ++   K LR S S +                + SPP
Sbjct  19    TPSLPSFSSKPSPLSFRFPPSHHRSSLRIKSLRLSCSLS----------------DPSPP  62

Query  256   A--RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAG  429
                RRPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVD+IEAG
Sbjct  63    LCRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAG  122

Query  430   FPASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHT  603
             FPA+S+ D EAV+ IA  VG   +GD +VPVICGL+RCNKRDI+ AWEAVK+AK+PRIHT
Sbjct  123   FPAASKDDFEAVKTIAGTVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKRPRIHT  182

Query  604   FIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  783
             FIATS+IH+ YKLK S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLYQILGE
Sbjct  183   FIATSDIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYQILGE  242

Query  784   VIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  963
             VIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+G
Sbjct  243   VIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSG  302

Query  964   ACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEE  1143
             A +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+
Sbjct  303   AHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVED  362

Query  1144  YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLS  1323
             YTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLS
Sbjct  363   YTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLS  422

Query  1324  GRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRL  1503
             GRHAL+ ++ ELGY ++ ++L  +FWRFKSVAERKK+VTD D+IALVSDEVFQP+  W+L
Sbjct  423   GRHALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWKL  482

Query  1504  GDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMN  1683
              D+Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEYSMN
Sbjct  483   LDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMN  542

Query  1684  AVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNK  1857
             AVTEGIDAIA+TRVLIR   + ++ +  TG    R+F+GTGA MD+V+SSV+AYVGALNK
Sbjct  543   AVTEGIDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNK  602

Query  1858  LLGFQ  1872
             +L F+
Sbjct  603   MLDFK  607



>ref|XP_008232670.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform 
X1 [Prunus mume]
Length=633

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/551 (77%), Positives = 489/551 (89%), Gaps = 7/551 (1%)
 Frame = +1

Query  241   ESSPP--ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVD  414
             +S+ P  ARRP+YIPNRI DPNYVRIFDTTLRDGEQSPGA++T+KEKL +ARQLA+LGVD
Sbjct  67    QSTNPKAARRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARQLAKLGVD  126

Query  415   IIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKK  588
             IIEAGFPA+S  D EAV++IA+EVG    +  +VPVICGL+RCNK+DI +AW+AV+ AK+
Sbjct  127   IIEAGFPAASNDDFEAVKMIAKEVGNSVDKDGYVPVICGLSRCNKKDIKRAWDAVECAKR  186

Query  589   PRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  768
             PRIHTFIATS IHM +KL+ ++EQVVE A  MV+YARSLGC DVEFSPEDAGRSDREFLY
Sbjct  187   PRIHTFIATSAIHMEHKLRKTKEQVVEIARDMVSYARSLGCDDVEFSPEDAGRSDREFLY  246

Query  769   QILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  948
             QILGEVIKAGATTLNIPDTVGY +P+E+ QLI+DIK+NT GIENVIISTHCQNDLGLSTA
Sbjct  247   QILGEVIKAGATTLNIPDTVGYNVPSEYSQLISDIKSNTTGIENVIISTHCQNDLGLSTA  306

Query  949   NTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMAS  1128
             NT+AGA AGARQLEVTINGIGERAGNASLEEVVM L CRG+ VLGGLYTGIN + I + S
Sbjct  307   NTIAGASAGARQLEVTINGIGERAGNASLEEVVMTLDCRGDHVLGGLYTGINARHIYITS  366

Query  1129  KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIV  1308
             KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIG  R+NE+GIV
Sbjct  367   KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIV  426

Query  1309  LGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQ  1488
             LGKLSGRHAL+ ++ ELGYE+   +LE +FWRFK+VA++KK+VTD DL ALVSDEVFQP+
Sbjct  427   LGKLSGRHALKKRLEELGYELADDQLETIFWRFKAVADQKKRVTDADLRALVSDEVFQPE  486

Query  1489  VFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKV-PVTL  1665
             V W+L D+QVTCG+LGLSTATVKLIDADG EHVAC++GTGPVD+AYKAVDL+ K  PVTL
Sbjct  487   VVWKLHDLQVTCGTLGLSTATVKLIDADGREHVACAIGTGPVDSAYKAVDLIVKQEPVTL  546

Query  1666  LEYSMNAVTEGIDAIASTRVLIREDQASI--HGSTGGSANRSFNGTGAAMDVVISSVRAY  1839
             LEYSMNAVTEGIDAIA+TRVLIR + ++I  H  TG +  R+F+G GA MD+V+SSV+AY
Sbjct  547   LEYSMNAVTEGIDAIATTRVLIRGENSNITTHAFTGETVQRTFSGIGAGMDIVVSSVKAY  606

Query  1840  VGALNKLLGFQ  1872
             VGALNK+LGF+
Sbjct  607   VGALNKMLGFK  617



>ref|XP_006390475.1| hypothetical protein EUTSA_v10018267mg [Eutrema salsugineum]
 gb|ESQ27761.1| hypothetical protein EUTSA_v10018267mg [Eutrema salsugineum]
Length=631

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/544 (77%), Positives = 487/544 (90%), Gaps = 4/544 (1%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P RRPEY PNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGF
Sbjct  69    PRRRPEYTPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGF  128

Query  433   PASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             PA+S+ D EAV+ IAE VG    E  +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTF
Sbjct  129   PAASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTF  188

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS+IH+ YKLK S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEV
Sbjct  189   IATSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCQDVEFSPEDAGRSEREYLYEILGEV  248

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVG T+P+EFGQLIADIKANTPG +NVIISTHCQNDLGLSTANTLAGA
Sbjct  249   IKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGNQNVIISTHCQNDLGLSTANTLAGA  308

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVEEY
Sbjct  309   HSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEEY  368

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             TG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+NE+GIVLGKLSG
Sbjct  369   TGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMCPEEIGLERSNEAGIVLGKLSG  428

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHAL+ ++ ELGYE+  ++L +LFWRFK+VAE+KK+VTD DLIALVSDEVFQP+  W+L 
Sbjct  429   RHALRDRLNELGYELNDEQLSNLFWRFKTVAEQKKRVTDADLIALVSDEVFQPEAVWKLL  488

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             D+Q+TCG+LGLST+TVKL D+DG+EHVACS+GTGPVDAAYKAVDL+ K P TLLEYSMNA
Sbjct  489   DMQITCGTLGLSTSTVKLADSDGKEHVACSIGTGPVDAAYKAVDLIVKEPATLLEYSMNA  548

Query  1687  VTEGIDAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             VTEGIDAIA+TRVLIR D   +S +  TG S  R+F+G GA MD+V+SSV+AYVGALNK+
Sbjct  549   VTEGIDAIATTRVLIRGDNNYSSTNAVTGESVQRTFSGAGAGMDIVVSSVKAYVGALNKM  608

Query  1861  LGFQ  1872
             LGF+
Sbjct  609   LGFK  612



>ref|XP_010274930.1| PREDICTED: 2-isopropylmalate synthase A-like [Nelumbo nucifera]
Length=613

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/586 (74%), Positives = 502/586 (86%), Gaps = 12/586 (2%)
 Frame = +1

Query  133   PIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRI  312
             P H++   F     FS+    R  S  SFS+  ++C +S    RPEYIPNRI DP YVRI
Sbjct  26    PAHSV---FLVTKSFSVRSPHR--SVDSFSSKTIKCCASA---RPEYIPNRIPDPLYVRI  77

Query  313   FDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR  492
             FDTTLRDGEQSPGATMT+KEKL +ARQLA+LGVDIIEAGFPA+S+ DLEAV+ IA EVG 
Sbjct  78    FDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKDDLEAVKTIAMEVGN  137

Query  493   G--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVV  666
                E  +VPVICGLARCN+ DID AWEAVKHAK+PRIHTFIATSEIHM +KL+ SRE+V+
Sbjct  138   DVDETGYVPVICGLARCNRADIDAAWEAVKHAKRPRIHTFIATSEIHMKHKLRKSREEVI  197

Query  667   EKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPN  846
             + A  MV+YARSLGC DVEFSPEDAGRS++EFLYQIL EVIKAGATTLNIPDTVG  + +
Sbjct  198   QIARDMVSYARSLGCQDVEFSPEDAGRSEKEFLYQILEEVIKAGATTLNIPDTVGCLLED  257

Query  847   EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGN  1026
             EF QLIADIKANTPGIENVIISTHCQNDLG ++ NT+AGA AGARQLEVTINGIGERAGN
Sbjct  258   EFAQLIADIKANTPGIENVIISTHCQNDLGQASGNTIAGARAGARQLEVTINGIGERAGN  317

Query  1027  ASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHE  1206
             ASLEEVVMA+K RG+ ++GGLYTGINT+ I M SKMV EY+GL VQPHKAIVGANAF+HE
Sbjct  318   ASLEEVVMAIKTRGKAIMGGLYTGINTKHIFMTSKMVTEYSGLPVQPHKAIVGANAFSHE  377

Query  1207  SGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKEL  1386
             SGIHQDGMLK K TYEI+SPEDIGL+R+N+SGIVLGKLSGRHAL++++LELGYE++ KE 
Sbjct  378   SGIHQDGMLKFKGTYEIMSPEDIGLYRSNDSGIVLGKLSGRHALRSRLLELGYELDSKEF  437

Query  1387  EDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLID  1566
             +DLFWRFK+VAE+KK ++D D+ AL+ DE+FQPQV W LGD+QVTCG+LGLSTATVKLI 
Sbjct  438   DDLFWRFKTVAEKKKHISDGDIEALILDEIFQPQVVWSLGDLQVTCGTLGLSTATVKLIA  497

Query  1567  ADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR-EDQ  1743
             ADG EHVACSVGTGPVDAAYKAVD + K+PVTL+EYSMNAVTEGIDAIASTRV+IR ED 
Sbjct  498   ADGVEHVACSVGTGPVDAAYKAVDQIVKIPVTLVEYSMNAVTEGIDAIASTRVVIRGEDA  557

Query  1744  ASI-HGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
              ++ H  +G    R+F+GTGA MD+V+SSVRAYVGALNK+LGFQ++
Sbjct  558   HTVKHALSGQITQRTFSGTGAGMDIVVSSVRAYVGALNKVLGFQSV  603



>ref|XP_006300309.1| hypothetical protein CARUB_v10019832mg [Capsella rubella]
 gb|EOA33207.1| hypothetical protein CARUB_v10019832mg [Capsella rubella]
Length=781

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/552 (76%), Positives = 490/552 (89%), Gaps = 4/552 (1%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P  RP+YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGF
Sbjct  220   PRLRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGF  279

Query  433   PASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             PA+S+ D EAV+ IAE VG    E  +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTF
Sbjct  280   PAASKDDFEAVKTIAETVGNTMDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTF  339

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS+IH+ YKLK S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEV
Sbjct  340   IATSDIHLKYKLKKSKEEVIEIARNMVGFARSLGCQDVEFSPEDAGRSEREYLYEILGEV  399

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA
Sbjct  400   IKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGA  459

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEY
Sbjct  460   HSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEY  519

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             TG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPE+IGL R+NE+GIVLGKLSG
Sbjct  520   TGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSG  579

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHAL+ ++ ELGY ++  +L +LFWRFK+VAE+KK+VTD DLIALVSDEVFQP+  W+L 
Sbjct  580   RHALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLL  639

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             D+Q+TCG+LGLST+TVKL D+DG+EHVACS+GTGPVDAAYKAVDL+ K P TLLEYSMNA
Sbjct  640   DIQITCGTLGLSTSTVKLSDSDGKEHVACSIGTGPVDAAYKAVDLIVKEPATLLEYSMNA  699

Query  1687  VTEGIDAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             VTEGIDAIASTRVLIR     +S +  TG S  R+F+GTGA MD+V+SSV+AYVGALNK+
Sbjct  700   VTEGIDAIASTRVLIRGGNYYSSTNAITGESVERTFSGTGAGMDIVVSSVKAYVGALNKM  759

Query  1861  LGFQNLVSRYNK  1896
             LGF+   S   K
Sbjct  760   LGFKEHSSTLRK  771



>ref|XP_010416235.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Camelina 
sativa]
Length=627

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/586 (73%), Positives = 503/586 (86%), Gaps = 9/586 (2%)
 Frame = +1

Query  166   QLRFSISGASRRPSFQSFSAAAVRCESSP-PA----RRPEYIPNRILDPNYVRIFDTTLR  330
              LR    GA    + + F  +    +SSP P+    RRP+YIPNRI DPNY+RIFDTTLR
Sbjct  32    HLRSHHHGAVSLCTAEKFRVSCSISDSSPLPSHSHRRRPDYIPNRISDPNYIRIFDTTLR  91

Query  331   DGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR--GEGD  504
             DGEQSPGAT+T+KEKL +A QLA L VDIIEAGFPA+S+ D EAV+ IAE VG    E  
Sbjct  92    DGEQSPGATLTSKEKLDIASQLANLEVDIIEAGFPAASKDDFEAVKTIAETVGNTVDENG  151

Query  505   HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSM  684
             +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTFIATS+IH+ YKLK S+++V+E A +M
Sbjct  152   YVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIATSDIHLKYKLKKSKDEVIEIARNM  211

Query  685   VAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLI  864
             VA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGATTLNIPDTVG T+P+EFGQLI
Sbjct  212   VAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLI  271

Query  865   ADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEV  1044
             ADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA +GARQ+EVTINGIGERAGNASLEEV
Sbjct  272   ADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEV  331

Query  1045  VMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQD  1224
             VMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  QPHKAIVGANAFAHESGIHQD
Sbjct  332   VMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQD  391

Query  1225  GMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWR  1404
             GMLKHK TYEI+SPE+IGL R+NE+GIVLGKLSGRHAL+ ++ ELGY ++  +L +LFWR
Sbjct  392   GMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSGRHALKDRLNELGYVLDDGQLSNLFWR  451

Query  1405  FKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEH  1584
             FK+VAE+KK+VTD DLIALVSDEVFQP+  W+L D+Q+TCG+LGLST+TVKL D+DG+EH
Sbjct  452   FKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEH  511

Query  1585  VACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQ--ASIHG  1758
             VACSVGTGPVDAAYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR D   +S + 
Sbjct  512   VACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDNNYSSTNA  571

Query  1759  STGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNK  1896
              TG S  R+F+GTGA MD+V+SSV+AYVGALNK+LGF+   S   K
Sbjct  572   VTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLGFKEYSSTLRK  617



>ref|XP_006416598.1| hypothetical protein EUTSA_v10007073mg [Eutrema salsugineum]
 gb|ESQ34951.1| hypothetical protein EUTSA_v10007073mg [Eutrema salsugineum]
Length=625

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/611 (72%), Positives = 515/611 (84%), Gaps = 11/611 (2%)
 Frame = +1

Query  61    ACLRASPNPPVIT---PPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAA  231
             + L  SPN   IT   P    ++ K     T++  F  +   S+ G S R S  S S  +
Sbjct  3     SSLLKSPNLSSITITTPSLPAFSSKS---PTVSFRFRHRSSISLRGDSFRLSC-SVSDPS  58

Query  232   VRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGV  411
                  SP  RRPEYIP+RI DP+YVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGV
Sbjct  59    PLPPHSPRRRRPEYIPSRISDPSYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGV  118

Query  412   DIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAK  585
             DIIEAGFPA+S+ D EAV+ IA+ VG    E  +VPVICGL+RCNK+DI+ AWEAVK+AK
Sbjct  119   DIIEAGFPAASKDDFEAVKTIAKTVGNDVDENGYVPVICGLSRCNKKDIETAWEAVKYAK  178

Query  586   KPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  765
             +PRIHTFIATS+IH+ YKLK S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+REFL
Sbjct  179   RPRIHTFIATSDIHLEYKLKKSKEEVIEIARNMVMFARSLGCEDVEFSPEDAGRSEREFL  238

Query  766   YQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLST  945
             YQILGEVIKAGATTLNIPDTVG T+P+EFGQLIAD+KANTPGIENVIISTHCQNDLGLST
Sbjct  239   YQILGEVIKAGATTLNIPDTVGITLPSEFGQLIADLKANTPGIENVIISTHCQNDLGLST  298

Query  946   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMA  1125
             ANTL+GA AGARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M 
Sbjct  299   ANTLSGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMT  358

Query  1126  SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGI  1305
             SKMVEEYTG+H QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GI
Sbjct  359   SKMVEEYTGMHTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGI  418

Query  1306  VLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQP  1485
             VLGKLSGRHAL+ ++ ELGYE++ ++L  +FWRFKSVAERKK+VTD D+IALVSDEVFQP
Sbjct  419   VLGKLSGRHALKGRLTELGYELDDEQLSTIFWRFKSVAERKKRVTDADIIALVSDEVFQP  478

Query  1486  QVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTL  1665
             +  W+L D+Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TL
Sbjct  479   EAVWKLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATL  538

Query  1666  LEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAY  1839
             LEYSMNAVTEGIDAIA+TRVLIR   + +S +  TG    R+F+GTGA MD+V+SSV+AY
Sbjct  539   LEYSMNAVTEGIDAIATTRVLIRGNNNYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAY  598

Query  1840  VGALNKLLGFQ  1872
             VGALNK+L F+
Sbjct  599   VGALNKMLDFK  609



>ref|XP_010097501.1| 2-isopropylmalate synthase 2 [Morus notabilis]
 gb|EXB68692.1| 2-isopropylmalate synthase 2 [Morus notabilis]
Length=637

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/563 (76%), Positives = 496/563 (88%), Gaps = 11/563 (2%)
 Frame = +1

Query  220   SAAAVRCESS---PPA----RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKL  378
             S   V C+SS   PPA    RR EY+PNRI DP YVRIFDTTLRDGEQSPGA++T+KEKL
Sbjct  60    SDCLVFCQSSDGQPPATGRRRRSEYVPNRISDPYYVRIFDTTLRDGEQSPGASLTSKEKL  119

Query  379   AVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDI  552
              +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG    +  +VPVICGL+RCN+ DI
Sbjct  120   DIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDKDGYVPVICGLSRCNENDI  179

Query  553   DKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSP  732
               AWEAVK+AK+PRIHTFIATS IHM YKL+ S+EQV+E A +MV +ARSLGC DVEFSP
Sbjct  180   RTAWEAVKYAKRPRIHTFIATSPIHMEYKLRKSKEQVIEIARNMVKFARSLGCEDVEFSP  239

Query  733   EDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIIS  912
             EDAGRSDREFLY+ILGEVIKAGATTLNIPDTVGYT+P EFG+LIADIKANT GIENVIIS
Sbjct  240   EDAGRSDREFLYRILGEVIKAGATTLNIPDTVGYTVPEEFGKLIADIKANTFGIENVIIS  299

Query  913   THCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLY  1092
             THCQNDLGLSTANT+AGACAGARQLEVTINGIGERAGNASLEEVVM LKCRGE+ LGGL+
Sbjct  300   THCQNDLGLSTANTIAGACAGARQLEVTINGIGERAGNASLEEVVMTLKCRGERELGGLH  359

Query  1093  TGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPED  1272
             T INT+ I+M SKMVE+YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEII+PED
Sbjct  360   TRINTKHIMMTSKMVEDYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIIAPED  419

Query  1273  IGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDL  1452
             IGL R NE+GIVLGKLSGRHAL+ ++ ELGYE++ ++L  +FWRFK+VA++KK+VTD DL
Sbjct  420   IGLERINEAGIVLGKLSGRHALKRRLEELGYELDDEQLGSIFWRFKAVADQKKRVTDADL  479

Query  1453  IALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKA  1632
              ALV+DEVFQP+V W+L D+QVTCG+LGLSTATVKL+DADG+++VACSVGTGPVD+AYKA
Sbjct  480   RALVTDEVFQPEVVWKLVDLQVTCGTLGLSTATVKLVDADGKDYVACSVGTGPVDSAYKA  539

Query  1633  VDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQAS--IHGSTGGSANRSFNGTGAA  1806
             VDL+ K PVTLLEYSM AVTEGIDAIA+TRVLIR + A    H STG S +R+F+G GA 
Sbjct  540   VDLIVKEPVTLLEYSMIAVTEGIDAIATTRVLIRGENACSPTHASTGESVSRTFSGNGAG  599

Query  1807  MDVVISSVRAYVGALNKLLGFQN  1875
             MD+V+SSV+AY+GALNK+LGF++
Sbjct  600   MDIVVSSVKAYIGALNKMLGFKD  622



>gb|KFK44007.1| hypothetical protein AALP_AA1G202700 [Arabis alpina]
Length=627

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/607 (71%), Positives = 509/607 (84%), Gaps = 25/607 (4%)
 Frame = +1

Query  94    ITPPE-SKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPPA----  258
             ITPP    ++ +  P+ +     S   +FS+    RR S +      + C  S P+    
Sbjct  16    ITPPSLPTFSSQSTPV-SFRFRPSPHRQFSL----RRESLR------ISCSISDPSPLPP  64

Query  259   -----RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
                  RRPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIE
Sbjct  65    HALRRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIE  124

Query  424   AGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRI  597
             AGFPA+S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI+ AWEAVK+AK+PRI
Sbjct  125   AGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRI  184

Query  598   HTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  777
             HTFIATS IH+ YKLK ++E+V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLY+IL
Sbjct  185   HTFIATSNIHLEYKLKKTKEEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYEIL  244

Query  778   GEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  957
             GEVIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL
Sbjct  245   GEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  304

Query  958   AGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMV  1137
             +GA +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTG++T+ I+M SKMV
Sbjct  305   SGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGLDTRHIVMTSKMV  364

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGK  1317
             EEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGK
Sbjct  365   EEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGK  424

Query  1318  LSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFW  1497
             LSGRHAL+ ++ ELGYE++ ++L  +FWRFKSVAE+KKKVTD D+IALVSDEVFQP+  W
Sbjct  425   LSGRHALKDRLTELGYELDDEQLSTIFWRFKSVAEQKKKVTDADIIALVSDEVFQPEAVW  484

Query  1498  RLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYS  1677
             +L D+Q+TCG+LGLSTATVKL +ADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEYS
Sbjct  485   KLLDIQITCGTLGLSTATVKLAEADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYS  544

Query  1678  MNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGAL  1851
             MNAVTEGIDAIA+TRVLIR   +  + +  TG    R+F+GTGA MD+V+SSV+AYVGAL
Sbjct  545   MNAVTEGIDAIATTRVLIRGNNNYTATNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGAL  604

Query  1852  NKLLGFQ  1872
             NK+L F+
Sbjct  605   NKMLDFK  611



>ref|XP_009411766.1| PREDICTED: 2-isopropylmalate synthase A-like [Musa acuminata 
subsp. malaccensis]
Length=629

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/570 (75%), Positives = 493/570 (86%), Gaps = 9/570 (2%)
 Frame = +1

Query  175   FSISGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGA  354
             FSI   S  P   S S  A++C  S P+R PEYIPN I DPNYVRIFDTTLRDGEQSPGA
Sbjct  46    FSIPSPSPLPKPWSRSGGALKC--SLPSR-PEYIPNHIPDPNYVRIFDTTLRDGEQSPGA  102

Query  355   TMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICG  525
             TMT+ EKL VAR L+RLGVDIIEAGFPASS  DL+AVR IA EVG    GE  HVPVICG
Sbjct  103   TMTSNEKLVVARHLSRLGVDIIEAGFPASSPDDLDAVRSIAIEVGNQPVGEDGHVPVICG  162

Query  526   LARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSL  705
             LARCNK+DID AWEAV+HAKKPR+HTFIATSEIH+ +KL+ +RE+VV  A  MVAYARSL
Sbjct  163   LARCNKKDIDAAWEAVRHAKKPRVHTFIATSEIHLQHKLRKTREEVVNIAREMVAYARSL  222

Query  706   GCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANT  885
             GC D+EFSPEDAGRSDREFLY +L EVIKAGATTLNIPDTVGYT+P+EFG+LIADIKANT
Sbjct  223   GCQDIEFSPEDAGRSDREFLYHVLEEVIKAGATTLNIPDTVGYTLPSEFGKLIADIKANT  282

Query  886   PGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCR  1065
             PGIEN IISTHCQNDLGL+TANTLAGA AGARQLEVT+NGIGERAGNASLEEVV+A+KCR
Sbjct  283   PGIENAIISTHCQNDLGLATANTLAGAYAGARQLEVTVNGIGERAGNASLEEVVVAMKCR  342

Query  1066  GEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKD  1245
              +++LGGLYTGINT+ I MASKMV E+TGLHVQPHKAIVGANAFAHESGIHQDGMLKHK 
Sbjct  343   -QELLGGLYTGINTKHIFMASKMVAEHTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKG  401

Query  1246  TYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAER  1425
             TYEIISPEDIGL R+NESGIVLGKLSGRHAL++++LE GY+I GKEL+D+F RFK VAE+
Sbjct  402   TYEIISPEDIGLSRSNESGIVLGKLSGRHALRSRLLEFGYDISGKELDDVFKRFKEVAEK  461

Query  1426  KKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGT  1605
             KK+++D+DL AL+SDE+FQP V W L ++Q TCG+LGLSTATVKL+ +DGEE +ACS+GT
Sbjct  462   KKRISDEDLEALISDEIFQPPVIWSLSELQATCGTLGLSTATVKLVSSDGEEKIACSIGT  521

Query  1606  GPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA--SIHGSTGGSAN  1779
             GPVDAAYKA+D + +V   L EY+MNAVTEGIDAIA+TRV+I  D +  S+H  TG +  
Sbjct  522   GPVDAAYKAIDSIVQVHAVLKEYAMNAVTEGIDAIATTRVVISGDDSYTSMHALTGETMR  581

Query  1780  RSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             R+F+G+GA+MDVV+SSVRAY+ ALNK+LGF
Sbjct  582   RTFSGSGASMDVVVSSVRAYISALNKMLGF  611



>ref|XP_004149446.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis 
sativus]
Length=633

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/583 (72%), Positives = 505/583 (87%), Gaps = 11/583 (2%)
 Frame = +1

Query  160   SKQLRFSISGASR----RPSFQSFSAAAVRCESSPPA--RRPEYIPNRILDPNYVRIFDT  321
             S+ L F  + AS      P +   + + V   S P A  RRP YIPNRI DP+YVR+FDT
Sbjct  40    SRSLSFKTAAASAPHNVSPVYSCLTESIV-SNSVPKASIRRPPYIPNRIPDPSYVRVFDT  98

Query  322   TLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--  495
             TLRDGEQSPGA++T KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV++IA+E+G    
Sbjct  99    TLRDGEQSPGASLTVKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVKMIAKEIGNAVD  158

Query  496   EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKA  675
             E  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIATSEIHM +KL+ ++E+V+E A
Sbjct  159   EDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSEIHMEHKLRKTKEEVIEIA  218

Query  676   TSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFG  855
              +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT+P EFG
Sbjct  219   RNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTMPFEFG  278

Query  856   QLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASL  1035
             +LIADIK+NTPGIENVIIS+HCQNDLGL+TANT+AGACAGARQ+EVTINGIGERAGNASL
Sbjct  279   KLIADIKSNTPGIENVIISSHCQNDLGLATANTVAGACAGARQVEVTINGIGERAGNASL  338

Query  1036  EEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGI  1215
             EEVVMAL+CRGE VLGGL+TGIN++ I + SKMVEE+TGL+VQPHKAIVGANAFAH SGI
Sbjct  339   EEVVMALQCRGEHVLGGLHTGINSRHIFLTSKMVEEFTGLNVQPHKAIVGANAFAHASGI  398

Query  1216  HQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDL  1395
             HQDGMLKHK TYEI++PEDIG  R+N++GIV  + SGRHAL++ +LELGYE++G+ L+++
Sbjct  399   HQDGMLKHKGTYEIMAPEDIGYERSNDAGIVFFEYSGRHALKSLLLELGYELDGENLDNV  458

Query  1396  FWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADG  1575
             FWRFK+VAE+KK+VTD DL ALVSDEVFQP V W+L D+QVTCG+LGLSTATVKL+DADG
Sbjct  459   FWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDMQVTCGTLGLSTATVKLLDADG  518

Query  1576  EEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA--S  1749
             +EH+ACSVGTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR D++  S
Sbjct  519   KEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDKSYTS  578

Query  1750  IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
              +  TG +  R+F+G GA MD+V+SSV+AY+GALNK+LGFQ +
Sbjct  579   TNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLGFQGI  621



>emb|CDY19217.1| BnaC05g14180D [Brassica napus]
Length=623

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/603 (71%), Positives = 506/603 (84%), Gaps = 18/603 (3%)
 Frame = +1

Query  76    SPNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPP  255
             +P+ P  +   S  + ++ P H  ++   K LR S S +   P  +              
Sbjct  19    TPSLPSFSSKPSPLSFRFPPSHHRSSLRIKSLRLSCSLSDPSPPLRRRRP----------  68

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
                 EYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVD+IEAGFP
Sbjct  69    ----EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFP  124

Query  436   ASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             A+S+ D EAV+ IAE VG   +GD +VPVICGL+RCNKRDI+ AWEAVK+AK+PRIHTFI
Sbjct  125   AASKDDFEAVKTIAETVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFI  184

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IH+ YKLK S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLYQILGEVI
Sbjct  185   ATSDIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYQILGEVI  244

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA 
Sbjct  245   KAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAH  304

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             +GARQLEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+YT
Sbjct  305   SGARQLEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYT  364

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGR
Sbjct  365   GMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGR  424

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGD  1509
             HAL+ ++ ELGY ++ ++L  +FWRFKSVAERKK+VTD D+IALVSDEVFQP+  W+L D
Sbjct  425   HALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWKLLD  484

Query  1510  VQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
             +Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDLV K P TLLEYSMNAV
Sbjct  485   IQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLVVKEPATLLEYSMNAV  544

Query  1690  TEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             TEGIDAIA+TRVLIR   + ++ +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L
Sbjct  545   TEGIDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKML  604

Query  1864  GFQ  1872
              F+
Sbjct  605   DFK  607



>ref|XP_007034041.1| 2-isopropylmalate synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY04967.1| 2-isopropylmalate synthase 1 isoform 1 [Theobroma cacao]
Length=657

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/622 (71%), Positives = 510/622 (82%), Gaps = 47/622 (8%)
 Frame = +1

Query  190   ASRRPSFQSFSA----------AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGE  339
             +S+ PSF SF +          +++      P+RRP +IPN I DPNYVR+FDTTLRDGE
Sbjct  34    SSKLPSFPSFPSKSCSKTFLISSSLTPNPPSPSRRPPFIPNHIPDPNYVRVFDTTLRDGE  93

Query  340   QSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVP  513
             QSPGATMT+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG    E  +VP
Sbjct  94    QSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDEDGYVP  153

Query  514   VICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAY  693
             VICGL+RCN++DI  AWEAVK+AK+PRIHTFIATS IHM YKL+ S+ +VV+ A SMV +
Sbjct  154   VICGLSRCNEKDIKAAWEAVKYAKRPRIHTFIATSGIHMEYKLRKSKAEVVDIARSMVRF  213

Query  694   ARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADI  873
             ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGATTLNIPDTVG  +P+EFGQLIADI
Sbjct  214   ARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGATTLNIPDTVGINLPSEFGQLIADI  273

Query  874   KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMA  1053
             KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ+EVTINGIGERAGNASLEEVVMA
Sbjct  274   KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQVEVTINGIGERAGNASLEEVVMA  333

Query  1054  LKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGML  1233
             LKCRGE VLGGLYTGINT+ I+MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGML
Sbjct  334   LKCRGEHVLGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGML  393

Query  1234  KHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKS  1413
             KHK TYEIISPEDIGL R+NE+GIVLGKLSGRHAL  ++ ELGYE++ ++L ++FWRFK+
Sbjct  394   KHKGTYEIISPEDIGLERSNEAGIVLGKLSGRHALSDRLKELGYELDQEQLGNIFWRFKA  453

Query  1414  VAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQ--------------------------  1515
             VAE+KK+VTD DLIALVSDEVFQP+V W+L D+Q                          
Sbjct  454   VAEQKKRVTDADLIALVSDEVFQPEVVWKLHDLQVAFLKRSRMQKNHDLGYMKWIAFLGG  513

Query  1516  -------VTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEY  1674
                    VTCG+LGLSTATVKLI ADGEEHVACSVGTGPVD+AYKAVDL+TK  VTLLEY
Sbjct  514   SSDPGNYVTCGTLGLSTATVKLISADGEEHVACSVGTGPVDSAYKAVDLITKEAVTLLEY  573

Query  1675  SMNAVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGA  1848
             S+ AVTEGIDAIA+TRVLIR +++  S H  TG   +R+F+GTGA MD+V+SSV+AY+GA
Sbjct  574   SLIAVTEGIDAIATTRVLIRTEKSHMSTHALTGEITHRTFSGTGAGMDIVVSSVKAYIGA  633

Query  1849  LNKLLGFQNLVSRYNKTQGTVV  1914
             +NK+LGF+  +      + T +
Sbjct  634   INKMLGFKEQIPTKGSAERTTI  655



>ref|XP_008786904.1| PREDICTED: 2-isopropylmalate synthase A-like [Phoenix dactylifera]
Length=631

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/558 (75%), Positives = 487/558 (87%), Gaps = 9/558 (2%)
 Frame = +1

Query  223   AAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLAR  402
             + A RC       RPEYIPN I DP YVR+FDTTLRDGEQSPGATMT+KEKL VARQL+R
Sbjct  62    SGATRCSLRS---RPEYIPNDIPDPRYVRVFDTTLRDGEQSPGATMTSKEKLVVARQLSR  118

Query  403   LGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAV  573
             LGVDIIEAGFPASS  DL+AVR IA EVG+    E  H+PVICGLARCNK+DID AWEAV
Sbjct  119   LGVDIIEAGFPASSPDDLDAVRSIAMEVGKQPVSEDGHIPVICGLARCNKKDIDAAWEAV  178

Query  574   KHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSD  753
             +HAKKPR+HTFIATSEIHM +KL+ +RE+VV  A  MVAYARSLGC D+EFSPEDAGRSD
Sbjct  179   RHAKKPRVHTFIATSEIHMQHKLRKTREEVVRIAREMVAYARSLGCQDIEFSPEDAGRSD  238

Query  754   REFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDL  933
             R+FLY +L EVIKAGATT+NIPDTVGYT+P+EF +LIADIKANT GIENVIISTHCQNDL
Sbjct  239   RDFLYHVLEEVIKAGATTVNIPDTVGYTLPSEFEKLIADIKANTHGIENVIISTHCQNDL  298

Query  934   GLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQ  1113
             GL+TANTLAGA AGARQLEVT+NGIGERAGNASLEEVV+A+KCR ++++GGLYTGINT+ 
Sbjct  299   GLATANTLAGAYAGARQLEVTVNGIGERAGNASLEEVVIAMKCR-QELMGGLYTGINTKH  357

Query  1114  IIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRAN  1293
             I+MASKMV EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK+TYEIISPEDIGL R+N
Sbjct  358   IVMASKMVAEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKNTYEIISPEDIGLSRSN  417

Query  1294  ESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDE  1473
             ESGIVLGKLSGRHAL++K+LE GY+I G ELED+F RFK VAE+KK+V+D+D+ AL++DE
Sbjct  418   ESGIVLGKLSGRHALRSKLLEFGYDINGNELEDVFKRFKEVAEKKKRVSDEDIEALITDE  477

Query  1474  VFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKV  1653
             +FQP V W LG++Q TCG+LGLSTATVKLI +DGEE +ACSVGTGPVDAAYKA+D + +V
Sbjct  478   IFQPAVIWSLGELQATCGTLGLSTATVKLIASDGEEKIACSVGTGPVDAAYKAIDSIVQV  537

Query  1654  PVTLLEYSMNAVTEGIDAIASTRVLIREDQAS--IHGSTGGSANRSFNGTGAAMDVVISS  1827
             P  L EY+MN+VTEGIDAIA+TRV+I  D  S  +H  TG S  R+F+G+GAAMD+V+SS
Sbjct  538   PAVLREYAMNSVTEGIDAIATTRVVIGGDNNSMAMHALTGESVRRTFSGSGAAMDIVVSS  597

Query  1828  VRAYVGALNKLLGFQNLV  1881
             VRAYV ALNK+LGF + V
Sbjct  598   VRAYVSALNKMLGFMSAV  615



>gb|KHF98529.1| 2-isopropylmalate synthase 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=648

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/594 (73%), Positives = 499/594 (84%), Gaps = 38/594 (6%)
 Frame = +1

Query  202   PSFQSFSAAAVRCESS-----PPA--RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATM  360
             PSF S S       SS     PP+  R P YIPN I DPNYVR+FDTTLRDGEQSPGAT+
Sbjct  39    PSFPSKSCPKSLPISSSLNPNPPSSQRCPPYIPNHIPDPNYVRVFDTTLRDGEQSPGATL  98

Query  361   TTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLA  531
             T+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG    G G +VPVICGL+
Sbjct  99    TSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDGNG-YVPVICGLS  157

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN++DI  AWEAVK+AK+PRIHTFIATS IH+ YKL+ S+E+V++ A +MV +ARSLGC
Sbjct  158   RCNEKDIKTAWEAVKYAKRPRIHTFIATSAIHLEYKLRKSKEEVLDIARNMVRFARSLGC  217

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
             +DVEFSPEDAGRSDREFLY+ILGEVIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPG
Sbjct  218   NDVEFSPEDAGRSDREFLYEILGEVIKAGATTLNIPDTVGITMPSEFGQLIADIKANTPG  277

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
             IENVIISTHCQNDLGLSTANT+AGACAGARQ+EVTINGIGERAGNAS+EEVVMALKCRGE
Sbjct  278   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASMEEVVMALKCRGE  337

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
              VLGGL+TGINT+ I+MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  338   HVLGGLHTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  397

Query  1252  EIISPEDIGLFRANESGIVLGKL-------------------------SGRHALQAKMLE  1356
             EIISPEDIGL R+NE+GIVLGKL                          GRHAL  ++ E
Sbjct  398   EIISPEDIGLERSNEAGIVLGKLRFLTFTNSMVLCYLELDMNVGVGPMGGRHALSDRLKE  457

Query  1357  LGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLG  1536
             LGYE++  +L ++FWRFK VAE+KK+VTD DL+ALVSDEVFQP V W+L D+QVTCG+LG
Sbjct  458   LGYELDDVQLGNIFWRFKEVAEQKKRVTDADLVALVSDEVFQPDVVWKLLDLQVTCGTLG  517

Query  1537  LSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAS  1716
             LSTATVKLIDADG EHVACSVGTGPVD+AYKAVDL+ K  V+LLEYSMNAVTEGIDAIA+
Sbjct  518   LSTATVKLIDADGREHVACSVGTGPVDSAYKAVDLIIKESVSLLEYSMNAVTEGIDAIAT  577

Query  1717  TRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             TRVLIR +++  S H  TG   +R+F+GTGA MD+V+SSV+AYV ALNK+LGF+
Sbjct  578   TRVLIRVEKSHLSTHALTGELVHRTFSGTGAGMDIVVSSVKAYVSALNKMLGFK  631



>ref|XP_010672455.1| PREDICTED: 2-isopropylmalate synthase A-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=638

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/558 (77%), Positives = 483/558 (87%), Gaps = 9/558 (2%)
 Frame = +1

Query  238   CESSP-----PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLAR  402
             C S+P     P  RPEYIP RI DPNYVRIFDTTLRDGEQSPGA+MT +EKL +ARQLA 
Sbjct  59    CASTPQPTPVPHARPEYIPQRISDPNYVRIFDTTLRDGEQSPGASMTPREKLEIARQLAL  118

Query  403   LGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVK  576
             LGVDIIEAGFPA+S++DLEAV+ IA EVG    E  +VPVICGL+RCNK DID AWEAVK
Sbjct  119   LGVDIIEAGFPAASKSDLEAVKAIAMEVGNDVDEEGYVPVICGLSRCNKEDIDAAWEAVK  178

Query  577   HAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDR  756
             +AK+PRIHTFIATSEIHM YKL  +RE+VV+ A SMV YARSLGC DVEFSPEDAGRSDR
Sbjct  179   YAKRPRIHTFIATSEIHMKYKLNKTREEVVDIARSMVGYARSLGCLDVEFSPEDAGRSDR  238

Query  757   EFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLG  936
             EFLYQILGEVI+AGATTLNIPDTVGYT+P EFGQLIADIKANTPGIENVIISTHCQNDLG
Sbjct  239   EFLYQILGEVIRAGATTLNIPDTVGYTVPKEFGQLIADIKANTPGIENVIISTHCQNDLG  298

Query  937   LSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQI  1116
             LSTANT++GACAGARQLEVTINGIGERAGNASLEEVVM +KCRG Q LGGL+TGI T+ I
Sbjct  299   LSTANTVSGACAGARQLEVTINGIGERAGNASLEEVVMTIKCRG-QSLGGLHTGIQTEHI  357

Query  1117  IMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE  1296
             + ASKMV EYTGL VQPHKAIVGANAF HESGIHQ GMLKHK TYEI+SPEDIGL RA+E
Sbjct  358   VKASKMVAEYTGLLVQPHKAIVGANAFKHESGIHQHGMLKHKGTYEIMSPEDIGLQRADE  417

Query  1297  SGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEV  1476
             SG+VLGKLSGRHALQ ++ +LGY  EGKEL+D+FWRFKSVAE+KK V D+D+ ALV DE+
Sbjct  418   SGLVLGKLSGRHALQKRLEQLGYFFEGKELDDVFWRFKSVAEKKKHVLDEDIEALVVDEL  477

Query  1477  FQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVP  1656
             FQP   W LGD+QVTCG+LGLSTATVKLI ADG+EHVAC+VGTGPVD+AYKAVD + K+P
Sbjct  478   FQPDSVWSLGDLQVTCGTLGLSTATVKLICADGKEHVACAVGTGPVDSAYKAVDSIVKMP  537

Query  1657  VTLLEYSMNAVTEGIDAIASTRVLIR-EDQASIHGSTGGSANRSFNGTGAAMDVVISSVR  1833
             VTLLEYS++AVTEGIDA+A+TRVLIR E+  +   + G    RSF+G+G+ MD+V+SSVR
Sbjct  538   VTLLEYSLSAVTEGIDALATTRVLIRGENGFTSTQANGEQIRRSFSGSGSEMDIVVSSVR  597

Query  1834  AYVGALNKLLGFQNLVSR  1887
             AYV ALNK+L F N  S+
Sbjct  598   AYVSALNKMLAFNNKSSQ  615



>ref|XP_010064504.1| PREDICTED: 2-isopropylmalate synthase A-like, partial [Eucalyptus 
grandis]
Length=654

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/574 (74%), Positives = 496/574 (86%), Gaps = 14/574 (2%)
 Frame = +1

Query  199   RPSFQSFSAAAVRCESSPPARRP----------EYIPNRILDPNYVRIFDTTLRDGEQSP  348
             RP  Q  S++A+RC ++PP              EYIPNRI DPNYVRIFDTTLRDGEQSP
Sbjct  68    RPPQQRASSSAIRCSAAPPPPPEAPTTAPPPRPEYIPNRIPDPNYVRIFDTTLRDGEQSP  127

Query  349   GATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--VPVIC  522
             GATMT+KEKL +ARQLA+LGVDIIEAGFPA+S  D  AV+ IA EVG     H  VPVIC
Sbjct  128   GATMTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVIC  187

Query  523   GLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARS  702
             GL+RCN++DI  AW+AV+ A++PRIHTFIATS IHM YKLK S+++V++ A  MVA+AR 
Sbjct  188   GLSRCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARR  247

Query  703   LGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKAN  882
             LGC+DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKAN
Sbjct  248   LGCNDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKAN  307

Query  883   TPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKC  1062
             TPGIENVIISTHCQNDLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVVMALKC
Sbjct  308   TPGIENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKC  367

Query  1063  RGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK  1242
             +G  +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQDGMLKHK
Sbjct  368   KGGSILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHK  427

Query  1243  DTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAE  1422
              TYEIISP+DIGL R NE+GIVLGKLSGRHAL+ K++ELGY+I+G++L+++FWRFK+VAE
Sbjct  428   GTYEIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAE  487

Query  1423  RKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVG  1602
             +KK+VTD D+ ALVSDEVFQP V W+L D+QVTCG+LGLSTATVKLI A+G+EH+AC+VG
Sbjct  488   QKKRVTDADIRALVSDEVFQPTVVWKLHDLQVTCGTLGLSTATVKLISAEGKEHIACAVG  547

Query  1603  TGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSA  1776
             TGPVD+AYKAVDL+ KVP TLLEYSM AVTEGIDAIA+TRVLIR   +  S    TG + 
Sbjct  548   TGPVDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHTSTLALTGETI  607

Query  1777  NRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
             +R+F+G G++MD+ +SSVRAY+GALNK+LGF  L
Sbjct  608   HRTFSGIGSSMDITVSSVRAYIGALNKMLGFMEL  641



>ref|XP_009149293.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic [Brassica 
rapa]
Length=626

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/539 (76%), Positives = 485/539 (90%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVD+IEAGFPA+S+
Sbjct  72    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFPAASK  131

Query  448   ADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ IAE VG   +GD +VPVICGL+RCNKRDI+ AWEAVK+AK+PRIHTFIATS+
Sbjct  132   DDFEAVKTIAETVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFIATSD  191

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  192   IHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYEILGEVIKAGA  251

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA +GAR
Sbjct  252   TTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHSGAR  311

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+YTG+  
Sbjct  312   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQT  371

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  372   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  431

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY ++ ++L  +FWRFKSVAERKK+VTD D+IALVSDEVFQP+  WRL D+Q+T
Sbjct  432   DRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWRLLDIQIT  491

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL+DADG+EHVACS+G GPVD+AYKA+DL+ K P TLLEYSMNAVTEGI
Sbjct  492   CGTLGLSTATVKLVDADGKEHVACSMGAGPVDSAYKAIDLIVKEPATLLEYSMNAVTEGI  551

Query  1702  DAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVLIR   + ++ +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L F+
Sbjct  552   DAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  610



>emb|CDY26154.1| BnaA06g12630D [Brassica napus]
Length=626

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/539 (76%), Positives = 485/539 (90%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVD+IEAGFPA+S+
Sbjct  72    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFPAASK  131

Query  448   ADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ IAE VG   +GD +VPVICGL+RCNKRDI+ AWEAVK+AK+PRIHTFIATS+
Sbjct  132   DDFEAVKTIAETVGNAVDGDGYVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFIATSD  191

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  192   IHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYEILGEVIKAGA  251

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA +GAR
Sbjct  252   TTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHSGAR  311

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+YTG+  
Sbjct  312   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQT  371

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  372   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  431

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY ++ ++L  +FWRFKSVAERKK+VTD D+IALVSDEVFQP+  WRL D+Q+T
Sbjct  432   DRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWRLLDIQIT  491

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL+DADG+EHVACS+G GPVD+AYKA+DL+ K P TLLEYSMNAVTEGI
Sbjct  492   CGTLGLSTATVKLVDADGKEHVACSMGAGPVDSAYKAIDLIVKEPATLLEYSMNAVTEGI  551

Query  1702  DAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVLIR   + ++ +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L F+
Sbjct  552   DAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  610



>ref|XP_004289267.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=628

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/562 (74%), Positives = 489/562 (87%), Gaps = 7/562 (1%)
 Frame = +1

Query  202   PSFQSFSAAAVRCESSP---PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKE  372
             P+ ++ +   V C  +P   P RRP+Y+PNRI DPNYVRIFDTTLRDGEQSPGA++T+KE
Sbjct  50    PNPRAATKGRVLCSQNPNPTPTRRPDYVPNRISDPNYVRIFDTTLRDGEQSPGASLTSKE  109

Query  373   KLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKR  546
             KL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG       +VPVICGL+RCN++
Sbjct  110   KLGIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNFVDIDGYVPVICGLSRCNEK  169

Query  547   DIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEF  726
             DI  AWEAVK+AK+PRIHTFIATS IHM +KL+ ++EQV+E A SMV+YARSLGC DVEF
Sbjct  170   DIKTAWEAVKYAKRPRIHTFIATSPIHMEHKLRKTKEQVIEIARSMVSYARSLGCEDVEF  229

Query  727   SPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVI  906
             SPEDAGRS++EFLYQILGEVIKAGATTLNIPDTVG T+PNEFGQLIADIKANTPGI+NVI
Sbjct  230   SPEDAGRSEKEFLYQILGEVIKAGATTLNIPDTVGITVPNEFGQLIADIKANTPGIDNVI  289

Query  907   ISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG  1086
             ISTHCQNDLGLSTANTLAGA  GARQ+EVTINGIGERAGNASLEEVVM L CRGEQV GG
Sbjct  290   ISTHCQNDLGLSTANTLAGASRGARQVEVTINGIGERAGNASLEEVVMTLNCRGEQVFGG  349

Query  1087  LYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISP  1266
             LYTGIN + I + SKMV EYTG+HVQPHKAIVG+NAFAHESGIHQDGMLK K TYEIISP
Sbjct  350   LYTGINPKHIYITSKMVSEYTGMHVQPHKAIVGSNAFAHESGIHQDGMLKDKRTYEIISP  409

Query  1267  EDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDD  1446
             EDIG  R+NE+GIVLGKLSGRHA++ ++ +LGYE++  +LE +FWRFK VAE+KK+VTD 
Sbjct  410   EDIGYDRSNEAGIVLGKLSGRHAVKKQLEQLGYELDDVQLETVFWRFKGVAEQKKRVTDA  469

Query  1447  DLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAY  1626
             DL ALVSDEVFQP+V W+L D+QVTCG+LGLSTATVKLIDADG EH+ACSVGTGPVD+AY
Sbjct  470   DLRALVSDEVFQPEVVWKLHDLQVTCGTLGLSTATVKLIDADGREHIACSVGTGPVDSAY  529

Query  1627  KAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAA  1806
             KAVDL+ K PVTL+EYSMN VTEGIDAIA+TRV+IR + + +    G  + R+F+G GA 
Sbjct  530   KAVDLIVKEPVTLVEYSMNGVTEGIDAIATTRVVIRVENSDM--VAGEISQRTFSGIGAG  587

Query  1807  MDVVISSVRAYVGALNKLLGFQ  1872
             MD+V+SSV+AY+GALNK+LGF+
Sbjct  588   MDIVVSSVKAYIGALNKMLGFK  609



>ref|NP_001066116.1| Os12g0138900 [Oryza sativa Japonica Group]
 gb|ABA95781.2| 2-isopropylmalate synthase B, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29135.1| Os12g0138900 [Oryza sativa Japonica Group]
 gb|EEC68833.1| hypothetical protein OsI_37410 [Oryza sativa Indica Group]
 gb|EEE52743.1| hypothetical protein OsJ_35174 [Oryza sativa Japonica Group]
Length=635

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/602 (73%), Positives = 499/602 (83%), Gaps = 13/602 (2%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLRFSIS----GASRRPSFQSFSAAAVRCESSPP  255
             P  TP     T    P    A  FS  L  + +     ASRR   ++F A  VR   + P
Sbjct  19    PTSTPRPRAQTLS--PFRAAAPRFSHGLATAAAAANPSASRRCYHRAF-ARPVRASMAQP  75

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
              RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFP
Sbjct  76    -RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFP  134

Query  436   ASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             ASS  DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA++PRIHTF
Sbjct  135   ASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRIHTF  194

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EV
Sbjct  195   IATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEV  254

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA
Sbjct  255   IKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGA  314

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQ I M+SKMV+E+
Sbjct  315   HAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMVQEH  373

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             +GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSG
Sbjct  374   SGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSG  433

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+VFW L 
Sbjct  434   RHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFWSLA  493

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             DVQ TCG+LGLSTATVKLI  DG+E +AC+VGTGPVDAAYKAVD + ++P  L EYSM +
Sbjct  494   DVQATCGTLGLSTATVKLIGPDGDEKIACAVGTGPVDAAYKAVDDIIQIPTVLREYSMTS  553

Query  1687  VTEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             VTEGIDAIA+TRV++  D + S H  TG S NR+F+G+GAA+D+V+SSVRAY+ ALNK+ 
Sbjct  554   VTEGIDAIATTRVVVTGDVSDSKHALTGHSFNRAFSGSGAALDIVVSSVRAYLSALNKMS  613

Query  1864  GF  1869
              F
Sbjct  614   SF  615



>ref|XP_006664321.1| PREDICTED: 2-isopropylmalate synthase A-like [Oryza brachyantha]
Length=605

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/562 (76%), Positives = 483/562 (86%), Gaps = 6/562 (1%)
 Frame = +1

Query  199   RP-SFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEK  375
             RP +  S   AA RC     A RPEY+PNRI DP+YVRIFDTTLRDGEQSPGATMT+ EK
Sbjct  25    RPRALLSSRVAAPRCSHGLAAARPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEK  84

Query  376   LAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKR  546
             L VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG    GE  HVPVICGL+RCNKR
Sbjct  85    LVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKR  144

Query  547   DIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEF  726
             DID AWEAV+HA++PRIHTFIATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEF
Sbjct  145   DIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEF  204

Query  727   SPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVI  906
             SPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN I
Sbjct  205   SPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAI  264

Query  907   ISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG  1086
             ISTHCQNDLGL+TANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGG
Sbjct  265   ISTHCQNDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGG  323

Query  1087  LYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISP  1266
             LYTGINTQ I M+SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP
Sbjct  324   LYTGINTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISP  383

Query  1267  EDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDD  1446
             +DIGL RANE GIVLGKLSGRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+
Sbjct  384   DDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDE  443

Query  1447  DLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAY  1626
             D+ AL+SDE+FQP+VFW L DVQ TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDAAY
Sbjct  444   DIEALLSDEIFQPKVFWSLADVQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAY  503

Query  1627  KAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGA  1803
             KAVD + ++P  L EYSM +VTEGIDAIA+TRV++  D   S H  TG S NR+F+G+GA
Sbjct  504   KAVDEIIQIPTVLREYSMTSVTEGIDAIATTRVVVTGDVIDSKHALTGQSFNRAFSGSGA  563

Query  1804  AMDVVISSVRAYVGALNKLLGF  1869
             AMD+V+SSVRAY+ ALNK+  F
Sbjct  564   AMDIVVSSVRAYLSALNKMSSF  585



>gb|ABA91408.1| 2-isopropylmalate synthase B, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEE51633.1| hypothetical protein OsJ_32925 [Oryza sativa Japonica Group]
Length=635

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/602 (73%), Positives = 499/602 (83%), Gaps = 13/602 (2%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLRFSIS----GASRRPSFQSFSAAAVRCESSPP  255
             P  TP     T    P    A  FS  L  + +     ASRR   ++F A  VR   + P
Sbjct  19    PTSTPRPRAQTLS--PFRAAAPRFSHGLATAAAAANPSASRRCYHRAF-ARPVRASMAQP  75

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
              RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFP
Sbjct  76    -RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFP  134

Query  436   ASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             ASS  DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA++PRIHTF
Sbjct  135   ASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRIHTF  194

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EV
Sbjct  195   IATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEV  254

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA
Sbjct  255   IKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGA  314

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQ I M+SKMV+E+
Sbjct  315   HAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMVQEH  373

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             +GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSG
Sbjct  374   SGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSG  433

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+VFW L 
Sbjct  434   RHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFWSLA  493

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             DVQ TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDAAYKAVD + ++P  L EYSM +
Sbjct  494   DVQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDAAYKAVDDIIQIPTVLREYSMTS  553

Query  1687  VTEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             VTEGIDAIA+TRV++  D + S H  TG S +R+F+G+GAA+D+V+SSVRAY+ ALNK+ 
Sbjct  554   VTEGIDAIATTRVVVTGDVSDSKHALTGHSFSRAFSGSGAALDIVVSSVRAYLSALNKMS  613

Query  1864  GF  1869
              F
Sbjct  614   SF  615



>ref|XP_006663190.1| PREDICTED: 2-isopropylmalate synthase A-like [Oryza brachyantha]
Length=605

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/562 (76%), Positives = 483/562 (86%), Gaps = 6/562 (1%)
 Frame = +1

Query  199   RP-SFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEK  375
             RP +  S   AA RC     A RPEY+PNRI DP+YVRIFDTTLRDGEQSPGATMT+ EK
Sbjct  25    RPRALLSSRVAAPRCSHGLAAARPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEK  84

Query  376   LAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKR  546
             L VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG    GE  HVPVICGL+RCNKR
Sbjct  85    LVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKR  144

Query  547   DIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEF  726
             DID AWEAV+HA++PRIHTFIATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEF
Sbjct  145   DIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEF  204

Query  727   SPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVI  906
             SPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN I
Sbjct  205   SPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAI  264

Query  907   ISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG  1086
             ISTHCQNDLGL+TANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGG
Sbjct  265   ISTHCQNDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGG  323

Query  1087  LYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISP  1266
             LYTGINTQ I M+SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP
Sbjct  324   LYTGINTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISP  383

Query  1267  EDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDD  1446
             +DIGL RANE GIVLGKLSGRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+
Sbjct  384   DDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDE  443

Query  1447  DLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAY  1626
             D+ AL+SDE+FQP+VFW L DVQ TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDAAY
Sbjct  444   DIEALLSDEIFQPKVFWSLVDVQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAY  503

Query  1627  KAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGA  1803
             KAVD + ++P  L EYSM +VTEGIDAIA+TRV++  D   S H  TG S NR+F+G+GA
Sbjct  504   KAVDEIIQIPTVLREYSMTSVTEGIDAIATTRVVVTGDVIDSKHALTGQSFNRAFSGSGA  563

Query  1804  AMDVVISSVRAYVGALNKLLGF  1869
             AMD+V+SSVRAY+ ALNK+  F
Sbjct  564   AMDIVVSSVRAYLSALNKMSSF  585



>ref|XP_010477031.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Camelina 
sativa]
Length=626

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/608 (69%), Positives = 508/608 (84%), Gaps = 16/608 (3%)
 Frame = +1

Query  67    LRASPNPPVITP-PESKYTCKYLPIHTIATSF-SKQLRFSISGASRRPSFQSFSAAAVRC  240
             L  +P+ P  +  P + ++ +  P    + S  S+ LR S S +   P            
Sbjct  12    LSTTPSLPTFSSKPTTPFSFRVQPSRHCSISLRSQTLRLSCSISDPSPLPPHI-------  64

Query  241   ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDII  420
                P  RRPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDII
Sbjct  65    ---PLRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII  121

Query  421   EAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPR  594
             EAGFPA+S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PR
Sbjct  122   EAGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPR  181

Query  595   IHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  774
             IHTFIATS+IH+ +KLK ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+I
Sbjct  182   IHTFIATSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEI  241

Query  775   LGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  954
             LGEVIKAGATTLNIPDTVG T+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT
Sbjct  242   LGEVIKAGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  301

Query  955   LAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKM  1134
             L+GA AGARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTG++T+ I+M SKM
Sbjct  302   LSGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGLDTRHIVMTSKM  361

Query  1135  VEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLG  1314
             VEEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLG
Sbjct  362   VEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLG  421

Query  1315  KLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVF  1494
             KLSGRHAL+ ++ ELGY+++ ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  
Sbjct  422   KLSGRHALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAV  481

Query  1495  WRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEY  1674
             W+L D+Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEY
Sbjct  482   WKLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEY  541

Query  1675  SMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGA  1848
             SMNAVTEGIDAIA+TRVLIR     +S +  TG    R+F+GTG+ +D+V+SSV+AYVGA
Sbjct  542   SMNAVTEGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKAYVGA  601

Query  1849  LNKLLGFQ  1872
             LNK++ F+
Sbjct  602   LNKMMDFK  609



>ref|NP_173285.2| 2-isopropylmalate synthase [Arabidopsis thaliana]
 sp|Q9LPR4.2|LEU11_ARATH RecName: Full=2-isopropylmalate synthase 1, chloroplastic; AltName: 
Full=Methylthioalkylmalate synthase-like 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE29723.1| 2-isopropylmalate synthase [Arabidopsis thaliana]
Length=631

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/539 (75%), Positives = 482/539 (89%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+
Sbjct  77    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  136

Query  448   ADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ IAE VG    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PRIHTFIATS+
Sbjct  137   DDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSD  196

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK ++ +V+E A SMV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA
Sbjct  197   IHLEYKLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGA  256

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLI D+KANTPGIENV+ISTHCQNDLGLSTANTL+GA AGAR
Sbjct  257   TTLNIPDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  316

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  
Sbjct  317   QMEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQT  376

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  377   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  436

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY+++ ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  W+L D+Q+T
Sbjct  437   DRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  496

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGI
Sbjct  497   CGTLGLSTATVKLADADGKEHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  556

Query  1702  DAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVLIR     +S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK++ F+
Sbjct  557   DAIATTRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDFK  615



>emb|CBX25286.1| hypothetical_protein [Oryza brachyantha]
Length=564

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/541 (78%), Positives = 476/541 (88%), Gaps = 5/541 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEY+PNRI DP+YVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFPA
Sbjct  5     RRPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPA  64

Query  439   SSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SS  DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA++PRIHTFI
Sbjct  65    SSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRIHTFI  124

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVI
Sbjct  125   ATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVI  184

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA 
Sbjct  185   KAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGAH  244

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQ I M+SKMV+E++
Sbjct  245   AGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMVQEHS  303

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSGR
Sbjct  304   GLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGR  363

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGD  1509
             HA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+VFW L D
Sbjct  364   HAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFWSLVD  423

Query  1510  VQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
             VQ TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDAAYKAVD + ++P  L EYSM +V
Sbjct  424   VQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAYKAVDEIIQIPTVLREYSMTSV  483

Query  1690  TEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             TEGIDAIA+TRV++  D + S H  TG S NR+F+G+GAAMD+V+SSVRAY+ ALNK+  
Sbjct  484   TEGIDAIATTRVVVTGDVSDSKHALTGQSFNRAFSGSGAAMDIVVSSVRAYLSALNKMSS  543

Query  1867  F  1869
             F
Sbjct  544   F  544



>ref|XP_010459471.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Camelina 
sativa]
Length=625

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/608 (69%), Positives = 507/608 (83%), Gaps = 6/608 (1%)
 Frame = +1

Query  61    ACLRASPNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRC  240
             + L  +PN    TP    ++ K  P   +    S+    S+   + R S  S S  +   
Sbjct  3     SSLLRNPNLLPTTPSLPTFSSKPTPFSFLVKP-SRHCSISLRSQTLRLSC-SISDPSPLP  60

Query  241   ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDII  420
                P  RRPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDII
Sbjct  61    PHIPLRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII  120

Query  421   EAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPR  594
             EAGFPA+S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PR
Sbjct  121   EAGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPR  180

Query  595   IHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  774
             IHTFIATS+IH+ +KLK ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+I
Sbjct  181   IHTFIATSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEI  240

Query  775   LGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  954
             LGEVIKAGATTLNIPDTVG T+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT
Sbjct  241   LGEVIKAGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  300

Query  955   LAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKM  1134
             L+GA AGARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTG++T+ I+M SKM
Sbjct  301   LSGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGLDTRHIVMTSKM  360

Query  1135  VEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLG  1314
             VEEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLG
Sbjct  361   VEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLG  420

Query  1315  KLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVF  1494
             KLSGRHAL+ ++ ELGY+ + ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  
Sbjct  421   KLSGRHALKDRLTELGYDFDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAV  480

Query  1495  WRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEY  1674
             W+L D+Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEY
Sbjct  481   WKLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEY  540

Query  1675  SMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGA  1848
             SMNAVTEGIDAIA+TRVLIR     +S +  TG    R+F+GTG+ +D+V+SSV+AYVGA
Sbjct  541   SMNAVTEGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKAYVGA  600

Query  1849  LNKLLGFQ  1872
             LNK++ F+
Sbjct  601   LNKMMDFK  608



>gb|AFW64772.1| 2-isopropylmalate synthase B [Zea mays]
Length=641

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/610 (71%), Positives = 493/610 (81%), Gaps = 18/610 (3%)
 Frame = +1

Query  79    PNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFS------AAAVRC  240
             P P     P     C    I   A + S + R S  G S   +  S +      A   R 
Sbjct  16    PTPAAHRSPSGPSPC----ISVRAAAVSPRARHSAYGLSAAGNASSSTVRLRALAQRTRA  71

Query  241   ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDII  420
             +  PP RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVD+I
Sbjct  72    QPQPPRRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDVI  131

Query  421   EAGFPASSEADLEAVRLIAEEVGRGE-----GDHVPVICGLARCNKRDIDKAWEAVKHAK  585
             EAGFPASS  DL+AVR IA EVG        G HVPVICGL+RCN+RDID AWEAV+HA+
Sbjct  132   EAGFPASSPDDLDAVRSIAIEVGNPPPGDDGGAHVPVICGLSRCNRRDIDAAWEAVRHAR  191

Query  586   KPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  765
             +PRIHTFIATSEIHM +KL+ + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFL
Sbjct  192   RPRIHTFIATSEIHMQHKLRKTPDQVVAVAREMVAYARSLGCADVEFSPEDAGRSNREFL  251

Query  766   YQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLST  945
             Y IL EVIKAGATTLNIPDTVGYT+P EFG+LI+DIK NTPGIEN IISTHCQNDLGL+T
Sbjct  252   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLISDIKENTPGIENAIISTHCQNDLGLAT  311

Query  946   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMA  1125
             ANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+Q I + 
Sbjct  312   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLT  370

Query  1126  SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGI  1305
             SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GI
Sbjct  371   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLARANEFGI  430

Query  1306  VLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQP  1485
             VLGKLSGRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP
Sbjct  431   VLGKLSGRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  490

Query  1486  QVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTL  1665
             +V W L DVQ TCG+LGLSTATVKLI  DGEE +ACSVGTGPVDAAYKAVD + ++P  L
Sbjct  491   KVIWSLADVQATCGTLGLSTATVKLIGPDGEERIACSVGTGPVDAAYKAVDQIIQIPTVL  550

Query  1666  LEYSMNAVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAY  1839
              EY M +VTEGIDAIA+TRV++  D A  S H  TG S NRSF+G+GAAMD+V+SSVRAY
Sbjct  551   REYGMTSVTEGIDAIATTRVVVTGDVANNSKHALTGHSFNRSFSGSGAAMDIVVSSVRAY  610

Query  1840  VGALNKLLGF  1869
             + ALNK+  F
Sbjct  611   LSALNKMCSF  620



>ref|XP_010931990.1| PREDICTED: 2-isopropylmalate synthase A-like [Elaeis guineensis]
Length=631

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/617 (70%), Positives = 507/617 (82%), Gaps = 34/617 (6%)
 Frame = +1

Query  76    SPNP----------PVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSA  225
             +PNP          P ++PP S++    +P  + ++S      +S SGA           
Sbjct  18    NPNPNIPRSHILFNPWLSPPSSRF--GLIPHLSCSSSVLLSKPWSRSGA-----------  64

Query  226   AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARL  405
               +RC       RPEYIPN I DP YVR+FDTTLRDGEQSPGATMT+KEKL VARQL+ L
Sbjct  65    --LRCSLR---SRPEYIPNHIPDPCYVRVFDTTLRDGEQSPGATMTSKEKLVVARQLSLL  119

Query  406   GVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVK  576
             GVDIIEAGFPASS  DL+AVR IA EVG     E  H+PVICGLARCNK+DID AWEAV+
Sbjct  120   GVDIIEAGFPASSPDDLDAVRSIAMEVGNQPVSEDGHIPVICGLARCNKKDIDAAWEAVR  179

Query  577   HAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDR  756
             HAKKPR+HTFIATSEIHM +KL+ +RE+VV  A  MVAYARSLGC D+EFSPEDAGRSDR
Sbjct  180   HAKKPRVHTFIATSEIHMQHKLRKTREEVVRIACEMVAYARSLGCQDIEFSPEDAGRSDR  239

Query  757   EFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLG  936
             +FLY +L EVIKAGATT+NIPDTVGYT+P+EF +LIADIKANT GIE+VIISTHCQNDLG
Sbjct  240   DFLYHVLEEVIKAGATTVNIPDTVGYTLPSEFEKLIADIKANTRGIEDVIISTHCQNDLG  299

Query  937   LSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQI  1116
             L+TANTLAGA AGARQ+EVT+NGIGERAGNASLEEVV+ALKCR ++++GGLYTGINT+ I
Sbjct  300   LATANTLAGAYAGARQVEVTVNGIGERAGNASLEEVVIALKCR-QELMGGLYTGINTKHI  358

Query  1117  IMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE  1296
             +MASKMV EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK+TYEIISPEDIGL R+NE
Sbjct  359   VMASKMVAEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKNTYEIISPEDIGLSRSNE  418

Query  1297  SGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEV  1476
             SGIVLGKLSGRHAL++K+LE GY+I GKELED+F RFK VAE+KK+++D+D+ AL+SDE+
Sbjct  419   SGIVLGKLSGRHALRSKLLEFGYDINGKELEDVFKRFKEVAEKKKRISDEDIEALISDEI  478

Query  1477  FQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVP  1656
             FQP V W LG++Q TCG+LGLSTATVKL+ +DGEE +ACSVGTGPVDAAYKA+D + +VP
Sbjct  479   FQPAVIWSLGELQATCGTLGLSTATVKLVASDGEEKIACSVGTGPVDAAYKAIDSIVEVP  538

Query  1657  VTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGSANRSFNGTGAAMDVVISSV  1830
              TL EY+M +VTEGIDAIA+TRV+I  D    S H  TG   +R+F+G+GAAMD+V+SSV
Sbjct  539   ATLREYAMTSVTEGIDAIATTRVVIGGDGSHMSTHALTGEPVHRTFSGSGAAMDIVVSSV  598

Query  1831  RAYVGALNKLLGFQNLV  1881
             RAY+ ALNK+LGF + V
Sbjct  599   RAYISALNKMLGFMSAV  615



>ref|XP_010498246.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic isoform 
X2 [Camelina sativa]
Length=625

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/607 (69%), Positives = 507/607 (84%), Gaps = 15/607 (2%)
 Frame = +1

Query  67    LRASPNPPVITPPESKYTCKYLPIHTIATSF-SKQLRFSISGASRRPSFQSFSAAAVRCE  243
             L  +P+ P  +   + ++ +  P    + S  S+ LR S S +   P             
Sbjct  12    LSTTPSLPTFSSKPTPFSFRVKPSRHCSISLRSQTLRLSCSISDPSPLPPHI--------  63

Query  244   SSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
               P  RRPEYIPNRI DP+YVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIE
Sbjct  64    --PLRRRPEYIPNRISDPSYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIE  121

Query  424   AGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRI  597
             AGFPA+S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PRI
Sbjct  122   AGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRI  181

Query  598   HTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  777
             HTFIATS+IH+ +KLK ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+IL
Sbjct  182   HTFIATSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEIL  241

Query  778   GEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  957
             GEVIKAGATTLNIPDTVG T+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL
Sbjct  242   GEVIKAGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  301

Query  958   AGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMV  1137
             +GA AGARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TG++T+ I+M SKMV
Sbjct  302   SGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGLDTRHIVMTSKMV  361

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGK  1317
             EEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGK
Sbjct  362   EEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGK  421

Query  1318  LSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFW  1497
             LSGRHAL+ ++ ELGY+++ ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  W
Sbjct  422   LSGRHALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVW  481

Query  1498  RLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYS  1677
             +L D+Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPVD+AYKAVDL+ K P TLLEYS
Sbjct  482   KLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYS  541

Query  1678  MNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGAL  1851
             MNAVTEGIDAIA+TRVLIR     +S +  TG    R+F+GTG+ +D+V+SSV+AYVGAL
Sbjct  542   MNAVTEGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKAYVGAL  601

Query  1852  NKLLGFQ  1872
             NK++ F+
Sbjct  602   NKMMDFK  608



>ref|XP_009117611.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Brassica 
rapa]
Length=627

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/539 (76%), Positives = 479/539 (89%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             +YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+
Sbjct  73    DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  132

Query  448   ADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ I+E VG    E  +VPVICGL+RCN+RDI  AWEAV++AK+PRIHTFIATS+
Sbjct  133   DDFEAVKTISETVGNAVDENGYVPVICGLSRCNERDIQTAWEAVRYAKRPRIHTFIATSD  192

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK S+++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  193   IHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  252

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLIADIKANTPGIENV+ISTHCQNDLGLSTANTL+GA AGAR
Sbjct  253   TTLNIPDTVGITLPSEFGQLIADIKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  312

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+YTG+  
Sbjct  313   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQT  372

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  373   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  432

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY ++ ++L  +FWRFKSVAE+KK+VTD D+IALVSDEVFQP+  W+L D+Q+T
Sbjct  433   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  492

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL DADG+EH ACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGI
Sbjct  493   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPTTLLEYSMNAVTEGI  552

Query  1702  DAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVL+R      S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L F+
Sbjct  553   DAIATTRVLVRGSNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  611



>emb|CDY21704.1| BnaA09g44550D [Brassica napus]
Length=627

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/539 (76%), Positives = 480/539 (89%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             +YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+
Sbjct  73    DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  132

Query  448   ADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ I+E VG    E  +VPVICGL+RCN+RDI  AWEAV++AK+PRIHTFIATS+
Sbjct  133   DDFEAVKTISETVGNAVNENGYVPVICGLSRCNERDIQTAWEAVRYAKRPRIHTFIATSD  192

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK S+++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  193   IHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  252

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLIADIKANTPGIENV+ISTHCQNDLGLSTANTL+GA AGAR
Sbjct  253   TTLNIPDTVGITLPSEFGQLIADIKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  312

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+ I+M SKMVE+YTG+  
Sbjct  313   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQT  372

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  373   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  432

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY ++ ++L  +FWRFKSVAE+KK+VTD D+IALVSDEVFQP+  W+L D+Q+T
Sbjct  433   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  492

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL DADG+EH ACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGI
Sbjct  493   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  552

Query  1702  DAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVL+R +    S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L F+
Sbjct  553   DAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  611



>ref|NP_001146593.1| uncharacterized protein LOC100280189 [Zea mays]
 gb|ACL54348.1| unknown [Zea mays]
Length=641

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/610 (71%), Positives = 493/610 (81%), Gaps = 18/610 (3%)
 Frame = +1

Query  79    PNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFS------AAAVRC  240
             P P     P     C    I   A + S + R S  G S   +  S +      A   R 
Sbjct  16    PTPAAHRSPSGPSPC----ISVRAAAVSPRARHSAYGLSAAGNASSSTVRLRALAQRTRA  71

Query  241   ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDII  420
             +  PP RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVD+I
Sbjct  72    QPQPPRRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDVI  131

Query  421   EAGFPASSEADLEAVRLIAEEVGRGE-----GDHVPVICGLARCNKRDIDKAWEAVKHAK  585
             EAGFPASS  DL+AVR IA EVG        G HVPVICGL+RCN+RDID AWEAV+HA+
Sbjct  132   EAGFPASSPDDLDAVRSIAIEVGNPPPGDDGGAHVPVICGLSRCNRRDIDAAWEAVRHAR  191

Query  586   KPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  765
             +PRIHTFIATSEIHM +KL+ + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFL
Sbjct  192   RPRIHTFIATSEIHMQHKLRKTPDQVVAVAREMVAYARSLGCADVEFSPEDAGRSNREFL  251

Query  766   YQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLST  945
             Y IL EVIKAGATTLNIPDTVGYT+P EFG+LI+DIK NTPGIEN IISTHCQNDLGL+T
Sbjct  252   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLISDIKENTPGIENAIISTHCQNDLGLAT  311

Query  946   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMA  1125
             ANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+Q I + 
Sbjct  312   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLT  370

Query  1126  SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGI  1305
             SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GI
Sbjct  371   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLARANEFGI  430

Query  1306  VLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQP  1485
             VLGKLSGRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP
Sbjct  431   VLGKLSGRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  490

Query  1486  QVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTL  1665
             +V W L DVQ TCG+LGLSTATVKLI  DGEE +ACSVGTGPVDAA+KAVD + ++P  L
Sbjct  491   KVIWSLADVQATCGTLGLSTATVKLIGPDGEERIACSVGTGPVDAAHKAVDQIIQIPTVL  550

Query  1666  LEYSMNAVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAY  1839
              EY M +VTEGIDAIA+TRV++  D A  S H  TG S NRSF+G+GAAMD+V+SSVRAY
Sbjct  551   REYGMTSVTEGIDAIATTRVVVTGDVANNSKHALTGHSFNRSFSGSGAAMDIVVSSVRAY  610

Query  1840  VGALNKLLGF  1869
             + ALNK+  F
Sbjct  611   LSALNKMCSF  620



>dbj|BAJ93533.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=627

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/606 (71%), Positives = 497/606 (82%), Gaps = 17/606 (3%)
 Frame = +1

Query  73    ASPNPPVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVR----C  240
             +S NP   TP   +     LP        +K  RFS   A+   + ++   A +R    C
Sbjct  12    SSLNPAHSTPVAGRTALSTLPA-------AKPRRFSHGLAAVAANPRASRTAVLRSVHAC  64

Query  241   ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDII  420
              ++P  RRPEY+P+RI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDII
Sbjct  65    LAAP--RRPEYVPDRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDII  122

Query  421   EAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKP  591
             EAGFPASS  DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA+KP
Sbjct  123   EAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARKP  182

Query  592   RIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQ  771
             RIHTFIATSEIHM +KL+ + +QVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY 
Sbjct  183   RIHTFIATSEIHMQHKLRKTPDQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYH  242

Query  772   ILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTAN  951
             IL EVIKAGATTLNIPDTVGYT+P+EFG+LIADIKANTPGIEN IISTHCQNDLGL++AN
Sbjct  243   ILEEVIKAGATTLNIPDTVGYTLPHEFGKLIADIKANTPGIENAIISTHCQNDLGLASAN  302

Query  952   TLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASK  1131
             TLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGIN+Q I M SK
Sbjct  303   TLAGAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLDGLYTGINSQHITMTSK  361

Query  1132  MVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVL  1311
             MV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK K TYEIISP+DIGL RANE GIVL
Sbjct  362   MVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIISPDDIGLTRANEFGIVL  421

Query  1312  GKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQV  1491
             GKLSGRHA++ K++ELGYEI  +E ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+V
Sbjct  422   GKLSGRHAVRTKLVELGYEINDREFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKV  481

Query  1492  FWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLE  1671
              W LGDVQ TCG+LGLSTATVKLI  DGEE + CSVGTGPVDAAYKAVD + ++P  L E
Sbjct  482   IWSLGDVQATCGTLGLSTATVKLITLDGEEKIGCSVGTGPVDAAYKAVDQIIQIPTILRE  541

Query  1672  YSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGAL  1851
             YSM +VTEGIDAIA+TRV+I  D ++   +  G +NRSF+G+GAAMDVV+SSVRAY+ AL
Sbjct  542   YSMTSVTEGIDAIATTRVVITGDVSANKYALTGHSNRSFSGSGAAMDVVVSSVRAYLSAL  601

Query  1852  NKLLGF  1869
             NK+  F
Sbjct  602   NKMSSF  607



>ref|XP_002890281.1| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66540.1| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. 
lyrata]
Length=630

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/601 (70%), Positives = 504/601 (84%), Gaps = 15/601 (2%)
 Frame = +1

Query  85    PPVITPPESKYTCKYLPIHTIATSF-SKQLRFSISGASRRPSFQSFSAAAVRCESSPPAR  261
             P V + P    + ++ P H  + S  S+ LR S S           S  +     +P  R
Sbjct  24    PTVSSNPTPVSSFRFQPSHHRSISLRSQTLRLSCS----------ISDPSPLPPHTPRRR  73

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+
Sbjct  74    RPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA  133

Query  442   SEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PRIHTFIAT
Sbjct  134   SKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIAT  193

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S+IH+ +KLK ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKA
Sbjct  194   SDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKA  253

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATTLNIPDTVG T+PNEFGQLI D+KANTPGIENV+ISTHCQNDLGLSTANTL+GA AG
Sbjct  254   GATTLNIPDTVGITLPNEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAG  313

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGL  1155
             ARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+
Sbjct  314   ARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGM  373

Query  1156  HVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHA  1335
               QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHA
Sbjct  374   QTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHA  433

Query  1336  LQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQ  1515
             L+ ++ ELGY+++ ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  W+L D+Q
Sbjct  434   LKDRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQ  493

Query  1516  VTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTE  1695
             +TCG+LGLSTATVKL D DG EHVACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAVTE
Sbjct  494   ITCGTLGLSTATVKLADTDGREHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTE  553

Query  1696  GIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             GIDAIA+TRVLIR     +S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK++ F
Sbjct  554   GIDAIATTRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDF  613

Query  1870  Q  1872
             +
Sbjct  614   K  614



>gb|EMT05050.1| 2-isopropylmalate synthase A [Aegilops tauschii]
Length=627

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/593 (72%), Positives = 496/593 (84%), Gaps = 10/593 (2%)
 Frame = +1

Query  160   SKQLRFSISGASRRPSFQSFSAAAVR----CESSPPARRPEYIPNRILDPNYVRIFDTTL  327
             +K  RFS   A+   + ++  +A +R    C ++P  RRPEY+P+RI DPNYVRIFDTTL
Sbjct  34    AKPRRFSHGLAAVAANPRASRSAVLRPVRACLAAP--RRPEYVPDRIDDPNYVRIFDTTL  91

Query  328   RDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GE  498
             RDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG    GE
Sbjct  92    RDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGE  151

Query  499   GDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKAT  678
               HVPVICGL+RCNKRDID AWEAV+HA+KPRIHTFIATSEIHM +KL+ + +QVV  A 
Sbjct  152   DGHVPVICGLSRCNKRDIDAAWEAVRHARKPRIHTFIATSEIHMQHKLRKTPDQVVAIAR  211

Query  679   SMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQ  858
              MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P+EFG+
Sbjct  212   EMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPHEFGK  271

Query  859   LIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLE  1038
             LIADIKANTPGIEN IISTHCQNDLGL++ANTLAGA AGARQLEVTINGIGERAGNASLE
Sbjct  272   LIADIKANTPGIENAIISTHCQNDLGLASANTLAGAYAGARQLEVTINGIGERAGNASLE  331

Query  1039  EVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIH  1218
             EVVMA+KCR E +LGGL+TGIN+Q I M SKMV+E++GLHVQPHKAIVGANAFAHESGIH
Sbjct  332   EVVMAIKCRRE-LLGGLHTGINSQHITMTSKMVQEHSGLHVQPHKAIVGANAFAHESGIH  390

Query  1219  QDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLF  1398
             QDGMLK K TYEIISP+DIGL RANE GIVLGKLSGRHA++ K++ELGYEI  KE ED F
Sbjct  391   QDGMLKFKGTYEIISPDDIGLTRANEFGIVLGKLSGRHAVRTKLVELGYEINDKEFEDFF  450

Query  1399  WRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGE  1578
              R+K VAE+KK+VTD+D+ AL+SDE+FQP+V W LGDVQ TCG+LGLSTATVKLI  DGE
Sbjct  451   KRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSLGDVQATCGTLGLSTATVKLITIDGE  510

Query  1579  EHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQASIHG  1758
             E + CSVGTGPVDAAYKAVD + ++P  L EYSM +VTEGIDAIA+TRV+I  D ++   
Sbjct  511   EKIGCSVGTGPVDAAYKAVDQIIQIPTVLREYSMTSVTEGIDAIATTRVVIAGDVSADKP  570

Query  1759  STGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
             +   ++NRSF+G+GAAMDVV+SSVRAY+ ALNK+  +   V   ++   T+ +
Sbjct  571   ALTSNSNRSFSGSGAAMDVVVSSVRAYLSALNKMSSYVGAVKASSEAPETISV  623



>emb|CDX81876.1| BnaC08g37250D [Brassica napus]
Length=629

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/539 (76%), Positives = 480/539 (89%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             +YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+
Sbjct  75    DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  134

Query  448   ADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ I+E VG    E  +VPVICGL+RCNK+DI  AWEAV++AK+PRIHTFIATS+
Sbjct  135   DDFEAVKTISETVGNAVDENGYVPVICGLSRCNKKDIQTAWEAVRYAKRPRIHTFIATSD  194

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK SR++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  195   IHLEYKLKKSRQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  254

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLIAD+KANTPGIENV+ISTHCQNDLGLSTANTL+GA AGAR
Sbjct  255   TTLNIPDTVGITLPSEFGQLIADLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  314

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVE+YTG+  
Sbjct  315   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEDYTGMQT  374

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  375   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  434

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY ++ ++L  +FWRFKSVAE+KK+VTD D+IALVSDEVFQP+  W+L D+Q+T
Sbjct  435   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEALWKLLDIQIT  494

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL DADG+EH ACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGI
Sbjct  495   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  554

Query  1702  DAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVL+R +    S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L F+
Sbjct  555   DAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  613



>gb|ACB59195.1| 2-isopropylmalate synthase [Brassica oleracea]
Length=672

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/539 (75%), Positives = 480/539 (89%), Gaps = 4/539 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             +YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+
Sbjct  118   DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  177

Query  448   ADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ I+E VG    E  +VPVICGL+RCNK+DI  AWEAV++AK+PRIHTFIATS+
Sbjct  178   DDFEAVKTISETVGNAVDENGYVPVICGLSRCNKKDIQTAWEAVRYAKRPRIHTFIATSD  237

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK S+++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  238   IHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  297

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLIAD+KANTPGIENV+ISTHCQNDLGLSTANTL+GA AGAR
Sbjct  298   TTLNIPDTVGITLPSEFGQLIADLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  357

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVE+YTG+  
Sbjct  358   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEDYTGMQT  417

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  418   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  477

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY ++ ++L  +FWRFKSVAE+KK+VTD D+IALVSDEVFQP+  W++ D+Q+T
Sbjct  478   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEAVWKVLDIQIT  537

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG+LGLSTATVKL DADG+EH ACS+GTGPVD+AYKAVDL+ K P TLLEYSMNAVTEGI
Sbjct  538   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  597

Query  1702  DAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             DAIA+TRVL+R +    S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK+L F+
Sbjct  598   DAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  656



>ref|XP_003578949.1| PREDICTED: 2-isopropylmalate synthase A-like [Brachypodium distachyon]
Length=633

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/562 (75%), Positives = 478/562 (85%), Gaps = 13/562 (2%)
 Frame = +1

Query  196   RRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEK  375
             RRP     +A A         RRPEY+P+RI DPNYVRIFDTTLRDGEQSPGATMT+ EK
Sbjct  60    RRPVRACLAAGAA-------PRRPEYVPDRIDDPNYVRIFDTTLRDGEQSPGATMTSAEK  112

Query  376   LAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR----GEGDHVPVICGLARCNK  543
             L VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG     G+G HVPVICGL+RCNK
Sbjct  113   LVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPLGGDG-HVPVICGLSRCNK  171

Query  544   RDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVE  723
             RDID AWEAV+HA+KPRIHTFIATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVE
Sbjct  172   RDIDAAWEAVRHARKPRIHTFIATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVE  231

Query  724   FSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENV  903
             FSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGY +P+EFG+LIADIKANTPGIEN 
Sbjct  232   FSPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYNLPHEFGKLIADIKANTPGIENA  291

Query  904   IISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLG  1083
             IISTHCQNDLGL++ANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LG
Sbjct  292   IISTHCQNDLGLASANTLAGAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLG  350

Query  1084  GLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIIS  1263
             GLYTGI+TQ I M+SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIIS
Sbjct  351   GLYTGISTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIIS  410

Query  1264  PEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTD  1443
             PEDIGL R NE GIVLGKLSGRHA++ K++ELGYEI  KE ED F R+K VAE+KK+VTD
Sbjct  411   PEDIGLVRVNEFGIVLGKLSGRHAVKTKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTD  470

Query  1444  DDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAA  1623
             +D+ AL+SDE+FQP+V W LGDVQ TCG+LGLSTATVKLI  DGEE + CSVGTGPVDAA
Sbjct  471   EDIEALLSDEIFQPKVIWSLGDVQATCGTLGLSTATVKLIAIDGEEKIGCSVGTGPVDAA  530

Query  1624  YKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGA  1803
             YKAVD + ++P  L EYSM +VTEGIDAIA+TRV+I  D ++   +  G  NRSF+G+GA
Sbjct  531   YKAVDQIIQIPTVLREYSMTSVTEGIDAIATTRVVITGDVSNSKNALIGQNNRSFSGSGA  590

Query  1804  AMDVVISSVRAYVGALNKLLGF  1869
             A+DVV+SSVRAY+ ALNK+  +
Sbjct  591   ALDVVVSSVRAYLSALNKMSSY  612



>gb|KHG05648.1| 2-isopropylmalate synthase 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=674

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/620 (70%), Positives = 499/620 (80%), Gaps = 64/620 (10%)
 Frame = +1

Query  202   PSFQSFSAAAVRCESS-----PPA--RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATM  360
             PSF S S       SS     PP+  R P YIPN I DPNYVR+FDTTLRDGEQSPGAT+
Sbjct  39    PSFPSKSCPKSLPISSSLNPNPPSSQRCPPYIPNHIPDPNYVRVFDTTLRDGEQSPGATL  98

Query  361   TTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLA  531
             T+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG    G G +VPVICGL+
Sbjct  99    TSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDGNG-YVPVICGLS  157

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN++DI  AWEAVK+AK+PRIHTFIATS IH+ YKL+ S+E+V++ A +MV +ARSLGC
Sbjct  158   RCNEKDIKTAWEAVKYAKRPRIHTFIATSAIHLEYKLRKSKEEVLDIARNMVRFARSLGC  217

Query  712   SDVEFSPEDAGR--------------------------SDREFLYQILGEVIKAGATTLN  813
             +DVEFSPEDAGR                          SDREFLY+ILGEVIKAGATTLN
Sbjct  218   NDVEFSPEDAGRCMLVFAWGGLIISGALNDSYFAVAVVSDREFLYEILGEVIKAGATTLN  277

Query  814   IPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEV  993
             IPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT+AGACAGARQ+EV
Sbjct  278   IPDTVGITMPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTIAGACAGARQVEV  337

Query  994   TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHK  1173
             TINGIGERAGNAS+EEVVMALKCRGE VLGGL+TGINT+ I+MASKMVEEYTGLHVQPHK
Sbjct  338   TINGIGERAGNASMEEVVMALKCRGEHVLGGLHTGINTRHIVMASKMVEEYTGLHVQPHK  397

Query  1174  AIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL-----------  1320
             AIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R+NE+GIVLGKL           
Sbjct  398   AIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNEAGIVLGKLRFLTFTNSMVL  457

Query  1321  --------------SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIA  1458
                            GRHAL  ++ ELGYE++  +L ++FWRFK VAE+KK+VTD DL+A
Sbjct  458   CYLELDMNVGVGPMGGRHALSDRLKELGYELDDVQLGNIFWRFKEVAEQKKRVTDADLVA  517

Query  1459  LVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVD  1638
             LVSDEVFQP V W+L D+QVTCG+LGLSTATVKLIDADG EHVACSVGTGPVD+AYKAVD
Sbjct  518   LVSDEVFQPDVVWKLLDLQVTCGTLGLSTATVKLIDADGREHVACSVGTGPVDSAYKAVD  577

Query  1639  LVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMD  1812
             L+ K  V+LLEYSMNAVTEGIDAIA+TRVLIR +++  S H  TG   +R+F+GTGA MD
Sbjct  578   LIIKESVSLLEYSMNAVTEGIDAIATTRVLIRVEKSHLSTHALTGELVHRTFSGTGAGMD  637

Query  1813  VVISSVRAYVGALNKLLGFQ  1872
             +V+SSV+AYV ALNK+LGF+
Sbjct  638   IVVSSVKAYVSALNKMLGFK  657



>gb|ACR35826.1| unknown [Zea mays]
 tpg|DAA39219.1| TPA: 2-isopropylmalate synthase B [Zea mays]
Length=640

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/572 (74%), Positives = 480/572 (84%), Gaps = 10/572 (2%)
 Frame = +1

Query  181   ISGASRRPSFQSFSAAA--VRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGA  354
             + G    PS     A A  +R     P RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGA
Sbjct  50    VGGGKASPSTVRLRARAQRIRASQQQPRRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGA  109

Query  355   TMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR----GEGD-HVPVI  519
             TMT+ EKL VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG     G G  HVPVI
Sbjct  110   TMTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNPPTAGAGTAHVPVI  169

Query  520   CGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYAR  699
             CGL+RCN++DID AWEAV+HA++PRIHTFIATSEIHM +KL+ + EQVV  A  MVAYAR
Sbjct  170   CGLSRCNRKDIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAREMVAYAR  229

Query  700   SLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKA  879
             SLGC DVEFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P EFG+LIADIKA
Sbjct  230   SLGCPDVEFSPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKA  289

Query  880   NTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  1059
             NT GIEN IISTHCQNDLGL+TANTLAGA +GARQLEVTINGIGERAGNASLEEVVMA+K
Sbjct  290   NTSGIENAIISTHCQNDLGLATANTLAGARSGARQLEVTINGIGERAGNASLEEVVMAIK  349

Query  1060  CRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKH  1239
             CRGE +L GLYTGIN+Q I + SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+
Sbjct  350   CRGE-LLDGLYTGINSQHITLTSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKY  408

Query  1240  KDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVA  1419
             K TYEIISP+DIGL RANE GIVLGKLSGRHA+++K++ELGYEI  KE ED F R+K VA
Sbjct  409   KGTYEIISPDDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEISDKEFEDFFKRYKEVA  468

Query  1420  ERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSV  1599
             E+KK+VTD+D+ AL+SDE+FQP+V W L DVQ TCG+LGLSTATVKLI  DGEE +ACSV
Sbjct  469   EKKKRVTDEDIEALLSDEIFQPKVIWSLADVQATCGTLGLSTATVKLIAPDGEERIACSV  528

Query  1600  GTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGS  1773
             GTGPVDAAYKA+D + ++P  L EY M +VTEGIDAIA+TRV++  D    S H  TG +
Sbjct  529   GTGPVDAAYKAIDQIIQIPTVLREYGMTSVTEGIDAIATTRVVVTGDVTNNSKHALTGRA  588

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
              NRSF+G+GAAMD+V+SSVRAY+ ALNK+  F
Sbjct  589   FNRSFSGSGAAMDIVVSSVRAYLSALNKMCSF  620



>ref|XP_003556565.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Glycine 
max]
Length=624

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/540 (76%), Positives = 477/540 (88%), Gaps = 7/540 (1%)
 Frame = +1

Query  271   YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEA  450
             YIPNRI DP+YVRIFDTTLRDGEQSPGA+MT+KEKL VARQLA+LGVDIIEAGFPA+S+ 
Sbjct  70    YIPNRIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLAKLGVDIIEAGFPAASKD  129

Query  451   DLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEI  624
             D EAV++IA+EVG    D  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIATS I
Sbjct  130   DFEAVKMIAQEVGNAVDDDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSAI  189

Query  625   HMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  804
             HM YKL+MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  190   HMEYKLRMSKDKVVDIARNMVKFARSLGCEDVEFSPEDAGRSDREFLYEILGEVIKAGAT  249

Query  805   TLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  984
             TLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQ
Sbjct  250   TLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIEGARAGARQ  309

Query  985   LEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             LEVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+ I + S+MVEEYTGL +Q
Sbjct  310   LEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGINTKHIFLTSRMVEEYTGLQLQ  368

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             PHKA+VGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R NE+GIVLGKLSGRHAL+ 
Sbjct  369   PHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKLSGRHALRK  428

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELGYE+   +++ LFWRFK+VAE+KK+VTD DL ALVSDEVFQ +  W+LGD+QVTC
Sbjct  429   RLEELGYELSDDQVQTLFWRFKAVAEQKKRVTDADLRALVSDEVFQAEPVWKLGDLQVTC  488

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+LGLSTATVKL+ +DG  HVACSVGTGPVD+AYKAVDL+ K PVTLLEYSMNAVTEGID
Sbjct  489   GTLGLSTATVKLLSSDGSTHVACSVGTGPVDSAYKAVDLIVKEPVTLLEYSMNAVTEGID  548

Query  1705  AIASTRVLIREDQ----ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             AIA+TRV+IR +     ++ H  TG +  R+F+GTGA MDVV+SSV+AY+ ALNK+LGF+
Sbjct  549   AIATTRVVIRGESETSTSTTHALTGEAVLRTFSGTGAGMDVVVSSVKAYIAALNKMLGFK  608



>ref|XP_009336349.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase 1, 
chloroplastic-like [Pyrus x bretschneideri]
Length=659

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/595 (70%), Positives = 484/595 (81%), Gaps = 37/595 (6%)
 Frame = +1

Query  199   RPSFQSFSAAAVRCESS---PPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTK  369
             RP+  +     + C  S    P  RP+YIPNRI DPNYVRIFDTTLRDGEQSPGA++T+K
Sbjct  49    RPNLHNTCNPHILCSQSDNPKPTPRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSK  108

Query  370   EKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNK  543
             EKL +AR+LA+LGVDIIEAGFPASS+ D EAV++IA+EVG    +  +VPVICGL+RCN+
Sbjct  109   EKLDIARKLAKLGVDIIEAGFPASSKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNR  168

Query  544   RDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVE  723
              DI  AW+AVK+AK+PRIHTFIATS IH+ YKL+ S+EQV+E A +MV +AR LGC DVE
Sbjct  169   NDIQTAWDAVKYAKRPRIHTFIATSPIHLEYKLRKSKEQVIEIARNMVKFARELGCDDVE  228

Query  724   FSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENV  903
             FSPEDAGRS+REFLYQILGEVIK GATTLNIPDTVGY +P+E+ QLIADIK+NTPGI+NV
Sbjct  229   FSPEDAGRSEREFLYQILGEVIKVGATTLNIPDTVGYNVPDEYSQLIADIKSNTPGIDNV  288

Query  904   IISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLG  1083
             IISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVM L CRGE VLG
Sbjct  289   IISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMTLNCRGEHVLG  348

Query  1084  GLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIIS  1263
             GLYTGINT+ I + SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIIS
Sbjct  349   GLYTGINTKHIYVTSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIIS  408

Query  1264  PEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTD  1443
             PEDIG  R+NE+GIVLGKLSGRHAL+ ++ ELGYE+E  +L  +F  FK+VAE+KK +TD
Sbjct  409   PEDIGYERSNEAGIVLGKLSGRHALRNRLAELGYELEDDQLATVFEHFKAVAEQKKIITD  468

Query  1444  DDLIALVSDEVFQPQVFWRLGDV------------------------------QVTCGSL  1533
              DL ALV DEVFQP+V W+L D+                              QVTCG+L
Sbjct  469   ADLGALVRDEVFQPEVVWKLHDLQVFRDSVLPCSLSARXVLRVDHLXFIGLDAQVTCGTL  528

Query  1534  GLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIA  1713
             GLSTATVKLIDADG EHVACSVGTGPVD+AYKAVDL+ K PVTL+EYSMNA+TEG DAIA
Sbjct  529   GLSTATVKLIDADGREHVACSVGTGPVDSAYKAVDLIVKEPVTLIEYSMNAITEGNDAIA  588

Query  1714  STRVLIREDQASI--HGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             +TRV+IR +   +  H  TG S  R+F+G GA MD+V+SSV+AY+GALNK++GF 
Sbjct  589   TTRVVIRPENRRMITHAHTGESVQRTFSGIGAGMDIVVSSVKAYIGALNKMIGFN  643



>ref|XP_003592827.1| 2-isopropylmalate synthase [Medicago truncatula]
 gb|AES63078.1| 2-isopropylmalate synthase [Medicago truncatula]
Length=598

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/569 (73%), Positives = 486/569 (85%), Gaps = 9/569 (2%)
 Frame = +1

Query  190   ASRRPSFQSF----SAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGAT  357
             +S++P+  SF     + + + +S  P  RP YIPN I DP+YVRIFDTTLRDGEQSPGA+
Sbjct  31    SSKQPTHSSFPNFSISCSSQSQSQSPRHRPPYIPNHIPDPSYVRIFDTTLRDGEQSPGAS  90

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGD--HVPVICGLA  531
             MT+KEKL +ARQLA+LGVDIIEAGFPA+S  D EAV++IA EVG    D  +VPVICGL+
Sbjct  91    MTSKEKLDIARQLAKLGVDIIEAGFPAASTDDFEAVKMIANEVGNAVDDNGYVPVICGLS  150

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN+ DI  AW AVKHAK+PRIHTFIATS IHM +KL+MS++QV++KA +MVA+ARSLGC
Sbjct  151   RCNENDIQTAWNAVKHAKRPRIHTFIATSAIHMEFKLRMSKQQVIDKARTMVAFARSLGC  210

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
              DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVG T+P+EFG+LIADIKANTPG
Sbjct  211   QDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGITMPSEFGKLIADIKANTPG  270

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
             +ENVIISTHCQNDLGLSTANT+ GA AGARQLEVTINGIGERAGNASLEEVVMALKC G 
Sbjct  271   VENVIISTHCQNDLGLSTANTIEGARAGARQLEVTINGIGERAGNASLEEVVMALKC-GG  329

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
              +   L+TGINT+ I + S+MVEEY+GL +QPHKA+VGANAFAHESGIHQDGMLKHK TY
Sbjct  330   HIFNNLFTGINTRHIYLTSRMVEEYSGLQLQPHKALVGANAFAHESGIHQDGMLKHKGTY  389

Query  1252  EIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             EIISPEDIGL R+NE+GIVLGKLSGRHA++ ++ ELGYE++  ++E LFWRFK+VAE+KK
Sbjct  390   EIISPEDIGLERSNEAGIVLGKLSGRHAMRKRLEELGYELKDDQVESLFWRFKAVAEQKK  449

Query  1432  KVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGP  1611
             ++TD DL ALVSDEVFQ +  W+L D+QVTCG+LGLSTATVKL+  DG  H+ACSVGTGP
Sbjct  450   RITDADLRALVSDEVFQAEPIWKLDDLQVTCGTLGLSTATVKLVGDDGSTHIACSVGTGP  509

Query  1612  VDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRS  1785
             VD+AYKAVDL+ K P TLLEYSM AVTEGIDAIA+TRV+IR   DQ S H  TG S  R+
Sbjct  510   VDSAYKAVDLIVKEPATLLEYSMIAVTEGIDAIATTRVVIRGDTDQTSTHALTGESVQRT  569

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             F+GTGA MDVV+SSV+AY+ A+NK+L F+
Sbjct  570   FSGTGAGMDVVVSSVKAYIAAINKMLSFK  598



>ref|NP_001147962.1| LOC100281571 [Zea mays]
 gb|ACG29253.1| 2-isopropylmalate synthase B [Zea mays]
Length=640

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/572 (73%), Positives = 478/572 (84%), Gaps = 10/572 (2%)
 Frame = +1

Query  181   ISGASRRPSFQSFSAAA--VRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGA  354
             + G    PS     A A  +R     P RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGA
Sbjct  50    VGGGKASPSTVRLRARAQRIRASQQQPRRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGA  109

Query  355   TMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGD-----HVPVI  519
             TMT+ EKL VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG          HVPVI
Sbjct  110   TMTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNPPTASAGTVHVPVI  169

Query  520   CGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYAR  699
             CGL+RCN++DID AWEAV+HA++PRIHTFIATSEIHM +KL+ + EQVV  A  MVAYAR
Sbjct  170   CGLSRCNRKDIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAREMVAYAR  229

Query  700   SLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKA  879
             SLGC DVEFSPEDAGRS+REF+Y IL EVIKAGATTLNIPDTVGYT+P EFG+LIADIKA
Sbjct  230   SLGCPDVEFSPEDAGRSNREFMYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKA  289

Query  880   NTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALK  1059
             NT GIEN IISTHCQNDLGL+TANTLAGA +GARQLEVTINGIGERAGNASLEEVVMA+K
Sbjct  290   NTSGIENAIISTHCQNDLGLATANTLAGARSGARQLEVTINGIGERAGNASLEEVVMAIK  349

Query  1060  CRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKH  1239
             CRGE +L GLYTGIN+Q I + SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+
Sbjct  350   CRGE-LLDGLYTGINSQHITLTSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKY  408

Query  1240  KDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVA  1419
             K TYEIISP+DIGL RANE GIVLGKLSGRHA+++K++ELGYEI  KE ED F R+K VA
Sbjct  409   KGTYEIISPDDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEISDKEFEDFFKRYKEVA  468

Query  1420  ERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSV  1599
             E+KK+VTD+D+ AL+SDE+FQP+V W L DVQ TCG+LGLSTATVKLI  DGEE +ACSV
Sbjct  469   EKKKRVTDEDIEALLSDEIFQPKVIWSLADVQATCGTLGLSTATVKLIAPDGEERIACSV  528

Query  1600  GTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGS  1773
             GTGPVDAAYKA+D + ++P  L EY M +VTEGIDAIA+TRV++  D    S H  TG +
Sbjct  529   GTGPVDAAYKAIDQIIQIPTVLREYGMTSVTEGIDAIATTRVVVTGDVTNNSKHALTGRA  588

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
              NRSF+G+GAAMD+V+SSVRAY+ ALNK+  F
Sbjct  589   FNRSFSGSGAAMDIVVSSVRAYLSALNKMCSF  620



>gb|KCW87847.1| hypothetical protein EUGRSUZ_A00248 [Eucalyptus grandis]
Length=638

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/579 (71%), Positives = 489/579 (84%), Gaps = 24/579 (4%)
 Frame = +1

Query  199   RPSFQSFSAAAVRCESS---------------PPARRPEYIPNRILDPNYVRIFDTTLRD  333
             RP  Q  S++ +RC ++               PP   P+YIPNRI DPNY+RIFDTTLRD
Sbjct  51    RPPPQRASSSVIRCSTTPPPPPPPQSEGPTTAPPC--PKYIPNRIPDPNYIRIFDTTLRD  108

Query  334   GEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--  507
             GEQSPGATMT++EKL +ARQLA+LGVDIIEAGFPA+S  D  AV+ IA EVG     H  
Sbjct  109   GEQSPGATMTSQEKLNIARQLAKLGVDIIEAGFPAASPDDFNAVKAIALEVGNAVDPHGY  168

Query  508   VPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMV  687
             +P+IC L+RCN++DI  AW+AV+ A++PRIHTFIATS IHM YKLK S+++V+  A +MV
Sbjct  169   IPIICSLSRCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVINIARTMV  228

Query  688   AYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIA  867
             A+ARSLGC+DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIA
Sbjct  229   AFARSLGCNDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPEEFGKLIA  288

Query  868   DIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVV  1047
             D+KANTPGIENVIIS HC NDLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVV
Sbjct  289   DVKANTPGIENVIISAHCHNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVV  348

Query  1048  MALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDG  1227
             MALKC+GE +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQD 
Sbjct  349   MALKCKGESILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDR  408

Query  1228  MLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRF  1407
             MLKHK TYEIISP+DIGL R NE  IVLGKLSGRHAL+ K++ELGY+I+G++L+++FW+F
Sbjct  409   MLKHKGTYEIISPDDIGLERTNEVDIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWQF  468

Query  1408  KSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHV  1587
             K+VAE+KK+VTD ++IALVSDEVFQP V W+L D+QV+CG+LGLSTATVKLI  DG+EH+
Sbjct  469   KAVAEQKKRVTDAEIIALVSDEVFQPAVVWKLHDLQVSCGTLGLSTATVKLISGDGKEHI  528

Query  1588  ACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGS  1761
             AC+VGTG VD+AYKAVDL+ KVP TLL+YSM  VTEGIDAIA+T+VLI    D+ S H  
Sbjct  529   ACAVGTGRVDSAYKAVDLIVKVPTTLLKYSMTTVTEGIDAIATTQVLIHGENDRTSRHAL  588

Query  1762  TGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
             T    +R+F+GTG++MD+ +SSVRAY+ ALNK+LGF  L
Sbjct  589   T---IHRTFSGTGSSMDIAVSSVRAYIVALNKMLGFMEL  624



>ref|XP_004978642.1| PREDICTED: 2-isopropylmalate synthase A-like [Setaria italica]
Length=635

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/546 (76%), Positives = 469/546 (86%), Gaps = 4/546 (1%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P RRPEY+P+RI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGF
Sbjct  79    PRRRPEYVPSRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGF  138

Query  433   PASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHT  603
             PASS  DL+AVR IA EVG    GE  HVPVICGL+RCN++DID AWEAV+HA++PRIHT
Sbjct  139   PASSPDDLDAVRSIAIEVGNTPVGEEGHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHT  198

Query  604   FIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  783
             FIATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL E
Sbjct  199   FIATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEE  258

Query  784   VIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  963
             VIKAGATTLNIPDTVGYT+P EFG LIADIKANTPGIEN IISTHCQNDLGL+TANTLAG
Sbjct  259   VIKAGATTLNIPDTVGYTLPYEFGNLIADIKANTPGIENAIISTHCQNDLGLATANTLAG  318

Query  964   ACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEE  1143
             A AGARQLEVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+Q I + SKMV+E
Sbjct  319   ARAGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQE  377

Query  1144  YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLS  1323
             ++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLS
Sbjct  378   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLS  437

Query  1324  GRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRL  1503
             GRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+V W L
Sbjct  438   GRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSL  497

Query  1504  GDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMN  1683
               VQ TCG+LGLSTATVKLI  DGEE +AC VGTGPVDAAYKAVD + ++P  L EY M 
Sbjct  498   AAVQATCGTLGLSTATVKLIAPDGEEKIACCVGTGPVDAAYKAVDEIIQIPTVLREYGMT  557

Query  1684  AVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             +VTEGIDAIA+TRV+I  D +S       S NRSF+G+GA+MDVV+SSVRAY+ ALNK+ 
Sbjct  558   SVTEGIDAIATTRVVITGDVSSNSKHALTSLNRSFSGSGASMDVVVSSVRAYLSALNKMC  617

Query  1864  GFQNLV  1881
              F   V
Sbjct  618   SFAGAV  623



>ref|XP_004977502.1| PREDICTED: 2-isopropylmalate synthase A-like [Setaria italica]
Length=631

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/608 (72%), Positives = 493/608 (81%), Gaps = 35/608 (6%)
 Frame = +1

Query  145   IATSFSKQLRFSISGASRR-PSF-QSFSAAAVRCESSPPARR------------------  264
             IA  F  Q   S S +SR  P F    SAAAVR  +SP ARR                  
Sbjct  18    IANRFPSQ---SPSLSSRAAPRFAHGLSAAAVR--ASPGARRRLGALARPIRASSQQQQQ  72

Query  265   ----PEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
                 PEY+P RI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGF
Sbjct  73    PPRRPEYVPGRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGF  132

Query  433   PASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHT  603
             PASS  DL+AVR IA EVG    GE  HVPVICGL+RCN++DID AWEAV+HA++PRIHT
Sbjct  133   PASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHT  192

Query  604   FIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  783
             FIATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL E
Sbjct  193   FIATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEE  252

Query  784   VIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  963
             VIKAGATTLNIPDTVGYT+P EFG LIADIKANTPGIEN IISTHCQNDLGL+TANTLAG
Sbjct  253   VIKAGATTLNIPDTVGYTLPYEFGNLIADIKANTPGIENAIISTHCQNDLGLATANTLAG  312

Query  964   ACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEE  1143
             A AGARQLEVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+Q I + SKMV+E
Sbjct  313   ARAGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLNGLYTGINSQHITLTSKMVQE  371

Query  1144  YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLS  1323
             ++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLS
Sbjct  372   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLS  431

Query  1324  GRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRL  1503
             GRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SD++FQP+V W L
Sbjct  432   GRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDQIFQPKVIWSL  491

Query  1504  GDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMN  1683
              DVQ TCG+LGLSTATVKLI  DGEE +AC VGTGPVDAAYKAVD + ++P  L EY M 
Sbjct  492   ADVQATCGTLGLSTATVKLIAPDGEEKIACCVGTGPVDAAYKAVDEIIQIPTVLREYGMT  551

Query  1684  AVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNK  1857
             +VTEGIDAIA+TRV+I  D +  S H  TG S NRSF+G+GA+MDVV+SSVRAY+ ALNK
Sbjct  552   SVTEGIDAIATTRVIITGDLSNNSKHALTGHSFNRSFSGSGASMDVVVSSVRAYLSALNK  611

Query  1858  LLGFQNLV  1881
             +  F  +V
Sbjct  612   MCSFAGVV  619



>ref|XP_002448963.1| hypothetical protein SORBIDRAFT_05g002540 [Sorghum bicolor]
 gb|EES07951.1| hypothetical protein SORBIDRAFT_05g002540 [Sorghum bicolor]
Length=620

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/539 (77%), Positives = 469/539 (87%), Gaps = 5/539 (1%)
 Frame = +1

Query  265   PEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASS  444
             PEY+P+RI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFPASS
Sbjct  63    PEYVPHRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPASS  122

Query  445   EADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATS  618
               DL+AVR IA EVG    EG HVPVICGL+RCNKRDID AWEAV++A++PRIHTFIATS
Sbjct  123   PDDLDAVRSIAIEVGNPVEEGAHVPVICGLSRCNKRDIDAAWEAVRNARRPRIHTFIATS  182

Query  619   EIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  798
             EIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVIKAG
Sbjct  183   EIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVIKAG  242

Query  799   ATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGA  978
             ATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA AGA
Sbjct  243   ATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGARAGA  302

Query  979   RQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLH  1158
             RQLEVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+Q I + SKMV+E++GLH
Sbjct  303   RQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQEHSGLH  361

Query  1159  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHAL  1338
             VQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSGRHA+
Sbjct  362   VQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGRHAV  421

Query  1339  QAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQV  1518
             ++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+V W L DVQ 
Sbjct  422   RSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSLADVQA  481

Query  1519  TCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEG  1698
             TCG+LGLSTATVKLI  DGEE + CSVGTGPVDAAYKAVD + ++P  L EY M +VTEG
Sbjct  482   TCGTLGLSTATVKLIAPDGEEKIGCSVGTGPVDAAYKAVDQIIQIPTVLREYGMTSVTEG  541

Query  1699  IDAIASTRVLIRED--QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             IDAIA+TRV++  D    S H  TG S NRSF+G+GAAMD+V+SSVRAY+ ALNK+  F
Sbjct  542   IDAIATTRVVVTGDVTNNSKHALTGQSFNRSFSGSGAAMDIVVSSVRAYLSALNKMCSF  600



>ref|XP_004497478.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=617

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/552 (75%), Positives = 475/552 (86%), Gaps = 8/552 (1%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P RRP YIPN I DP+YVRIFDTTLRDGEQSPGA+MT+KEKL +ARQL +LGVDIIEAGF
Sbjct  62    PRRRPPYIPNHIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDIARQLTKLGVDIIEAGF  121

Query  433   PASSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             PA+S+ D EAV++IA EVG    D  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTF
Sbjct  122   PAASKDDFEAVKVIATEVGNDVDDNGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTF  181

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS IHM YKL+MS+E+V+EKA SMVA+ARSLGC DVEFSPEDAGRSDREFLYQILGEV
Sbjct  182   IATSAIHMEYKLRMSKEKVIEKARSMVAFARSLGCDDVEFSPEDAGRSDREFLYQILGEV  241

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVG T+P+EFG+LIADIKANTPG+ENVIISTHCQNDLGLSTANT+ GA
Sbjct  242   IKAGATTLNIPDTVGITMPSEFGKLIADIKANTPGVENVIISTHCQNDLGLSTANTIEGA  301

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              AGARQLEVTINGIGERAGNASLEEVVMALKC G  V   L+TGINT+ I M S+MVEEY
Sbjct  302   RAGARQLEVTINGIGERAGNASLEEVVMALKC-GGHVFDNLFTGINTRHIYMTSRMVEEY  360

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             +GL +QPHKA+VGANAFAHESGIHQDGMLKHK+TYEIISPEDIGL R+NE+GIVLGKLSG
Sbjct  361   SGLQLQPHKALVGANAFAHESGIHQDGMLKHKNTYEIISPEDIGLERSNEAGIVLGKLSG  420

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHAL+ ++ ELGYE++  ++E LFWRFK+VAE+KK++TD DL ALVSDEVFQ +  W+LG
Sbjct  421   RHALRKRLEELGYELKDDQVESLFWRFKAVAEQKKRITDADLRALVSDEVFQAEPIWKLG  480

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             D+QVTCG+LGLSTATVKL+  DG   VACSVGTGPVD+AYKA+DL+ K PVTLLEYSMNA
Sbjct  481   DLQVTCGTLGLSTATVKLVGDDGSTCVACSVGTGPVDSAYKAIDLIVKEPVTLLEYSMNA  540

Query  1687  VTEGIDAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             VTEGIDAIA+TRV+IR DQ   S H  TG    R+F      MDVV+SSV+AY+ A+NK+
Sbjct  541   VTEGIDAIATTRVVIRGDQKHKSTHALTGERVQRTFR---YGMDVVVSSVKAYIAAINKM  597

Query  1861  LGFQNLVSRYNK  1896
             L F+   S   K
Sbjct  598   LSFKETSSSTEK  609



>ref|XP_010498244.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic isoform 
X1 [Camelina sativa]
Length=650

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/632 (66%), Positives = 507/632 (80%), Gaps = 40/632 (6%)
 Frame = +1

Query  67    LRASPNPPVITPPESKYTCKYLPIHTIATSF-SKQLRFSISGASRRPSFQSFSAAAVRCE  243
             L  +P+ P  +   + ++ +  P    + S  S+ LR S S +   P             
Sbjct  12    LSTTPSLPTFSSKPTPFSFRVKPSRHCSISLRSQTLRLSCSISDPSPLPPHI--------  63

Query  244   SSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
               P  RRPEYIPNRI DP+YVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIE
Sbjct  64    --PLRRRPEYIPNRISDPSYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIE  121

Query  424   AGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRI  597
             AGFPA+S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PRI
Sbjct  122   AGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRI  181

Query  598   HTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  777
             HTFIATS+IH+ +KLK ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+IL
Sbjct  182   HTFIATSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEIL  241

Query  778   GEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  957
             GEVIKAGATTLNIPDTVG T+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL
Sbjct  242   GEVIKAGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  301

Query  958   AGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMV  1137
             +GA AGARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TG++T+ I+M SKMV
Sbjct  302   SGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGLDTRHIVMTSKMV  361

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGK  1317
             EEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGK
Sbjct  362   EEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGK  421

Query  1318  LSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFW  1497
             LSGRHAL+ ++ ELGY+++ ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  W
Sbjct  422   LSGRHALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVW  481

Query  1498  RLGDVQV-------------------------TCGSLGLSTATVKLIDADGEEHVACSVG  1602
             +L D+QV                         TCG+LGLSTATVKL DADG+EHVACS+G
Sbjct  482   KLLDIQVKLRSSCFLFHFLLAYSHLLQSGMQITCGTLGLSTATVKLADADGKEHVACSMG  541

Query  1603  TGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSA  1776
             TGPVD+AYKAVDL+ K P TLLEYSMNAVTEGIDAIA+TRVLIR     +S +  TG   
Sbjct  542   TGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGSNKYSSTNAITGEEV  601

Query  1777  NRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
              R+F+GTG+ +D+V+SSV+AYVGALNK++ F+
Sbjct  602   LRTFSGTGSEIDIVVSSVKAYVGALNKMMDFK  633



>ref|XP_006858638.1| hypothetical protein AMTR_s00066p00043610 [Amborella trichopoda]
 gb|ERN20105.1| hypothetical protein AMTR_s00066p00043610 [Amborella trichopoda]
Length=629

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/554 (74%), Positives = 480/554 (87%), Gaps = 5/554 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             +RPEY+PNRI D  YVRIFDTTLRDGEQSPGA+MT+KEKL VARQLARLGVDIIEAGFP 
Sbjct  76    QRPEYLPNRIDDLQYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLARLGVDIIEAGFPI  135

Query  439   SSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             +S  DLEA+++IA +VG    D  +VPVICGLARCNK DID AWEAV+ A +PRIH FIA
Sbjct  136   ASREDLEAIKMIAADVGSFIDDSGYVPVICGLARCNKADIDAAWEAVQRAVRPRIHIFIA  195

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIH+ +KLK +R++V+E A SMVAYARSLGC DVEFSPEDAGRSDREFLY +LGE IK
Sbjct  196   TSEIHLEHKLKKTRDEVLEIARSMVAYARSLGCPDVEFSPEDAGRSDREFLYLVLGEAIK  255

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVGYT+P+E+G+LI+DI+ANTPGIENVIISTHCQNDLGL+++NTLAGA A
Sbjct  256   AGATTLNIPDTVGYTLPSEYGKLISDIRANTPGIENVIISTHCQNDLGLASSNTLAGAYA  315

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQLEVT+NGIGERAGNASLEEVVMAL  RG+++LGGLYTGINT+QI MASKMV EYTG
Sbjct  316   GARQLEVTVNGIGERAGNASLEEVVMALHLRGKELLGGLYTGINTKQIAMASKMVTEYTG  375

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             + VQPHKAIVGANAFAHESGIHQDGMLK + TYEI+SP DIGL R+ ESGIVLGKLSGRH
Sbjct  376   MPVQPHKAIVGANAFAHESGIHQDGMLKFQGTYEILSPSDIGLNRSTESGIVLGKLSGRH  435

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL++++++LGY +  K+L+D+FWRFK+VAE+KK ++D D+ ALVSDEVFQPQV W LGD+
Sbjct  436   ALKSRLVQLGYNLGEKKLDDVFWRFKAVAEKKKHLSDGDIEALVSDEVFQPQVIWSLGDL  495

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QVTCG+ GLST TVKLI ADG EH+AC+VGTGPVDAAYKA+D + KV VTLLEYSMNAVT
Sbjct  496   QVTCGTSGLSTGTVKLIGADGTEHIACAVGTGPVDAAYKAIDSIVKVSVTLLEYSMNAVT  555

Query  1693  EGIDAIASTRVLIREDQA---SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             EGIDAIA TRV+IR +     S H  TG + +R+F+GTGA MD+V SSVRAYV ALNK+L
Sbjct  556   EGIDAIAHTRVIIRPEHGHHTSTHALTGETLHRTFSGTGAGMDIVASSVRAYVSALNKML  615

Query  1864  GFQNLVSRYNKTQG  1905
              F+ + +R    +G
Sbjct  616   SFRTISTRKETVEG  629



>gb|ACG29264.1| 2-isopropylmalate synthase B [Zea mays]
Length=642

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/541 (76%), Positives = 468/541 (87%), Gaps = 8/541 (1%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVD+IEAGFPASS 
Sbjct  82    EYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDVIEAGFPASSP  141

Query  448   ADLEAVRLIAEEVGRGE-----GDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
              DL+AVR IA EVG        G HVPVICGL+RCN+RDID AWEAV+HA++PRIHTFIA
Sbjct  142   DDLDAVRSIAIEVGNPPPGDDGGAHVPVICGLSRCNRRDIDAAWEAVRHARRPRIHTFIA  201

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIHM +KL+ + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY IL EVIK
Sbjct  202   TSEIHMQHKLRKTPDQVVAVAREMVAYARSLGCADVEFSPEDAGRSNREFLYHILEEVIK  261

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
              GATTLNIPDTVGYT+P EFG+LI+DIK NTPGIEN IISTHCQNDLGL+TANTLAGA A
Sbjct  262   VGATTLNIPDTVGYTLPYEFGKLISDIKENTPGIENAIISTHCQNDLGLATANTLAGARA  321

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GA+QLEVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+Q I + SKMV+E++G
Sbjct  322   GAQQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQEHSG  380

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             LHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSGRH
Sbjct  381   LHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLARANEFGIVLGKLSGRH  440

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             A+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+V W L DV
Sbjct  441   AVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSLADV  500

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             Q TCG+LGLSTATVKLI  DGEE +ACSVGTGPVDAAYKAVD + ++P  L EY M +VT
Sbjct  501   QATCGTLGLSTATVKLIGPDGEERIACSVGTGPVDAAYKAVDQIIQIPTVLREYGMTSVT  560

Query  1693  EGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             EGIDAIA+TRV++  D A  S H  TG S NRSF+G+GAAMD+V+SSVRAY+ ALNK+  
Sbjct  561   EGIDAIATTRVVVTGDVANNSKHALTGHSFNRSFSGSGAAMDIVVSSVRAYLSALNKMCS  620

Query  1867  F  1869
             F
Sbjct  621   F  621



>ref|XP_003536802.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Glycine 
max]
Length=620

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/609 (70%), Positives = 497/609 (82%), Gaps = 26/609 (4%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPPARRP  267
             P++ P  S +  +    HT  T     LRFS    + R S +S S  AV C  S P    
Sbjct  8     PILFPSTSHHPNQN---HTFLT-----LRFS---QTLRSSLRSKSRFAVSCSQSEPPPPH  56

Query  268   E--------YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
                      YIPN I DP+YVRIFDTTLRDGEQSPGA+MT+KEKL VARQLA+LGVDIIE
Sbjct  57    PSSSRRRPPYIPNLIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLAKLGVDIIE  116

Query  424   AGFPASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRI  597
             AGFPA+S+ D EAV++IA+ VG   E D +VPVICGL+RCN++DI  AWEAVK+AK+PRI
Sbjct  117   AGFPAASKDDFEAVKMIAQAVGNAVENDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRI  176

Query  598   HTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  777
             HTFIATS IHM YKL+MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+IL
Sbjct  177   HTFIATSPIHMEYKLRMSKDKVVDIARNMVKFARSLGCDDVEFSPEDAGRSDREFLYEIL  236

Query  778   GEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  957
             GEVIK GATTLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+
Sbjct  237   GEVIKVGATTLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTI  296

Query  958   AGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMV  1137
              GA AGARQLEVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+ I + SKMV
Sbjct  297   EGARAGARQLEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGINTKHIFLTSKMV  355

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGK  1317
             EEYTGL +QPHKA+VGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R NE+GIVLGK
Sbjct  356   EEYTGLQIQPHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGK  415

Query  1318  LSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFW  1497
             LSGRHAL+ ++ ELGYE+   +++ LFW FK+VAE+KK+VTD DL ALVSDEVFQ +  W
Sbjct  416   LSGRHALRKRLEELGYELNDDQVQTLFWCFKAVAEQKKRVTDADLRALVSDEVFQAEPVW  475

Query  1498  RLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYS  1677
             +LGD+QVTCG+LGLSTATVKL+ +DG  HVACS+GTGPVD+AYKAVDL+ K  VTLLEYS
Sbjct  476   KLGDLQVTCGTLGLSTATVKLLSSDGSTHVACSIGTGPVDSAYKAVDLIVKEQVTLLEYS  535

Query  1678  MNAVTEGIDAIASTRVLIR-EDQAS---IHGSTGGSANRSFNGTGAAMDVVISSVRAYVG  1845
             MNAVTEGIDAIA+TRV+IR E + S    H  TG +  R+F+GTGA MDVV+SSV+AY+ 
Sbjct  536   MNAVTEGIDAIATTRVVIRGESETSTITTHALTGETVIRTFSGTGAGMDVVVSSVKAYIA  595

Query  1846  ALNKLLGFQ  1872
             ALNK+ GF+
Sbjct  596   ALNKMSGFK  604



>emb|CBX25373.1| hypothetical_protein [Oryza brachyantha]
Length=553

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/541 (77%), Positives = 463/541 (86%), Gaps = 16/541 (3%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEY+PNRI DP+YVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFPA
Sbjct  5     RRPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPA  64

Query  439   SSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SS  DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA++PRIHTFI
Sbjct  65    SSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRIHTFI  124

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVI
Sbjct  125   ATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVI  184

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA 
Sbjct  185   KAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGAH  244

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQ I M+SKMV+E++
Sbjct  245   AGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMVQEHS  303

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGK    
Sbjct  304   GLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGK----  359

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGD  1509
                    L LGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+VFW L D
Sbjct  360   -------LRLGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFWSLAD  412

Query  1510  VQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
             VQ TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDAAYKAVD + ++P  L EYSM +V
Sbjct  413   VQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAYKAVDEIIQIPTVLREYSMTSV  472

Query  1690  TEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             TEGIDAIA+TRV++  D   S H  TG S NR+F+G+GAAMD+V+SSVRAY+ ALNK+  
Sbjct  473   TEGIDAIATTRVVVTGDVIDSKHALTGQSFNRAFSGSGAAMDIVVSSVRAYLSALNKMSS  532

Query  1867  F  1869
             F
Sbjct  533   F  533



>gb|AAF26002.1|AC013354_21 F15H18.3 [Arabidopsis thaliana]
Length=675

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/583 (70%), Positives = 483/583 (83%), Gaps = 48/583 (8%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFPA+S+
Sbjct  77    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  136

Query  448   ADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSE  621
              D EAV+ IAE VG    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PRIHTFIATS+
Sbjct  137   DDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSD  196

Query  622   IHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  801
             IH+ YKLK ++ +V+E A SMV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA
Sbjct  197   IHLEYKLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGA  256

Query  802   TTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGAR  981
             TTLNIPDTVG T+P+EFGQLI D+KANTPGIENV+ISTHCQNDLGLSTANTL+GA AGAR
Sbjct  257   TTLNIPDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  316

Query  982   QLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHV  1161
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  
Sbjct  317   QMEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQT  376

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGKLSGRHAL+
Sbjct  377   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  436

Query  1342  AKMLE-----------------------------LGYEIEGKELEDLFWRFKSVAERKKK  1434
              ++ E                             LGY+++ ++L  +FWRFK+VAE+KK+
Sbjct  437   DRLTEVHSNLTHTNTCIAIFVGDTNVLLSFVHFQLGYQLDDEQLSTIFWRFKTVAEQKKR  496

Query  1435  VTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPV  1614
             VTD D+IALVSDEVFQP+  W+L D+Q+TCG+LGLSTATVKL DADG+EHVACS+GTGPV
Sbjct  497   VTDADIIALVSDEVFQPEAVWKLLDIQITCGTLGLSTATVKLADADGKEHVACSIGTGPV  556

Query  1615  DAAYKAVDLVTKV---------------PVTLLEYSMNAVTEGIDAIASTRVLIR--EDQ  1743
             D+AYKAVDL+ KV               P TLLEYSMNAVTEGIDAIA+TRVLIR     
Sbjct  557   DSAYKAVDLIVKVLFIPLRLSSTNNSPEPATLLEYSMNAVTEGIDAIATTRVLIRGSNKY  616

Query  1744  ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             +S +  TG    R+F+GTGA MD+V+SSV+AYVGALNK++ F+
Sbjct  617   SSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDFK  659



>ref|NP_001146891.1| 2-isopropylmalate synthase B [Zea mays]
 gb|ACG24230.1| 2-isopropylmalate synthase B [Zea mays]
Length=624

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/546 (75%), Positives = 470/546 (86%), Gaps = 9/546 (2%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ +KL VARQLARLGVDIIEAGFPASS 
Sbjct  64    EYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAQKLVVARQLARLGVDIIEAGFPASSP  123

Query  448   ADLEAVRLIAEEVGR----GEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
              DL+AVR IA EVG     GE    HVPVICGL+RCN+RDID AWEAV+HA++PRIHTFI
Sbjct  124   DDLDAVRSIAIEVGNPAPAGEDAAVHVPVICGLSRCNRRDIDAAWEAVRHARRPRIHTFI  183

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IHM +KL+ + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY ILGEVI
Sbjct  184   ATSDIHMQHKLRKTPDQVVAIAREMVAYARSLGCTDVEFSPEDAGRSNREFLYHILGEVI  243

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVGY +P EFG+LIADIKANTPGIE  IISTHCQNDLGL+TANTLAGA 
Sbjct  244   KAGATTLNIPDTVGYNLPYEFGKLIADIKANTPGIEKAIISTHCQNDLGLATANTLAGAR  303

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGI+++ I + SKMV+E++
Sbjct  304   AGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLDGLYTGIDSRHITLTSKMVQEHS  362

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSGR
Sbjct  363   GLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGR  422

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGD  1509
             HA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+DL AL+SDE+FQP+V W L D
Sbjct  423   HAVRSKLVELGYEIGDKEFEDFFKRYKEVAEKKKRVTDEDLEALLSDEIFQPKVIWSLAD  482

Query  1510  VQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
             VQ TCG+L LSTATVKLI  DGEE +ACSVGTGPVDAAYKAVD + ++P  L EYSM +V
Sbjct  483   VQATCGTLALSTATVKLIAPDGEEKIACSVGTGPVDAAYKAVDKIIQIPTVLREYSMTSV  542

Query  1690  TEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             TEGIDAIA+TRV++  D +  + H  TG S NRSF+G+GA+MD+V+SSVRAY+ ALNK+ 
Sbjct  543   TEGIDAIATTRVVVTGDVSNNAKHALTGQSFNRSFSGSGASMDIVVSSVRAYLSALNKIC  602

Query  1864  GFQNLV  1881
              F   V
Sbjct  603   SFAGAV  608



>gb|ACN29300.1| unknown [Zea mays]
 gb|AFW55822.1| 2-isopropylmalate synthase B [Zea mays]
Length=626

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/548 (74%), Positives = 471/548 (86%), Gaps = 11/548 (2%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             +Y+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ +KL VARQLARLGVDIIEAGFPASS 
Sbjct  64    DYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAQKLVVARQLARLGVDIIEAGFPASSP  123

Query  448   ADLEAVRLIAEEVGR------GEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHT  603
              DL+AVR IA EVG       GE D  HVPVICGL+RCN++DID AWEAV+HA++PRIHT
Sbjct  124   DDLDAVRSIAIEVGNPAPGPAGEEDAVHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHT  183

Query  604   FIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  783
             FIATS+IHM +KL+ + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY ILGE
Sbjct  184   FIATSDIHMQHKLRKTPDQVVAIAREMVAYARSLGCTDVEFSPEDAGRSNREFLYHILGE  243

Query  784   VIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  963
             VIKAGATTLNIPDTVGY +P EFG+LIADIKANTPGIE  IISTHCQNDLGL+TANTLAG
Sbjct  244   VIKAGATTLNIPDTVGYNLPYEFGKLIADIKANTPGIEKAIISTHCQNDLGLATANTLAG  303

Query  964   ACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEE  1143
             A AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGI+++ I + SKMV+E
Sbjct  304   ARAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLDGLYTGIDSRHITLTSKMVQE  362

Query  1144  YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLS  1323
             ++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLS
Sbjct  363   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLS  422

Query  1324  GRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRL  1503
             GRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+DL AL+SDE+FQP+V W L
Sbjct  423   GRHAVRSKLVELGYEIGDKEFEDFFKRYKEVAEKKKRVTDEDLEALLSDEIFQPKVIWSL  482

Query  1504  GDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMN  1683
              DVQ TCG+L LSTATVKL+  DGEE +ACSVGTGPVDAAYKAVD + ++P  L EYSM 
Sbjct  483   ADVQATCGTLALSTATVKLVAPDGEEKIACSVGTGPVDAAYKAVDKIIQIPTVLREYSMT  542

Query  1684  AVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNK  1857
             +VTEGIDAIA+TRV++  D +  + H  TG S NRSF+G+GA+MD+V+SSVRAY+ ALNK
Sbjct  543   SVTEGIDAIATTRVVVTGDVSNNAKHALTGQSFNRSFSGSGASMDIVVSSVRAYLSALNK  602

Query  1858  LLGFQNLV  1881
             +  F   V
Sbjct  603   ICSFAGAV  610



>ref|XP_002442681.1| hypothetical protein SORBIDRAFT_08g001160 [Sorghum bicolor]
 gb|EES16519.1| hypothetical protein SORBIDRAFT_08g001160 [Sorghum bicolor]
Length=633

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/549 (74%), Positives = 468/549 (85%), Gaps = 12/549 (2%)
 Frame = +1

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ +KL VARQLARLGVDIIEAGFPASS 
Sbjct  70    EYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAQKLVVARQLARLGVDIIEAGFPASSP  129

Query  448   ADLEAVRLIAEEVGR---------GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIH  600
              DL+AVR IA EVG           +  HVPVICGL+RCN++DID AWEAV+HA++PRIH
Sbjct  130   DDLDAVRSIAIEVGNPAPAGDDGGADATHVPVICGLSRCNRKDIDAAWEAVRHARRPRIH  189

Query  601   TFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  780
             TFIATS+IHM +KL+ + EQV   A  MVAYARSLGC+DVEFSPEDAGRS+REFLY ILG
Sbjct  190   TFIATSDIHMQHKLRKTPEQVAAIARDMVAYARSLGCTDVEFSPEDAGRSNREFLYHILG  249

Query  781   EVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  960
             EVIKAGATTLNIPDTVGY +P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLA
Sbjct  250   EVIKAGATTLNIPDTVGYNLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLA  309

Query  961   GACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVE  1140
             GA AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGI+++ I + SKMV+
Sbjct  310   GARAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLNGLYTGIDSRHITLTSKMVQ  368

Query  1141  EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKL
Sbjct  369   EHSGLIVQPHKAIVGANAFAHESGIHQDGMLKNKGTYEIISPDDIGLTRANEFGIVLGKL  428

Query  1321  SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWR  1500
             SGRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+DL AL+SDE+FQP++ W 
Sbjct  429   SGRHAVRSKLVELGYEIGDKEFEDFFKRYKEVAEKKKRVTDEDLEALLSDEIFQPKLIWS  488

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             L DVQ TCG+L LSTATVKLI  DGEE +ACSVGTGPVDAAYKAVD + ++P  L EYSM
Sbjct  489   LADVQATCGTLSLSTATVKLIGPDGEERIACSVGTGPVDAAYKAVDQIIQIPTVLREYSM  548

Query  1681  NAVTEGIDAIASTRVLIREDQA--SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALN  1854
              +VTEGIDAIA+TRV++  D +  + H  TG S NRSF+G+GA+MD+V+SSVRAY+ ALN
Sbjct  549   TSVTEGIDAIATTRVVVTGDVSINAKHALTGRSFNRSFSGSGASMDIVVSSVRAYLSALN  608

Query  1855  KLLGFQNLV  1881
             K+  F   V
Sbjct  609   KICSFAGAV  617



>emb|CBX24424.1| hypothetical_protein [Oryza glaberrima]
Length=622

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/601 (71%), Positives = 486/601 (81%), Gaps = 24/601 (4%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPPARRP  267
             P  TP     T    P    A  FS  L  +   ASRR   ++F A  VR   + P RRP
Sbjct  19    PTSTPRPRAQTLS--PFRAAAPRFSYGLAAANPSASRRCYHRAF-ARPVRASMAQP-RRP  74

Query  268   EYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSE  447
             EY+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFPASS 
Sbjct  75    EYVPNRIDDPNYVRVFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPASSP  134

Query  448   ADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATS  618
              DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA++PRIHTFIATS
Sbjct  135   DDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRIHTFIATS  194

Query  619   EIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR-SDREFLYQILGEVIKA  795
             EIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGR S+REFLY IL EVIKA
Sbjct  195   EIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRRSNREFLYHILEEVIKA  254

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA AG
Sbjct  255   GATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGAHAG  314

Query  976   ARQLEVTINGIGERAGNASLEE-VVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             ARQLEVTINGIGERAGNASLEE VVMA+KCR E +LGGLYTGINTQ I M+SKMV+E++G
Sbjct  315   ARQLEVTINGIGERAGNASLEEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMVQEHSG  373

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             LHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKL    
Sbjct  374   LHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKL----  429

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
                     +GYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+VFW L DV
Sbjct  430   --------IGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFWSLADV  481

Query  1513  -QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAV  1689
              Q TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDAAYKAVD + ++P  L EYSM +V
Sbjct  482   QQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDAAYKAVDDIIQIPTVLREYSMTSV  541

Query  1690  TEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             TEGIDAIA+TRV++  D + S H  TG S +R+F+G+GA++D+V+SSVRAY+ ALNK+  
Sbjct  542   TEGIDAIATTRVVVTGDVSDSKHALTGRSFSRAFSGSGASLDIVVSSVRAYLSALNKMSS  601

Query  1867  F  1869
             F
Sbjct  602   F  602



>gb|ABG21878.1| 2-isopropylmalate synthase B, putative, expressed [Oryza sativa 
Japonica Group]
Length=589

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/575 (73%), Positives = 475/575 (83%), Gaps = 13/575 (2%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLRFSIS----GASRRPSFQSFSAAAVRCESSPP  255
             P  TP     T    P    A  FS  L  + +     ASRR   ++F A  VR   + P
Sbjct  19    PTSTPRPRAQTLS--PFRAAAPRFSHGLATAAAAANPSASRRCYHRAF-ARPVRASMAQP  75

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
              RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ EKL VARQLARLGVDIIEAGFP
Sbjct  76    -RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFP  134

Query  436   ASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             ASS  DL+AVR IA EVG    GE  HVPVICGL+RCNKRDID AWEAV+HA++PRIHTF
Sbjct  135   ASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRIHTF  194

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATSEIHM +KL+ + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EV
Sbjct  195   IATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEV  254

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA
Sbjct  255   IKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGA  314

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQ I M+SKMV+E+
Sbjct  315   HAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMVQEH  373

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             +GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISP+DIGL RANE GIVLGKLSG
Sbjct  374   SGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSG  433

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHA+++K++ELGYEI  KE ED F R+K VAE+KK+VTD+D+ AL+SDE+FQP+VFW L 
Sbjct  434   RHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFWSLA  493

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             DVQ TCG+LGLSTATVKLI  DG+E +AC+VGTGPVDAAYKAVD + ++P  L EYSM +
Sbjct  494   DVQATCGTLGLSTATVKLIGPDGDEKIACAVGTGPVDAAYKAVDDIIQIPTVLREYSMTS  553

Query  1687  VTEGIDAIASTRVLIREDQA-SIHGSTGGSANRSF  1788
             VTEGIDAIA+TRV++  D + S H  TG S NR+F
Sbjct  554   VTEGIDAIATTRVVVTGDVSDSKHALTGHSFNRAF  588



>ref|XP_001775199.1| predicted protein [Physcomitrella patens]
 gb|EDQ59935.1| predicted protein [Physcomitrella patens]
Length=583

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/553 (73%), Positives = 473/553 (86%), Gaps = 4/553 (1%)
 Frame = +1

Query  226   AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARL  405
             A ++C  S   +RP+Y+PNRI DP YVRIFDTTLRDGEQSPGATMT+KEKL +ARQLARL
Sbjct  10    ALIQCNGSALRKRPQYVPNRIDDPAYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLARL  69

Query  406   GVDIIEAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKH  579
             GVDIIEAGFP +S  DLEAVRLIA+EVG    E  +VPVICGL+RCNK+DID AWEAVK+
Sbjct  70    GVDIIEAGFPIASPDDLEAVRLIAKEVGNQVDEDGYVPVICGLSRCNKKDIDAAWEAVKY  129

Query  580   AKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  759
             A +PRIHTFIATSEIHM +KLK + +QVV+ A  MVAYARSLGC D+EFSPEDAGRSD E
Sbjct  130   AVRPRIHTFIATSEIHMVHKLKKTPDQVVQIARDMVAYARSLGCEDIEFSPEDAGRSDPE  189

Query  760   FLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGL  939
             FLY+IL EVIKAGATTLNIPDTVGYT+P+EFG LI  +KANTPG E VI STHCQNDLGL
Sbjct  190   FLYRILAEVIKAGATTLNIPDTVGYTLPSEFGSLIGKLKANTPGAEKVIFSTHCQNDLGL  249

Query  940   STANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQII  1119
             +TANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMAL+CRG++ LGGL+TG+NT+ I 
Sbjct  250   ATANTLAGAHAGARQVEVTINGIGERAGNASLEEVVMALRCRGQEQLGGLFTGLNTKHIA  309

Query  1120  MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANES  1299
             +AS+MV +YTG+ VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI++PEDIGL RA+ S
Sbjct  310   VASRMVADYTGMVVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEILAPEDIGLVRADAS  369

Query  1300  GIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVF  1479
             GIVLGKLSGRHAL+ ++ +LGYEI+G++L+D+F RFK+VAE+KK V+DDDL  L+SDEVF
Sbjct  370   GIVLGKLSGRHALKQRLNQLGYEIDGQDLDDVFKRFKAVAEKKKNVSDDDLEILLSDEVF  429

Query  1480  QPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPV  1659
             QP+  W +G +QV CG+ GLSTATVKL+  DG EH+  SVGTGPVDAAYKAVD + K PV
Sbjct  430   QPETLWSVGLIQVVCGTSGLSTATVKLVGPDGVEHIGMSVGTGPVDAAYKAVDTIVKAPV  489

Query  1660  TLLEYSMNAVTEGIDAIASTRVLIRE-DQASI-HGSTGGSANRSFNGTGAAMDVVISSVR  1833
             TLLEYSM+AVTEGIDAIA TRV IR  D  ++ +  TG    RS++GTGAA DVV+SSVR
Sbjct  490   TLLEYSMHAVTEGIDAIAHTRVQIRALDPLTVTNPQTGSQVPRSYSGTGAAEDVVVSSVR  549

Query  1834  AYVGALNKLLGFQ  1872
             AY+ ALNK+L F+
Sbjct  550   AYISALNKMLTFR  562



>ref|XP_002887519.1| hypothetical protein ARALYDRAFT_476544 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63778.1| hypothetical protein ARALYDRAFT_476544 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/565 (72%), Positives = 476/565 (84%), Gaps = 30/565 (5%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P RRP+YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGF
Sbjct  66    PRRRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGF  125

Query  433   PASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             PA+S+ D EAV+ IAE VG    E  +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTF
Sbjct  126   PAASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTF  185

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS+IH+ YKLK S+E+V+E A +MV +ARSL C DVEFSPEDAGRS+RE+LY+ILGEV
Sbjct  186   IATSDIHLKYKLKKSKEEVIEIARNMVRFARSLRCEDVEFSPEDAGRSEREYLYEILGEV  245

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTLNIPDTVG T+P+EFGQLIADIK NT GI+NVI STHCQNDLGLSTANTL+GA
Sbjct  246   IKAGATTLNIPDTVGITLPSEFGQLIADIKTNTRGIQNVISSTHCQNDLGLSTANTLSGA  305

Query  967   CAGARQLEVTINGIGERAGNASLEEV------------VMALKCRGEQVLGGLYTGINTQ  1110
              +GARQ+EVTINGIGERAGNASLEEV            VMA+KCRG+ VLGGL+TGI+T+
Sbjct  306   HSGARQVEVTINGIGERAGNASLEEVRSENLLKCYEFFVMAIKCRGDHVLGGLFTGIDTR  365

Query  1111  QIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRA  1290
              I+M SKMVEEYTG+  QPHKAI              DGMLKHK TYEI+SPE+IGL R+
Sbjct  366   HIVMTSKMVEEYTGMQTQPHKAI--------------DGMLKHKGTYEIMSPEEIGLQRS  411

Query  1291  NESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSD  1470
             NE+GIVLGKLSGRHAL+ ++ ELGY ++  +L +LFWRFK+VAE+KK+VTD DLIALVSD
Sbjct  412   NEAGIVLGKLSGRHALRDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSD  471

Query  1471  EVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTK  1650
             EVFQP+  W+L D+Q+TCG+LGLST+TVKL D+DG+EHVACSVGTGPVDAAYKAVDL+ K
Sbjct  472   EVFQPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVK  531

Query  1651  VPVTLLEYSMNAVTEGIDAIASTRVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVIS  1824
              P TLLEYSMNAVTEGIDAIA+TRVLIR D   +S +  TG S  R+F+GTGA MD+V+S
Sbjct  532   EPATLLEYSMNAVTEGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVS  591

Query  1825  SVRAYVGALNKLLGFQNLVSRYNKT  1899
             SV+AYVGALNK+LGF+   S  +KT
Sbjct  592   SVKAYVGALNKMLGFKEHSSTLSKT  616



>ref|XP_009368425.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase 2, 
chloroplastic-like [Pyrus x bretschneideri]
Length=632

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/636 (65%), Positives = 488/636 (77%), Gaps = 56/636 (9%)
 Frame = +1

Query  76    SPNPPVITPPESKYTCKYLPIHTIATSFSKQL-----------RFSISGASRRPSFQSFS  222
             S NP ++  P +  +   +P     TS S+ L           +F +S    RP+  +  
Sbjct  5     STNPKILPSPAATMSSVNIP----NTSQSQLLFRSHLHKPNMPKFLVS----RPNLHNTC  56

Query  223   AAAVRC---ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQ  393
                + C   ++S P  RP+YIPNRI DPNYVRIFDTTLRDGEQSPGA++T+KEKL +AR+
Sbjct  57    NPHILCSQTDNSMPTPRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARK  116

Query  394   LARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWE  567
             LA+LGVDIIEAGFPASS+ D EAV++IA+EVG    +  +VPVICGL+RCN+ DI  AW+
Sbjct  117   LAKLGVDIIEAGFPASSKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNRNDIQTAWD  176

Query  568   AVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  747
             AVK+AK+PRIHTFIATS IH+ YKL+ S+EQV+E A +MV +AR LGC DVEFSPEDAGR
Sbjct  177   AVKYAKRPRIHTFIATSPIHLEYKLRKSKEQVIEIARNMVKFARELGCDDVEFSPEDAGR  236

Query  748   SDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQN  927
             S+REFLYQILGEVIK GATTLNIPDTVGY +P+E+ QLIADIK+NTPGI+NVIISTHCQN
Sbjct  237   SEREFLYQILGEVIKVGATTLNIPDTVGYNVPDEYSQLIADIKSNTPGIDNVIISTHCQN  296

Query  928   DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1107
             DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVM L CRGE VLGGLYTGINT
Sbjct  297   DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMTLNCRGEHVLGGLYTGINT  356

Query  1108  QQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFR  1287
             + I + SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIG  R
Sbjct  357   KHIYVTSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYER  416

Query  1288  ANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
             +NE+GIVLGKLSGRHAL+ ++ ELGYE+E  +L  +F  FK+VAE+KK +TD DL ALV 
Sbjct  417   SNEAGIVLGKLSGRHALRNRLAELGYELEDDQLATVFEHFKAVAEQKKIITDADLGALVR  476

Query  1468  DEVFQPQVFWRLGDV------------------------------QVTCGSLGLSTATVK  1557
             DEVFQP+V W+L D+                              QVTCG+LGLSTATVK
Sbjct  477   DEVFQPEVVWKLHDLQVFRDSVLPCSLSARXVLRVDHLXFIGLDAQVTCGTLGLSTATVK  536

Query  1558  LIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRE  1737
             LIDADG EHVACSVGTGPVD+AYKAVDL+ K PVTL+EYSMNAVTEG D+IA+TRV+IR 
Sbjct  537   LIDADGREHVACSVGTGPVDSAYKAVDLIVKEPVTLVEYSMNAVTEGNDSIATTRVVIRP  596

Query  1738  DQASI--HGSTGGSANRSFNGTGAAMDVVISSVRAY  1839
             +   +  H  TG S  R+F+G  A M +V     A+
Sbjct  597   ENKRMITHAHTGESVQRTFSGVAAGMSLVSRHTSAH  632



>ref|XP_001761198.1| predicted protein [Physcomitrella patens]
 gb|EDQ73920.1| predicted protein [Physcomitrella patens]
Length=616

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/553 (72%), Positives = 472/553 (85%), Gaps = 4/553 (1%)
 Frame = +1

Query  226   AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARL  405
             A ++C+ +   +RP+YIPNRI DP+YVRIFDTTLRDGEQSPGATMT+KEKL +ARQLARL
Sbjct  43    AFIQCQGAQHKKRPQYIPNRIDDPSYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLARL  102

Query  406   GVDIIEAGFPASSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKH  579
             GVDIIEAGFP +S  DLEAVRLIA+EVG    D  +VPVICGL+RCNK+DID AWEAVK+
Sbjct  103   GVDIIEAGFPIASPDDLEAVRLIAKEVGNNVDDDGYVPVICGLSRCNKKDIDAAWEAVKY  162

Query  580   AKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  759
             A +PRIHTFIATSEIHM +KLK S E+VV+ A  MVAYARSLGC D+EFSPEDAGRSD E
Sbjct  163   AVRPRIHTFIATSEIHMVHKLKKSPEEVVQIARDMVAYARSLGCEDIEFSPEDAGRSDPE  222

Query  760   FLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGL  939
             FLY+IL EVIKAGATTLNIPDTVGYT+P+EFG LIA +KANTPG + VI STHCQNDLGL
Sbjct  223   FLYRILEEVIKAGATTLNIPDTVGYTLPSEFGGLIAKLKANTPGADKVIFSTHCQNDLGL  282

Query  940   STANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQII  1119
             +TANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMAL+CRG++ LGGLYTG+NT+ I 
Sbjct  283   ATANTLAGAHAGARQVEVTINGIGERAGNASLEEVVMALRCRGQERLGGLYTGLNTKHIA  342

Query  1120  MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANES  1299
             +AS+MV +YTG+ VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SP+DIGL RA+ S
Sbjct  343   VASRMVADYTGMVVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEILSPDDIGLVRADAS  402

Query  1300  GIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVF  1479
             GIVLGKLSGRHAL+ ++ +LGYE++G+EL+D+F RFK+VAE+KK V+++DL  L+ DEVF
Sbjct  403   GIVLGKLSGRHALKQRLNQLGYEVDGQELDDVFKRFKAVAEKKKNVSNEDLETLLFDEVF  462

Query  1480  QPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPV  1659
             QP+  W LG +QV CG+ G+STATVKL   DG +H+  SVGTGPVDAAYKAVD + K PV
Sbjct  463   QPETLWSLGLIQVVCGNAGISTATVKLEGPDGAQHIGMSVGTGPVDAAYKAVDTIVKAPV  522

Query  1660  TLLEYSMNAVTEGIDAIASTRVLIRE-DQASI-HGSTGGSANRSFNGTGAAMDVVISSVR  1833
             TLLEYS+N+VTEGIDA+A TRV IR  D  ++ H  T     R+++GTGA+ DVV+SS R
Sbjct  523   TLLEYSLNSVTEGIDALAHTRVQIRALDSLTVTHAQTDSQVPRTYSGTGASEDVVVSSCR  582

Query  1834  AYVGALNKLLGFQ  1872
             AY+ ALNK+L F+
Sbjct  583   AYISALNKMLTFR  595



>gb|EEC67654.1| hypothetical protein OsI_35067 [Oryza sativa Indica Group]
Length=609

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/564 (73%), Positives = 468/564 (83%), Gaps = 28/564 (5%)
 Frame = +1

Query  190   ASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTK  369
             ASRR   ++F A  VR   + P RRPEY+PNRI DPNYVRIFDTTLRDGEQSPGATMT+ 
Sbjct  50    ASRRCYHRAF-ARPVRASMAQP-RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSA  107

Query  370   EKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCN  540
             EKL VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG    GE  HVPVICGL+RCN
Sbjct  108   EKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCN  167

Query  541   KRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDV  720
             KRDID AWEA                     +KL+ + EQVV  A  MVAYARSLGC DV
Sbjct  168   KRDIDAAWEA---------------------HKLRKTPEQVVAIAKEMVAYARSLGCPDV  206

Query  721   EFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIEN  900
             EFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P EFG+LIADIKANTPGIEN
Sbjct  207   EFSPEDAGRSNREFLYHILKEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIEN  266

Query  901   VIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVL  1080
              IISTHCQNDLGL+TANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCR E +L
Sbjct  267   AIISTHCQNDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LL  325

Query  1081  GGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEII  1260
             GGLYTGINTQ I M+SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K TYEII
Sbjct  326   GGLYTGINTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEII  385

Query  1261  SPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVT  1440
             SP+DIGL RANE GIVLGKLSGRHA+++K++ELGYEI  KE ED F R+K VAE+KK+VT
Sbjct  386   SPDDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVT  445

Query  1441  DDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDA  1620
             D+D+ AL+SDE+FQP+VFW L DVQ TCG+LGLSTATVKLI  DGEE +AC+VGTGPVDA
Sbjct  446   DEDIEALLSDEIFQPKVFWSLADVQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDA  505

Query  1621  AYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA-SIHGSTGGSANRSFNGT  1797
             AYKAVD + ++P  L EYSM +VTEGIDAIA+TRV++  D + S H  TG S +R+F+G+
Sbjct  506   AYKAVDDIIQIPTVLREYSMTSVTEGIDAIATTRVVVTGDVSDSKHALTGHSFSRAFSGS  565

Query  1798  GAAMDVVISSVRAYVGALNKLLGF  1869
             GAA+D+V+SSVRAY+ ALNK+  F
Sbjct  566   GAALDIVVSSVRAYLSALNKMSSF  589



>ref|XP_010035134.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase 2, 
chloroplastic-like [Eucalyptus grandis]
Length=515

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/511 (76%), Positives = 453/511 (89%), Gaps = 4/511 (1%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--VPVICGLA  531
             MT+KEKL +ARQLA+LGVDIIEAGFPA+S  D  AV+ IA EVG     H  VPVICGL+
Sbjct  1     MTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVICGLS  60

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN++DI  AW+AV+ A++PRIHTFIATS IHM YKLK S+++V++ A  MVA+ARSLGC
Sbjct  61    RCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARSLGC  120

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
             +DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKANTPG
Sbjct  121   NDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKANTPG  180

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
             IENVIISTHCQNDLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVVMALKC+G 
Sbjct  181   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGG  240

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
              +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  241   SILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  300

Query  1252  EIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             EIISP+DIGL R NE+GIVLGKLSGRHAL+ K++ELGY+I+G++L+++FWRFK+VAE+KK
Sbjct  301   EIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAEQKK  360

Query  1432  KVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGP  1611
             +VTD D+ ALVSDEVFQP V W+L D+QVTCG+LGLST TVKLI ADG+EH+AC+VGTGP
Sbjct  361   RVTDADIRALVSDEVFQPTVVWKLHDLQVTCGTLGLSTXTVKLISADGKEHIACAVGTGP  420

Query  1612  VDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRS  1785
             VD+AYKAVDL+ KVP TLLEYSM AVTEGIDAIA+TRVLIR   +  S    TG + +R+
Sbjct  421   VDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHISTLALTGETIHRT  480

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
             F+G G++MD+ +SSVRAY+GALNK+LGF  L
Sbjct  481   FSGIGSSMDITVSSVRAYIGALNKMLGFMEL  511



>gb|KCW87848.1| hypothetical protein EUGRSUZ_A00249 [Eucalyptus grandis]
Length=524

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/511 (76%), Positives = 453/511 (89%), Gaps = 4/511 (1%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--VPVICGLA  531
             MT+KEKL +ARQLA+LGVDIIEAGFPA+S  D  AV+ IA EVG     H  VPVICGL+
Sbjct  1     MTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVICGLS  60

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN++DI  AW+AV+ A++PRIHTFIATS IHM YKLK S+++V++ A  MVA+AR LGC
Sbjct  61    RCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARRLGC  120

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
             +DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKANTPG
Sbjct  121   NDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKANTPG  180

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
             IENVIISTHCQNDLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVVMALKC+G 
Sbjct  181   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGG  240

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
              +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  241   SILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  300

Query  1252  EIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             EIISP+DIGL R NE+GIVLGKLSGRHAL+ K++ELGY+I+G++L+++FWRFK+VAE+KK
Sbjct  301   EIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAEQKK  360

Query  1432  KVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGP  1611
             +VTD D+ ALVSDEVFQP V W+L D+QVTCG+LGLSTATVKLI A+G+EH+AC+VGTGP
Sbjct  361   RVTDADIRALVSDEVFQPTVVWKLHDLQVTCGTLGLSTATVKLISAEGKEHIACAVGTGP  420

Query  1612  VDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRS  1785
             VD+AYKAVDL+ KVP TLLEYSM AVTEGIDAIA+TRVLIR   +  S    TG + +R+
Sbjct  421   VDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHTSTLALTGETIHRT  480

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
             F+G G++MD+ +SSVRAY+GALNK+LGF  L
Sbjct  481   FSGIGSSMDITVSSVRAYIGALNKMLGFMEL  511



>emb|CBX25469.1| hypothetical_protein [Oryza glaberrima]
Length=527

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/508 (77%), Positives = 443/508 (87%), Gaps = 5/508 (1%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGL  528
             MT+ EKL VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG    GE  HVPVICGL
Sbjct  1     MTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGL  60

Query  529   ARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLG  708
             +RCNKRDID AWEAV+HA++PRIHTFIATSEIHM +KL+ + EQVV  A  MVAYARSLG
Sbjct  61    SRCNKRDIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLG  120

Query  709   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTP  888
             C DVEFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P EFG+LIADIKANTP
Sbjct  121   CPDVEFSPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTP  180

Query  889   GIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRG  1068
             GIEN IISTHCQNDLGL+TANTLAG  AGARQLEVTINGIGERAGNASLEEVVMA+KCR 
Sbjct  181   GIENAIISTHCQNDLGLATANTLAGTHAGARQLEVTINGIGERAGNASLEEVVMAIKCRR  240

Query  1069  EQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1248
             E +LGGLYTGINTQ I M+SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK+K T
Sbjct  241   E-LLGGLYTGINTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGT  299

Query  1249  YEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERK  1428
             YEIISP+DIGL RANE GIVLGKLSGRHA+++K++ELGYEI  KE ED F R+K VAE+K
Sbjct  300   YEIISPDDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKK  359

Query  1429  KKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTG  1608
             K+VTD+D+ AL+SDE+FQP+VFW L DVQ TCG+LGLSTATVKLI  DGEE +AC+VGTG
Sbjct  360   KRVTDEDIEALLSDEIFQPKVFWSLADVQATCGTLGLSTATVKLIGPDGEEKIACAVGTG  419

Query  1609  PVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQA-SIHGSTGGSANRS  1785
             PVDAAYKAVD + ++P  L EYSM +VTEGIDAIA+TRV++  D + S H  TG S +R+
Sbjct  420   PVDAAYKAVDDIIQIPTVLREYSMTSVTEGIDAIATTRVVVTGDVSDSKHALTGHSFSRA  479

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             F+G+GAA+D+V+SSVRAY+ ALNK+  F
Sbjct  480   FSGSGAALDIVVSSVRAYLSALNKMSSF  507



>gb|EMS63121.1| 2-isopropylmalate synthase A [Triticum urartu]
Length=526

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/523 (74%), Positives = 445/523 (85%), Gaps = 4/523 (1%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGL  528
             MT+ EKL VARQLARLGVDIIEAGFPASS  DL+AVR IA EVG    GE  HVPVICGL
Sbjct  1     MTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGL  60

Query  529   ARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLG  708
             +RCNKRDID AWEAV+HA+KPRIHTFIATSEIHM +KL+ + +QVV  A  MVAYAR LG
Sbjct  61    SRCNKRDIDAAWEAVRHARKPRIHTFIATSEIHMQHKLRKTPDQVVAIAREMVAYARGLG  120

Query  709   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTP  888
             C DVEFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYT+P+EFG+LIADIKANTP
Sbjct  121   CPDVEFSPEDAGRSNREFLYHILDEVIKAGATTLNIPDTVGYTLPHEFGKLIADIKANTP  180

Query  889   GIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRG  1068
             GIEN IISTHCQNDLGL++ANTLAGA AGARQLEVTINGIGERAGNASLEEVVMA+KCR 
Sbjct  181   GIENAIISTHCQNDLGLASANTLAGAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRR  240

Query  1069  EQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1248
             E +LGGLYTGIN+Q I M SKMV+E++GLHVQPHKAIVGANAFAHESGIHQDGMLK K T
Sbjct  241   E-LLGGLYTGINSQHITMTSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKFKGT  299

Query  1249  YEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERK  1428
             YEIISP+DIGL RANE GIVLGKLSGRHA++ K++ELGYEI  KE ED F R+K VAE+K
Sbjct  300   YEIISPDDIGLTRANEFGIVLGKLSGRHAVRTKLVELGYEINDKEFEDFFKRYKEVAEKK  359

Query  1429  KKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTG  1608
             K+VTD+D+ AL+SDE+FQP+V W LGDVQ TCG+LGLSTATVKLI  DGEE + CSVGTG
Sbjct  360   KRVTDEDIEALLSDEIFQPKVIWSLGDVQATCGTLGLSTATVKLITIDGEEKIGCSVGTG  419

Query  1609  PVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSF  1788
             PVDAAYKAVD + ++P  L EYSM +VTEGIDAIA+TRV+I  D ++   +   ++NRSF
Sbjct  420   PVDAAYKAVDQIIQIPTVLREYSMTSVTEGIDAIATTRVVIAGDVSADKPALTSNSNRSF  479

Query  1789  NGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQGTVVI  1917
             +G+GAAMDVV+SSVRAY+ ALNK+  +   V   ++   T+ +
Sbjct  480   SGSGAAMDVVVSSVRAYLSALNKMSSYVGAVKASSEAPETISV  522



>ref|XP_002980035.1| hypothetical protein SELMODRAFT_111991 [Selaginella moellendorffii]
 gb|EFJ18905.1| hypothetical protein SELMODRAFT_111991 [Selaginella moellendorffii]
Length=610

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/560 (69%), Positives = 465/560 (83%), Gaps = 8/560 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             +RP Y+P+RI DP+YVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFP 
Sbjct  48    KRPIYVPSRIDDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPI  107

Query  439   SSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             +S  DL AV+ IA +VG    D  +VPVICGL+RCNK DI  AWEAV HA +PRIHTFIA
Sbjct  108   ASPDDLLAVKGIALDVGNRVDDDGYVPVICGLSRCNKADIAAAWEAVSHALRPRIHTFIA  167

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIHM +KL+ S ++VV+ AT MV YA+SLGC D+EFSPEDAGRSD EFLY+IL EVIK
Sbjct  168   TSEIHMKHKLRKSPDEVVQIATDMVGYAKSLGCQDIEFSPEDAGRSDPEFLYRILAEVIK  227

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVGYT+P+EFG+LIA IK NTPG +NV+ISTHCQNDLGL+TANTLAGA A
Sbjct  228   AGATTLNIPDTVGYTLPSEFGRLIAMIKENTPGSQNVVISTHCQNDLGLATANTLAGAYA  287

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQLEVTINGIGERAGNASLEEVVMA++CRG++ L GL+TGI  + I + S+MV +YTG
Sbjct  288   GARQLEVTINGIGERAGNASLEEVVMAIRCRGDEQLNGLHTGIKPKHIAVTSRMVSDYTG  347

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             + VQPHKAIVGANAFAHESGIHQDGMLK K TYEI+ PEDIGL RA+E+GIVLGK SGRH
Sbjct  348   MTVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIMCPEDIGLVRADEAGIVLGKHSGRH  407

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL+ ++ +LGYE+E K+L+D+F RFK+VA++KK ++D DL AL+SDEVFQP+V W L D+
Sbjct  408   ALKTRLSQLGYELESKKLDDVFKRFKAVADKKKSLSDVDLEALLSDEVFQPEVVWALLDL  467

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QV CG+LGLSTATVKL   D  + V  S+GTGPVDAAYKAVD + ++PVTLLEYSMNAVT
Sbjct  468   QVVCGTLGLSTATVKLSGPDNIQRVGTSIGTGPVDAAYKAVDSIVQIPVTLLEYSMNAVT  527

Query  1693  EGIDAIASTRVLIREDQAS--IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             EGIDAIA+TRV+IR + ++   H  +     RSF+G+GA+ DV +SSVRAYV ALNK++G
Sbjct  528   EGIDAIANTRVVIRAENSTPVTHAQSTEPVQRSFSGSGASEDVTVSSVRAYVSALNKVIG  587

Query  1867  FQNLV----SRYNKTQGTVV  1914
             F   V    S  + TQ T V
Sbjct  588   FSKAVPSSESSVSATQATTV  607



>ref|XP_002992921.1| hypothetical protein SELMODRAFT_187069 [Selaginella moellendorffii]
 gb|EFJ06010.1| hypothetical protein SELMODRAFT_187069 [Selaginella moellendorffii]
Length=610

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/560 (69%), Positives = 465/560 (83%), Gaps = 8/560 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             +RP Y+P+RI DP+YVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAGFP 
Sbjct  48    KRPIYVPSRIDDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPI  107

Query  439   SSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             +S  DL AV+ IA +VG    D  +VPVICGL+RCNK DI  AWEAV HA +PRIHTFIA
Sbjct  108   ASPDDLLAVKGIALDVGNRVDDDGYVPVICGLSRCNKADIAAAWEAVSHALRPRIHTFIA  167

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TSEIHM +KL+ S ++VV+ AT MV YA+SLGC D+EFSPEDAGRSD EFLY+IL EVIK
Sbjct  168   TSEIHMKHKLRKSPDEVVQIATDMVGYAKSLGCQDIEFSPEDAGRSDPEFLYRILAEVIK  227

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTLNIPDTVGYT+P+EFG+LIA IK NTPG ++V+ISTHCQNDLGL+TANTLAGA A
Sbjct  228   AGATTLNIPDTVGYTLPSEFGRLIAMIKENTPGSQSVVISTHCQNDLGLATANTLAGAYA  287

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQLEVTINGIGERAGNASLEEVVMA++CRG++ L GL+TGI  + I + S+MV +YTG
Sbjct  288   GARQLEVTINGIGERAGNASLEEVVMAIRCRGDEQLNGLHTGIKPKHIAVTSRMVSDYTG  347

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             + VQPHKAIVGANAFAHESGIHQDGMLK K TYEI+ PEDIGL RA+E+GIVLGK SGRH
Sbjct  348   MTVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIMCPEDIGLVRADEAGIVLGKHSGRH  407

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL+ ++ +LGYE+E K+L+D+F RFK+VA++KK ++D DL AL+SDEVFQP+V W L D+
Sbjct  408   ALKTRLSQLGYELESKQLDDVFKRFKAVADKKKSLSDVDLEALLSDEVFQPEVVWALLDL  467

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QV CG+LGLSTATVKL   D  + V  S+GTGPVDAAYKAVD + ++PVTLLEYSMNAVT
Sbjct  468   QVVCGTLGLSTATVKLSGPDNIQRVGTSIGTGPVDAAYKAVDSIVQIPVTLLEYSMNAVT  527

Query  1693  EGIDAIASTRVLIREDQAS--IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             EGIDAIA+TRV+IR + ++   H  +     RSF+G+GA+ DV +SSVRAYV ALNK++G
Sbjct  528   EGIDAIANTRVVIRAENSTPVTHAQSTEPVQRSFSGSGASEDVTVSSVRAYVSALNKVIG  587

Query  1867  FQNLV----SRYNKTQGTVV  1914
             F   V    S  + TQ T V
Sbjct  588   FSKAVPSSESSVSATQATTV  607



>gb|KCW87662.1| hypothetical protein EUGRSUZ_A00052 [Eucalyptus grandis]
Length=519

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/515 (74%), Positives = 447/515 (87%), Gaps = 8/515 (2%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--VPVICGLA  531
             MT+KEKL +ARQLA+LGVDIIEAGFPA+S  D  AV+ IA EVG     H  VPVICGL+
Sbjct  1     MTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVICGLS  60

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN++DI  AW+AV+ A++PRIHTFIATS IHM YKLK S+++V++ A  MVA+ARSLGC
Sbjct  61    RCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARSLGC  120

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
             +DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKANTPG
Sbjct  121   NDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKANTPG  180

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
             IENVIISTHCQNDLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVVMALKC+G 
Sbjct  181   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGG  240

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
              +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  241   SILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  300

Query  1252  EIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             EIISP+DIGL R NE+GIVLGKLSGRHAL+ K++ELGY+I+G++L+++FWRFK+VAE+KK
Sbjct  301   EIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAEQKK  360

Query  1432  KVTDDDLIALVSDEVFQPQVFWRLGDV-QVTCG---SLGLSTATVKLIDADGEEHVACSV  1599
             +VTD D+ ALVSDEVFQP V W+L D+ Q+ C     L +   TVKLI ADG+EH+AC+V
Sbjct  361   RVTDADIRALVSDEVFQPTVVWKLHDLQQMPCMLHVELLVCRRTVKLISADGKEHIACAV  420

Query  1600  GTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGS  1773
             GTGPVD+AYKAVDL+ KVP TLLEYSM AVTEGIDAIA+TRVLIR   +  S    TG +
Sbjct  421   GTGPVDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHISTLALTGET  480

Query  1774  ANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
              +R+F+G G++MD+ +SSVRAY+GALNK+LGF  L
Sbjct  481   IHRTFSGIGSSMDITVSSVRAYIGALNKMLGFMEL  515



>gb|KHN27115.1| 2-isopropylmalate synthase 2, chloroplastic [Glycine soja]
Length=594

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/540 (71%), Positives = 448/540 (83%), Gaps = 37/540 (7%)
 Frame = +1

Query  271   YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEA  450
             YIPNRI DP+Y                              LA+LGVDIIEAGFPA+S+ 
Sbjct  70    YIPNRIPDPSY------------------------------LAKLGVDIIEAGFPAASKD  99

Query  451   DLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEI  624
             D EAV++IA+EVG    D  +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIATS I
Sbjct  100   DFEAVKMIAQEVGNAVDDDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSAI  159

Query  625   HMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  804
             HM YKL+MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  160   HMEYKLRMSKDKVVDIARNMVKFARSLGCEDVEFSPEDAGRSDREFLYEILGEVIKAGAT  219

Query  805   TLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  984
             TLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQ
Sbjct  220   TLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIEGARAGARQ  279

Query  985   LEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             LEVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+ I + S+MVEEYTGL +Q
Sbjct  280   LEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGINTKHIFLTSRMVEEYTGLQLQ  338

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             PHKA+VGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R NE+GIVLGKLSGRHAL+ 
Sbjct  339   PHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKLSGRHALRK  398

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELGYE+   +++ LFWRFK+VAE+KK+VTD DL ALVSDEVFQ +  W+LGD+QVTC
Sbjct  399   RLEELGYELSDDQVQTLFWRFKAVAEQKKRVTDADLRALVSDEVFQAEPVWKLGDLQVTC  458

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+LGLSTATVKL+ +DG  HVACSVGTGPVD+AYKAVDL+ K PVTLLEYSMNAVTEGID
Sbjct  459   GTLGLSTATVKLLSSDGSTHVACSVGTGPVDSAYKAVDLIVKEPVTLLEYSMNAVTEGID  518

Query  1705  AIASTRVLIREDQ----ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             AIA+TRV+IR +     ++ H  TG +  R+F+GTGA MDVV+SSV+AY+ ALNK+LGF+
Sbjct  519   AIATTRVVIRGESETSTSTTHALTGEAVLRTFSGTGAGMDVVVSSVKAYIAALNKMLGFK  578



>gb|KHN37280.1| 2-isopropylmalate synthase 2, chloroplastic [Glycine soja]
Length=586

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/608 (66%), Positives = 466/608 (77%), Gaps = 58/608 (10%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPPARRP  267
             P++ P  S +  +    HT  T     LRFS    + R S +S S  AV C  S P    
Sbjct  8     PILFPSTSHHPNQN---HTFLT-----LRFS---QTLRSSLRSKSRFAVSCSQSEPPPPH  56

Query  268   E--------YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
                      YIPN I DP+YVRIFDTTLRDGEQSPGA+MT+KEKL               
Sbjct  57    PSSSRRRPPYIPNLIPDPSYVRIFDTTLRDGEQSPGASMTSKEKL---------------  101

Query  424   AGFPASSEADLEAVRLIAEEVGRGEGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIH  600
                               + VG    D +VP ICGL+RCN++DI  AWEAVK+AK+PRIH
Sbjct  102   ------------------DRVGNAVDDGYVPAICGLSRCNEKDIRTAWEAVKYAKRPRIH  143

Query  601   TFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  780
             TFIATS IHM YKL+MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILG
Sbjct  144   TFIATSPIHMEYKLRMSKDKVVDIARNMVKFARSLGCDDVEFSPEDAGRSDREFLYEILG  203

Query  781   EVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  960
             EVIKAGATTLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ 
Sbjct  204   EVIKAGATTLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIE  263

Query  961   GACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVE  1140
             GA AGARQLEVTINGIGERAGNASLEEVVMAL+C G  V G LYTGI+T+ I + SKMVE
Sbjct  264   GARAGARQLEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGIDTKHIFLTSKMVE  322

Query  1141  EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             EYTGL VQPHKA+VGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R NE+GIVLGKL
Sbjct  323   EYTGLQVQPHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKL  382

Query  1321  SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWR  1500
             SGRHAL+ ++ ELGYE+   +++ LFW FK+VAE+KK+VTD DL ALVSDEVFQ +  W+
Sbjct  383   SGRHALRKRLEELGYELNDDQVQTLFWCFKAVAEQKKRVTDADLRALVSDEVFQAEPVWK  442

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             LGD+QVTCG+LGLSTATVKL+ +DG  HVACS+GTGPVD+AYKAVDL+ K  VTLLEYSM
Sbjct  443   LGDLQVTCGTLGLSTATVKLLSSDGSTHVACSIGTGPVDSAYKAVDLIVKEQVTLLEYSM  502

Query  1681  NAVTEGIDAIASTRVLIR-EDQAS---IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGA  1848
             NAVTEGIDAIA+TRV+IR E + S    H  TG +  R+F+GTGA MDVV+SSV+AY+ A
Sbjct  503   NAVTEGIDAIATTRVVIRGESETSTITTHALTGETVIRTFSGTGAGMDVVVSSVKAYIAA  562

Query  1849  LNKLLGFQ  1872
             LNK+ GF+
Sbjct  563   LNKMSGFK  570



>ref|XP_010064495.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Eucalyptus 
grandis]
Length=550

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/502 (73%), Positives = 431/502 (86%), Gaps = 19/502 (4%)
 Frame = +1

Query  199   RPSFQSFSAAAVRCESS---------------PPARRPEYIPNRILDPNYVRIFDTTLRD  333
             RP  Q  S++ +RC ++               PP   P+YIPNRI DPNY+RIFDTTLRD
Sbjct  51    RPPPQRASSSVIRCSTTPPPPPPPQSEGPTTAPPC--PKYIPNRIPDPNYIRIFDTTLRD  108

Query  334   GEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--  507
             GEQSPGATMT++EKL +ARQLA+LGVDIIEAGFPA+S  D  AV+ IA EVG     H  
Sbjct  109   GEQSPGATMTSQEKLNIARQLAKLGVDIIEAGFPAASPDDFNAVKAIALEVGNAVDPHGY  168

Query  508   VPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMV  687
             +P+IC L+RCN++DI  AW+AV+ A++PRIHTFIATS IHM YKLK S+++V+  A +MV
Sbjct  169   IPIICSLSRCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVINIARTMV  228

Query  688   AYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIA  867
             A+ARSLGC+DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIA
Sbjct  229   AFARSLGCNDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPEEFGKLIA  288

Query  868   DIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVV  1047
             D+KANTPGIENVIIS HC NDLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVV
Sbjct  289   DVKANTPGIENVIISAHCHNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVV  348

Query  1048  MALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDG  1227
             MALKC+GE +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAFAHESGIHQD 
Sbjct  349   MALKCKGESILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDR  408

Query  1228  MLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRF  1407
             MLKHK TYEIISP+DIGL R NE  IVLGKLSGRHAL+ K++ELGY+I+G++L+++FW+F
Sbjct  409   MLKHKGTYEIISPDDIGLERTNEVDIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWQF  468

Query  1408  KSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHV  1587
             K+VAE+KK+VTD ++IALVSDEVFQP V W+L D+QV+CG+LGLSTATVKLI  DG+EH+
Sbjct  469   KAVAEQKKRVTDAEIIALVSDEVFQPAVVWKLHDLQVSCGTLGLSTATVKLISGDGKEHI  528

Query  1588  ACSVGTGPVDAAYKAVDLVTKV  1653
             AC+VGTG VD+AYKAVDL+ KV
Sbjct  529   ACAVGTGRVDSAYKAVDLIVKV  550



>dbj|BAH20374.1| AT1G74040 [Arabidopsis thaliana]
Length=491

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/482 (75%), Positives = 428/482 (89%), Gaps = 4/482 (1%)
 Frame = +1

Query  466   RLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYK  639
             + IAE VG    E  +VPVICGL+RCNK+DI+ AWEAVK+AK+PRIHTFIATS+IH+ YK
Sbjct  1     KTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIATSDIHLKYK  60

Query  640   LKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIP  819
             LK S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGATTLNIP
Sbjct  61    LKKSKEEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNIP  120

Query  820   DTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTI  999
             DTVG T+P+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA +GARQ+EVTI
Sbjct  121   DTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHSGARQVEVTI  180

Query  1000  NGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             NGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  QPHKAI
Sbjct  181   NGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAI  240

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VGANAFAHESGIHQDGMLKHK TYEI+SPE+IGL R+N++GIVLGKLSGRHAL+ ++ EL
Sbjct  241   VGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNDAGIVLGKLSGRHALKDRLNEL  300

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             GY ++  +L +LFWRFK+VAE+KK+VTD DLIALVSDEVFQP+  W+L D+Q+TCG+LGL
Sbjct  301   GYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDMQITCGTLGL  360

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
             ST+TVKL D+DG+EHVACSVGTGPVDAAYKAVDL+ K P TLLEYSMNAVTEGIDAIA+T
Sbjct  361   STSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATT  420

Query  1720  RVLIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYN  1893
             RVLIR D   +S +  TG S  R+F+GTGA MD+V+SSV+AYVGALNK+LGF+   S  +
Sbjct  421   RVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLGFKEHTSTLS  480

Query  1894  KT  1899
             KT
Sbjct  481   KT  482



>ref|XP_007207420.1| hypothetical protein PRUPE_ppa004868mg [Prunus persica]
 gb|EMJ08619.1| hypothetical protein PRUPE_ppa004868mg [Prunus persica]
Length=488

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/472 (77%), Positives = 419/472 (89%), Gaps = 4/472 (1%)
 Frame = +1

Query  469   LIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKL  642
             +IA+EVG    +  +VPVICGL+RCNK+DI +AW+AV+ AK+PRIHTFIATS IHM +KL
Sbjct  1     MIAKEVGNSVDKDGYVPVICGLSRCNKKDIKRAWDAVECAKRPRIHTFIATSAIHMEHKL  60

Query  643   KMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  822
             + ++EQVVE A  MV+YARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD
Sbjct  61    RKTKEQVVEIARDMVSYARSLGCDDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  120

Query  823   TVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTIN  1002
             TVGY +P+E+ QLI+DIK+NTPGIENVIISTHCQNDLGLSTANT+AGA AGARQLEVTIN
Sbjct  121   TVGYNVPSEYSQLISDIKSNTPGIENVIISTHCQNDLGLSTANTIAGASAGARQLEVTIN  180

Query  1003  GIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             GIGERAGNASLEEVVM L CRG+ VLGGLYTGIN + I + SKMVEEYTGLHVQPHKAIV
Sbjct  181   GIGERAGNASLEEVVMTLDCRGDHVLGGLYTGINARHIYITSKMVEEYTGLHVQPHKAIV  240

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDGMLKHK TYEIISPEDIG  R+NE+GIVLGKLSGRHAL+ ++ ELG
Sbjct  241   GANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHALKKRLEELG  300

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             YE+   +LE +FWRFK+VA++KK+VTD DL ALVSDEVFQP+V W+L D+QVTCG+LGLS
Sbjct  301   YELADDQLETIFWRFKAVADQKKRVTDADLRALVSDEVFQPEVVWKLHDLQVTCGTLGLS  360

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATVKLIDADG EHVAC+VGTGPVD+AYKAVDL+ K PV LLEYSMNAVTEGIDAIA+TR
Sbjct  361   TATVKLIDADGREHVACAVGTGPVDSAYKAVDLIVKEPVILLEYSMNAVTEGIDAIATTR  420

Query  1723  VLIREDQASI--HGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             VLIR + ++I  H  TG +  R+F+G GA MD+V+SSV+AYVGALNK+LGF+
Sbjct  421   VLIRGENSNITTHAFTGETVQRTFSGIGAGMDIVVSSVKAYVGALNKMLGFK  472



>ref|XP_002307122.2| hypothetical protein POPTR_0005s08480g [Populus trichocarpa]
 gb|EEE94118.2| hypothetical protein POPTR_0005s08480g [Populus trichocarpa]
Length=489

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/473 (78%), Positives = 422/473 (89%), Gaps = 6/473 (1%)
 Frame = +1

Query  469   LIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYK  639
             +IA EVG     EG +VPVICGL+RCN++DI  AWEAVK+AK+PRIHTFIATS IHM YK
Sbjct  1     MIANEVGNQVDSEG-YVPVICGLSRCNEKDIRAAWEAVKNAKRPRIHTFIATSGIHMEYK  59

Query  640   LKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIP  819
             L+ S+E+VVE A+SMV +ARSLGC DVEFSPEDAGRS+REFLY ILGEVIKAGATTLNIP
Sbjct  60    LRKSKEEVVEIASSMVRFARSLGCDDVEFSPEDAGRSEREFLYHILGEVIKAGATTLNIP  119

Query  820   DTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTI  999
             DTVG T P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GACAGARQ+EVTI
Sbjct  120   DTVGITTPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGACAGARQVEVTI  179

Query  1000  NGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             NGIGERAGNASLEEVVM +KCRGE VLGGLYTGINT+ I MASKMVEEYTGLHVQPHKAI
Sbjct  180   NGIGERAGNASLEEVVMVIKCRGEHVLGGLYTGINTRHITMASKMVEEYTGLHVQPHKAI  239

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R+N++GIVLGKLSGRHAL+ ++ EL
Sbjct  240   VGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNDAGIVLGKLSGRHALKDRLNEL  299

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             GYE++  +L ++FWRFK+VAE KK+VTD DLIALVSDEVFQP+  W+L D+QVTCG+LGL
Sbjct  300   GYELDDAQLGNIFWRFKAVAETKKRVTDADLIALVSDEVFQPENVWKLHDLQVTCGTLGL  359

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
             STATVKL+ ADGEEHVACS+GTGPVD+AYKAV+L+ K PVTLLEYSM AVTEGIDAIA+T
Sbjct  360   STATVKLLSADGEEHVACSLGTGPVDSAYKAVNLIVKEPVTLLEYSMIAVTEGIDAIATT  419

Query  1720  RVLIR-EDQ-ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             RV+IR E+Q A  H  T     R+F+G+GA MD+V+SSV+AYVGALNK+L F+
Sbjct  420   RVVIRGENQHAPTHALTDEPFQRTFSGSGAGMDIVVSSVKAYVGALNKMLAFK  472



>ref|XP_010546232.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Tarenaya 
hassleriana]
Length=606

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/579 (65%), Positives = 465/579 (80%), Gaps = 16/579 (3%)
 Frame = +1

Query  169   LRFSI--SGASRRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQ  342
             LR +I  S A  R S  S         ++ P RRPEY+ NRI D NYVRIFDTTLRDGEQ
Sbjct  26    LRIAIRRSLALSRSSALSLHHHRHCHAAASPLRRPEYVANRISDQNYVRIFDTTLRDGEQ  85

Query  343   SPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVP  513
             SPGA +T+ +KLA+ARQLA+LGVD+I+AGFPA+S  D EAV+ IA+ VG     + D+VP
Sbjct  86    SPGAALTSTQKLAIARQLAKLGVDVIDAGFPAASADDFEAVKTIAKTVGNEWDKKTDYVP  145

Query  514   VICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAY  693
             VICGLARCN +D+  AWEAVKHA++PRIH FI+TS++H+ +KL+ +RE+VVE A++ V +
Sbjct  146   VICGLARCNMKDVTDAWEAVKHARRPRIHVFISTSDLHIKHKLRTTREKVVEMASNTVTF  205

Query  694   ARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADI  873
             AR+LGC DV+FSPEDA RS++EFLY ILGEVI AGATTLNI DTVG++IPNEFGQLI+DI
Sbjct  206   ARNLGCDDVQFSPEDACRSEKEFLYSILGEVIAAGATTLNIADTVGFSIPNEFGQLISDI  265

Query  874   KANTPGIENVIISTHCQNDLGLSTANTLA-GACAGARQLEVTINGIGERAGNASLEEVVM  1050
             KANT GI +VIIS HC +DLGLSTANTLA  ACAGARQ+EVT+NGIGER GNASLEEVVM
Sbjct  266   KANTRGINDVIISVHCHDDLGLSTANTLAVSACAGARQIEVTVNGIGERGGNASLEEVVM  325

Query  1051  ALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQ-DG  1227
             A+KCRG  VLGGLY+GINT+QII +SK++EE TGLHVQP+KAIVGANAF HESGIHQ DG
Sbjct  326   AMKCRGPHVLGGLYSGINTRQIIPSSKLLEECTGLHVQPNKAIVGANAFVHESGIHQLDG  385

Query  1228  MLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRF  1407
             +LKHK+TYEII+PED+GL RAN SGIVLGKLSGRHALQ+++ ELGYE++ ++L  +FWRF
Sbjct  386   VLKHKNTYEIIAPEDVGLLRANNSGIVLGKLSGRHALQSRLKELGYELDNEKLNVVFWRF  445

Query  1408  KSVAERKKKVTDDDLIALVSD-EVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEH  1584
             K++A++KK+V+D D+IALVSD E  + +V W+L DVQV CG+ G S ATVKL+D  GEEH
Sbjct  446   KAIADQKKRVSDADIIALVSDGETTRYEVTWKLLDVQVVCGTAGQSMATVKLVDPKGEEH  505

Query  1585  VACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAI--ASTRVLIREDQASIHG  1758
              ACSVG GPVD+AYKAVDL+ K PV LLEYS N V  G+D+    +TRV I+ +   +  
Sbjct  506   KACSVGNGPVDSAYKAVDLIVKEPVRLLEYSTNDVLGGVDSTTKTTTRVSIQTNPDFV--  563

Query  1759  STGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQN  1875
                 S +++F+G G  MD ++SSV AY+GALN +LG ++
Sbjct  564   ----SEDQTFSGVGEGMDFIVSSVEAYIGALNNMLGNKD  598



>dbj|BAI49592.1| homocitrate synthase [Lotus japonicus]
Length=540

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/539 (66%), Positives = 434/539 (81%), Gaps = 13/539 (2%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RPEYIPN I +P YVRI DTTLRDGEQSPGA MT  +KL  ARQLA+LGVDIIEAGFP +
Sbjct  11    RPEYIPNHIPNPTYVRILDTTLRDGEQSPGAAMTCVQKLETARQLAKLGVDIIEAGFPCA  70

Query  442   SEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIA  612
             S+ D  AV++IAEEVG    G G +VPVI G++RCN++DI  AWEA+KHAK+PR+ TFIA
Sbjct  71    SKQDFMAVKMIAEEVGNCVDGNG-YVPVITGVSRCNEKDIATAWEALKHAKRPRLRTFIA  129

Query  613   TSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  792
             TS IHM YKL+ S++QV+E A +MV +ARSLGC+D++F  EDA RSD+EFLYQI GEVIK
Sbjct  130   TSPIHMEYKLRKSKDQVLETARNMVKFARSLGCTDIQFGAEDAARSDKEFLYQIFGEVIK  189

Query  793   AGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACA  972
             AGATTL IPDTVG  +P E+G+LIADIKANTPGIEN I++THC NDLGL+TANT+ GA  
Sbjct  190   AGATTLTIPDTVGIAMPFEYGKLIADIKANTPGIENAIMATHCHNDLGLATANTIEGARY  249

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTG  1152
             GARQLEVTINGIGERAGNAS EEVVMAL CRG  +LGGL+TGINT+ I+  SKMVE+Y+G
Sbjct  250   GARQLEVTINGIGERAGNASFEEVVMALTCRGIDILGGLHTGINTRHILKTSKMVEKYSG  309

Query  1153  LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRH  1332
             LH+QPHKA+VGANAF HESGIHQDGMLKH+ TYEIISPEDIGL R+    IVLGKLSGR 
Sbjct  310   LHLQPHKALVGANAFLHESGIHQDGMLKHRGTYEIISPEDIGLVRSVGDTIVLGKLSGRQ  369

Query  1333  ALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             AL+ ++ ELGY+++  E+E +FW+FK+VAE+KK++TD DL ALVS+E F  Q  W+LGD+
Sbjct  370   ALRNRLEELGYKLKDTEVEGVFWQFKAVAEKKKRITDTDLRALVSNEAFNEQPIWKLGDL  429

Query  1513  QVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVT  1692
             QVTCG++G STATVKL   DG  HVACS+GTGPVD+AYKA++ + K P  L++Y++ A+T
Sbjct  430   QVTCGTVGFSTATVKLFSIDGSMHVACSIGTGPVDSAYKAINHIVKEPAKLVKYTLGAIT  489

Query  1693  EGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             EGIDA A+T V I         S G + +  F+GTG   DVV+SSV AY+ ALN +L F
Sbjct  490   EGIDATATTSVEI---------SRGDTNHPVFSGTGGGTDVVVSSVDAYLSALNNMLRF  539



>ref|XP_010546219.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=642

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/611 (61%), Positives = 467/611 (76%), Gaps = 21/611 (3%)
 Frame = +1

Query  88    PVITPPESKYTCKYLPIHTIATSFSKQLR--------FSISGASRRPSFQSFSAAAVRCE  243
             P+ T      T    P+    ++F  +LR          IS A++       SAAA    
Sbjct  10    PIGTTSSWPTTVSGPPLPFTTSAFPSRLRPYAAQPPPLRISAAAKMSPL-PLSAAANHLR  68

Query  244   SSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
                  RRPEYIPNRI DPNYVR+FDTTLRDGEQSPGA M T++KL +AR+LA LGVD+IE
Sbjct  69    R---VRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGAAMQTEQKLLIARKLAELGVDVIE  125

Query  424   AGFPASSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPR  594
             AGFPA+S AD EAV+ IA+ VG     E  +VPVICGL+RC K D++ AWEAVKHAK+PR
Sbjct  126   AGFPAASAADFEAVKAIAQTVGNDVDEETGYVPVICGLSRCRKDDVEAAWEAVKHAKRPR  185

Query  595   IHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  774
             IH FI+TS+IHM +KL+ +RE+V++ A+SM+ +ARSLGC+DVEF  EDAGRS++ F+Y+I
Sbjct  186   IHVFISTSDIHMEHKLRKTREEVIQMASSMIRFARSLGCADVEFGAEDAGRSEKGFMYKI  245

Query  775   LGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  954
             L EVIKAGA+T+NI DTVG   P+EFG+LI+DIKANTPGI++VIISTHCQNDLGL+TANT
Sbjct  246   LEEVIKAGASTVNIADTVGINTPDEFGELISDIKANTPGIDDVIISTHCQNDLGLATANT  305

Query  955   LAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKM  1134
             L+G  AGARQ+EVTINGIGER GNASLEEVVM LKC+GE    GLYTGI+T+ I+ ASK+
Sbjct  306   LSGTSAGARQVEVTINGIGERGGNASLEEVVMTLKCKGEHAFCGLYTGIDTRHIVPASKL  365

Query  1135  VEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLG  1314
             VEE+TGLHVQPHKAIVGANAF HESGIHQDGMLK+K TYEI+ PED+GL R+ E GIVLG
Sbjct  366   VEEHTGLHVQPHKAIVGANAFVHESGIHQDGMLKNKSTYEIMLPEDVGLERSQELGIVLG  425

Query  1315  KLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEVFQPQ  1488
             KLSGRHALQ ++ +LGYE++  +L  +F +FK+VAE KK+VTD DL+ALVS  D     +
Sbjct  426   KLSGRHALQERLKQLGYEMDDTKLNHVFLKFKAVAELKKRVTDADLVALVSDVDTCRSDE  485

Query  1489  VFWRLGDVQVTCGS--LGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVT  1662
               W+L +VQV CGS  L  STA V L+D  G+EHVACSVGTGP+D+AY+AVDL+ K  VT
Sbjct  486   PTWKLLEVQVVCGSGTLSRSTAIVTLVDRKGQEHVACSVGTGPIDSAYRAVDLIVKEAVT  545

Query  1663  LLEYSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYV  1842
             LLEYSM+ ++EGID+I++ RV IR++  SI  ++     ++F G G   D+V+SSV+AY+
Sbjct  546   LLEYSMDGISEGIDSISTIRVSIRKNCHSI--ASTHEPLQTFEGMGVGTDIVVSSVKAYI  603

Query  1843  GALNKLLGFQN  1875
             GALN ++   N
Sbjct  604   GALNNVIRISN  614



>ref|XP_005648878.1| 2-isopropylmalate synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24334.1| 2-isopropylmalate synthase [Coccomyxa subellipsoidea C-169]
Length=599

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/548 (65%), Positives = 438/548 (80%), Gaps = 7/548 (1%)
 Frame = +1

Query  247   SPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEA  426
             S  +RRPEYIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +ARQLA+L VDIIEA
Sbjct  26    STQSRRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLRVDIIEA  85

Query  427   GFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIH  600
             GFP +S  D +AVR IA +VG    E  +VPVICGL+R   RD++ AWEAVK AK+PR+H
Sbjct  86    GFPVASPDDFDAVRSIAMDVGNNVDEDGYVPVICGLSRTIIRDLEVAWEAVKLAKRPRVH  145

Query  601   TFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  780
             TF+ATS IHM +KLKM+ +QVVE A   V + RSLGC+D+EFSPEDAGRSD +FLY++L 
Sbjct  146   TFLATSAIHMEHKLKMTPDQVVENAVKAVRHLRSLGCTDIEFSPEDAGRSDPKFLYRVLA  205

Query  781   EVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  960
              VI+AGATTLNIPDT G+ +P+EFG LIAD+ ANTPG + V+ STHCQNDLGLSTAN+LA
Sbjct  206   AVIEAGATTLNIPDTTGWNLPHEFGGLIADLIANTPGADKVVFSTHCQNDLGLSTANSLA  265

Query  961   GACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVE  1140
             GA AGARQ+E TINGIGERAGNASLEEVVMA+  RG Q +GGL TGI    II  SKMV 
Sbjct  266   GAMAGARQIECTINGIGERAGNASLEEVVMAINKRGAQQMGGLRTGIRPVHIISTSKMVS  325

Query  1141  EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             +Y+G+ VQPHKAIVGANAFAHESGIHQDGMLK KDTYEII PE+IGL R +++GIV+GK 
Sbjct  326   DYSGMMVQPHKAIVGANAFAHESGIHQDGMLKSKDTYEIIRPEEIGLTRQDDAGIVMGKH  385

Query  1321  SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWR  1500
             SGR+AL+ K+  LG+++   +L+D+F RFKS+A++KK VTD+D++ALVSDEV QP+  W 
Sbjct  386   SGRNALRTKLQALGFDLAQDQLDDVFKRFKSLADKKKNVTDEDVLALVSDEVHQPEKLWD  445

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             L  +QV CG++GL TATV+++  DG    A  +GTGPVDAAYKA+D + +V V L EY+M
Sbjct  446   LLGLQVVCGTMGLPTATVRMLGPDGIARTATGMGTGPVDAAYKAIDALVRVQVQLSEYTM  505

Query  1681  NAVTEGIDAIASTRVLIRE-----DQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVG  1845
              +VTEGI+A+ASTRV IR      DQ  +  + GGS  RSF+G+GA  D+V++S RAYV 
Sbjct  506   TSVTEGIEALASTRVSIRPVGGHADQGFVIHAQGGSTQRSFSGSGANEDIVVASARAYVS  565

Query  1846  ALNKLLGF  1869
             ALNKL+ F
Sbjct  566   ALNKLIAF  573



>ref|XP_002945733.1| 2-isopropylmalate synthase [Volvox carteri f. nagariensis]
 gb|EFJ52728.1| 2-isopropylmalate synthase [Volvox carteri f. nagariensis]
Length=635

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/560 (63%), Positives = 446/560 (80%), Gaps = 12/560 (2%)
 Frame = +1

Query  232   VRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGV  411
             VR E    ARRP+YIPNRI DPNYVRIFDTTLRDGEQSPGAT+T+KEKL +AR LARLGV
Sbjct  36    VRAE----ARRPDYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARGLARLGV  91

Query  412   DIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAK  585
             DIIEAGFP +S  D EAVR IA EVG       +VPVICGL+R    D+++AW+AV+HAK
Sbjct  92    DIIEAGFPVASPDDFEAVRTIAMEVGNDVQPDGYVPVICGLSRTKFADLERAWDAVRHAK  151

Query  586   KPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  765
             +PR+HTFIATS+IHM YKL+M+ ++VVE A + V + RSLGC+D+EFSPEDAGRSD +FL
Sbjct  152   RPRVHTFIATSDIHMKYKLRMTPDEVVENAVAAVRHLRSLGCNDIEFSPEDAGRSDPQFL  211

Query  766   YQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLST  945
             Y+ILGEVIKAGATTLNIPDT G+ +P+EFG LIA I+ NTPG ENVIISTHCQNDLGLST
Sbjct  212   YRILGEVIKAGATTLNIPDTTGWNLPHEFGGLIAAIRKNTPGAENVIISTHCQNDLGLST  271

Query  946   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMA  1125
             AN+LAGA AGARQ+E TINGIGERAGNASLEEVVMA+  RG+  + GLYTGI    I   
Sbjct  272   ANSLAGAMAGARQIECTINGIGERAGNASLEEVVMAISLRGKDQMNGLYTGIRPVHIYPM  331

Query  1126  SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANES-G  1302
             SKMV +Y+G+ VQPHKAIVGANAFAHESGIHQDGMLK+++TYEI++PE IGL R  +  G
Sbjct  332   SKMVSDYSGMIVQPHKAIVGANAFAHESGIHQDGMLKNRETYEIMTPESIGLPRQEQDRG  391

Query  1303  IVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQ  1482
             IVLGK SGR+AL +++  LGYE+   EL+D+F RFK++A++KK +TD+D++AL+SDE+ Q
Sbjct  392   IVLGKHSGRNALSSRLRSLGYELSTSELDDVFKRFKALADKKKGITDEDILALMSDELHQ  451

Query  1483  PQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVT  1662
             P+V W L D+QV CG++G+ TATV++   DG   +   VGTGPVDAAYKA+D + +V   
Sbjct  452   PKVIWELLDLQVVCGTMGMPTATVQMQGPDGIARIGVGVGTGPVDAAYKAIDSLVRVEAE  511

Query  1663  LLEYSMNAVTEGIDAIASTRVLIR-----EDQASIHGSTGGSANRSFNGTGAAMDVVISS  1827
             L++YS+++VT+GI+A+A TRV+IR      DQ     +  G+  R F+G+GA  D+V++S
Sbjct  512   LVDYSVSSVTQGIEALAHTRVMIRPAGKMSDQGYSEHAALGTVQRQFSGSGANEDIVVAS  571

Query  1828  VRAYVGALNKLLGFQNLVSR  1887
              RAY+ ALNK++G+ ++  +
Sbjct  572   ARAYISALNKMIGWMSVAQK  591



>gb|KHN34615.1| Putative 2-isopropylmalate synthase [Glycine soja]
Length=583

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/545 (63%), Positives = 430/545 (79%), Gaps = 4/545 (1%)
 Frame = +1

Query  253   PARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
             P  RPEYIPN I DP+YVRI DTTLRDGEQSPGA MT+ +KL +ARQL +LGVDII+AGF
Sbjct  39    PRSRPEYIPNHIPDPSYVRILDTTLRDGEQSPGAAMTSDQKLGIARQLVKLGVDIIDAGF  98

Query  433   PASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             P++S+ D  AV++IA+EVG   + D +VPVI  L RCN++DI  AWEAV++AKKPR+  F
Sbjct  99    PSASQEDFNAVKMIAQEVGNDCDADGYVPVIAALCRCNEKDITTAWEAVRYAKKPRLIPF  158

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS IHM YKL  ++E+V++ A  MV + RSLGC D+EF  EDA RSD EFLY+IL EV
Sbjct  159   IATSSIHMEYKLNKTKEEVLQIAIDMVKFTRSLGCDDIEFGVEDAARSDTEFLYKILEEV  218

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATTL I DTVG T+P EFG++IA IKAN PG+ENVIIS HC NDLG +TANT+  A
Sbjct  219   IKAGATTLCIADTVGITMPLEFGEMIAGIKANVPGVENVIISVHCHNDLGHATANTIQAA  278

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
             C GARQLEVTINGIGERAGNA+ EEVVMALKCRG+  LGGLYTGINT+ I+  S+MVEE 
Sbjct  279   CVGARQLEVTINGIGERAGNAAFEEVVMALKCRGDHALGGLYTGINTRHILKTSRMVEEC  338

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             +G+++QPHKA+VG N+F HESGIHQ G+LKH+ TYEIISPEDIG  R+N + +VLGKLSG
Sbjct  339   SGMYLQPHKALVGDNSFLHESGIHQAGLLKHRGTYEIISPEDIGHERSNGANMVLGKLSG  398

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHAL+ ++ ELGYE+   ELE +F  FK++A +KK+VTD DL ALVSD+V   +  W+L 
Sbjct  399   RHALKNRLQELGYELRDDELESVFRNFKAMAGKKKRVTDVDLKALVSDQVCHVEPIWKLD  458

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
             D+QVTCG++G STA+VKL+   G  HVACSVG GPVDAAYKA+DL+ K  V +LEY++N 
Sbjct  459   DLQVTCGTMGSSTASVKLVTVHGSTHVACSVGVGPVDAAYKAIDLIVKETVKVLEYTLNP  518

Query  1687  VTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             VTEG DAIA+TR++IR   ++   H   G     +F+GTG  +DVV+SSV AY+ ALNK+
Sbjct  519   VTEGTDAIATTRIVIRRENNKTLTHALNGNFVYPTFSGTGEGVDVVVSSVEAYLTALNKM  578

Query  1861  LGFQN  1875
             L F++
Sbjct  579   LDFKD  583



>ref|XP_006604280.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=583

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/549 (63%), Positives = 431/549 (79%), Gaps = 4/549 (1%)
 Frame = +1

Query  241   ESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDII  420
             + + P  RPEYIPN I DP+YVRI DTTLRDGEQSPGA MT+ +KL +ARQL +LGVDII
Sbjct  35    DGTHPRSRPEYIPNHIPDPSYVRILDTTLRDGEQSPGAAMTSDQKLGIARQLVKLGVDII  94

Query  421   EAGFPASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPR  594
             +AGFP++S+ D  AV++IA+EVG   + D +VPVI  L RCN++DI  AWEAV++AKKPR
Sbjct  95    DAGFPSASQEDFNAVKMIAQEVGNDCDADGYVPVIAALCRCNEKDITTAWEAVRYAKKPR  154

Query  595   IHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  774
             +  FIATS IHM YKL  ++E+V++ A  MV + RSLGC D+EF  EDA RSD EFLY+I
Sbjct  155   LIPFIATSSIHMEYKLNKTKEEVLQIAIDMVKFTRSLGCDDIEFGVEDAARSDTEFLYKI  214

Query  775   LGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  954
             L EVIKAGATTL I DTVG T+P EFG++IA IKAN PG+EN IIS HC NDLG +TANT
Sbjct  215   LEEVIKAGATTLCIADTVGITMPLEFGEMIAGIKANVPGVENAIISVHCHNDLGHATANT  274

Query  955   LAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKM  1134
             +  AC GARQLEVTINGIGERAGNA+ EEVVMALKCRG+  LGGLYTGINT+ I+  S+M
Sbjct  275   IQAACVGARQLEVTINGIGERAGNAAFEEVVMALKCRGDHALGGLYTGINTRHILKTSRM  334

Query  1135  VEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLG  1314
             VEE +G+++QPHKA+VG N+F HESGIHQ G+LKH+ TYEIISPEDIG  R+N + +VLG
Sbjct  335   VEECSGMYLQPHKALVGDNSFLHESGIHQAGLLKHRGTYEIISPEDIGHERSNGANMVLG  394

Query  1315  KLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVF  1494
             KLSGRHAL+ ++ ELGYE+   ELE +F  FK++A +KK+VTD DL ALVSD+V   +  
Sbjct  395   KLSGRHALKNRLQELGYELRDDELESVFRNFKAMAGKKKRVTDVDLKALVSDQVCHVEPI  454

Query  1495  WRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEY  1674
             W+L D+QVTCG++G STA+VKL+   G  HVACSVG GPVDAAYKA+DL+ K  V +LEY
Sbjct  455   WKLDDLQVTCGTMGSSTASVKLVTVHGSTHVACSVGVGPVDAAYKAIDLIVKETVKVLEY  514

Query  1675  SMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGA  1848
             ++N VTEG DAIA+TR++IR   ++   H   G     +F+GTG  +DVV+SSV AY+ A
Sbjct  515   TLNPVTEGTDAIATTRIVIRRENNKTLTHALNGNFVYPTFSGTGEGVDVVVSSVEAYLTA  574

Query  1849  LNKLLGFQN  1875
             LNK+L F++
Sbjct  575   LNKMLDFKD  583



>ref|XP_006443113.1| hypothetical protein CICLE_v10020218mg [Citrus clementina]
 gb|ESR56353.1| hypothetical protein CICLE_v10020218mg [Citrus clementina]
Length=433

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/431 (77%), Positives = 384/431 (89%), Gaps = 2/431 (0%)
 Frame = +1

Query  628   MNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATT  807
             M +KL+ +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILGEVIK GATT
Sbjct  1     MEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATT  60

Query  808   LNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQL  987
             LNIPDTVG T+P EFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+AGACAGARQ+
Sbjct  61    LNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQV  120

Query  988   EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQP  1167
             EVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+ I+MASKMVEEYTGLHVQP
Sbjct  121   EVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQP  180

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             HKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R++E+GIVLGKLSGRHAL+ +
Sbjct  181   HKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDR  240

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELGYE+  ++L  +FW FK+VAE+KK+VTD DLIALVSDEVFQP+V W+L D+QVTCG
Sbjct  241   LKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEVFQPEVVWKLLDMQVTCG  300

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +LGLSTATVKL+DA+GEEHVACS GTGPVD+AYKAVDL+ K P TLLEYSMNAVT GIDA
Sbjct  301   TLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDA  360

Query  1708  IASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLV  1881
             IA+TRVLIR  + Q S H STG +  R+F+GTGA MD+V+SSV+AY+GALNK+LGF++ +
Sbjct  361   IATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQL  420

Query  1882  SRYNKTQGTVV  1914
                +  + T V
Sbjct  421   PAKDSVERTSV  431



>ref|XP_003521867.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=555

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/537 (63%), Positives = 427/537 (80%), Gaps = 4/537 (1%)
 Frame = +1

Query  265   PEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASS  444
             PEYIPNRI DP+YVRI DTTLRDGEQ+PGA MT+ +KL +ARQLA+LGVD+IE GFP++S
Sbjct  15    PEYIPNRIPDPHYVRILDTTLRDGEQAPGAAMTSDQKLQIARQLAKLGVDVIEGGFPSAS  74

Query  445   EADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATS  618
             + D  AV++IA+EVG   + D +VPVI  L RCN+RDI +AWEA+K+AK+PR+  FIA S
Sbjct  75    QEDFNAVKMIAQEVGNNCDADGYVPVIAALCRCNERDITRAWEALKYAKRPRLMPFIAVS  134

Query  619   EIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  798
              IHM YKL  ++E+V++ AT M+ +AR LGC+D++F  EDA RSDREFLYQIL EVIKAG
Sbjct  135   PIHMEYKLNKTKEEVLQIATDMIKFARGLGCTDIQFCSEDAARSDREFLYQILEEVIKAG  194

Query  799   ATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGA  978
             ATTL I DTVG T+P E  +L+A IKAN PG ENVIIS HC NDLG +TANT+  A AGA
Sbjct  195   ATTLGIGDTVGITMPFEIRELVAGIKANVPGAENVIISIHCHNDLGHATANTIEAARAGA  254

Query  979   RQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLH  1158
              QLEVTINGIGERAGNASLEEVVMALKCRG+ VLGGLYTGINT+ ++  SKMVEE++G++
Sbjct  255   MQLEVTINGIGERAGNASLEEVVMALKCRGDHVLGGLYTGINTRHLLKTSKMVEEFSGMY  314

Query  1159  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHAL  1338
             +QPHKA+VG NAF HESG+HQ G+LKH+ TYEI+SPEDIG  ++N   +VLGKLSGR AL
Sbjct  315   LQPHKAVVGDNAFLHESGVHQAGLLKHRGTYEILSPEDIGHEKSNGVNMVLGKLSGRQAL  374

Query  1339  QAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQV  1518
             ++++ ELGYE+  +E+E +F  FK++AE+KK+VTD DL ALVSD+    +  W+LG +QV
Sbjct  375   KSRLKELGYELRDEEVESVFRNFKAIAEKKKRVTDVDLKALVSDQASHAEPIWKLGGLQV  434

Query  1519  TCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEG  1698
             TCG++G STAT+KL+ +DG  HVACSVG GPVD+AYKA++L+ K  V +LEYS + VT G
Sbjct  435   TCGTMGSSTATIKLVTSDGSTHVACSVGVGPVDSAYKAINLIVKETVKVLEYSPSTVTGG  494

Query  1699  IDAIASTRVLIRED--QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
              DAIA+TRV+IR +  Q+      G     +F+GTG  +D+V SSV AY+ ALNK+L
Sbjct  495   TDAIATTRVVIRRENKQSPTPALNGNVIYPTFSGTGEGVDIVTSSVEAYITALNKML  551



>ref|XP_003554069.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=555

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/541 (63%), Positives = 430/541 (79%), Gaps = 6/541 (1%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RPEYIPNRI DP+YVRI DTTLRDGEQ+PGA+M + +KLA  RQLA+LGVD+IE GFP++
Sbjct  16    RPEYIPNRIPDPHYVRILDTTLRDGEQAPGASMVSSQKLA--RQLAKLGVDVIEGGFPSA  73

Query  442   SEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S+ D  AV++IA+EVG   + D +VPVI  L RCN++DI  AWEA+K+AK+PR+  FIA 
Sbjct  74    SQEDFNAVKMIAQEVGNNCDADGYVPVIAALCRCNEKDIATAWEALKYAKRPRLMPFIAV  133

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S IHM YKL  ++E+V++ A  M+ +ARSLGCSD++F  EDA RSDREFLYQIL EVIKA
Sbjct  134   SPIHMEYKLNKTKEEVLQIAKDMIKFARSLGCSDIQFCSEDAARSDREFLYQILEEVIKA  193

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATTL I DTVG T+P E  QLIADIKAN PG ENVIIS HC NDLG +TAN +  A AG
Sbjct  194   GATTLGIGDTVGITMPFEIRQLIADIKANVPGAENVIISMHCHNDLGHATANAIEAAQAG  253

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGL  1155
             A QLEVTINGIGERAGNASLEEVVMALKCRG+QVLGGLYTGINT+ ++  SKMVEE++G+
Sbjct  254   AMQLEVTINGIGERAGNASLEEVVMALKCRGDQVLGGLYTGINTRHLLKTSKMVEEFSGM  313

Query  1156  HVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHA  1335
             ++QPHKA+VG NAF HESG+HQ G+LKH+ TYEI+SPEDIG  +++   +VLGKLSGR A
Sbjct  314   YLQPHKAVVGDNAFLHESGVHQAGLLKHRATYEIMSPEDIGHEKSSGVNMVLGKLSGRQA  373

Query  1336  LQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQ  1515
             L++++ ELGYE+  +E+E +F  FK++AE+KK+VTD DL ALVS++V   +  W+L  +Q
Sbjct  374   LKSRLKELGYELRDEEVESVFRNFKAIAEKKKRVTDVDLKALVSNQVSHDEPIWKLDGLQ  433

Query  1516  VTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTE  1695
             VTCG++G STAT+KL+ +DG  HVACSVG GPVD+AYKA++L+ K  V +LEYS++ VTE
Sbjct  434   VTCGTMGSSTATIKLVTSDGITHVACSVGVGPVDSAYKAINLIVKETVKVLEYSLSTVTE  493

Query  1696  GIDAIASTRVLIRED--QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             G DAIA+TRV+IR +  Q+      G     +F+GTG  +DVV SSV AY+ ALNK+L  
Sbjct  494   GTDAIATTRVVIRRENKQSPTPALNGNVIYPTFSGTGEGVDVVTSSVEAYLTALNKMLDL  553

Query  1870  Q  1872
             +
Sbjct  554   K  554



>ref|NP_001237749.1| probable 2-isopropylmalate synthase [Glycine max]
 sp|Q39891.1|LEU1_SOYBN RecName: Full=Probable 2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate 
synthase; AltName: Full=Late nodulin-56; Short=N-56 [Glycine 
max]
 dbj|BAA07212.1| late nodulin [Glycine max]
Length=565

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/541 (63%), Positives = 425/541 (79%), Gaps = 4/541 (1%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP+YIPN I D +YVRI DTTLRDGEQSPGATMT KEKL +ARQL +LGVDII+ GFP++
Sbjct  19    RPQYIPNHIPDSSYVRILDTTLRDGEQSPGATMTAKEKLDIARQLVKLGVDIIQPGFPSA  78

Query  442   SEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S +D  AV++IA+EVG    D  +VPVI G  RC ++DI  AWEAVK+AK+PR+ T IAT
Sbjct  79    SNSDFMAVKMIAQEVGNAVDDDGYVPVIAGFCRCVEKDISTAWEAVKYAKRPRLCTSIAT  138

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S IHM +KL+ S++QV++ A  MV +ARSLGC+D++F  EDA RSDREFLY+ILG VI+A
Sbjct  139   SPIHMEHKLRKSKDQVIQIARDMVKFARSLGCNDIQFGAEDATRSDREFLYEILGVVIEA  198

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATT+NI DTVG  +P E G+LI DIK NTPGI NVIISTHC NDLGL+TANT+ GA  G
Sbjct  199   GATTVNIADTVGIVMPLELGKLIVDIKDNTPGIANVIISTHCHNDLGLATANTIEGARTG  258

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGL  1155
             ARQLEVTINGIGERAGNASLEEVVMAL  +G+  L GLYT INT+ I+  SKMVEEY+G+
Sbjct  259   ARQLEVTINGIGERAGNASLEEVVMALASKGDHALNGLYTRINTRHILETSKMVEEYSGM  318

Query  1156  HVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHA  1335
             H+QPHK +VGANAF H SGIHQDGMLKHK TYE ISPE+IG  R    GIVLGKLSG  A
Sbjct  319   HLQPHKPLVGANAFVHASGIHQDGMLKHKGTYETISPEEIGHKRTTRIGIVLGKLSGSQA  378

Query  1336  LQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQ  1515
             L+ ++ ELGY+++  E++ +FW+FK++AE+KK VTD DL ALVS + F  +  W+LGD+Q
Sbjct  379   LRKRLEELGYDLKEDEVDSVFWQFKAMAEKKKVVTDVDLKALVSYKAFHAESIWKLGDLQ  438

Query  1516  VTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTE  1695
             VTCG++GLSTATVKL++ DG  HVACS+G G VD+ YKA++L+ K P  LL+YS+N+VTE
Sbjct  439   VTCGTIGLSTATVKLVNIDGSTHVACSIGIGAVDSTYKAINLIVKEPTKLLDYSLNSVTE  498

Query  1696  GIDAIASTRVLI-RE-DQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             GI    + RV+I RE +  S +  T  +   +F+G  A MDVV+S+V+AY+ ALNKLL +
Sbjct  499   GIGVNVTARVVICRENNHTSTYAFTEDANYPTFSGIAAEMDVVVSTVKAYLVALNKLLRW  558

Query  1870  Q  1872
             +
Sbjct  559   K  559



>ref|XP_006307272.1| hypothetical protein CARUB_v10008887mg [Capsella rubella]
 gb|EOA40170.1| hypothetical protein CARUB_v10008887mg [Capsella rubella]
Length=511

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/491 (68%), Positives = 406/491 (83%), Gaps = 13/491 (3%)
 Frame = +1

Query  67    LRASPNPPVITPPESKYTCKYLPIHTIATSF-SKQLRFSISGASRRPSFQSFSAAAVRCE  243
             +  +P+ P  +   +  + ++ P    + S  S+ LR S S           S  A    
Sbjct  16    ITTTPSLPTFSSKPTPSSFRFQPSRHCSISLRSRTLRLSCS----------ISDPAPLPP  65

Query  244   SSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
               P   RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIE
Sbjct  66    HIPRRPRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIE  125

Query  424   AGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRI  597
             AGFPA+S+ D EAV+ IAE +G    E  +VPVICGL+RCNK+DI++AW+AVK+AK+PRI
Sbjct  126   AGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRI  185

Query  598   HTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  777
             HTFIATS IH+ +KLK ++ QV+E A SMV +ARSLGC DVEFSPEDAGRS+RE+LY+IL
Sbjct  186   HTFIATSNIHLEHKLKKTKAQVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEIL  245

Query  778   GEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  957
             GEVIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL
Sbjct  246   GEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIKNVIISTHCQNDLGLSTANTL  305

Query  958   AGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMV  1137
             +GA +GARQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+ I+M SKMV
Sbjct  306   SGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMV  365

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGK  1317
             EEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEII PE+IGL R+N++GIVLGK
Sbjct  366   EEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGK  425

Query  1318  LSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFW  1497
             LSGRHAL+ ++ ELGY+++ ++L  +FWRFK+VAE+KK+VTD D+IALVSDEVFQP+  W
Sbjct  426   LSGRHALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVW  485

Query  1498  RLGDVQVTCGS  1530
             +L D+QV  G+
Sbjct  486   KLLDIQVKLGT  496



>ref|XP_003538074.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=565

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/541 (62%), Positives = 420/541 (78%), Gaps = 4/541 (1%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP+YIPN I D +YVRI DTTLRDGEQSPGATMT KEKL +ARQL +LGVDII+ GFP++
Sbjct  19    RPQYIPNHIPDSSYVRILDTTLRDGEQSPGATMTAKEKLDIARQLVKLGVDIIQPGFPSA  78

Query  442   SEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S +D  AV++IA+EVG   GD  +VPVI    RC ++DI  AWEAVK+AK+PR+ T IAT
Sbjct  79    SNSDFMAVKMIAQEVGNAVGDDGYVPVIASFCRCVEKDIATAWEAVKYAKRPRLCTSIAT  138

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S IHM +KL+ S++QV++ A  MV +ARSLGC+D++F  EDA RSDREFLY+ILG VI+A
Sbjct  139   SPIHMEHKLRKSKDQVIQIARDMVKFARSLGCNDIQFGAEDATRSDREFLYEILGVVIEA  198

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATT+NI DTVG  +P E G+LI DIK NTPGI NVIISTHC NDLGL+TANT+ GA  G
Sbjct  199   GATTVNIADTVGIVMPLELGKLIVDIKDNTPGIANVIISTHCHNDLGLATANTIEGARTG  258

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGL  1155
             ARQLEVTINGIGERAGNASLEEVVM L  +G+  L GLYT INT+ I+  SKMVEEY+G+
Sbjct  259   ARQLEVTINGIGERAGNASLEEVVMVLASKGDHALNGLYTRINTRHILETSKMVEEYSGM  318

Query  1156  HVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHA  1335
             H+QPHK +VGANAF H SGIHQDGMLKHK TYE ISPE+IG  R    GIVLGKLSG  A
Sbjct  319   HLQPHKPLVGANAFVHASGIHQDGMLKHKGTYETISPEEIGHKRTTRIGIVLGKLSGSQA  378

Query  1336  LQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQ  1515
             L+ ++ ELGY+++  E++ +F +FK++AE+KK VTD DL ALVS +    +  W+LG +Q
Sbjct  379   LRKRLEELGYDLKEDEVDSVFRQFKAMAEKKKVVTDVDLKALVSHKACHAESIWKLGGLQ  438

Query  1516  VTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTE  1695
             VTCG++GLSTATVKL++ DG  HVACS+G G VD+ YKA++LV K P  LL+YS+N+VTE
Sbjct  439   VTCGTIGLSTATVKLVNIDGSTHVACSIGIGAVDSTYKAINLVVKEPTKLLDYSLNSVTE  498

Query  1696  GIDAIASTRVLI-RE-DQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             GI    + RV+I RE +  S +  T  +   +F+G  A MDVV+S+ +AY+ ALNKLL +
Sbjct  499   GIGVNVTARVVICRENNHTSTYAFTEDANYPTFSGIAAEMDVVVSTAKAYLVALNKLLRW  558

Query  1870  Q  1872
             +
Sbjct  559   K  559



>ref|XP_002508720.1| 2-isopropylmalate synthase [Micromonas sp. RCC299]
 gb|ACO69978.1| 2-isopropylmalate synthase [Micromonas sp. RCC299]
Length=639

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/553 (63%), Positives = 421/553 (76%), Gaps = 17/553 (3%)
 Frame = +1

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
             A RPEYIPN+I D NYVR+FDTTLRDGEQSPGAT+T+KEKL +AR LA+LGVDIIEAGFP
Sbjct  61    APRPEYIPNKIDDLNYVRVFDTTLRDGEQSPGATLTSKEKLDIARNLAKLGVDIIEAGFP  120

Query  436   ASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
              +S  DLEAVR IA+ VG       +VPVICGL+R NK+DID AWE V+HAK+PRIHTFI
Sbjct  121   IASPDDLEAVRNIAKNVGNEVYPDGYVPVICGLSRANKKDIDAAWEGVRHAKRPRIHTFI  180

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IHM  KL+ + ++VV+ A   V YARSLGC DVEFSPEDAGRSD EFLY+IL  V+
Sbjct  181   ATSKIHMESKLRKTPDEVVQIAVDGVTYARSLGCEDVEFSPEDAGRSDPEFLYRILAAVV  240

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             +AGATTLNIPDTVG  +P EFG LIA IKAN PG    IISTHCQNDLGLSTAN+LAG  
Sbjct  241   EAGATTLNIPDTVGICLPEEFGALIAGIKANVPG--QYIISTHCQNDLGLSTANSLAGVA  298

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
              GARQ+E TINGIGERAGNASLEEV M++  RG++ + G  TGIN   I   SKMV EY+
Sbjct  299   NGARQVECTINGIGERAGNASLEEVAMSIWMRGQEKIFGARTGINPVYIYPCSKMVREYS  358

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRA-NESGIVLGKLSG  1326
             G+ VQPHKAIVGANAFAHESGIHQDGMLK+K TYEII+PE IG FR   + G+V+GK SG
Sbjct  359   GMAVQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPETIGYFRGEGDVGVVMGKHSG  418

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK-KVTDDDLIALVSDEVFQ---PQVF  1494
             RHAL++K+ +LG+ +EG EL ++F RFK VAE+K   V DD++IALV+    Q     V 
Sbjct  419   RHALKSKLKQLGFPLEGDELNEMFDRFKLVAEQKTGGVGDDEIIALVTSGAGQGDDTAVT  478

Query  1495  WRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEY  1674
             W+L +VQV CG++GL TATVK+   D    +  +VGTGPVDAAYKA+D + +V V L+EY
Sbjct  479   WKLDEVQVVCGTMGLPTATVKMTGPDAVTRINSAVGTGPVDAAYKAIDGLCRVKVDLVEY  538

Query  1675  SMNAVTEGIDAIASTRVLIR-EDQASIHGS-------TGGSANRSFNGTGAAMDVVISSV  1830
             ++NAV EGI+++A TRV IR +   ++ G+       TG    R+F  TGA  D+V+SS 
Sbjct  539   TVNAVVEGIESLAQTRVSIRAKSDQTMPGAMMKANVQTGNVEARTFMATGADSDIVVSSA  598

Query  1831  RAYVGALNKLLGF  1869
             RAYV ALN+++ F
Sbjct  599   RAYVAALNRMISF  611



>gb|KFM22835.1| 2-isopropylmalate synthase A [Auxenochlorella protothecoides]
Length=534

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/517 (63%), Positives = 404/517 (78%), Gaps = 10/517 (2%)
 Frame = +1

Query  196   RRPSFQSFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEK  375
             RR      SA + R    P  +RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEK
Sbjct  20    RRSLVTRASAGSAR----PQRKRPEYIPNRIDDPNYVRVFDTTLRDGEQSPGATLTSKEK  75

Query  376   LAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLARCNKRD  549
             + +A+QL +LGVD+IEAGFP +S  D EAVR IA EVG   + D +VP ICGL+R  + D
Sbjct  76    MEIAKQLQKLGVDVIEAGFPIASPDDFEAVRSIAMEVGNNVDADGYVPAICGLSRSREAD  135

Query  550   IDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFS  729
             +++AW+AV+HA+ PR+H F+ATS IHM +KL+M+ +QV+ +A   V + RSLGC D+EFS
Sbjct  136   LERAWDAVRHARHPRVHVFLATSPIHMEHKLRMTPDQVIRQAVESVKHLRSLGCKDIEFS  195

Query  730   PEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFG---QLIADIKANTPGIEN  900
             PEDA RS   FLY++L EVIKAGATTLNIPDT G+++P+EF     LI D++AN  G  +
Sbjct  196   PEDATRSHPTFLYEVLAEVIKAGATTLNIPDTTGWSLPHEFQVLRGLITDLRANVHGAND  255

Query  901   VIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVL  1080
             VI STHCQNDLGLSTAN+LAGA  GARQ+E TINGIGERAGNASLEE+VMA+  RGE+ L
Sbjct  256   VIFSTHCQNDLGLSTANSLAGAMGGARQVECTINGIGERAGNASLEEIVMAIALRGERQL  315

Query  1081  GGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEII  1260
             GGL+TGIN   I + SKMV +Y+G+ VQPHKAIVGANAFAHESGIHQDGMLK +DTYEI+
Sbjct  316   GGLWTGINPVHIAVTSKMVCDYSGMPVQPHKAIVGANAFAHESGIHQDGMLKSRDTYEIM  375

Query  1261  SPEDIGLFRANESGIVLGKLSGRHALQAKMLELGY-EIEGKELEDLFWRFKSVAERKKKV  1437
             +PE IGL RA+  G+VLGK SGRHAL  ++ ELGY ++  + + +LF RFK +A++KK +
Sbjct  376   TPESIGLARASGVGLVLGKHSGRHALSTRLAELGYGDLPAERVAELFRRFKDLADKKKDI  435

Query  1438  TDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVD  1617
              D+DL+ALV D V QP+  W LGD+QV CGS+GL TATVKLI  DG   VA  +GTGPVD
Sbjct  436   ADEDLLALVQDGVHQPEAVWALGDLQVVCGSMGLPTATVKLIGPDGLPRVAAGMGTGPVD  495

Query  1618  AAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVL  1728
             AAYKA+D + +VP  L++YSMN VTEGI+A+A TRV+
Sbjct  496   AAYKAIDSLVRVPARLVDYSMNGVTEGIEALAVTRVI  532



>ref|XP_008392601.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Malus 
domestica]
Length=474

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/401 (78%), Positives = 356/401 (89%), Gaps = 2/401 (0%)
 Frame = +1

Query  235   RCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVD  414
             + ++  P RRP+YIPNRI DPNYVRIFDTTLRDGEQSPGA++T+ EKL +ARQLA+LGVD
Sbjct  69    QTDNPKPTRRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSXEKLDIARQLAKLGVD  128

Query  415   IIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKK  588
             IIEAGFPASS+ D EAV++IA+EVG    +  +VPVICGL+RCNK DI  AW+AVK+AK+
Sbjct  129   IIEAGFPASSKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNKNDIQTAWDAVKYAKR  188

Query  589   PRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  768
             PRIHTFIATS IH+ YKL+ S+EQV+E A +MV +AR LGC DVEFSPEDAGRS+REFLY
Sbjct  189   PRIHTFIATSPIHLEYKLRKSKEQVIEIARNMVKFARELGCDDVEFSPEDAGRSEREFLY  248

Query  769   QILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  948
             QILGEVIKAGATTLNIPDTVGY +P E+ QLIADIK+NTPGI+NVIISTHCQNDLGLSTA
Sbjct  249   QILGEVIKAGATTLNIPDTVGYNVPEEYRQLIADIKSNTPGIDNVIISTHCQNDLGLSTA  308

Query  949   NTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMAS  1128
             NTLAGACAGARQLEVTINGIGERAGNASLEEVV+ L CRGE VLGGLYTGINT+ I + S
Sbjct  309   NTLAGACAGARQLEVTINGIGERAGNASLEEVVLTLNCRGEXVLGGLYTGINTKHIYVTS  368

Query  1129  KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIV  1308
             KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIG  R+NE+GIV
Sbjct  369   KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIV  428

Query  1309  LGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             LGKLSGRHAL+ ++ ELGYE+E  +L  +F RFK+VAE+KK
Sbjct  429   LGKLSGRHALRNRLAELGYELENDQLATIFERFKAVAEQKK  469



>ref|WP_013558760.1| 2-isopropylmalate synthase [Anaerolinea thermophila]
 ref|YP_004172963.1| 2-isopropylmalate synthase [Anaerolinea thermophila UNI-1]
 dbj|BAJ62363.1| 2-isopropylmalate synthase [Anaerolinea thermophila UNI-1]
Length=541

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/528 (63%), Positives = 408/528 (77%), Gaps = 9/528 (2%)
 Frame = +1

Query  289   LDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVR  468
             +  +YVRIFDTTLRDGEQSPGAT+T+ EKL VAR LARLGVD+IEAGFPA+S  DLEAVR
Sbjct  1     MSQDYVRIFDTTLRDGEQSPGATLTSAEKLEVARGLARLGVDVIEAGFPAASPDDLEAVR  60

Query  469   LIAEEVGR-GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLK  645
              IA EVG   +G H P+ICGLAR  + DIDKAWEAV+ A+ PRIHTF+ATSEIHM YKL+
Sbjct  61    RIAVEVGNPADGGHAPIICGLARATRSDIDKAWEAVRPARHPRIHTFLATSEIHMQYKLR  120

Query  646   MSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDT  825
             M+R+QV+E+   MV+YARSL C DVEFSPEDAGRSD  FLY++LG  I+AGATTLNIPDT
Sbjct  121   MTRQQVLERVEEMVSYARSL-CEDVEFSPEDAGRSDPAFLYEVLGVAIRAGATTLNIPDT  179

Query  826   VGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTING  1005
             VGYT P+EFG LIA I  +TPGIE+ I+S HC NDLGL+TANTLAG  AGARQ EVTING
Sbjct  180   VGYTTPDEFGALIAGILRHTPGIEHCIVSVHCHNDLGLATANTLAGLRAGARQAEVTING  239

Query  1006  IGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVG  1185
             IGERAGN +LEEVVMAL  R    L GL TGI+T QI   SK+V  YTG+ VQP+KAIVG
Sbjct  240   IGERAGNTALEEVVMALHTRPN--LYGLRTGIDTTQITRLSKLVSNYTGMPVQPNKAIVG  297

Query  1186  ANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGY  1365
             ANAFAHE+GIHQDGMLKH  TYEI+ PE +G   A +S +VLGK SGRHAL+ ++  LGY
Sbjct  298   ANAFAHEAGIHQDGMLKHTLTYEIMRPETVG---ATQSKLVLGKHSGRHALKTRLASLGY  354

Query  1366  EIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLST  1545
              +   E++ +F RFK++A+RKK +TD DL ALVSDE++QP+  + L  +QV CG++G+ T
Sbjct  355   ALGEDEMDQVFERFKNLADRKKVITDADLEALVSDELYQPRELYALDGLQVACGTMGMPT  414

Query  1546  ATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRV  1725
             ATV+L   DG+ HV  +VGTGPVDA YKA+D +  VP+TLLE+ ++AVTEGIDA+    V
Sbjct  415   ATVRLRGPDGQLHVHAAVGTGPVDATYKAIDAIVGVPITLLEFVVHAVTEGIDALGEVTV  474

Query  1726  LIREDQ--ASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
              I+ +   +S+         R+F G GA  D+V++S +AY+ ALNKLL
Sbjct  475   RIQGEDGLSSVSAQREDDLPRTFGGYGADTDIVVASAKAYLAALNKLL  522



>gb|ACJ85684.1| unknown [Medicago truncatula]
Length=416

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 366/417 (88%), Gaps = 3/417 (1%)
 Frame = +1

Query  628   MNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATT  807
             M +KL+MS++QV++KA +MVA+ARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATT
Sbjct  1     MEFKLRMSKQQVIDKARTMVAFARSLGCQDVEFSPEDAGRSDREFLYQILGEVIKAGATT  60

Query  808   LNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQL  987
             LNIPDTVG T+P+EFG+LIADIKANTPG+ENVIISTHCQNDLGLSTANT+ GA AGARQL
Sbjct  61    LNIPDTVGITMPSEFGKLIADIKANTPGVENVIISTHCQNDLGLSTANTIEGARAGARQL  120

Query  988   EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQP  1167
             EVTINGIGERAGNASLEEVVMALKC G  +   L+TGINT+ I + S+MVEEY+GL +QP
Sbjct  121   EVTINGIGERAGNASLEEVVMALKCGG-HIFNNLFTGINTRHIYLTSRMVEEYSGLQLQP  179

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             HKA+VGANAFAHESGIHQDGMLKHK TYEIISPEDIGL  +NE+GIVLGKLSGRHA++ +
Sbjct  180   HKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLEGSNEAGIVLGKLSGRHAMRKR  239

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELGYE++  ++E LFWRFK+VAE+KK++TD DL ALVSDEVFQ +  W+L D+QVTCG
Sbjct  240   LEELGYELKDDQVESLFWRFKAVAEQKKRITDADLRALVSDEVFQAEPIWKLDDLQVTCG  299

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +LGLSTATVKL+  DG  H+ACSVGTGPVD+AYKAVDL+ K P TLLEYSM AVTEGIDA
Sbjct  300   TLGLSTATVKLVGDDGSAHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMIAVTEGIDA  359

Query  1708  IASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             IA+TRV+IR   DQ S H  TG S  R+F+GTGA MDVV+SSV+AY+ A+NK+L F+
Sbjct  360   IATTRVVIRGDTDQTSTHALTGESVQRTFSGTGAGMDVVVSSVKAYIAAINKMLSFK  416



>ref|XP_008342849.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Malus 
domestica]
Length=469

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/428 (74%), Positives = 365/428 (85%), Gaps = 9/428 (2%)
 Frame = +1

Query  163   KQLRFSISGASRRPSFQSFSAAAVRC---ESSPPARRPEYIPNRILDPNYVRIFDTTLRD  333
             K  +F +S    RP+  +     + C   ++  P  RP+YIPNRI DPNYVRIFDTTLRD
Sbjct  41    KMPKFLVS----RPNLHNTCNPHILCSQTDNPKPTPRPDYIPNRISDPNYVRIFDTTLRD  96

Query  334   GEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDH  507
             GEQSPGA++T+KEKL +AR+LA+LGVDIIEAGFPASS+ D EAV++IA+EVG    +  +
Sbjct  97    GEQSPGASLTSKEKLDIARKLAKLGVDIIEAGFPASSKDDAEAVKMIAKEVGNAVDKDGY  156

Query  508   VPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMV  687
             VPVICGL+RCN+ DI  AW+AVK+AK+PRIHTFIATS IH+ YKL+ ++EQV+E A +MV
Sbjct  157   VPVICGLSRCNRXDIQTAWDAVKYAKRPRIHTFIATSPIHLEYKLRKTKEQVIEIARNMV  216

Query  688   AYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIA  867
              +AR LGC DVEFSPEDAGRS+REFLYQILGEVIKAGATTLNIPDTVGY +P+E+ QLIA
Sbjct  217   KFARELGCDDVEFSPEDAGRSEREFLYQILGEVIKAGATTLNIPDTVGYNVPDEYSQLIA  276

Query  868   DIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVV  1047
             DIK+NTPGI+N IISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVV
Sbjct  277   DIKSNTPGIDNXIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVV  336

Query  1048  MALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDG  1227
             M L CRGE VLGGLYTGINT+ I + SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDG
Sbjct  337   MTLNCRGEHVLGGLYTGINTKHIYVTSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDG  396

Query  1228  MLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRF  1407
             MLKHK TYEIISPEDIG  R+NE+GIVLGKLSGRHAL+ ++ ELGYE+E  +L  +F  F
Sbjct  397   MLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHALRNRLAELGYELEDDQLATVFEHF  456

Query  1408  KSVAERKK  1431
             K+VAE+KK
Sbjct  457   KAVAEQKK  464



>gb|EPS60107.1| hypothetical protein M569_14697, partial [Genlisea aurea]
Length=385

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/379 (84%), Positives = 347/379 (92%), Gaps = 4/379 (1%)
 Frame = +1

Query  745   RSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQ  924
             RSDR FLY+IL EVI AGATTLNIPDTVGYT+P+EFGQLIADIKANTPGIENVIISTHCQ
Sbjct  1     RSDRTFLYKILAEVIAAGATTLNIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTHCQ  60

Query  925   NDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIN  1104
             NDLGLSTANT+AGA AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQ L GLYTGIN
Sbjct  61    NDLGLSTANTIAGAHAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQALDGLYTGIN  120

Query  1105  TQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLF  1284
             T+ I+MASKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEIISPED+GL 
Sbjct  121   TKHIVMASKMVEEYSGLRVQPHKAIVGANAFAHESGIHQDGMLKNKSTYEIISPEDVGLT  180

Query  1285  RANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV  1464
             R+NESGIVLGKLSGRHAL+AKMLELGY+I+GKEL+DLF RFK VA  KK +TDDDL+ALV
Sbjct  181   RSNESGIVLGKLSGRHALKAKMLELGYDIDGKELDDLFTRFKDVAGNKKIITDDDLVALV  240

Query  1465  SDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLV  1644
             SDEVFQP V W+L  VQVTCG+LGLSTATVKL+DA+G+EHV+CSVGTGPVDAAYKAVDLV
Sbjct  241   SDEVFQPTVVWKLEAVQVTCGTLGLSTATVKLVDANGKEHVSCSVGTGPVDAAYKAVDLV  300

Query  1645  TKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQASI----HGSTGGSANRSFNGTGAAMD  1812
              KVPVTLLEY+MN+VT+GIDAIASTRVLIR D  S+    H  TG   NR+F+GTGAAMD
Sbjct  301   VKVPVTLLEYTMNSVTQGIDAIASTRVLIRGDGNSVTETTHALTGEPVNRAFSGTGAAMD  360

Query  1813  VVISSVRAYVGALNKLLGF  1869
             +VISSVRAYVGALNKL+GF
Sbjct  361   IVISSVRAYVGALNKLIGF  379



>ref|XP_001415634.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93926.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=624

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/549 (61%), Positives = 408/549 (74%), Gaps = 14/549 (3%)
 Frame = +1

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
             A RP Y+P  I DP YVR+FDTTLRDGEQSPGAT+T+KEKL +A  LARLGVDIIEAGFP
Sbjct  60    APRPAYVPGVISDPKYVRVFDTTLRDGEQSPGATLTSKEKLDIATSLARLGVDIIEAGFP  119

Query  436   ASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
              +S  DLEAVR IA++VG    E  +VPVICGL+R NK+DID AWE V+HA +PRIHTFI
Sbjct  120   IASPDDLEAVRGIAKKVGNEVYEDGYVPVICGLSRANKKDIDAAWEGVRHALRPRIHTFI  179

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS IHM  KL+ + ++VV  A   V YARSLGC DVEFSPEDAGRSD EFLY+IL  V+
Sbjct  180   ATSPIHMESKLRKTPDEVVAIAVEAVKYARSLGCDDVEFSPEDAGRSDPEFLYRILSAVV  239

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             +AGATTLNIPDTVG  +P+EFGQLIA IKAN  GIE  +ISTHCQNDLGLSTAN+LAG  
Sbjct  240   EAGATTLNIPDTVGICLPDEFGQLIAGIKANVKGIEGAVISTHCQNDLGLSTANSLAGVA  299

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
              GARQ+E TINGIGERAGNASLEEV M++  RG+  L G YTGIN   I   S+MV+ Y+
Sbjct  300   NGARQVECTINGIGERAGNASLEEVAMSIFMRGQSRLAGAYTGINPVYIYPTSQMVKNYS  359

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRA-NESGIVLGKLSG  1326
             G+ +QPHKAIVGANAFAHESGIHQDGMLK+K TYEII+PE IG FR  N+ G+V+GK SG
Sbjct  360   GMAIQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPEQIGYFRGENDVGVVMGKHSG  419

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERK-KKVTDDDLIALVSDEVFQPQVFWRL  1503
             RHAL +K+ +LG  +EG  L+++F RFK VAE K   V DD+L+A+V D        W L
Sbjct  420   RHALSSKLKQLGVPMEGDALDEVFNRFKLVAETKLGGVNDDELLAIVRDGESVQDPAWSL  479

Query  1504  GDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMN  1683
               VQV CG+ GL TATVK++  DG  H++  VGTGPVDAA+KA+D +  + V L EY + 
Sbjct  480   ETVQVVCGTTGLPTATVKMLAKDGTVHISAVVGTGPVDAAFKAIDALVGLDVVLTEYRVT  539

Query  1684  AVTEGIDAIASTRVLIR----------EDQASIHGSTGGSANRSFNGTGAAMDVVISSVR  1833
             AVT+GI+++A T + ++           D    +  TG +A RSF  TGA  D+V+SS R
Sbjct  540   AVTKGINSLAETTITVKPREGAEQKLGADVFKTNLQTGETAVRSFTATGADTDIVVSSAR  599

Query  1834  AYVGALNKL  1860
             AYV ALN++
Sbjct  600   AYVIALNRM  608



>ref|XP_003063010.1| 2-isopropylmalate synthase [Micromonas pusilla CCMP1545]
 gb|EEH52949.1| 2-isopropylmalate synthase [Micromonas pusilla CCMP1545]
Length=649

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/553 (61%), Positives = 417/553 (75%), Gaps = 17/553 (3%)
 Frame = +1

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
             A RPEY+P+RI DPNYVR+FDTTLRDGEQSPGAT+T+ EKL +AR LA+LGVDIIEAGFP
Sbjct  71    APRPEYVPSRIDDPNYVRVFDTTLRDGEQSPGATLTSSEKLDIARNLAKLGVDIIEAGFP  130

Query  436   ASSEADLEAVRLIAEEVG--RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
              +S  DLEAVR IA+ VG  R E  +VPVICGL+R NK+DID +WE V+HA +PRIHTFI
Sbjct  131   IASPDDLEAVRNIAKIVGNERFEDGYVPVICGLSRANKKDIDASWEGVRHAIRPRIHTFI  190

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IHM  KL+ + ++VV+ A   V YARSLGC DVEFSPEDAGRSD +FL++IL  V+
Sbjct  191   ATSKIHMESKLRKTPDEVVQIAVDAVKYARSLGCDDVEFSPEDAGRSDPKFLHRILTAVV  250

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
              AGATTLNIPDTVG  +P EFG LIA IK N PG    +ISTHCQNDLGLSTAN+LAG  
Sbjct  251   DAGATTLNIPDTVGVCLPEEFGTLIAGIKENVPG--EYVISTHCQNDLGLSTANSLAGVA  308

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQ--VLGGLYTGINTQQIIMASKMVEE  1143
              GARQ+E TINGIGERAGNASLEEV MA+  RG+    + G +TGIN   I   SKMV++
Sbjct  309   NGARQVECTINGIGERAGNASLEEVAMAIWLRGQDKTAIYGAFTGINPVYIYPCSKMVKD  368

Query  1144  YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANES-GIVLGKL  1320
             ++G+ VQPHKAIVGANAFAHESGIHQDGMLK+K TYEII+PE IG FR  +S G+V+GK 
Sbjct  369   FSGMSVQPHKAIVGANAFAHESGIHQDGMLKNKKTYEIIAPETIGYFRGEDSVGVVMGKH  428

Query  1321  SGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK-KVTDDDLIALVSDEVFQ-----  1482
             SGRHAL +K+ +LGY +EG  L+++F RFK VAE+K   V DD++IALV+ E  Q     
Sbjct  429   SGRHALSSKLKQLGYPLEGDALDEMFNRFKLVAEQKTGGVDDDEIIALVTCEGSQFAGDV  488

Query  1483  -PQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVD-LVTKVP  1656
                  W+L DVQV CG++GL TATVK+   DG   V   VG+GPVDA YKA+D +V    
Sbjct  489   DKSASWKLEDVQVVCGTMGLPTATVKMCGPDGMSRVRSEVGSGPVDATYKAIDGIVAAGK  548

Query  1657  VTLLEYSMNAVTEGIDAIASTRVLIRE-DQASIHGSTGGSAN-RSFNGTGAAMDVVISSV  1830
             V L+EYS+NAV EGI+++A TRV +R  D  ++   + G    R+F  +GA  D+V++S 
Sbjct  549   VELVEYSVNAVVEGIESLAETRVRVRPMDSVAMKAKSSGEMEARTFTASGADTDIVVASA  608

Query  1831  RAYVGALNKLLGF  1869
             RAYV A N+++GF
Sbjct  609   RAYVAATNRMIGF  621



>ref|XP_005851963.1| hypothetical protein CHLNCDRAFT_133663 [Chlorella variabilis]
 gb|EFN59861.1| hypothetical protein CHLNCDRAFT_133663 [Chlorella variabilis]
Length=564

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/555 (59%), Positives = 411/555 (74%), Gaps = 57/555 (10%)
 Frame = +1

Query  232   VRCESSPPARR--PEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARL  405
             VR  ++P  +R  PEY+PNRI DP+YVRIFDTTLRDGEQSPGAT+T+KEKL +A++L++L
Sbjct  30    VRATAAPQQQRARPEYVPNRIDDPDYVRIFDTTLRDGEQSPGATLTSKEKLEIAKKLSQL  89

Query  406   GVDIIEAGFPASSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKH  579
             GVDIIEAGFP +S  D EAVR IA +VG    D  +VPVICGL+R  ++D++ AWEAV+H
Sbjct  90    GVDIIEAGFPIASPDDFEAVRAIAMDVGNAVHDDGYVPVICGLSRTREKDLETAWEAVRH  149

Query  580   AKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  759
             AK PR+HTFIATSEIHM YKL+MS +QV+E A + V + RSLGCSD+EFSPEDAGRS+  
Sbjct  150   AKLPRVHTFIATSEIHMKYKLRMSPDQVIENAVNAVKHLRSLGCSDIEFSPEDAGRSEPA  209

Query  760   FLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGL  939
             FLY+IL EVIKAGATTLNIPDT G+T+P+EF  LI+ IKANTPG E VIISTHCQNDLGL
Sbjct  210   FLYEILAEVIKAGATTLNIPDTTGWTLPHEFQSLISKIKANTPGAEGVIISTHCQNDLGL  269

Query  940   STANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQII  1119
             STAN+LAGA  GARQ+E TINGIGERAGNASLEEVVMA+  RG+  +GGL+TG       
Sbjct  270   STANSLAGAMGGARQIECTINGIGERAGNASLEEVVMAIALRGKDQMGGLWTG-------  322

Query  1120  MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANES  1299
                               AIVGANAFAHESGIHQDGMLK++DTYEI+SPE IGL R + +
Sbjct  323   ---------------ARPAIVGANAFAHESGIHQDGMLKNRDTYEIMSPETIGLQRVDAA  367

Query  1300  GIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVF  1479
             GIVLGK SGR+AL  ++ +LG+++   +L D+F RFK++A+RKK ++D+D++ALV+DEV 
Sbjct  368   GIVLGKHSGRNALNTRLGQLGFQLPEDQLNDVFRRFKNLADRKKNISDEDVLALVNDEVH  427

Query  1480  QPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPV  1659
             QP V W L  +QV CGS+GL TAT                          A+D + +V  
Sbjct  428   QPTVVWVLEGLQVVCGSMGLPTAT--------------------------AIDSLVRVQA  461

Query  1660  TLLEYSMNAVTEGIDAIASTRVLIR-----EDQASIHGSTGGSANRSFNGTGAAMDVVIS  1824
              L++YS+N+VTEGI+A+A+TRV+IR      D+  +    GG   RSF+G+GA  D+V+S
Sbjct  462   ELVDYSVNSVTEGIEALANTRVVIRPAGKQADEGYVASYKGGRTQRSFSGSGADEDIVVS  521

Query  1825  SVRAYVGALNKLLGF  1869
             S RAYV ALNK++GF
Sbjct  522   SARAYVSALNKMIGF  536



>ref|XP_009768817.1| PREDICTED: 2-isopropylmalate synthase A-like [Nicotiana sylvestris]
Length=862

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/432 (73%), Positives = 375/432 (87%), Gaps = 3/432 (1%)
 Frame = +1

Query  496   EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKA  675
             E  +VP+ICGLAR +K+DI++AWEA+K+AKKP +H FIATS+IHM YKLKMSRE+ +E A
Sbjct  408   EEGYVPMICGLARSSKKDIERAWEALKYAKKPMLHMFIATSDIHMKYKLKMSREETLETA  467

Query  676   TSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFG  855
              SMVAYA++L   DV FS EDA RSDREFLY I GEVIKAGAT + +PDTVG  +P+E+ 
Sbjct  468   RSMVAYAKTL-FEDVRFSTEDASRSDREFLYHINGEVIKAGATVIGLPDTVGCNLPSEYA  526

Query  856   QLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASL  1035
             QLI+DIKANTPGI++V ISTHC NDLGL++ANTLAG CAGAR ++VTINGIGERAGNASL
Sbjct  527   QLISDIKANTPGIQDVNISTHCHNDLGLASANTLAGICAGARLVDVTINGIGERAGNASL  586

Query  1036  EEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGI  1215
             EE+VMALK RGEQVLGG+YTGINT+ I M SKMVEEY+GL +QPHKAIVGANAF+HESGI
Sbjct  587   EEIVMALKYRGEQVLGGIYTGINTKHIFMTSKMVEEYSGLKLQPHKAIVGANAFSHESGI  646

Query  1216  HQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDL  1395
             HQDG+LK++DTYE +S ED+G  RANE GI LGKLSGRHAL+AKM+E GY+ +GKEL+DL
Sbjct  647   HQDGVLKNRDTYEFVSLEDVGYRRANEYGISLGKLSGRHALKAKMVEFGYDFDGKELDDL  706

Query  1396  FWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADG  1575
             F RFKS+AERKKK+TDDDL ALVSDEVFQPQV W+LGDVQ+TCGS+G STA VKLID+DG
Sbjct  707   FHRFKSLAERKKKITDDDLRALVSDEVFQPQVSWQLGDVQITCGSVGRSTANVKLIDSDG  766

Query  1576  EEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQAS  1749
             +EH A SVGTGPVDAAYKAVDL+ KVPVTL+EYS+NA+TE I++ ASTRVL+R  +D AS
Sbjct  767   QEHTASSVGTGPVDAAYKAVDLIVKVPVTLVEYSVNAITERINSTASTRVLVRGDDDYAS  826

Query  1750  IHGSTGGSANRS  1785
              + S G + NR+
Sbjct  827   FNTSNGQTVNRT  838



>ref|XP_003074581.1| Putative 2-isopropylmalate synthase (ISS) [Ostreococcus tauri]
Length=586

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/553 (59%), Positives = 412/553 (75%), Gaps = 15/553 (3%)
 Frame = +1

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
             A RP Y+P  I DP YVR+FDTTLRDGEQSPGAT+T++EKL +A  LA+LGVD+IEAGFP
Sbjct  21    APRPAYVPGVISDPKYVRVFDTTLRDGEQSPGATLTSREKLDIATSLAKLGVDVIEAGFP  80

Query  436   ASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
              +S  DLEAVR IA++VG    E  +VPVICGL+R NK+DID AWE V+HA +PRIHTFI
Sbjct  81    IASPDDLEAVRGIAKKVGNEVYEDGYVPVICGLSRANKKDIDAAWEGVRHALRPRIHTFI  140

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IHM+YKL+ + ++VV+ A   V YARSLGC DVEFSPEDAGRSD +FLY+IL  V+
Sbjct  141   ATSQIHMDYKLRKTPDEVVQIAVDAVKYARSLGCEDVEFSPEDAGRSDPQFLYRILNAVV  200

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGI-ENVIISTHCQNDLGLSTANTLAGA  966
             +AGATTLNIPDTVG  +P+EFG LI  IK N  G  E V+ISTHCQNDLGLSTAN+LAG 
Sbjct  201   EAGATTLNIPDTVGICLPDEFGTLIKGIKENVKGAGETVVISTHCQNDLGLSTANSLAGV  260

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
               GARQ+E TINGIGERAGNASLEEV MA+  RG++ L G YTGIN   I  +S+MV+ +
Sbjct  261   ANGARQVECTINGIGERAGNASLEEVTMAIFMRGQERLMGAYTGINPVYIYPSSQMVKNF  320

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRA-NESGIVLGKLS  1323
             +G+ +QPHKAIVGANAFAHESGIHQDGMLK+K TYEII+PE IG FR  +E G+V+GK S
Sbjct  321   SGMAIQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPEQIGYFRGEDECGVVMGKHS  380

Query  1324  GRHALQAKMLELGYEIEGKELEDLFWRFKSVAERK-KKVTDDDLIALVSDEVFQPQVFWR  1500
             GRHAL +K+ +LG  +EG  L+++F RFK VAE K   V DD+L+A+V D        W 
Sbjct  381   GRHALSSKLKQLGVPMEGAALDEVFNRFKLVAETKLGGVNDDELLAIVRDGESVQDPAWS  440

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             L  VQV CG+ GL TATV++ + DG +H++  VGTGPVDAA+KA+D +  + V L EY +
Sbjct  441   LETVQVVCGTTGLPTATVRMNNRDGTQHISAVVGTGPVDAAFKAIDALVGLDVVLTEYRV  500

Query  1681  NAVTEGIDAIASTRVLIR----------EDQASIHGSTGGSANRSFNGTGAAMDVVISSV  1830
              AVT+GI+++A T + I+           D    +  TG    R+F  TGA  D+V+SS 
Sbjct  501   TAVTKGINSMAETTITIKPKEGVEQKLGTDVYKTNVQTGEKTMRAFTATGADTDIVVSSA  560

Query  1831  RAYVGALNKLLGF  1869
             RAYV ALN+++ +
Sbjct  561   RAYVIALNRMVEY  573



>gb|KCW87846.1| hypothetical protein EUGRSUZ_A00246 [Eucalyptus grandis]
Length=514

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/494 (67%), Positives = 384/494 (78%), Gaps = 44/494 (9%)
 Frame = +1

Query  394   LARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGDH--VPVICGLARCNKRDIDKAWE  567
             LA+L VDIIEAGFP +S  D  AV+ IA EVG     H  +PVICGL+RCN++DI  AW+
Sbjct  57    LAKLSVDIIEAGFPTASSYDFVAVKAIALEVGNAIDPHSYIPVICGLSRCNEKDILTAWD  116

Query  568   AVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  747
             AV+ A++PRIHTFIATS IHM YKLK S+++V++ A  MVA+A SLGC DVEFSPEDAGR
Sbjct  117   AVRFARRPRIHTFIATSGIHMQYKLKKSKQEVIDIARRMVAFAWSLGCDDVEFSPEDAGR  176

Query  748   SDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQN  927
             S+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIK NTPGIENVIISTHC N
Sbjct  177   SEREFLYEILGEVIKAGATTLNIPDTVGITMPEEFGKLIADIKVNTPGIENVIISTHCHN  236

Query  928   DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1107
             DLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVVMALKC+G  +LGGLYTGINT
Sbjct  237   DLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGGSILGGLYTGINT  296

Query  1108  QQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFR  1287
             + IIM SKMVE Y+ L+VQPHKAIVGANAFAHESGIHQDGMLKH  TYEIISP+DIG  R
Sbjct  297   RHIIMTSKMVEGYSDLYVQPHKAIVGANAFAHESGIHQDGMLKHTGTYEIISPDDIGHER  356

Query  1288  ANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
              NE GIVLGKL  RH                        F  VAE    +T+ D+ ALVS
Sbjct  357   TNEVGIVLGKL--RH------------------------FIIVAEHMFSITNADIRALVS  390

Query  1468  DEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVT  1647
             DE              V+CG+LGLSTATVKLI ADG+E +AC+VGTGPVD+AYKAVDL+ 
Sbjct  391   DE--------------VSCGTLGLSTATVKLISADGKELIACAVGTGPVDSAYKAVDLIV  436

Query  1648  KVPVTLLEYSMNAVTEGIDAIASTRVLIRE--DQASIHGSTGGSANRSFNGTGAAMDVVI  1821
             KVP  LLEYSM A TE IDAIA+T+VLIR+  +  S    TG + +++F+GTG++MD+ +
Sbjct  437   KVPAMLLEYSMAAFTEDIDAIATTQVLIRDKNNHMSTLALTGETIHQTFSGTGSSMDIAV  496

Query  1822  SSVRAYVGALNKLL  1863
             SSVRAY+GALNK+ 
Sbjct  497   SSVRAYIGALNKMF  510



>gb|KHN42168.1| Putative 2-isopropylmalate synthase [Glycine soja]
Length=510

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/506 (61%), Positives = 399/506 (79%), Gaps = 4/506 (1%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLA  531
             MT+ +KL +ARQLA+LGVD+IE GFP++S+ D  AV++IA+EVG   + D +VPVI  L 
Sbjct  1     MTSDQKLQIARQLAKLGVDVIEGGFPSASQEDFNAVKMIAQEVGNNCDADGYVPVIAALC  60

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN+RDI +AWEA+K+AK+PR+  FIA S IHM YKL  ++E+V++ AT M+ +AR LGC
Sbjct  61    RCNERDITRAWEALKYAKRPRLMPFIAVSPIHMEYKLNKTKEEVLQIATDMIKFARGLGC  120

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
             +D++F  EDA RSDREFLYQIL EVIKAGATTL I DTVG T+P E  +L+A IKAN PG
Sbjct  121   TDIQFCSEDAARSDREFLYQILEEVIKAGATTLGIGDTVGITMPFEIRELVAGIKANVPG  180

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
              ENVIIS HC NDLG +TANT+  A AGA QLEVTINGIGERAGNASLEEVVMALKCRG+
Sbjct  181   AENVIISIHCHNDLGHATANTIEAARAGAMQLEVTINGIGERAGNASLEEVVMALKCRGD  240

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
              VLGGLYTGINT+ ++  SKMVEE++G+++QPHKA+VG NAF HESG+HQ G+LKH+ TY
Sbjct  241   HVLGGLYTGINTRHLLKTSKMVEEFSGMYLQPHKAVVGDNAFLHESGVHQAGLLKHRGTY  300

Query  1252  EIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             EI+SPEDIG  ++N   +VLGKLSGR AL++++ ELGYE+  +E+E +F  FK++AE+KK
Sbjct  301   EILSPEDIGHEKSNGVNMVLGKLSGRQALKSRLKELGYELRDEEVESVFRNFKAIAEKKK  360

Query  1432  KVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGP  1611
             +VTD DL ALVSD+    +  W+LG +QVTCG++G STAT+KL+ +DG  HVACSVG GP
Sbjct  361   RVTDVDLKALVSDQASHAEPIWKLGGLQVTCGTMGSSTATIKLVTSDGSTHVACSVGVGP  420

Query  1612  VDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGSANRS  1785
             VD+AYKA++L+ K  V +LEYS + VT G DAIA+TRV+IR +  Q+      G     +
Sbjct  421   VDSAYKAINLIVKETVKVLEYSPSTVTGGTDAIATTRVVIRRENKQSPTPALNGNVIYPT  480

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLL  1863
             F+GTG  +D+V SSV AY+ ALNK+L
Sbjct  481   FSGTGEGVDIVTSSVEAYITALNKML  506



>emb|CEF96841.1| 2-isopropylmalate synthase, bacterial-type [Ostreococcus tauri]
Length=642

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/553 (59%), Positives = 412/553 (75%), Gaps = 15/553 (3%)
 Frame = +1

Query  256   ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFP  435
             A RP Y+P  I DP YVR+FDTTLRDGEQSPGAT+T++EKL +A  LA+LGVD+IEAGFP
Sbjct  77    APRPAYVPGVISDPKYVRVFDTTLRDGEQSPGATLTSREKLDIATSLAKLGVDVIEAGFP  136

Query  436   ASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
              +S  DLEAVR IA++VG    E  +VPVICGL+R NK+DID AWE V+HA +PRIHTFI
Sbjct  137   IASPDDLEAVRGIAKKVGNEVYEDGYVPVICGLSRANKKDIDAAWEGVRHALRPRIHTFI  196

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IHM+YKL+ + ++VV+ A   V YARSLGC DVEFSPEDAGRSD +FLY+IL  V+
Sbjct  197   ATSQIHMDYKLRKTPDEVVQIAVDAVKYARSLGCEDVEFSPEDAGRSDPQFLYRILNAVV  256

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGI-ENVIISTHCQNDLGLSTANTLAGA  966
             +AGATTLNIPDTVG  +P+EFG LI  IK N  G  E V+ISTHCQNDLGLSTAN+LAG 
Sbjct  257   EAGATTLNIPDTVGICLPDEFGTLIKGIKENVKGAGETVVISTHCQNDLGLSTANSLAGV  316

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
               GARQ+E TINGIGERAGNASLEEV MA+  RG++ L G YTGIN   I  +S+MV+ +
Sbjct  317   ANGARQVECTINGIGERAGNASLEEVTMAIFMRGQERLMGAYTGINPVYIYPSSQMVKNF  376

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRA-NESGIVLGKLS  1323
             +G+ +QPHKAIVGANAFAHESGIHQDGMLK+K TYEII+PE IG FR  +E G+V+GK S
Sbjct  377   SGMAIQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPEQIGYFRGEDECGVVMGKHS  436

Query  1324  GRHALQAKMLELGYEIEGKELEDLFWRFKSVAERK-KKVTDDDLIALVSDEVFQPQVFWR  1500
             GRHAL +K+ +LG  +EG  L+++F RFK VAE K   V DD+L+A+V D        W 
Sbjct  437   GRHALSSKLKQLGVPMEGAALDEVFNRFKLVAETKLGGVNDDELLAIVRDGESVQDPAWS  496

Query  1501  LGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSM  1680
             L  VQV CG+ GL TATV++ + DG +H++  VGTGPVDAA+KA+D +  + V L EY +
Sbjct  497   LETVQVVCGTTGLPTATVRMNNRDGTQHISAVVGTGPVDAAFKAIDALVGLDVVLTEYRV  556

Query  1681  NAVTEGIDAIASTRVLIR----------EDQASIHGSTGGSANRSFNGTGAAMDVVISSV  1830
              AVT+GI+++A T + I+           D    +  TG    R+F  TGA  D+V+SS 
Sbjct  557   TAVTKGINSMAETTITIKPKEGVEQKLGTDVYKTNVQTGEKTMRAFTATGADTDIVVSSA  616

Query  1831  RAYVGALNKLLGF  1869
             RAYV ALN+++ +
Sbjct  617   RAYVIALNRMVEY  629



>gb|KDO41316.1| hypothetical protein CISIN_1g0069691mg, partial [Citrus sinensis]
Length=393

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/391 (77%), Positives = 350/391 (90%), Gaps = 2/391 (1%)
 Frame = +1

Query  748   SDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQN  927
             SDR+FLY+ILGEVIK GATTLNIPDTVG T+P EFG+LIADIKANTPGIENV+ISTHCQN
Sbjct  1     SDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQN  60

Query  928   DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1107
             DLGLSTANT+AGACAGARQ+EVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT
Sbjct  61    DLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINT  120

Query  1108  QQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFR  1287
             + I+MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R
Sbjct  121   RHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLER  180

Query  1288  ANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
             ++E+GIVLGKLSGRHAL+ ++ ELGYE+  ++L  +FW FK+VAE+KK+VTD DLIALVS
Sbjct  181   SSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVS  240

Query  1468  DEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVT  1647
             DE+FQP+V W+L D+QVTCG+LGLSTATVKL+DA+GEEHVACS GTGPVD+AYKAVDL+ 
Sbjct  241   DEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIV  300

Query  1648  KVPVTLLEYSMNAVTEGIDAIASTRVLIR--EDQASIHGSTGGSANRSFNGTGAAMDVVI  1821
             K P TLLEYSMNAVT GIDAIA+TRVLIR  + Q S H STG +  R+F+GTGA MD+V+
Sbjct  301   KEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVV  360

Query  1822  SSVRAYVGALNKLLGFQNLVSRYNKTQGTVV  1914
             SSV+AY+GALNK+LGF++ +   +  + T V
Sbjct  361   SSVKAYIGALNKMLGFKDQLPAKDSVERTSV  391



>ref|XP_002178632.1| 2-isopropylmalate synthase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50297.1| 2-isopropylmalate synthase [Phaeodactylum tricornutum CCAP 1055/1]
Length=663

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/573 (58%), Positives = 415/573 (72%), Gaps = 23/573 (4%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP YIP +I DP+YVRIFDTTLRDGEQSPGAT+T+ EKL +A+ LA+LGVD+IEAGFP +
Sbjct  76    RPAYIPGKIDDPDYVRIFDTTLRDGEQSPGATLTSAEKLEIAQMLAKLGVDVIEAGFPIA  135

Query  442   SEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S  D  AV+ IA+ VG    E  +VPVICGL+R N++DI  AW+AVK AK PR+HTFIAT
Sbjct  136   SPDDFNAVKQIADIVGNDVFEDGYVPVICGLSRANQKDIQTAWDAVKGAKLPRVHTFIAT  195

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S+IHM  KL  + +QVVE A   V +A+SLGC+D+EFSPEDAGRSD  FLY+IL EVI A
Sbjct  196   SQIHMETKLNKTPDQVVEIAVEAVKFAKSLGCNDIEFSPEDAGRSDPVFLYRILSEVIVA  255

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATTLNIPDT G+ +P EFG LI  ++ N  G ENV+ STHCQNDLGL+TAN+L+GA  G
Sbjct  256   GATTLNIPDTTGWNMPWEFGDLIKQLRENVKGAENVVFSTHCQNDLGLATANSLSGALNG  315

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGG------LYTGINTQQIIMASKMV  1137
             ARQLE TINGIGERAGNASLEE+VM+L  +G     G      L+T +N   I   SKMV
Sbjct  316   ARQLECTINGIGERAGNASLEEIVMSLALKGATKFSGGPGTGKLFTAVNPVYITPTSKMV  375

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE---SGIV  1308
              EYTG+  QPHKAIVGANAF HESGIHQDGM+K+K TYEI++PE IGL R      +GIV
Sbjct  376   SEYTGMACQPHKAIVGANAFQHESGIHQDGMIKNKSTYEIMTPESIGLMRGESQSGAGIV  435

Query  1309  LGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK-KVTDDDLIALVSDEVFQP  1485
             LGK SGR+A+  ++ ELGY+++ ++L  +F RFK VAERKK  + D+DL ALVSD+    
Sbjct  436   LGKHSGRNAVGTRLRELGYDLDTEKLNAVFVRFKQVAERKKGGLEDEDLEALVSDQAGLS  495

Query  1486  QVFWRLGDVQVTCGSLGLSTATVKLIDADG-EEHVACSVGTGPVDAAYKAVDLVTKVPVT  1662
              + W +  +QV  G  G+ TATVK++  DG E +VAC+ GTGPVDA YKA+D +  V V 
Sbjct  496   NLLWEVTGLQVATGLSGIPTATVKMLGPDGLERYVACT-GTGPVDAVYKAIDQIMGVSVR  554

Query  1663  LLEYSMNAVTEGIDAIASTRVLIR------EDQASIHGSTGGSANRSFNGTGAAMDVVIS  1824
             L  Y +N+VTEGI+A+A+TRV+I        D  SIH  TG S NR F+G+G+  D++ S
Sbjct  555   LEAYQLNSVTEGIEAMATTRVVIAPLEGGPNDSISIHSQTGVSRNRKFSGSGSDTDIITS  614

Query  1825  SVRAYVGALNKLLGFQNLV---SRYNKTQGTVV  1914
             S RAYV ALNKLL +       +R  KT G+ V
Sbjct  615   SARAYVSALNKLLKWNARSREQAREEKTNGSGV  647



>ref|XP_002286323.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95964.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=658

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/555 (59%), Positives = 403/555 (73%), Gaps = 18/555 (3%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RPEYIP +I DP+YVRIFDTTLRDGEQSPGAT+T+ EKL +AR LA+LGVDIIEAGFP +
Sbjct  72    RPEYIPGKISDPDYVRIFDTTLRDGEQSPGATLTSSEKLEIARNLAKLGVDIIEAGFPIA  131

Query  442   SEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S  D   V+ IA+ VG    E  +VPVI GL+R N++DI +AW+AVK A +PRIHTFIAT
Sbjct  132   SPDDFNGVKQIADVVGNEVFEDGYVPVIAGLSRANEKDIARAWDAVKGAMRPRIHTFIAT  191

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             SEIHM  KL  + ++VVE A + V +A+ LGC D+EFSPEDAGRSD EFLY+ILG VI+A
Sbjct  192   SEIHMKSKLNKTPDEVVEIAVNAVTFAKGLGCDDIEFSPEDAGRSDPEFLYRILGRVIEA  251

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATTLNIPDT G+ +P EFG+LI  ++ N PG ENV+ STHCQNDLGL+TAN+L+GA  G
Sbjct  252   GATTLNIPDTTGWNMPWEFGELIKKLRENVPGAENVVFSTHCQNDLGLATANSLSGALNG  311

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRG-EQVLGG-----LYTGINTQQIIMASKMV  1137
             ARQLE TINGIGERAGNASLEEVVM+L  +G EQ  GG     LYT IN   I   SKMV
Sbjct  312   ARQLECTINGIGERAGNASLEEVVMSLALKGDEQFKGGPGTGKLYTAINPVYITPTSKMV  371

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE---SGIV  1308
              EYTG+  QPHKAIVGANAF HESGIHQDGM+K K TYEI++PE IGL R      +GIV
Sbjct  372   SEYTGMKCQPHKAIVGANAFQHESGIHQDGMIKDKSTYEIMTPESIGLMRGESQSGAGIV  431

Query  1309  LGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK-KVTDDDLIALVSDEVFQP  1485
             LGK SGR+A+  ++ E+GY+++  +L  +F RFK VAE+KK  + DDDL +LV D+    
Sbjct  432   LGKHSGRNAVGTRLREMGYDLDMDKLNAVFARFKEVAEKKKGGLDDDDLESLVMDQSQST  491

Query  1486  QVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTL  1665
                W++  +Q T G  G+ T+TVK++  DG E    + GTGPVDA YKA+D +  V V L
Sbjct  492   NELWKVTGLQTTTGISGIPTSTVKMMGPDGVERFVSATGTGPVDAVYKAIDQIMGVSVEL  551

Query  1666  LEYSMNAVTEGIDAIASTRVLI------REDQASIHGSTGGSANRSFNGTGAAMDVVISS  1827
               YSMN+V EGI+A+ASTRV+I        D   +   T     R F+G+G+  D++ SS
Sbjct  552   ESYSMNSVNEGIEALASTRVVIVPNANGPNDSVVMDAQTSQLRERKFSGSGSDTDIITSS  611

Query  1828  VRAYVGALNKLLGFQ  1872
              RAYV ALNKLL +Q
Sbjct  612   ARAYVSALNKLLTWQ  626



>ref|XP_007508841.1| 2-isopropylmalate synthase [Bathycoccus prasinos]
 emb|CCO19927.1| 2-isopropylmalate synthase [Bathycoccus prasinos]
Length=731

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/547 (59%), Positives = 407/547 (74%), Gaps = 14/547 (3%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RPEYIP +I DP YVR+FDTTLRDGEQSPGAT+T+ EK+ +A  LA+LGVDIIEAGFP +
Sbjct  160   RPEYIPGKIQDPRYVRVFDTTLRDGEQSPGATLTSTEKVQIATNLAKLGVDIIEAGFPIA  219

Query  442   SEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S  DLEAVR IA+ VG    E  +VPVICGL+R N++DI  AWE V+HA +PRIHTFIAT
Sbjct  220   SPDDLEAVRNIAKVVGNKVYEDGYVPVICGLSRANEKDIACAWEGVRHAVRPRIHTFIAT  279

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S IHM YKLK + ++VV  A   V +A+SLGC D+EFSPEDAGRS+ EFLY+IL  V+ A
Sbjct  280   SPIHMEYKLKKTPDEVVNIAVKAVKFAKSLGCEDIEFSPEDAGRSEPEFLYRILKAVVDA  339

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGI--ENVIISTHCQNDLGLSTANTLAGAC  969
             GATT+NIPDTVG+ +P+EFG+LI  IK N   +   + IISTHCQNDLGLSTAN+LAG  
Sbjct  340   GATTINIPDTVGFCLPDEFGRLIKGIKENVIDVSANDAIISTHCQNDLGLSTANSLAGIA  399

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
              GARQ+E TINGIGERAGNASLEE+ M++  RG+  L G Y G+N   I   S+MV EY+
Sbjct  400   NGARQVECTINGIGERAGNASLEEIAMSVIMRGQNQLNGAYMGVNPVYIYQTSRMVSEYS  459

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFR-ANESGIVLGKLSG  1326
             G+ VQPHKAIVGANAFAHESGIHQDGMLK+K TYEII+PE IG+FR  ++ G+V+GK SG
Sbjct  460   GMLVQPHKAIVGANAFAHESGIHQDGMLKNKSTYEIIAPETIGVFRDEDDCGVVMGKHSG  519

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK-KVTDDDLIALVSD--EVFQPQVFW  1497
             RHAL++K+ ++G  +   +L   F RFK VAE K   V+D +L+AL+ D  EV + + F+
Sbjct  520   RHALKSKLGQMGVTLADDQLNAFFDRFKLVAETKTGGVSDVELMALLRDEMEVEEGKEFY  579

Query  1498  RLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYS  1677
              L DVQV CG++GL TATVK+ID  G E ++  VGTGPVDA YKA+D V    V L EY+
Sbjct  580   TLVDVQVVCGTMGLPTATVKIID-QGTERISACVGTGPVDAVYKAIDAVVGKSVELTEYN  638

Query  1678  MNAVTEGIDAIASTRVLIREDQAS-----IHGSTGGSANRSFNGTGAAMDVVISSVRAYV  1842
             + AVT+GI+++A+TRV I+    S      +  T     R+F  TGA  D+V+SS RAY+
Sbjct  639   VKAVTQGIESLATTRVTIKPTDESTAETITNNQTEARGTRTFTATGADTDIVVSSARAYL  698

Query  1843  GALNKLL  1863
              ALN++L
Sbjct  699   SALNRML  705



>gb|KDO41315.1| hypothetical protein CISIN_1g0069691mg [Citrus sinensis]
Length=447

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/420 (73%), Positives = 350/420 (83%), Gaps = 27/420 (6%)
 Frame = +1

Query  91    VITPPESKYTCKYLPIHTIATSFSKQLRFSISGASRRPSFQSFSAAAVRCESSPP-----  255
             +++PP++K     L  H                 + +P F++  + ++  +  PP     
Sbjct  16    ILSPPKTKVNASQLFFHC---------------NNSKPFFKTTISCSL--QKPPPSLYPR  58

Query  256   --ARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAG  429
               A RPEYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKL +ARQLA+LGVDIIEAG
Sbjct  59    ITASRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAG  118

Query  430   FPASSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIH  600
             FPA+S+ D EAVR IA+EVG     E  +VPVICGL+RCN+RDI  AWEAVK+AK+PRIH
Sbjct  119   FPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIH  178

Query  601   TFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  780
             TFIATS IHM +KL+ +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILG
Sbjct  179   TFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILG  238

Query  781   EVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  960
             EVIK GATTLNIPDTVG T+P EFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+A
Sbjct  239   EVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIA  298

Query  961   GACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVE  1140
             GACAGARQ+EVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+ I+MASKMVE
Sbjct  299   GACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVE  358

Query  1141  EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIGL R++E+GIVLGKL
Sbjct  359   EYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKL  418



>ref|XP_009351137.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=422

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/378 (79%), Positives = 337/378 (89%), Gaps = 2/378 (1%)
 Frame = +1

Query  745   RSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQ  924
             RS+REFLYQILGEVIKAGATTLNIPDTVGY +P E+ QLIADIK+NTPGI+NVIISTHCQ
Sbjct  29    RSEREFLYQILGEVIKAGATTLNIPDTVGYNVPEEYSQLIADIKSNTPGIDNVIISTHCQ  88

Query  925   NDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIN  1104
             NDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVV+ L CRGE VLGGLYTGIN
Sbjct  89    NDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVLTLNCRGEHVLGGLYTGIN  148

Query  1105  TQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLF  1284
             T+ I + SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHK TYEIISPEDIG  
Sbjct  149   TKHIYVTSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYE  208

Query  1285  RANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV  1464
             R+NE+GIVLGKLSGRHAL+ ++ ELGYE+E  +L  +F RFK+VAE+KK +TD DL ALV
Sbjct  209   RSNEAGIVLGKLSGRHALRNRLAELGYELENDQLATIFERFKAVAEQKKSITDADLGALV  268

Query  1465  SDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLV  1644
              DEVFQP+V W+L D+QVTCG+LGLSTAT+KLIDADG EHVACSVGTGPVD+AYKAVDL+
Sbjct  269   RDEVFQPEVVWKLHDLQVTCGTLGLSTATIKLIDADGREHVACSVGTGPVDSAYKAVDLI  328

Query  1645  TKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQAS--IHGSTGGSANRSFNGTGAAMDVV  1818
              K PVTL+EYSMNAVTEGIDAIA+TRV+IR + +    H  TG S  R+F+G GA MD+V
Sbjct  329   VKEPVTLIEYSMNAVTEGIDAIATTRVVIRLENSHTVTHAQTGESVQRTFSGIGAGMDIV  388

Query  1819  ISSVRAYVGALNKLLGFQ  1872
             +SSV+AY+GALNK++GF+
Sbjct  389   VSSVKAYIGALNKMIGFK  406



>ref|WP_012236363.1| 2-isopropylmalate synthase [Sorangium cellulosum]
 ref|YP_001614373.1| 2-isopropylmalate synthase [Sorangium cellulosum So ce56]
 emb|CAN93893.1| 2-isopropylmalate synthase [Sorangium cellulosum So ce56]
Length=564

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/540 (58%), Positives = 396/540 (73%), Gaps = 13/540 (2%)
 Frame = +1

Query  265   PEYIPNRILDP-NYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             PE I N+ + P +YVRIFDTTLRDGEQSPGATMT+ EKL +A  LA+LGVD+IE GFPA+
Sbjct  2     PEMIANQAMPPSDYVRIFDTTLRDGEQSPGATMTSSEKLEIALALAKLGVDVIETGFPAA  61

Query  442   SEADLEAVRLIAEEVGRGE-----GDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             S  DL AV+ IAE VG            P+IC LAR  K DIDKAWE V  A  PRIHTF
Sbjct  62    SPDDLLAVQTIAERVGAAAVPGRPAPTPPIICALARATKVDIDKAWEGVARAAHPRIHTF  121

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             +ATS+IH+ +KL+M+R +V+++  +MVAYAR L C+DVEFSPEDAGRS+ EFLYQ+L   
Sbjct  122   LATSDIHLKHKLRMTRAEVLDRVRAMVAYARDL-CADVEFSPEDAGRSEPEFLYQVLEAA  180

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             I AGATTLNIPDTVGYTIP+EFG LIA I+ N  GI+  I+S HC NDLGL+TAN L G 
Sbjct  181   IAAGATTLNIPDTVGYTIPSEFGALIAGIRKNVAGIDRAIVSVHCHNDLGLATANALEGI  240

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
              AGARQ EVTINGIGERAGN +LEE+VMAL  R  + + GL TGI+T QI   S++V   
Sbjct  241   RAGARQAEVTINGIGERAGNTALEEIVMALATR--RAVFGLRTGIDTTQIATVSRLVSAA  298

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             TG +VQP+KAIVGANAFAHESGIHQDGMLKH++TYEI+ PE +G+    ++ +VLGK SG
Sbjct  299   TGFNVQPNKAIVGANAFAHESGIHQDGMLKHQETYEIMRPEMVGV---TQTRLVLGKHSG  355

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             RHAL+ ++ ELGY ++  +L   F  FK++A++KK VTD D+ A+VS    Q    + L 
Sbjct  356   RHALRNRLEELGYHLDEAQLAAAFASFKALADKKKHVTDPDIEAIVSTTRAQADDLYTLD  415

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNA  1686
              +QV CG+ G+ TATV+L   DG  HV  ++GTGPVDAAY+A+D + +VP +LLE+S++A
Sbjct  416   ALQVACGTTGMPTATVRLRGPDGALHVRAAIGTGPVDAAYRAIDEIVRVPSSLLEFSVHA  475

Query  1687  VTEGIDAIASTRVLIRED-QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             VTEGIDA+    V +R D  +S       +A R F+G GA  D++++S +AY+ ALN+LL
Sbjct  476   VTEGIDALGEVSVRVRADATSSKRHPQHDAAARVFHGHGADTDILVASAKAYLTALNRLL  535



>gb|KFK41842.1| hypothetical protein AALP_AA2G178400 [Arabis alpina]
Length=552

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/399 (74%), Positives = 343/399 (86%), Gaps = 19/399 (5%)
 Frame = +1

Query  682   MVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQL  861
             MVA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA TLNIPDTVG T+P+EFGQL
Sbjct  1     MVAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGAITLNIPDTVGITLPSEFGQL  60

Query  862   IADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEE  1041
             IADIKANT GI+NVIISTHCQNDLGLSTANTL+GA +GARQ+EVTINGIGERAGNASLEE
Sbjct  61    IADIKANTHGIQNVIISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEE  120

Query  1042  VVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQ  1221
             VVMA+KCRG+ VLGGL+TGI+T+ I+M SKMVEEYTG+  QPHKAIVGANAFAHESGIHQ
Sbjct  121   VVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQ  180

Query  1222  DGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFW  1401
             DGMLKHK TYEI+ PE+IGL R+NE+GI                 LGYE++  +L +LFW
Sbjct  181   DGMLKHKGTYEIMCPEEIGLERSNEAGI-----------------LGYELDDVQLSNLFW  223

Query  1402  RFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEE  1581
             RFKSVA++KK+VTD DLIALVSDEVFQP+  W L D+Q+TCG+LGLST+TVKL + DG+E
Sbjct  224   RFKSVADQKKRVTDADLIALVSDEVFQPEAVWTLLDMQITCGTLGLSTSTVKLANFDGKE  283

Query  1582  HVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIREDQ--ASIH  1755
             HVACS+GTGPVDAAYKAVDL+ K P TLLEYSMN VTEGIDAI +TRVLIR D   +S +
Sbjct  284   HVACSIGTGPVDAAYKAVDLIVKEPTTLLEYSMNGVTEGIDAITTTRVLIRGDNNYSSTN  343

Query  1756  GSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
               TG S  R+F+GTGA MDVV+SSV+AYVGALNK+LGF+
Sbjct  344   AVTGESVQRTFSGTGAGMDVVVSSVKAYVGALNKMLGFK  382



>ref|XP_007142640.1| hypothetical protein PHAVU_007G004600g [Phaseolus vulgaris]
 gb|ESW14634.1| hypothetical protein PHAVU_007G004600g [Phaseolus vulgaris]
Length=435

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/394 (76%), Positives = 339/394 (86%), Gaps = 8/394 (2%)
 Frame = +1

Query  169   LRFSISGASRRPSFQSFSAAAVRCESSPPA--RRPEYIPNRILDPNYVRIFDTTLRDGEQ  342
             LRF  + + R  S Q  S  AV C +S P+  RRP Y+PNRI DP+YVRIFDTTLRDGEQ
Sbjct  31    LRFPQT-SLRHSSLQFKSRFAVSCCASEPSLRRRPPYVPNRIADPSYVRIFDTTLRDGEQ  89

Query  343   SPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGD--HVPV  516
             SPGA+MT+KEKL VARQLA+LGVDIIEAGFPA+S+ D EAV+ IA EVG    D  +VPV
Sbjct  90    SPGASMTSKEKLDVARQLAKLGVDIIEAGFPAASKDDFEAVKAIASEVGNAVDDDGYVPV  149

Query  517   ICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYA  696
             ICGL+RCN+ DI +AWEAVK+AK+PRIHTFIATS IHM YKL+MS+E+V++ A SMV +A
Sbjct  150   ICGLSRCNENDIRRAWEAVKYAKRPRIHTFIATSAIHMEYKLRMSKEKVIDTARSMVKFA  209

Query  697   RSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIK  876
             RSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGATTLNIPDTVG  +P+EFG+LIADIK
Sbjct  210   RSLGCEDVEFSPEDAGRSDREFLYEILGEVIKAGATTLNIPDTVGINLPSEFGRLIADIK  269

Query  877   ANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMAL  1056
             ANTPGIENV+ISTHCQNDLGLSTANT+ GA AGARQLEVTINGIGERAGNASLEEVVMAL
Sbjct  270   ANTPGIENVVISTHCQNDLGLSTANTIEGARAGARQLEVTINGIGERAGNASLEEVVMAL  329

Query  1057  KCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLK  1236
             +C G  V G LYTGINT+ I + SKMVEEYTGL +QPHKA+VGANAFAHESGIHQDGMLK
Sbjct  330   RC-GAHVTGNLYTGINTKHIFLTSKMVEEYTGLQLQPHKALVGANAFAHESGIHQDGMLK  388

Query  1237  HKDTYEIISPEDIGLFRANESGIVLGKLSGRHAL  1338
             HK TYEII+PEDIGL R NE+GIVLGKL  R+A+
Sbjct  389   HKGTYEIIAPEDIGLERTNEAGIVLGKL--RYAI  420



>ref|WP_020736424.1| 2-isopropylmalate synthase [Sorangium cellulosum]
 ref|YP_008150901.1| 2-isopropylmalate synthase [Sorangium cellulosum So0157-2]
 gb|AGP37014.1| 2-isopropylmalate synthase [Sorangium cellulosum So0157-2]
Length=558

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/528 (58%), Positives = 391/528 (74%), Gaps = 12/528 (2%)
 Frame = +1

Query  298   NYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIA  477
             +YVRIFDTTLRDGEQSPGATMT+ EKL +A  LA+LGVD+IE GFPA+S  DL AV+ IA
Sbjct  5     DYVRIFDTTLRDGEQSPGATMTSSEKLEIALALAKLGVDVIETGFPAASPDDLLAVQTIA  64

Query  478   EEVGRGE-----GDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKL  642
             E VG            P+IC LAR  K DIDKAWE V  A  PRIHTF+ATS+IH+ +KL
Sbjct  65    ERVGAAAVPGRPAATPPIICALARATKVDIDKAWEGVARAAHPRIHTFLATSDIHLKHKL  124

Query  643   KMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  822
             +M+R +V+++  +MVAYAR L C+DVEFSPEDAGRS+ EFLYQ+L   I AGATTLNIPD
Sbjct  125   RMTRPEVLDRVRAMVAYARDL-CADVEFSPEDAGRSEPEFLYQVLEAAIAAGATTLNIPD  183

Query  823   TVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTIN  1002
             TVGYT+P+EFG LIA I+ N PGI+  IIS HC NDLGL+TAN L G  AGARQ EVTIN
Sbjct  184   TVGYTMPSEFGALIAGIRKNVPGIDRAIISVHCHNDLGLATANALEGIRAGARQAEVTIN  243

Query  1003  GIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             GIGERAGN +LEEVVMAL  R  + + GL TGI+T QI   S++V   TG +VQP+KAIV
Sbjct  244   GIGERAGNTALEEVVMALATR--RAVFGLRTGIDTTQIATVSRLVSAATGFNVQPNKAIV  301

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDGMLKH+DTYEI+ PE +G+    ++ +VLGK SGRHAL+ ++ ELG
Sbjct  302   GANAFAHESGIHQDGMLKHQDTYEIMRPEMVGV---TQTRLVLGKHSGRHALRNRLEELG  358

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             Y ++  +L   F  FK++A++KK VTD D+ A+VS    Q    + L  +QV CG+ G+ 
Sbjct  359   YHLDEAQLAAAFASFKALADKKKHVTDPDIEAIVSTTRAQGDELYTLDALQVACGTTGMP  418

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV+L   DG  HV  ++GTGPVDAAY+A+D + +VP +LLE+S++AVTEGIDA+    
Sbjct  419   TATVRLRGPDGALHVRAAIGTGPVDAAYRAIDEIVRVPSSLLEFSVHAVTEGIDALGEVS  478

Query  1723  VLIRED-QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             V +R D  +S       +++R F+G GA  D++++S +AY+ ALN+LL
Sbjct  479   VRVRADATSSKRHPQHDASHRVFHGHGADTDILVASAKAYLTALNRLL  526



>gb|EJK57969.1| hypothetical protein THAOC_21945 [Thalassiosira oceanica]
Length=590

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/556 (57%), Positives = 398/556 (72%), Gaps = 35/556 (6%)
 Frame = +1

Query  130   LPIHTIATSFSKQLRF-----------SISGASRRPSFQSFSAAAVRCESSPPA------  258
             L   T A++FS Q  F           S S A+R P+  + S++     S+ PA      
Sbjct  9     LAFCTSASAFSTQSNFNGRAIIPSRVSSPSRAARGPTNTNLSSST----SADPAIAELYN  64

Query  259   --RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGF  432
                RPEYIP RI DP+YVRIFDTTLRDGEQSPGAT+T+ EKL +AR LA+LGVDIIEAGF
Sbjct  65    RKSRPEYIPGRIDDPDYVRIFDTTLRDGEQSPGATLTSSEKLDIARNLAKLGVDIIEAGF  124

Query  433   PASSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             P +S  D  AV+ IA+ VG    D  +VPVI GL+R N++DI +AW+AVK A +PRIHTF
Sbjct  125   PIASPDDFNAVKQIADVVGNEVYDDGYVPVIAGLSRANEKDIGRAWDAVKGAVRPRIHTF  184

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
             IATS+IHM  KL  + ++V+E A + V +A+SLGC D+EFSPEDAGRSD EFLY++LG+V
Sbjct  185   IATSDIHMKSKLNKTPDEVIEIAVNAVTFAKSLGCDDIEFSPEDAGRSDPEFLYRVLGKV  244

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             I+AGATTLNIPDT G+ +P EFG+LI  ++ N PG ENV+ STHCQNDLGL+TAN+L+GA
Sbjct  245   IEAGATTLNIPDTTGWNMPWEFGELIKKLRENVPGAENVVFSTHCQNDLGLATANSLSGA  304

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRG-EQVLGG-----LYTGINTQQIIMAS  1128
               GARQLE TINGIGERAGNASLEE+VM+L  +G EQ  GG     LYT +N   I   S
Sbjct  305   LNGARQLECTINGIGERAGNASLEEIVMSLALKGDEQFEGGPGSGKLYTAVNPVYITPTS  364

Query  1129  KMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE---S  1299
             KMV EYTG+  QPHKAIVGANAF HESGIHQDGM+K+K TYEI++PE IGL R +    +
Sbjct  365   KMVAEYTGMKCQPHKAIVGANAFQHESGIHQDGMIKNKSTYEIMTPESIGLMRGDSQSGA  424

Query  1300  GIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK-KVTDDDLIALVSDEV  1476
             GIVLGK SGR+A+  ++ ELGY+++ ++L  +F RFK VAE+KK  + DDDL +LVSD+ 
Sbjct  425   GIVLGKHSGRNAVGTRLRELGYDMDPEKLNAVFARFKEVAEKKKGGLDDDDLESLVSDQA  484

Query  1477  FQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVP  1656
                   WR+  +Q T G  G+ TATVK++  DG E    + GTGPVDA YKA+D +  V 
Sbjct  485   GSVNELWRVSGLQATTGLSGIPTATVKMVGPDGVERFVSATGTGPVDAVYKAIDQIMGVQ  544

Query  1657  VTLLEYSMNAVTEGID  1704
             V L  YSMNAV EGI+
Sbjct  545   VVLESYSMNAVNEGIE  560



>gb|KHN34617.1| Putative 2-isopropylmalate synthase [Glycine soja]
Length=482

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/509 (59%), Positives = 382/509 (75%), Gaps = 32/509 (6%)
 Frame = +1

Query  358   MTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG-EGD-HVPVICGLA  531
             M + +KL +ARQLA+LGVD+IE GFP++S+ D  AV++IA+EVG   + D +VPVI  L 
Sbjct  1     MVSSQKLRIARQLAKLGVDVIEGGFPSASQEDFNAVKMIAQEVGNNCDADGYVPVIAALC  60

Query  532   RCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGC  711
             RCN++DI  AWEA+K+AK+PR+  FIA S IHM YKL  ++E+V++ A  M+ +ARSLGC
Sbjct  61    RCNEKDIATAWEALKYAKRPRLMPFIAVSPIHMEYKLNKTKEEVLQIAKDMIKFARSLGC  120

Query  712   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPG  891
             SD++F  EDA RSDREFLYQIL EVIKAGATTL I DTVG T+P E  QLIADIKAN PG
Sbjct  121   SDIQFCSEDAARSDREFLYQILEEVIKAGATTLGIGDTVGITMPFEIRQLIADIKANVPG  180

Query  892   IENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGE  1071
              ENVIIS HC NDLG +TAN +  A AGA QLEVTINGIGERAGNASLEEVVMALKCRG+
Sbjct  181   AENVIISMHCHNDLGHATANAIEAAQAGAMQLEVTINGIGERAGNASLEEVVMALKCRGD  240

Query  1072  QVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1251
             QVLGGLYTGINT+ ++  SKMVEE++G+++QPHKA+VG NAF HESG+HQ G+LKH+ TY
Sbjct  241   QVLGGLYTGINTRHLLKTSKMVEEFSGMYLQPHKAVVGDNAFLHESGVHQAGLLKHRATY  300

Query  1252  EIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             EI+SPEDIG  +++   +VLGKLSGR AL++++ ELGYE+  +E+E +F  FK++AE+KK
Sbjct  301   EIMSPEDIGHEKSSGVNMVLGKLSGRQALKSRLKELGYELRDEEVESVFRNFKAIAEKKK  360

Query  1432  KVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGP  1611
                                         VTCG++G STAT+KL+ +DG  HVACSVG GP
Sbjct  361   ----------------------------VTCGTMGSSTATIKLVTSDGITHVACSVGVGP  392

Query  1612  VDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRED--QASIHGSTGGSANRS  1785
             VD+AYKA++L+ K  V +LEYS++ VTEG DAIA+TRV+IR +  Q+      G     +
Sbjct  393   VDSAYKAINLIVKETVKVLEYSLSTVTEGTDAIATTRVVIRRENKQSPTPALNGNVIYPT  452

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             F+GTG  +DVV SSV AY+ ALNK+L  +
Sbjct  453   FSGTGEGVDVVTSSVEAYLTALNKMLDLK  481



>ref|WP_026370668.1| 2-isopropylmalate synthase [bacterium JKG1]
Length=558

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/530 (59%), Positives = 383/530 (72%), Gaps = 18/530 (3%)
 Frame = +1

Query  298   NYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIA  477
             +YV+IFDTTLRDGEQSPGATMTT EKL VARQLARLGVDIIEAGFPA+S  D EAV LIA
Sbjct  3     DYVKIFDTTLRDGEQSPGATMTTPEKLEVARQLARLGVDIIEAGFPAASLGDWEAVHLIA  62

Query  478   EEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSRE  657
              EVG  +G   PVICGLAR N+ DI++ W A+K A KPRIHTFIATS+IH+ YKL+MSRE
Sbjct  63    REVGTPDG---PVICGLARANRNDIERCWTAIKPAAKPRIHTFIATSDIHLQYKLRMSRE  119

Query  658   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  837
             QV +    MV YARSL C+DVEFSPEDAGRSD +FLY++L   I+AGATTLNIPDTVGY 
Sbjct  120   QVKQIVREMVGYARSL-CADVEFSPEDAGRSDPQFLYEVLAIAIEAGATTLNIPDTVGYL  178

Query  838   IPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGER  1017
              P+E+G LI  I+   PG+E V ISTHC +DLGL+ AN+LAG   GARQ+E TINGIGER
Sbjct  179   TPDEYGALIRGIREAVPGVERVTISTHCHDDLGLAVANSLAGVRNGARQVECTINGIGER  238

Query  1018  AGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAF  1197
             AGNA+LEE+VMAL  R  Q    L TGI+T QI   S+MV   TGL VQP+KAIVGANAF
Sbjct  239   AGNAALEEIVMALHTR--QQFYHLRTGIDTTQIARTSRMVSAITGLPVQPNKAIVGANAF  296

Query  1198  AHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEG  1377
             +HESGIHQDGMLKH  TYEI+ PE IG     +S +VLGK SGRHA +  +  LGY++  
Sbjct  297   SHESGIHQDGMLKHHLTYEIMRPETIG----KDSVLVLGKHSGRHAFRKHLEHLGYQLSD  352

Query  1378  KELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVK  1557
              ELE  F RFK +A++KK V D D++AL+ D++ QP   W L  VQV+CG++ + TATV+
Sbjct  353   SELETAFQRFKDLADKKKVVDDRDIVALIDDQLHQPAPIWELEQVQVSCGNVAIPTATVR  412

Query  1558  LIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRE  1737
             L   DGE     + GTGPVDA YKA++ V   P  L E+S+ A+TEGIDA+    + I+E
Sbjct  413   LRGPDGEVRTDSAQGTGPVDAVYKAINRVIGQPNVLTEFSIKAITEGIDAVGDVTIRIQE  472

Query  1738  DQASIHGSTGG--------SANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
              + +     G         +  R++ G G   D+++++  AY+GALNKL+
Sbjct  473   PEPANGNGHGNGGAREQPEARARTYTGHGVHTDIIVAAAMAYMGALNKLI  522



>ref|XP_009039595.1| hypothetical protein AURANDRAFT_54528 [Aureococcus anophagefferens]
 gb|EGB05756.1| hypothetical protein AURANDRAFT_54528 [Aureococcus anophagefferens]
Length=609

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/566 (56%), Positives = 406/566 (72%), Gaps = 24/566 (4%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP YIP +I+DP YVRIFDTTLRDGEQSPGAT+T+ EKL +A+ L++LGVD+IEAGFP +
Sbjct  31    RPPYIPGKIVDPGYVRIFDTTLRDGEQSPGATLTSSEKLEIAKHLSKLGVDVIEAGFPIA  90

Query  442   SEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S  D EAVR IA+ VG    D  +VPVICGL+R N RDI++AW+AVK AK PR+HTFIAT
Sbjct  91    SPDDFEAVRQIAQIVGNEVDDSGYVPVICGLSRANARDIERAWDAVKSAKLPRLHTFIAT  150

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S IHM  KL  + ++VV+ A   V +ARSLGC D+EFSPEDAGRSD +FL +IL  V+ A
Sbjct  151   SNIHMETKLCKTPDEVVQIAVDAVKFARSLGCDDIEFSPEDAGRSDVDFLVRILEAVVDA  210

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPG-IENVIISTHCQNDLGLSTANTLAGACA  972
             GATTLNIPDT G+  P EFG+LIA ++      +E++I STHCQNDLGL++AN+LAGA  
Sbjct  211   GATTLNIPDTTGWNTPWEFGELIATLRRRLGARLEDIIFSTHCQNDLGLASANSLAGAYN  270

Query  973   GARQLEVTINGIGERAGNASLEEVVMALKCRG--EQVLGG---LYTGINTQQIIMASKMV  1137
             GARQ+E TINGIGERAGNA+LEE+ MAL  RG  E    G   L+TG++T  I   S+MV
Sbjct  271   GARQIECTINGIGERAGNAALEEIAMALCLRGTSEHAFAGGPRLWTGLDTTFITPCSRMV  330

Query  1138  EEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE---SGIV  1308
              EYTG+ +QPHKAIVGANAF HESGIHQDGM+K+K TYEI++PE +GL R      +GIV
Sbjct  331   AEYTGMAIQPHKAIVGANAFRHESGIHQDGMIKNKATYEIMTPESVGLPRGQAESGAGIV  390

Query  1309  LGKLSGRHALQAKMLELGY---EIEGKELEDLFWRFKSVAERKKKVTDDD-LIALVSDEV  1476
             LGK SGR+A+  +++ELGY     +  +L+ +F RFK VAERKK   DDD L ALVSDE 
Sbjct  391   LGKHSGRNAVSTRLVELGYGDIADDKLKLDAIFTRFKHVAERKKGGLDDDELEALVSDEA  450

Query  1477  FQPQ-VFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKV  1653
             +Q     W L   QVT GS  + T TV +   DG    A   G+GPVDA YKA+D +T V
Sbjct  451   YQNTCALWTLVGAQVTTGSGVIPTGTVTMQGPDGVIRHAALTGSGPVDAVYKAIDALTGV  510

Query  1654  PVTLLEYSMNAVTEGIDAIASTRVLIRE------DQASIHGSTGGSANRSFNGTGAAMDV  1815
              V L  Y + +V  GIDA+A+T+VLI+       + A++H  +G + N+ F+G+G+  D+
Sbjct  511   KVDLESYGLESVNSGIDAMATTKVLIKPRIGTQLESAAVHSQSGATTNKRFSGSGSDTDI  570

Query  1816  VISSVRAYVGALNKLLGFQNLVSRYN  1893
             V+SS RAY+ A+NKLL +   + RY+
Sbjct  571   VVSSARAYIAAVNKLLNWN--MHRYS  594



>ref|XP_009040112.1| hypothetical protein AURANDRAFT_38625 [Aureococcus anophagefferens]
 gb|EGB05211.1| hypothetical protein AURANDRAFT_38625 [Aureococcus anophagefferens]
Length=616

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/560 (57%), Positives = 397/560 (71%), Gaps = 24/560 (4%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP Y+P  I DP YVRIFDTTLRDGEQSPGAT+T+ EKL +A+QLA L VD+IEAGFP +
Sbjct  34    RPSYVPGEIADPGYVRIFDTTLRDGEQSPGATLTSSEKLDIAKQLANLQVDVIEAGFPIA  93

Query  442   SEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S  D  AV+ IA  VG    E  +VPVICGL+R N RDI+ AW+AVK A+ PR+HTFIAT
Sbjct  94    SPDDFNAVQQIARIVGNNVDEFGYVPVICGLSRANLRDIECAWDAVKSARLPRVHTFIAT  153

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S+IHM  KL  + ++V+  A   V +ARSLGC D+EFSPEDAGRSD  FL ++L  V+ A
Sbjct  154   SKIHMETKLCKTPDEVLRIAVDAVTFARSLGCDDIEFSPEDAGRSDVNFLVRVLEAVVDA  213

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGI--ENVIISTHCQNDLGLSTANTLAGAC  969
             GATTLNIPDT G+  P EFG+LIA ++A   GI  E V+ STHCQNDLGL++AN+LAGA 
Sbjct  214   GATTLNIPDTTGWNTPWEFGELIATLRARL-GIRAERVVFSTHCQNDLGLASANSLAGAY  272

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLG-----GLYTGINTQQIIMASKM  1134
              GARQ+E TINGIGERAGNA+LEEVVMAL  RG  V        L TGIN   I   S+M
Sbjct  273   RGARQIECTINGIGERAGNAALEEVVMALHLRGTSVAAFADGPHLRTGINPTFITPCSRM  332

Query  1135  VEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE---SGI  1305
             V EYTG+ +QPHKAIVGANAF HESGIHQDGM+K+K TYEI++PE IGL R      +GI
Sbjct  333   VSEYTGMAIQPHKAIVGANAFRHESGIHQDGMIKNKATYEIMTPESIGLARGQAESGAGI  392

Query  1306  VLGKLSGRHALQAKMLELGYE---IEGKELEDLFWRFKSVAERKKKVTDDD-LIALVSDE  1473
             VLGK SGR+A+  +++ELGYE    +  +LE +F RFK VAERKK   DDD L AL+SDE
Sbjct  393   VLGKHSGRNAVSTRLIELGYENIVKDQSKLEAIFTRFKHVAERKKGGLDDDELEALISDE  452

Query  1474  VFQP-QVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTK  1650
              +Q  +  W L   QVT GS  + +ATV +   DG    +   G+GPVDA YKA+D +T 
Sbjct  453   AYQNLRALWTLIGAQVTTGSGVIPSATVSMQGPDGVTRHSAVTGSGPVDAVYKAIDTLTD  512

Query  1651  VPVTLLEYSMNAVTEGIDAIASTRVLIRE------DQASIHGSTGGSANRSFNGTGAAMD  1812
             V V L  YS+ +V  GIDA+A+T+V+I+       + A++H  +G + NR F+G+G   D
Sbjct  513   VKVNLETYSLESVNAGIDAMATTKVIIKPLTGTQLESAAVHSQSGATTNRRFSGSGTDTD  572

Query  1813  VVISSVRAYVGALNKLLGFQ  1872
             +VISS RAYV A+NKLL + 
Sbjct  573   IVISSARAYVAAVNKLLNWN  592



>ref|XP_010324707.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum lycopersicum]
Length=414

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 335/406 (83%), Gaps = 2/406 (0%)
 Frame = +1

Query  280   NRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLE  459
             N+  +PNYV IFDTTLRDGEQ+PGA MT K+K+ +ARQL +LGVD+IEAGFPASSE + E
Sbjct  8     NKFSNPNYVSIFDTTLRDGEQAPGAAMTAKQKMDIARQLVKLGVDVIEAGFPASSEVEFE  67

Query  460   AVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMN  633
              V+ IA E+G    E  +VP+ICG ARC K++I++ WEA+K+AK P I TFIATS+IHM 
Sbjct  68    LVKSIAHEIGNSIDEEGYVPMICGAARCTKKEIERCWEALKYAKIPMICTFIATSDIHMK  127

Query  634   YKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLN  813
             YKL MSREQVVEKATSMVAYAR+LGC  V F+ EDA RSD+EFL  I+GE+IKAGAT + 
Sbjct  128   YKLNMSREQVVEKATSMVAYARTLGCEHVRFAIEDATRSDKEFLCHIIGEIIKAGATCIC  187

Query  814   IPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEV  993
             + DTVG  +PNEFGQL+A +K NTPGI+NVI++ HC NDLGL+TANTLAG CAG RQ++V
Sbjct  188   LADTVGCNLPNEFGQLVAHVKVNTPGIQNVILAVHCHNDLGLATANTLAGICAGVRQVDV  247

Query  994   TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHK  1173
             TINGIGERAGNASLEE+VMA+KCRGE+VLGG++TGINT+ I   S MVEEY+GL +QPHK
Sbjct  248   TINGIGERAGNASLEEIVMAIKCRGEEVLGGVHTGINTKHIFTTSNMVEEYSGLKLQPHK  307

Query  1174  AIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKML  1353
             AIVG NAF+HESGIHQDG+LK++ TYE IS EDIG  R+ E GI LGKLSGRHAL+AKML
Sbjct  308   AIVGVNAFSHESGIHQDGILKNRSTYEFISAEDIGFIRSTEHGIKLGKLSGRHALKAKML  367

Query  1354  ELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQV  1491
              LGY  + K LEDLFWRFKS+A  KK +TDDDL ALVS+E  Q Q+
Sbjct  368   LLGYNFDDKVLEDLFWRFKSMAGNKKNITDDDLRALVSNEDIQTQI  413



>ref|XP_006366147.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum tuberosum]
Length=418

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 332/406 (82%), Gaps = 2/406 (0%)
 Frame = +1

Query  280   NRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLE  459
             N+  DPNYV IFDTTLRDGEQ+PGA MT K+K+ +A QL +LGVD+IEAGFPASSE + E
Sbjct  12    NKFSDPNYVSIFDTTLRDGEQAPGAAMTAKQKMDIAHQLVKLGVDVIEAGFPASSEVEFE  71

Query  460   AVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMN  633
              V+ IA E+G    E  +VP+ICGLAR  K DID+AWE++K+AK P IH FI+TS+IHM 
Sbjct  72    LVKCIAHEIGNSIDEEGYVPMICGLARSTKEDIDRAWESLKYAKTPMIHMFISTSDIHMK  131

Query  634   YKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLN  813
             YKL MSREQVVE+A SMV YARSLG   V F  EDA RSD++FL  I+GE+IKAGAT + 
Sbjct  132   YKLNMSREQVVERARSMVTYARSLGFKHVRFGLEDATRSDKKFLCDIIGEIIKAGATCIC  191

Query  814   IPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEV  993
             + DTVG  +PNEFGQL+A +KANTPGI+NVI++ HC NDLGL+TANTLAG CAG  Q++V
Sbjct  192   LADTVGCNLPNEFGQLVAHVKANTPGIQNVILAVHCHNDLGLATANTLAGICAGVSQVDV  251

Query  994   TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHK  1173
             TINGIGERAGNASLEE+VMA+KCRGE+VLGG+YTGINT+ I   S MVEEY+GL +QPHK
Sbjct  252   TINGIGERAGNASLEEIVMAIKCRGEEVLGGVYTGINTKHIFTTSNMVEEYSGLKLQPHK  311

Query  1174  AIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKML  1353
             AIVG NAF+HESGIHQDG+LK++ TYE ISPEDIG  RA+E GI LGKLSGRHAL+AKML
Sbjct  312   AIVGVNAFSHESGIHQDGILKNRSTYEFISPEDIGFIRASEHGIKLGKLSGRHALKAKML  371

Query  1354  ELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQV  1491
              LGY  E K LEDLFWRFKS+A  KK +TDDDL AL+S+E  Q Q+
Sbjct  372   VLGYNFEEKVLEDLFWRFKSMAGSKKNITDDDLRALISNEAIQTQI  417



>ref|WP_014434671.1| 2-isopropylmalate synthase [Caldilinea aerophila]
 ref|YP_005443342.1| 2-isopropylmalate synthase [Caldilinea aerophila DSM 14535 = 
NBRC 104270]
 dbj|BAM01445.1| 2-isopropylmalate synthase [Caldilinea aerophila DSM 14535 = 
NBRC 104270]
Length=595

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/536 (59%), Positives = 389/536 (73%), Gaps = 16/536 (3%)
 Frame = +1

Query  286   ILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAV  465
             I + N V IFDTTLRDGEQSPGAT+ T+EKL +A QLARLGVDIIEAGFPA+S  DLEAV
Sbjct  42    IANGNVVLIFDTTLRDGEQSPGATLNTQEKLEIAHQLARLGVDIIEAGFPAASPGDLEAV  101

Query  466   RLIAEEVGR-------GEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEI  624
             + IAE VGR       GE    PVI GLAR NK DIDKAWEAVK A +PRIHTF+ATS+I
Sbjct  102   KRIAETVGRKPRRGKNGEIVAPPVIAGLARANKSDIDKAWEAVKGAIRPRIHTFLATSDI  161

Query  625   HMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  804
             HM YKL+M+R++V+E    MVAYARSL C DVEFSPED GRSD EFL ++L   IKAGAT
Sbjct  162   HMQYKLRMTRDEVLETVGDMVAYARSL-CQDVEFSPEDGGRSDPEFLVKVLEVAIKAGAT  220

Query  805   TLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  984
             TLNIPDTVGYT P E+G LI  ++ NTPG ++VI S HC NDLGL+TANTLAG   GARQ
Sbjct  221   TLNIPDTVGYTTPEEYGALIKYLRENTPGGKDVIFSCHCHNDLGLATANTLAGVRNGARQ  280

Query  985   LEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             +EVTINGIGERAGN SLEE VMA+  R  QV  GL T I TQ+I   S MV  YTG+ +Q
Sbjct  281   IEVTINGIGERAGNTSLEETVMAMYVR-PQVF-GLTTNIITQEIHRTSDMVSRYTGMVIQ  338

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHE+GIHQDGMLKHK TYEI+    IGL   N S +VLGK SG+HAL  
Sbjct  339   PNKAIVGANAFAHEAGIHQDGMLKHKRTYEIMDASTIGL---NTSKLVLGKHSGKHALAR  395

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             K+  +GY +  +EL+++F RFK +A++KK +T+ DL ALV DE++QP   W L +VQ  C
Sbjct  396   KLESMGYRLTQEELKEVFNRFKELADKKKHITEADLEALVGDELYQPVEAWELVEVQAHC  455

Query  1525  GSLGLSTATVKLID-ADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             G+    TA VKL D + GE  +  + GTGPVDA YKA++ V KVP  L+E+ + AVTEGI
Sbjct  456   GTALTPTAVVKLKDNSTGEIKMGAATGTGPVDAVYKAINEVVKVPNNLVEFLVQAVTEGI  515

Query  1702  DAIA--STRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             DA    + R+ + + +     + G    R F+G G   D++++S +AY+ ALNK++
Sbjct  516   DANGDVTIRIEVPDSRGYKETAQGRQRRRLFSGRGVDTDIIVASAKAYMQALNKMI  571



>ref|WP_022848903.1| 2-isopropylmalate synthase [Chloroflexi bacterium oral taxon 
439]
Length=530

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/521 (56%), Positives = 385/521 (74%), Gaps = 9/521 (2%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQ PGA+MT++EK+ +A  LARL VD+IEAGFP +S  DL AVR IA EVG
Sbjct  7     IFDTTLRDGEQCPGASMTSEEKMEIAHALARLRVDVIEAGFPIASPDDLAAVRRIANEVG  66

Query  490   RG-EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVV  666
                 G + P ICGLARC ++DID AWEAV+ A +PRIH FIA+S IHM YKL+M   +V+
Sbjct  67    VSRNGSYAPAICGLARCARKDIDAAWEAVRGADRPRIHVFIASSPIHMKYKLRMEPAEVI  126

Query  667   EKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPN  846
              +A  MVAYA SL CSD+EFSPEDA RS+ EFLY++LG  I+AGATTLNIPDTVGY  P+
Sbjct  127   SRAREMVAYAHSL-CSDIEFSPEDASRSEPEFLYELLGAAIEAGATTLNIPDTVGYATPH  185

Query  847   EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGN  1026
             E+G+LI  I+ +T GIE  I+STHC +DLGL+ A TLAG   GARQ+EVTINGIGERAGN
Sbjct  186   EYGELIRKIREHTKGIEKCILSTHCHDDLGLAVATTLAGCENGARQIEVTINGIGERAGN  245

Query  1027  ASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHE  1206
             ASLEEVVMA++ R  +   GL T I+T+ +   S+MV  +TG  + P+KAIVG NAFAHE
Sbjct  246   ASLEEVVMAIRTR--ESYYGLRTDIDTRHLARVSQMVSNFTGFPIAPNKAIVGRNAFAHE  303

Query  1207  SGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKEL  1386
             SGIHQDGMLK+  TYEI+ PED+G+ + N   +VLGK SGRHAL  +M E+GY +   EL
Sbjct  304   SGIHQDGMLKNAMTYEIMKPEDVGVRQTN---LVLGKHSGRHALANRMAEIGYNLTEAEL  360

Query  1387  EDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLID  1566
             + LF +FK +A++KK ++D DL ALVS ++ Q   +++L  +Q++CG++G+ TA+V+LI 
Sbjct  361   DVLFVKFKDLADKKKHISDWDLEALVSSDIRQLNPYYQLDGLQISCGTIGMPTASVRLIC  420

Query  1567  ADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIRE--D  1740
              DGE      +GTGP+DAAYKA+D++ +V  TL E+ ++AVTEGIDA+    V I     
Sbjct  421   PDGETRTVAEIGTGPIDAAYKAIDVIVQVENTLKEFMIHAVTEGIDAVGEVTVRIENAVP  480

Query  1741  QASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
              A +H  + G+     +G GA  D+V+++V+AY+ ALNKL+
Sbjct  481   SAEVHPQSDGAKTLLISGYGANNDIVVAAVKAYLSALNKLI  521



>ref|XP_006366146.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum tuberosum]
Length=433

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/433 (66%), Positives = 344/433 (79%), Gaps = 16/433 (4%)
 Frame = +1

Query  217   FSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQL  396
             +S  A+RC +            ++ DPNYV IFDTTLRDGEQ+PGA+MT K+K+ +A QL
Sbjct  10    YSPYAIRCSNI-----------QLSDPNYVTIFDTTLRDGEQAPGASMTAKQKMNIACQL  58

Query  397   ARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEA  570
             A+LGVD+IE GFPA+S+A+ + V+L+A+++G    E  +VP+ICGLAR  K DID+AWE+
Sbjct  59    AKLGVDVIEVGFPAASQAEFDLVKLVAQKIGNNIDEEGYVPMICGLARSTKEDIDRAWES  118

Query  571   VKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRS  750
             +K+AK P IH FIATS+IHM YKL MSREQVV++A SMVAYARSLG   V FS EDA RS
Sbjct  119   LKYAKTPMIHMFIATSDIHMKYKLNMSREQVVKRARSMVAYARSLGFEHVRFSLEDATRS  178

Query  751   DREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQND  930
             D+EF+Y I+GEVIKAGAT + + DTVG  +PNEF QLI DIKANT GI+NVI++ HC ND
Sbjct  179   DKEFVYHIIGEVIKAGATCICVADTVGCNLPNEFAQLIVDIKANTLGIQNVILAVHCHND  238

Query  931   LGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQ  1110
             LGL+TANTL G CAG RQ++VTINGIGERAGNASLEE+VMA+KCRG++VL GLYTGINT+
Sbjct  239   LGLATANTLVGICAGVRQVDVTINGIGERAGNASLEEIVMAIKCRGKEVLSGLYTGINTK  298

Query  1111  QIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRA  1290
              I   S MVEEY+GL +QPHKAIVG NAF+HESGIHQDG+LK++ TYE I  ED+G  RA
Sbjct  299   HIFTTSNMVEEYSGLKLQPHKAIVGVNAFSHESGIHQDGILKNRGTYEFIPAEDVGFIRA  358

Query  1291  NESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSD  1470
              E GI LGKLSGRHAL+ KMLELGY  E K+L DLFWRFKS+AERKK +TDDDL AL+ D
Sbjct  359   TEHGIKLGKLSGRHALKIKMLELGYNFEEKQLGDLFWRFKSLAERKKNITDDDLRALLLD  418

Query  1471  EVFQPQV---FWR  1500
             E  QPQ+    WR
Sbjct  419   ETIQPQIGLTTWR  431



>gb|KCW44560.1| hypothetical protein EUGRSUZ_L01927 [Eucalyptus grandis]
Length=351

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/349 (78%), Positives = 313/349 (90%), Gaps = 2/349 (1%)
 Frame = +1

Query  838   IPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGER  1017
             +P EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GACAGARQ+EVTINGIGER
Sbjct  1     MPEEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIVGACAGARQVEVTINGIGER  60

Query  1018  AGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAF  1197
             AGNASLEEVVMALKC+G  +LGGLYTGINT+ I+M SKMVEEY+GLHVQPHKAIVGANAF
Sbjct  61    AGNASLEEVVMALKCKGMSILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAF  120

Query  1198  AHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEG  1377
              HESGIHQDGMLKHK TYEIISP+DIGL R NE+GIVLGKLSGRHAL+ K++ELGY+I+ 
Sbjct  121   VHESGIHQDGMLKHKGTYEIISPDDIGLERTNETGIVLGKLSGRHALKMKLVELGYDIDV  180

Query  1378  KELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVK  1557
             ++L D+FWRFK+VAE+KK+VTD D+ ALV DEVFQP V W+L D+QVTCG+LGLSTATVK
Sbjct  181   EQLNDIFWRFKAVAEQKKRVTDADIRALVFDEVFQPTVVWKLHDLQVTCGTLGLSTATVK  240

Query  1558  LIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR-  1734
             LI ADG+EH+AC+VGTGPVD+AYKAVDL+ KVP TLLEYSM AVTEGIDAIA+TRVLIR 
Sbjct  241   LISADGKEHIACAVGTGPVDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRG  300

Query  1735  -EDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNL  1878
               +  S H  TG + +R+F+GTG++MD+ +SSVRAY+GALNKLLGF  L
Sbjct  301   ENNHTSTHALTGETIHRTFSGTGSSMDIAVSSVRAYIGALNKLLGFMEL  349



>ref|XP_004513503.1| PREDICTED: probable 2-isopropylmalate synthase-like [Cicer arietinum]
Length=434

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/435 (64%), Positives = 348/435 (80%), Gaps = 9/435 (2%)
 Frame = +1

Query  214   SFSAAAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQ  393
             S S  A +C S        YIPN+IL+P Y+RI DTTLRDGEQSPGA M+ KEKL +ARQ
Sbjct  7     SESHQATKCHSL-------YIPNQILNPTYLRILDTTLRDGEQSPGAAMSCKEKLDIARQ  59

Query  394   LARLGVDIIEAGFPASSEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWE  567
             LA+L VD+IE+GFP++   D  AV++IA+EVG    D  +VPVI G+ RC+++DI   WE
Sbjct  60    LAKLRVDVIESGFPSAGNDDFMAVKMIAQEVGNNVDDDGYVPVIGGMCRCSEKDIAITWE  119

Query  568   AVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  747
             AVK+AK+PRI TF+ATS IHM YKL+ ++++V+  A  MV +ARSLGC DV+F  EDA R
Sbjct  120   AVKYAKRPRICTFLATSPIHMEYKLRKTKDEVLVMARDMVKFARSLGCCDVQFGAEDAAR  179

Query  748   SDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQN  927
             SD+EFLYQILGEVIKAGATT+ IPDTVG  +P EFG LIAD+K NTPGIENVI++THC N
Sbjct  180   SDKEFLYQILGEVIKAGATTVVIPDTVGIAMPFEFGNLIADLKKNTPGIENVILATHCHN  239

Query  928   DLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1107
             DLGL+TANT+ GA AGARQLEVTINGIGERAGNASLEEVVM + CRG  +LGGL+TGINT
Sbjct  240   DLGLATANTIEGARAGARQLEVTINGIGERAGNASLEEVVMIVACRGNDILGGLHTGINT  299

Query  1108  QQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFR  1287
             +QI+  SKMVE+Y+GLH+QPHKA+VG NAF HESGIHQDGMLKH+ TYEIISPEDIGL R
Sbjct  300   RQILNISKMVEKYSGLHLQPHKALVGVNAFLHESGIHQDGMLKHRGTYEIISPEDIGLER  359

Query  1288  ANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
             +  + +VLGKLSGR AL+ ++ ELGY ++  E+E +FW+FK++A +KK+VT++DL  LVS
Sbjct  360   STLASLVLGKLSGRQALRKRLEELGYVLKDDEVEAMFWKFKALAGKKKRVTNEDLKVLVS  419

Query  1468  DEVFQPQVFWRLGDV  1512
             ++     + + +GDV
Sbjct  420   NKGQIHGIVYEIGDV  434



>gb|KEH22097.1| 2-isopropylmalate synthase [Medicago truncatula]
Length=436

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 338/416 (81%), Gaps = 2/416 (0%)
 Frame = +1

Query  271   YIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEA  450
             Y PN+I  P YVRI DTTLRDGEQSPGA M+ KEKL +A  LA+L VD+IEAGFP++S  
Sbjct  21    YTPNQIPIPTYVRILDTTLRDGEQSPGAAMSCKEKLDIAHLLAKLRVDVIEAGFPSASND  80

Query  451   DLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEI  624
             D  AV++IA+EVG    +  HVPVI G+ RCN++DI   WEAVKHAK+PRI TF+ATS I
Sbjct  81    DFMAVKMIAQEVGNDVDNDGHVPVIGGMCRCNEKDIAITWEAVKHAKRPRICTFLATSPI  140

Query  625   HMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  804
             HM YKL+ +++QV++ A   V +ARSLGC D++F  EDA RS++EFLYQ+LGEVIKAGAT
Sbjct  141   HMEYKLRKTKDQVLKIARETVKFARSLGCCDIQFGVEDATRSEKEFLYQVLGEVIKAGAT  200

Query  805   TLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  984
             T+ IPDTVG  +P E+G LIADIK NTPGIENVII+THC NDLGL+TANT+ GA AGARQ
Sbjct  201   TVVIPDTVGIAMPFEYGNLIADIKMNTPGIENVIIATHCHNDLGLATANTIEGARAGARQ  260

Query  985   LEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             LEVTINGIGERAGNASLEEVVMAL CRG  VLGGL+TGINT+ II  SKMVEEY+G+ +Q
Sbjct  261   LEVTINGIGERAGNASLEEVVMALTCRGNDVLGGLHTGINTRHIIRTSKMVEEYSGMLLQ  320

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             PHKA+VGANAF HESGIHQDGMLKHK TYEIISPEDIGL R+ E+ IVLGKLSGR AL+ 
Sbjct  321   PHKALVGANAFLHESGIHQDGMLKHKGTYEIISPEDIGLERSIEASIVLGKLSGRQALRK  380

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDV  1512
             ++ E GY+++  ELE LFW+FK++A  KK+VT+ DL  L+S+E +Q ++   L D+
Sbjct  381   RLEEHGYKLKDDELETLFWKFKALAGTKKRVTNADLKILMSNEAYQDELVHNLHDL  436



>ref|XP_004244758.2| PREDICTED: 2-isopropylmalate synthase A-like [Solanum lycopersicum]
Length=445

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/435 (63%), Positives = 339/435 (78%), Gaps = 12/435 (3%)
 Frame = +1

Query  205   SFQSFSAAAVRCESSPPARR----------PEYIPNRILDPNYVRIFDTTLRDGEQSPGA  354
             SF ++ +   +  S PP +R                ++ DPNYV IFDTTLRDGEQ+PGA
Sbjct  9     SFGNYISLHSKNNSVPPIKRNFQSSYDIRCSNIQRGKLSDPNYVTIFDTTLRDGEQAPGA  68

Query  355   TMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVPVICGL  528
             +MT K+K+ +A QLA+LGVD+IE GFPA+S A+ + V+L+A+++G    E  +VP+ICGL
Sbjct  69    SMTAKQKMKIACQLAKLGVDVIEVGFPAASHAEFDLVKLVAQKIGNNIDEEGYVPMICGL  128

Query  529   ARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLG  708
             AR  K DID+AWE++K+AK P IH FIATS++HM YKL MSRE+VVE+A SMVAYA SLG
Sbjct  129   ARSTKEDIDRAWESLKYAKTPMIHMFIATSDMHMKYKLNMSREEVVERARSMVAYATSLG  188

Query  709   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTP  888
                V FS EDA RSD+EF+Y I+ EVIKAGAT + + DTVG  +PNEF QLI DIKANT 
Sbjct  189   FEHVRFSLEDATRSDKEFVYHIIEEVIKAGATCICVADTVGCNLPNEFAQLIVDIKANTL  248

Query  889   GIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRG  1068
             GI+NV+++ HC NDLGL+TANTLAG CAG RQ++VTINGIGERAGNASLEE+VM +K RG
Sbjct  249   GIQNVVLAVHCHNDLGLATANTLAGICAGVRQVDVTINGIGERAGNASLEEIVMTIKYRG  308

Query  1069  EQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1248
              +VLGG+YTGINT+ I   S MVEEY+GL +QP+KAIVGANAF+HESGIHQDGMLK++ T
Sbjct  309   GEVLGGVYTGINTKYIFTTSNMVEEYSGLKLQPNKAIVGANAFSHESGIHQDGMLKNRGT  368

Query  1249  YEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERK  1428
             YE IS ED+G  RA + GI LGKLSGRHAL+ KMLELGY  E K+L DLFWRFKS+AE K
Sbjct  369   YEFISAEDVGFIRATKHGIKLGKLSGRHALKNKMLELGYSFEEKQLGDLFWRFKSLAEGK  428

Query  1429  KKVTDDDLIALVSDE  1473
             K +TDDDL AL+ DE
Sbjct  429   KNITDDDLRALILDE  443



>dbj|BAL52895.1| 2-isopropylmalate synthase [uncultured prokaryote]
Length=528

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/527 (55%), Positives = 376/527 (71%), Gaps = 19/527 (4%)
 Frame = +1

Query  289   LDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVR  468
             ++P+ VRIFDTTLRDGEQSPGAT+T +EKL +ARQL RLGVDIIEAGFP +S  D EAVR
Sbjct  1     MEPDVVRIFDTTLRDGEQSPGATLTVEEKLEIARQLVRLGVDIIEAGFPIASPGDFEAVR  60

Query  469   LIAEEVG---RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYK  639
              IA E+G   +   +  PVI GLAR NK DID  WEAV+ A +PRIH F+ATS+IH+ YK
Sbjct  61    RIAREIGPLGKERPNGPPVIAGLARANKEDIDACWEAVREAPRPRIHVFLATSDIHLQYK  120

Query  640   LKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIP  819
             L+M+RE+ + +   MVAYARSL C DVEFSPEDAGR+DR+FL Q L   ++AGATTLNIP
Sbjct  121   LRMTREECLARIREMVAYARSL-CDDVEFSPEDAGRTDRDFLMQALTAAVEAGATTLNIP  179

Query  820   DTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTI  999
             DTVGYT P EFG L A+I+   PG+E VI+S HC NDLGL+TANTLA    GARQ+EVT+
Sbjct  180   DTVGYTTPEEFGGLFAEIRRRVPGVERVILSAHCHNDLGLATANTLAAIRNGARQVEVTV  239

Query  1000  NGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             NGIGERAGN +LEEVVMAL  R +  + G+ T I+T QI   S++V   TG+ VQP+KAI
Sbjct  240   NGIGERAGNTALEEVVMALHTRRD--VFGVRTYIDTTQIYRTSRLVSALTGIPVQPNKAI  297

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VGANAFAHE+GIHQDGMLK+  TYEI+ PE +G+    ES +VLGK SGRHA + ++ ++
Sbjct  298   VGANAFAHEAGIHQDGMLKNPLTYEIMRPETVGV---PESRLVLGKHSGRHAFRVRLEQM  354

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             GY +     E+ F RFK++ +RKK VTD DL A+++D        WRL  +QVTCG+  +
Sbjct  355   GYHLPPDAFEEAFRRFKALCDRKKYVTDFDLEAMMADFTQSSGQGWRLDMLQVTCGTPLI  414

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
             +TATV+L+  DGE  V    G GPVDAAY+A++    V   LLE++++AVT G DA+   
Sbjct  415   ATATVRLVGPDGEVRVGTGTGNGPVDAAYRAIEAALGVQARLLEFNVHAVTPGRDAVGRV  474

Query  1720  RVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
              + + + Q      TG  A     G GA  D+V+++ +AY+ A+ +L
Sbjct  475   FIQVEDPQ------TGALA----GGFGADTDIVVAAAKAYLHAVLRL  511



>ref|XP_007034043.1| 2-isopropylmalate synthase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY04969.1| 2-isopropylmalate synthase 1 isoform 3, partial [Theobroma cacao]
Length=434

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/356 (78%), Positives = 311/356 (87%), Gaps = 12/356 (3%)
 Frame = +1

Query  190   ASRRPSFQSFSA----------AAVRCESSPPARRPEYIPNRILDPNYVRIFDTTLRDGE  339
             +S+ PSF SF +          +++      P+RRP +IPN I DPNYVR+FDTTLRDGE
Sbjct  34    SSKLPSFPSFPSKSCSKTFLISSSLTPNPPSPSRRPPFIPNHIPDPNYVRVFDTTLRDGE  93

Query  340   QSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGRG--EGDHVP  513
             QSPGATMT+KEKL +ARQLA+LGVDIIEAGFPA+S+ D EAV+ IA+EVG    E  +VP
Sbjct  94    QSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAKEVGNAVDEDGYVP  153

Query  514   VICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAY  693
             VICGL+RCN++DI  AWEAVK+AK+PRIHTFIATS IHM YKL+ S+ +VV+ A SMV +
Sbjct  154   VICGLSRCNEKDIKAAWEAVKYAKRPRIHTFIATSGIHMEYKLRKSKAEVVDIARSMVRF  213

Query  694   ARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADI  873
             ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGATTLNIPDTVG  +P+EFGQLIADI
Sbjct  214   ARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGATTLNIPDTVGINLPSEFGQLIADI  273

Query  874   KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMA  1053
             KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ+EVTINGIGERAGNASLEEVVMA
Sbjct  274   KANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQVEVTINGIGERAGNASLEEVVMA  333

Query  1054  LKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQ  1221
             LKCRGE VLGGLYTGINT+ I+MASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQ
Sbjct  334   LKCRGEHVLGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQ  389



>ref|XP_010534037.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like, 
partial [Tarenaya hassleriana]
Length=373

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/357 (73%), Positives = 309/357 (87%), Gaps = 3/357 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEYIPNRI DPNYVR+FDTTLRDGEQSPGA M T++KL +AR+LA LGVD+IEAGFPA
Sbjct  17    RRPEYIPNRISDPNYVRVFDTTLRDGEQSPGAAMQTEQKLLIARKLAELGVDVIEAGFPA  76

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             +S AD EAV+ IAE VG     E  +VPVICGL+RC K D++ AWEAVKHAK+PRIH FI
Sbjct  77    ASAADFEAVKAIAETVGNDVDEETGYVPVICGLSRCRKDDVEAAWEAVKHAKRPRIHVFI  136

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM +KL+ +RE+V++ A+SM+ +ARSLGC+DVEF  EDAGRS++ F+Y+IL EVI
Sbjct  137   STSDIHMEHKLRKTREEVIQMASSMIRFARSLGCADVEFGAEDAGRSEKGFMYKILEEVI  196

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGA+T+NI DTVG   P+EFG+LI+DIKANTPGI++VIISTHCQNDLGL+TANTL+G  
Sbjct  197   KAGASTVNIADTVGINTPDEFGELISDIKANTPGIDDVIISTHCQNDLGLATANTLSGTS  256

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER GNASLEEVVM LKC+GE    GLYTGI+T+ I+ ASK+VEE+T
Sbjct  257   AGARQVEVTINGIGERGGNASLEEVVMTLKCKGEHAFCGLYTGIDTRHIVPASKLVEEHT  316

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKL  1320
             GLHVQPHKAIVGANAF HESGIHQDGMLK+K TYEI+ PED+GL R+ E GIVLGKL
Sbjct  317   GLHVQPHKAIVGANAFVHESGIHQDGMLKNKSTYEIMLPEDVGLERSQELGIVLGKL  373



>ref|WP_013324885.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7822]
 ref|YP_003890122.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7822]
 gb|ADN16847.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7822]
Length=535

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 372/532 (70%), Gaps = 30/532 (6%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGAT+   EKL VAR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGATLNVDEKLTVARALARLGVDVIEAGFPYASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG   G   P ICGLAR  ++DI KA EA+K A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AKVVGVQGG---PTICGLARATRQDITKAAEALKPAAKPRIHTFLATSDIHLAYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
               P+EFGQLI  IK N P I+N IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   LTPSEFGQLIRGIKENVPNIDNAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRSYYNPFLGRPADSTEPLTNINTKEIYKTSRLVSSLTGMAVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A   +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFGTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEV-FQPQVFWRLGDVQVTC  1524
             + ELG+E+   EL   F RFK VA+++K++TD DL A+V+DE+   P++F RL  VQV+C
Sbjct  358   LKELGFELTETELNKAFVRFKEVADKRKEITDWDLEAIVNDEIHVAPEIF-RLELVQVSC  416

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G     TATV L   +GEE +  ++GTGPVDA YKA++ V  VP  L+E+S+ +VTEGID
Sbjct  417   GDQARPTATVILKGPNGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVKSVTEGID  476

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             A+    + ++ +            NR+F+G  A  D++++S RAY+ ALN+L
Sbjct  477   AMGEVTIRLKYE------------NRTFSGHAANTDIIVASARAYISALNRL  516



>ref|WP_012598523.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7424]
 ref|YP_002376445.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7424]
 sp|B7KJX8.1|LEU1_CYAP7 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Cyanothece sp. PCC 7424]
 gb|ACK69577.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7424]
Length=536

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/532 (56%), Positives = 370/532 (70%), Gaps = 30/532 (6%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             PN + IFDTTLRDGEQSPGAT+   EKL VAR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PNRIIIFDTTLRDGEQSPGATLNGDEKLTVARALARLGVDVIEAGFPYASPGDFEAVQQI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG   G   P ICGLAR  K DI KA EA+K A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AKVVGVEGG---PSICGLARATKADIAKAAEALKPAAKPRIHTFLATSDIHLAYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
               P+EFGQLI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   LTPSEFGQLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T INT++I   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYYNPFLGRPVDSTEPLTNINTKEIYKTSRLVSNLTGMAVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGRHA   +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRHAFSTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQ-PQVFWRLGDVQVTC  1524
             + ELG+E+   +L   F RFK VA++KK++TD DL A+V+DE+ Q P+VF RL  VQV+C
Sbjct  358   LKELGFELSETDLNKAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPEVF-RLELVQVSC  416

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G     TATV L   +G+E +  ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GID
Sbjct  417   GDQARPTATVILRGPEGQELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVKSVTAGID  476

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             A+    + ++ +            NR F+G  A  D++++S RAY+ ALN+L
Sbjct  477   AMGEVTIRLKYE------------NRIFSGHAANTDIIVASARAYISALNRL  516



>ref|WP_015147156.1| 2-isopropylmalate synthase [Oscillatoria acuminata]
 ref|YP_007084426.1| 2-isopropylmalate synthase [Oscillatoria acuminata PCC 6304]
 gb|AFY80506.1| 2-isopropylmalate synthase [Oscillatoria acuminata PCC 6304]
Length=535

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/534 (55%), Positives = 371/534 (69%), Gaps = 28/534 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ + IFDTTLRDGEQSPGA++  +EKL +ARQLARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRIIIFDTTLRDGEQSPGASLNGEEKLTIARQLARLGVDVIEAGFPYASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             AE VG   G   P ICGLAR  + DI+ A +A+K A K RIHTFIATS+IH+ YKLK +R
Sbjct  65    AELVGVEGG---PTICGLARATRADIEAAGKALKPAAKARIHTFIATSDIHLEYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
              +VV  A  MVAYA+S    DVEFSPEDAGRSD EFLY++L + I AGATT+NIPDTVGY
Sbjct  122   PEVVAIAEEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYEVLTKAIAAGATTINIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P EFG +I  IK N P I++ IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPGEFGAIIRGIKENVPNIDDAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T I+T+QI   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNPFLGRPVDSQESLTNIDTRQIYKTSRLVSNLTGMFVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  + IGL    ++ IVLGKLSGRHA  ++
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKHKQTYEIMDAQSIGL---TDNQIVLGKLSGRHAFASR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+++   EL + F +FK+VA++KK+VTD DL ++V+ E+ QP   +RL  VQV+CG
Sbjct  358   LKELGFDLSDTELNNAFLKFKTVADKKKEVTDWDLESIVNAEIQQPPEIFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
                  TATV L    GEE    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA
Sbjct  418   DRARPTATVTLRTPTGEELTDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             +    + +R      HG      +R F+G  A  D++++S  AYV ALN+L  F
Sbjct  478   LGEVTIRLR------HG------DRIFSGHSANTDIIVASAHAYVNALNRLYAF  519



>ref|WP_012594190.1| MULTISPECIES: 2-isopropylmalate synthase [Cyanothece]
 ref|YP_002371070.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8801]
 ref|YP_003136633.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8802]
 sp|B7JYP4.1|LEU1_CYAP8 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Cyanothece sp. PCC 8801]
 gb|ACK64914.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8801]
 gb|ACU99797.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8802]
Length=536

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/533 (55%), Positives = 371/533 (70%), Gaps = 28/533 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ + IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D EAV+ I
Sbjct  5     PDRIIIFDTTLRDGEQSPGASLTVEEKLTIARSLARLGVDIIEAGFPYASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG  +G   P ICGLAR  ++DI  A EAVK A K RIHTF+ATS+IH+ YKLK +R
Sbjct  65    AQTVGTEDG---PRICGLARATQKDIQTAAEAVKPAAKGRIHTFLATSDIHLQYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+     MVAYA+SL   DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLAIVPDMVAYAKSL-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTINIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEFGALIGGIKQNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T INT++I   S++V + TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNPFLGRPPESTEPLTNINTKEIYRTSRLVSQLTGMMVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVG NAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A + +
Sbjct  301   NKAIVGKNAFAHESGIHQDGVLKNKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   E+ + F RFK VA++KK++TD DL A+V+DE+ Q    +RL  VQV+CG
Sbjct  358   LKELGFELSDTEINNAFLRFKEVADKKKEITDWDLAAIVNDEMQQAPELFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
                  TATV L   DG+E    ++GTGPVDA YKA++ V +VP  L+E+S+ +VT GIDA
Sbjct  418   DHACPTATVTLRTPDGQELTDAAIGTGPVDAVYKAINRVVQVPNELIEFSVKSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             +    + +R +            ++ ++G  A  D++ +S RAY+ ALN+L G
Sbjct  478   MGEVTIRLRYE------------DKIYSGYAANTDIITASARAYISALNRLYG  518



>gb|AAV25874.1| 2-isopropylmalate synthase [Brassica oleracea]
Length=505

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/415 (62%), Positives = 334/415 (80%), Gaps = 5/415 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T  +K+ +ARQLA+L VDI+E GFP 
Sbjct  66    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  125

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+AK+PRI  F 
Sbjct  126   SSEEEFETIKTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  185

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLKM+RE+VVE   S + +A+SLG  D+EF  ED GRSD++++ ++  E I
Sbjct  186   STSDIHLKYKLKMTREEVVEMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICKVFEEAI  245

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTL  PDTVG  +P+E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG C
Sbjct  246   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  305

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+QI+  SKMV+EYT
Sbjct  306   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  365

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  366   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  425

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEVFQPQ  1488
             HA++ ++ ELGYEI  ++L ++F RF+ + ++KK+VTDDDL ALV+  DE+F  +
Sbjct  426   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLRALVTCGDEIFSSE  480



>gb|AAR36908.1| isopropylmalate synthase [Brassica oleracea]
Length=487

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/415 (62%), Positives = 334/415 (80%), Gaps = 5/415 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T  +K+ +ARQLA+L VDI+E GFP 
Sbjct  48    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  107

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+AK+PRI  F 
Sbjct  108   SSEEEFETIKTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  167

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLKM+RE+VVE   S + +A+SLG  D+EF  ED GRSD++++ ++  E I
Sbjct  168   STSDIHLKYKLKMTREEVVEMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICKVFEEAI  227

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTL  PDTVG  +P+E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG C
Sbjct  228   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  287

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+QI+  SKMV+EYT
Sbjct  288   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  347

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  348   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  407

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEVFQPQ  1488
             HA++ ++ ELGYEI  ++L ++F RF+ + ++KK+VTDDDL ALV+  DE+F  +
Sbjct  408   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLRALVTCGDEIFSSE  462



>ref|WP_017296798.1| 2-isopropylmalate synthase [Nodosilinea nodulosa]
Length=539

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/548 (54%), Positives = 375/548 (68%), Gaps = 40/548 (7%)
 Frame = +1

Query  244   SSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
             S+PP+      P+RIL      IFDTTLRDGEQSPGAT+  +EKL +ARQLARLGVDIIE
Sbjct  2     SNPPS------PDRIL------IFDTTLRDGEQSPGATLNVEEKLVIARQLARLGVDIIE  49

Query  424   AGFPASSEADLEAVRLIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHT  603
             AGFP +S  D EAV+ IA EVG  +G   P ICGLAR  + DI++A EA+K A K RIHT
Sbjct  50    AGFPFASPGDFEAVQKIAREVGTADG---PTICGLARATRGDIERAGEAIKPAAKGRIHT  106

Query  604   FIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  783
             F+ATS+IHM YKL+ SRE+V+  A  MVAYA++    DVEFSPEDAGRSD EFLYQ+L  
Sbjct  107   FLATSDIHMQYKLRKSREEVLAIAPEMVAYAKTF-TKDVEFSPEDAGRSDPEFLYQVLEA  165

Query  784   VIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  963
              I AGATT+NIPDTVGY  P EFG LI  I+ N P I+  +IS H  NDLGL+ AN L  
Sbjct  166   AIAAGATTVNIPDTVGYLTPTEFGGLIRGIRENVPNIDQAVISVHGHNDLGLAVANFLEA  225

Query  964   ACAGARQLEVTINGIGERAGNASLEEVVMALKCRG---EQVLG------GLYTGINTQQI  1116
                GARQLE TINGIGERAGNA+LEE+VMA+  R       LG         T I+T+QI
Sbjct  226   VKNGARQLECTINGIGERAGNAALEELVMAMHVRRAFYNPFLGRPAESEAPLTNIDTRQI  285

Query  1117  IMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE  1296
                S++V   TG+ VQP+KAIVGANAFAHESGIHQDG+LK+K TYEI+    IGL    +
Sbjct  286   YKTSRLVSNLTGMFVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDATSIGL---TD  342

Query  1297  SGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEV  1476
             + IVLGK SGR+A + ++ ELGYE++ + L   F RFK +A++KK++TD D+ ++V+DE 
Sbjct  343   NQIVLGKHSGRNAFRTRLQELGYELDDQALNRAFLRFKELADKKKEITDWDIESIVNDET  402

Query  1477  FQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVP  1656
              Q    + LG VQV+CG     TATV L   DG+E +  ++GTGPVDA YKA++ V  +P
Sbjct  403   QQAPEHFHLGLVQVSCGDSAKPTATVTLRTPDGQELMDAAIGTGPVDAVYKAINRVVDIP  462

Query  1657  VTLLEYSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRA  1836
               L+E+S+ +VTEGIDA+    + +R +            +R F+G  A  D+V++S  A
Sbjct  463   NQLIEFSVQSVTEGIDALGEVTIRVRHE------------DRVFSGHAANTDIVVASAHA  510

Query  1837  YVGALNKL  1860
             Y+ ALN+L
Sbjct  511   YLHALNRL  518



>ref|WP_007306993.1| 2-isopropylmalate synthase [Crocosphaera watsonii]
 gb|EAM49269.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 8501]
 gb|EHJ11128.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 0003]
Length=537

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/543 (53%), Positives = 374/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D +AV+ IAE VG
Sbjct  10    IFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFQAVQKIAETVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P ICGLAR + +DI  A EA+K A K RIHTFIATS+IH+ +KLK +R +V++
Sbjct  70    TENG---PRICGLARASTKDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTRSEVLD  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
                 MVAYA++    D+EFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  127   IVPEMVAYAKTF-TDDIEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGYTTPSE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG +I  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   FGAIIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VMAL  R +     L          T INTQ+I   S++V   TG+ VQP+KAIV
Sbjct  246   ALEELVMALHVRRQYFNPFLGRAVDSTEPLTNINTQEIYKTSRLVSNLTGMIVQPNKAIV  305

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A + ++ ELG
Sbjct  306   GANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRTRLSELG  362

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +E+   +L + F RFK VA++KK++TD DL A+V+DE+ Q    +RL  VQV+CG   +S
Sbjct  363   FELSDNDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCGDHAVS  422

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV L + +G+E    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA+    
Sbjct  423   TATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDAMGEVT  482

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQ  1902
             + +R +             R+++G  A  D++ +S RAY+ ALN+L G     S+ N ++
Sbjct  483   IRLRHE------------GRTYSGYAANTDIITASARAYISALNRLYGAIQEQSKVNSSE  530

Query  1903  GTV  1911
               +
Sbjct  531   AVL  533



>emb|CAQ56039.1| 2-isopropylmalate synthase, A genome specific 1 [Brassica juncea]
 emb|CAQ56040.1| 2-isopropylmalate synthase, A genome specific 1 [Brassica juncea]
Length=505

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/412 (62%), Positives = 332/412 (81%), Gaps = 5/412 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T  +K+ +ARQLA+L VDI+E GFP 
Sbjct  66    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  125

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+AK+PRI  F 
Sbjct  126   SSEEEFETIQTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  185

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLKM+RE+VV+   S + +A+SLG  D+EF  ED GRSD++++  +  E I
Sbjct  186   STSDIHLKYKLKMTREEVVDMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICTVFEEAI  245

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTL  PDTVG  +P+E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG C
Sbjct  246   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  305

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+QI+  SKMV+EYT
Sbjct  306   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  365

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEIISPED+G+ ++  SGIVLGKLSGR
Sbjct  366   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEIISPEDVGVVKSQNSGIVLGKLSGR  425

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEVF  1479
             HA++ ++ ELGYEI  ++L ++F RF+ + ++KK+VTDDDL ALV+  DE+F
Sbjct  426   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLKALVTCGDEIF  477



>gb|ACH41738.1| glucosinolate GS-Elong [Brassica rapa subsp. rapa]
 gb|ACH41739.1| glucosinolate GS-Elong [Brassica rapa subsp. rapa]
 gb|ACH41740.1| glucosinolate GS-Elong [Brassica rapa subsp. pekinensis]
Length=487

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/412 (62%), Positives = 332/412 (81%), Gaps = 5/412 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T  +K+ +ARQLA+L VDI+E GFP 
Sbjct  48    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  107

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+AK+PRI  F 
Sbjct  108   SSEEEFETIQTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  167

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLKM+RE+VV+   S + +A+SLG  D+EF  ED GRSD++++  +  E I
Sbjct  168   STSDIHLKYKLKMTREEVVDMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICTVFEEAI  227

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTL  PDTVG  +P+E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG C
Sbjct  228   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  287

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+QI+  SKMV+EYT
Sbjct  288   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  347

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEIISPED+G+ ++  SGIVLGKLSGR
Sbjct  348   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEIISPEDVGVVKSQNSGIVLGKLSGR  407

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEVF  1479
             HA++ ++ ELGYEI  ++L ++F RF+ + ++KK+VTDDDL ALV+  DE+F
Sbjct  408   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLKALVTCGDEIF  459



>emb|CAJ55512.1| methylthioalkylmalate synthase a [Boechera divaricarpa]
Length=504

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/411 (62%), Positives = 333/411 (81%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE V+ IA+ VG     E  +VP IC +AR    DI+ AWEAVK+AK+PRI  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEETGYVPAICAIARSKHSDIEAAWEAVKYAKRPRILIFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S V +A+SLG +D++F  ED GRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQFGCEDGGRSDKEFLCKILGESI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT +N+ DTVG  +P+E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGATVVNVADTVGINMPHEYGELVTYVKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMALKCRG  VL G+YTGI+T++I+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVLDGVYTGIDTREIMATSKMVQEYT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD DL ALV  SDE+
Sbjct  430   HAMKGRLKELGYELDDEKLNDVFSRFRDLTKHKKRITDADLKALVTSSDEI  480



>ref|WP_002794932.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI27285.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9808]
Length=533

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/531 (55%), Positives = 367/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG GE D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    ASSVG-GEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V K+P  L+ +S+  VTEGIDA
Sbjct  419   NNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R             A R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLR------------YAGRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_021829821.1| 2-isopropylmalate synthase [Crocosphaera watsonii]
 emb|CCQ60867.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 0401]
 emb|CCQ50009.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 8502]
Length=546

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/543 (53%), Positives = 374/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D +AV+ IAE VG
Sbjct  19    IFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFQAVQKIAETVG  78

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P ICGLAR + +DI  A EA+K A K RIHTFIATS+IH+ +KLK +R +V++
Sbjct  79    TENG---PRICGLARASTKDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTRSEVLD  135

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
                 MVAYA++    D+EFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  136   IVPEMVAYAKTF-TDDIEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGYTTPSE  194

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG +I  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  195   FGAIIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  254

Query  1030  SLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VMAL  R +     L          T INTQ+I   S++V   TG+ VQP+KAIV
Sbjct  255   ALEELVMALHVRRQYFNPFLGRAVDSTEPLTNINTQEIYKTSRLVSNLTGMIVQPNKAIV  314

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A + ++ ELG
Sbjct  315   GANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRTRLSELG  371

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +E+   +L + F RFK VA++KK++TD DL A+V+DE+ Q    +RL  VQV+CG   +S
Sbjct  372   FELSDNDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCGDHAVS  431

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV L + +G+E    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA+    
Sbjct  432   TATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDAMGEVT  491

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQ  1902
             + +R +             R+++G  A  D++ +S RAY+ ALN+L G     S+ N ++
Sbjct  492   IRLRHE------------GRTYSGYAANTDIITASARAYISALNRLYGAIQEQSKVNSSE  539

Query  1903  GTV  1911
               +
Sbjct  540   AVL  542



>ref|WP_021832269.1| 2-isopropylmalate synthase [Crocosphaera watsonii]
 emb|CCQ53962.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 0005]
Length=548

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/543 (53%), Positives = 374/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D +AV+ IAE VG
Sbjct  21    IFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFQAVQKIAETVG  80

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P ICGLAR + +DI  A EA+K A K RIHTFIATS+IH+ +KLK +R +V++
Sbjct  81    TENG---PRICGLARASTKDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTRSEVLD  137

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
                 MVAYA++    D+EFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  138   IVPEMVAYAKTF-TDDIEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGYTTPSE  196

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG +I  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  197   FGAIIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  256

Query  1030  SLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VMAL  R +     L          T INTQ+I   S++V   TG+ VQP+KAIV
Sbjct  257   ALEELVMALHVRRQYFNPFLGRAVDSTEPLTNINTQEIYKTSRLVSNLTGMIVQPNKAIV  316

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A + ++ ELG
Sbjct  317   GANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRTRLSELG  373

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +E+   +L + F RFK VA++KK++TD DL A+V+DE+ Q    +RL  VQV+CG   +S
Sbjct  374   FELSDNDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCGDHAVS  433

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV L + +G+E    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA+    
Sbjct  434   TATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDAMGEVT  493

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSRYNKTQ  1902
             + +R +             R+++G  A  D++ +S RAY+ ALN+L G     S+ N ++
Sbjct  494   IRLRHE------------GRTYSGYAANTDIITASARAYISALNRLYGAIQEQSKVNSSE  541

Query  1903  GTV  1911
               +
Sbjct  542   AVL  544



>ref|XP_009130133.1| PREDICTED: methylthioalkylmalate synthase 1, chloroplastic-like 
[Brassica rapa]
Length=543

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/412 (62%), Positives = 332/412 (81%), Gaps = 5/412 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T  +K+ +ARQLA+L VDI+E GFP 
Sbjct  104   RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  163

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+AK+PRI  F 
Sbjct  164   SSEEEFETIQTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  223

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLKM+RE+VV+   S + +A+SLG  D+EF  ED GRSD++++  +  E I
Sbjct  224   STSDIHLKYKLKMTREEVVDMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICTVFEEAI  283

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTL  PDTVG  +P+E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG C
Sbjct  284   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  343

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+QI+  SKMV+EYT
Sbjct  344   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  403

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEIISPED+G+ ++  SGIVLGKLSGR
Sbjct  404   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEIISPEDVGVVKSQNSGIVLGKLSGR  463

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEVF  1479
             HA++ ++ ELGYEI  ++L ++F RF+ + ++KK+VTDDDL ALV+  DE+F
Sbjct  464   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLKALVTCGDEIF  515



>ref|WP_002803918.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI38114.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9701]
Length=533

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/531 (54%), Positives = 368/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG GE D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-GEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             ++   TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NIARPTATVTIRTPDGSELSDSAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>dbj|GAL93306.1| 2-isopropylmalate synthase [Microcystis aeruginosa NIES-44]
Length=533

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/531 (55%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG GE D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-GEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V K+P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|XP_006289820.1| hypothetical protein CARUB_v10003425mg [Capsella rubella]
 gb|EOA22718.1| hypothetical protein CARUB_v10003425mg [Capsella rubella]
Length=508

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/406 (61%), Positives = 331/406 (82%), Gaps = 3/406 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEYIPN++ D NYVR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  74    RRPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  133

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE V+ IA+ VG     E  +VPVIC +AR   +DI+ AWEAVK+AK+PRI  F 
Sbjct  134   SSEEELETVKTIAKTVGNEVDEETGYVPVICAIARSKNKDIEAAWEAVKYAKRPRILIFT  193

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S V +A+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  194   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQLGCEDGGRSDKDFLCKILGESI  253

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT +N+ DTVG  +P+E+G+L+  +KANTPGI +++ S HC NDLGL+TAN++AG  
Sbjct  254   KAGATVVNVADTVGINMPHEYGELVTYLKANTPGINDIVFSVHCHNDLGLATANSIAGIR  313

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMA+KCRG  VL G+YTG++T++I+  SKMV+EYT
Sbjct  314   AGARQVEVTINGIGERSGNASLEEVVMAMKCRGAYVLDGVYTGLDTREIMATSKMVQEYT  373

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  374   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  433

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD D+ ALV+
Sbjct  434   HAVKERLKELGYELDDQKLNDVFSRFRDLTKHKKRITDADMKALVT  479



>ref|WP_035985134.1| 2-isopropylmalate synthase [Leptolyngbya sp. KIOST-1]
Length=539

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/548 (54%), Positives = 374/548 (68%), Gaps = 40/548 (7%)
 Frame = +1

Query  244   SSPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIE  423
             S+PP+      P+RIL      IFDTTLRDGEQSPGAT+  +EKLA+ARQL+RLGVDIIE
Sbjct  2     SNPPS------PDRIL------IFDTTLRDGEQSPGATLNVEEKLAIARQLSRLGVDIIE  49

Query  424   AGFPASSEADLEAVRLIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHT  603
             AGFP +S  D EAV+ IA EVG   G   P ICGLAR  K DI++A EA+K A + RIHT
Sbjct  50    AGFPFASPGDFEAVQKIAREVGTETG---PTICGLARATKGDIERAGEAIKPAARGRIHT  106

Query  604   FIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  783
             FIATS+IHM YKL+  R++V+  A  MVAYA++    DVEFSPEDAGRSD EFLYQ+L  
Sbjct  107   FIATSDIHMQYKLRKGRDEVLAIAPEMVAYAKTF-TDDVEFSPEDAGRSDPEFLYQVLEA  165

Query  784   VIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  963
              I AGATT+NIPDTVGY  P EFG LI  IKAN P I+  +IS H  NDLGL+ AN L  
Sbjct  166   AIAAGATTVNIPDTVGYLTPTEFGDLIRGIKANVPNIDQAVISVHGHNDLGLAVANFLEA  225

Query  964   ACAGARQLEVTINGIGERAGNASLEEVVMALKCRG---EQVLG------GLYTGINTQQI  1116
               AGARQLE TINGIGERAGNA+LEE+VMA+  R       LG         T I+T+QI
Sbjct  226   VKAGARQLECTINGIGERAGNAALEELVMAMHVRRSFYNPFLGRPADSEAPLTAIDTRQI  285

Query  1117  IMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANE  1296
                S++V   TG+ VQP+KAIVGANAFAHESGIHQDG+LK+K TYEI+    IGL    +
Sbjct  286   YKTSRLVSNLTGMFVQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDATSIGL---TD  342

Query  1297  SGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEV  1476
             + IVLGK SGR+A + ++ ELGYE++ + L   F RFK +A++KK++TD D+ ++V+DE 
Sbjct  343   NQIVLGKHSGRNAFRTRLGELGYELDDQALNRAFLRFKELADKKKEITDWDIESIVNDET  402

Query  1477  FQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVP  1656
              Q    + L  VQV+CG     TATV L   DG+E +  ++GTGPVDA YKA++ V  +P
Sbjct  403   QQAPEHFHLELVQVSCGDSAKPTATVTLRTPDGQELMDAAIGTGPVDAVYKAINRVVDIP  462

Query  1657  VTLLEYSMNAVTEGIDAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRA  1836
               L+E+S+ +VT GIDA+    + IR +            +R ++G  A  D+V++S  A
Sbjct  463   NQLIEFSVQSVTAGIDALGEVTIRIRHE------------DRVYSGHAANTDIVVASAHA  510

Query  1837  YVGALNKL  1860
             Y+ ALN+L
Sbjct  511   YLHALNRL  518



>ref|WP_009543901.1| MULTISPECIES: 2-isopropylmalate synthase [Cyanothece]
 ref|YP_001805422.1| 2-isopropylmalate synthase [Cyanothece sp. ATCC 51142]
 sp|B1WQQ4.1|LEU1_CYAA5 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Cyanothece sp. ATCC 51142]
 gb|ACB53356.1| 2-isopropylmalate synthase [Cyanothece sp. ATCC 51142]
Length=537

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/533 (54%), Positives = 368/533 (69%), Gaps = 28/533 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+++ IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D EAV+ I
Sbjct  5     PDHIIIFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG   G   P ICGLAR  K DI  A EA+K A K RIHTFIATS+IH+ +KLK +R
Sbjct  65    AKTVGNESG---PRICGLARATKNDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+     MVAYA++    DVEFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLAIVPEMVAYAKTF-TDDVEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEFGALIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEALKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T INT++I   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNPFLGRPVDSMEPLTNINTKEIYKTSRLVSNLTGMIVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A + +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+  ++L + F RFK VA++KK++TD DL A+V+DE+ Q    +RL  VQV+CG
Sbjct  358   LDELGFELSERDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
                  TATV L   +G+E    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA
Sbjct  418   DHSAPTATVTLRTPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             +    + +R +             R ++G  A  D++ +S RAY+ ALN+L G
Sbjct  478   MGEVTIRLRHE------------GRIYSGYAANTDIITASARAYISALNRLYG  518



>ref|WP_008198795.1| 2-isopropylmalate synthase [Microcystis sp. T1-4]
 emb|CCI31307.1| 2-isopropylmalate synthase [Microcystis sp. T1-4]
Length=533

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/531 (54%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>sp|P94907.1|LEU1_MICAE RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Microcystis aeruginosa]
 dbj|BAA12849.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
Length=533

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/531 (55%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AGSVG-SEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R             A R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLR------------YAGRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_002758694.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCH96510.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9717]
Length=533

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/531 (54%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRSPESTEPLTKINTREIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV + + DG E    ++GTGPVDA  KA++ V K+P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRNPDGSELSDAAIGTGPVDALCKAINRVVKIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSAHAADTDIIVASARAYVSALNRL  517



>ref|WP_002746244.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CAO86547.1| leuA [Microcystis aeruginosa PCC 7806]
 gb|ELS46530.1| 2-isopropylmalate synthase [Microcystis aeruginosa DIANCHI905]
Length=533

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/531 (55%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AGSVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVACG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V K+P  L+ +S+  VTEGIDA
Sbjct  419   NNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_002765307.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI05186.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9443]
Length=533

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/531 (54%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V++    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLDIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R             A R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLR------------YAGRTYSARAADTDIIVASARAYVSALNRL  517



>ref|XP_006367400.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum tuberosum]
Length=382

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/364 (70%), Positives = 300/364 (82%), Gaps = 2/364 (1%)
 Frame = +1

Query  280   NRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLE  459
             ++  DPNYV IFDTTLRDGEQ+PGA+MT  +K+ +ARQL +LGVD+IEAGFPASSE + E
Sbjct  17    DKFSDPNYVSIFDTTLRDGEQAPGASMTATQKMDIARQLVKLGVDVIEAGFPASSEVEFE  76

Query  460   AVRLIAEEVGRG--EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMN  633
              V+ IA E+G    E  +VP+ICGLAR  K DID+AWE++K+AK P IH FI+TS+IHM 
Sbjct  77    LVKCIAHEIGNSVDEEGYVPMICGLARSTKEDIDRAWESLKYAKTPMIHMFISTSDIHMK  136

Query  634   YKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLN  813
             YKL MSREQVVE+A SMV YARSLG   V F  EDA RSD+EF+Y I+GEVIKAGAT + 
Sbjct  137   YKLNMSREQVVERARSMVTYARSLGFKHVRFGLEDATRSDKEFVYHIIGEVIKAGATCIC  196

Query  814   IPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEV  993
             + DTVG  +PNEF QLI DIKANT GI+NVI++ HC NDLGL+TANTLAG CAG RQ++V
Sbjct  197   VADTVGCNLPNEFAQLIVDIKANTLGIQNVILAVHCHNDLGLATANTLAGICAGVRQIDV  256

Query  994   TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHK  1173
             TINGIGERAGNASLEE+VMA+KCRGE+VLGG+YTGINT+ I   S MVEEY+GL +QPHK
Sbjct  257   TINGIGERAGNASLEEIVMAIKCRGEEVLGGVYTGINTKHIFTTSNMVEEYSGLKLQPHK  316

Query  1174  AIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKML  1353
             AIVGANAF HESGIHQDG+LK++ TYE IS ED+G  RA+E GI LGKLSGRHAL+ KML
Sbjct  317   AIVGANAFTHESGIHQDGILKNRGTYEFISAEDVGFIRASEHGIKLGKLSGRHALKIKML  376

Query  1354  ELGY  1365
             E+ Y
Sbjct  377   EVQY  380



>ref|WP_009556473.1| 2-isopropylmalate synthase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69565.1| 2-isopropylmalate synthase [Oscillatoriales cyanobacterium JSC-12]
Length=550

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/526 (54%), Positives = 366/526 (70%), Gaps = 28/526 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGAT+   EKL +ARQLARLGVD+IEAGFP SS  D EAV+ IA+ VG
Sbjct  14    IFDTTLRDGEQSPGATLNVDEKLTIARQLARLGVDVIEAGFPYSSPGDFEAVQKIAQTVG  73

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
               +G   PVICGLAR  ++DI  A EA+K A + RIHTFIATS+IH+ YKL+ +R++V+ 
Sbjct  74    TEQG---PVICGLARATRQDIKTAAEALKPAARSRIHTFIATSDIHLEYKLRKTRKEVLA  130

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
              A  MVAYA++    D+EFSPEDAGRSD EFLY++L   I AGATT+NIPDTVGY  P E
Sbjct  131   IAEEMVAYAKTF-MDDIEFSPEDAGRSDPEFLYEMLERAIAAGATTVNIPDTVGYLTPAE  189

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG LI  IK N P I+N +IS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  190   FGALIRGIKENVPNIDNAVISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  249

Query  1030  SLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             ++EE+VMAL  R +     LG         T I+T+QI   S++V   TG+ VQP+KAIV
Sbjct  250   AMEELVMALHVRRQYFNPFLGRPVDSEAPLTNIDTRQIYKTSRLVSNLTGMLVQPNKAIV  309

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             G NAFAHESGIHQDG+LK+K TYEI+  + IGL    ++ IVLGKLSGR+A ++++ ELG
Sbjct  310   GTNAFAHESGIHQDGVLKNKLTYEIMDAQLIGL---TDNQIVLGKLSGRNAFRSRLKELG  366

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +++  +EL   F RFK +A++KK++TD DL A+V+DE+ Q    ++L  VQV+CG     
Sbjct  367   FDLSEQELNKAFLRFKELADKKKEITDWDLEAIVNDEIQQSPDLFKLELVQVSCGDHACP  426

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV L   DG E    + GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDAI    
Sbjct  427   TATVTLQTPDGHELTDAATGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDAIGEVT  486

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             + +R D            +R F+G  A  D++++S +AY+ ALN+L
Sbjct  487   IRLRHD------------DRIFSGHAANTDIIVASAQAYINALNRL  520



>ref|WP_023073959.1| 2-isopropylmalate synthase [Leptolyngbya sp. Heron Island J]
 gb|ESA35235.1| 2-isopropylmalate synthase [Leptolyngbya sp. Heron Island J]
Length=539

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/532 (55%), Positives = 369/532 (69%), Gaps = 30/532 (6%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGATM  +EKLAVARQLARLGVDIIEAGFP +S  D EAV+ I
Sbjct  5     PDRVLIFDTTLRDGEQSPGATMNVEEKLAVARQLARLGVDIIEAGFPYASPGDFEAVQRI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+EVG  +G   P ICGLAR  K+DI+ A  A++ A K RIHTFIATS+IHM YKLK SR
Sbjct  65    AQEVGTVDG---PTICGLARATKQDIEAAARAIEPAAKGRIHTFIATSDIHMKYKLKKSR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             +QV+     MV +A+     DVEFSPEDAGRS+ EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   DQVLAITDEMVRFAKGF-TDDVEFSPEDAGRSEPEFLYQVLEVAIAAGATTINIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
               P+EFG LI  IK N P ++  +IS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   LTPSEFGGLIKGIKDNVPNVDQTVISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQQIIMASKMVEEYTGLHVQ  1164
             RAGNA+LEE+VMA+  R  Q     +          T INTQ+I   S+++   TG+ VQ
Sbjct  241   RAGNAALEELVMAMHVR-RQYFNPFFGRPADSEAPLTNINTQEIYKTSRLISSVTGMLVQ  299

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IGL   N++ IVLGK SGR+A + 
Sbjct  300   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQTIGL---NDNLIVLGKHSGRNAFRT  356

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELGYE+  ++L   F RFK +A++KK+++D DL A+V+DE  Q    ++L  VQV+C
Sbjct  357   RLQELGYELSDQDLNKAFLRFKDLADKKKEISDRDLEAIVNDETQQVAEHYKLELVQVSC  416

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             GS    TATV +   +GEE +  ++GTGPVDA YKA++ V  +P  L+EYS+ +VT GID
Sbjct  417   GSNARPTATVTIRTPNGEELMDAAIGTGPVDAIYKAINRVVDIPNDLIEYSVQSVTAGID  476

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R +Q            R ++G  A  D+V++S  AY+ ALN+L
Sbjct  477   AIGEVTIRLRHNQ------------RIYSGHAANTDIVVASAHAYMQALNRL  516



>ref|WP_002783894.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI13647.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9806]
Length=533

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSAHAADTDIIVASARAYVSALNRL  517



>ref|WP_035153322.1| 2-isopropylmalate synthase [Calothrix sp. 336/3]
 gb|KFB83580.1| 2-isopropylmalate synthase [Calothrix sp. 336/3]
Length=530

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 365/526 (69%), Gaps = 28/526 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQ PGAT+  +EKLA+A+QLARLGVDIIEAGF  +S  D EAV  IA++VG
Sbjct  10    IFDTTLRDGEQCPGATLNIEEKLAIAKQLARLGVDIIEAGFAFASPGDFEAVSKIAQQVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   PVIC LAR  K DI  A E++K A K RIHTFIATS+IH+ YKLK SRE+VV 
Sbjct  70    TENG---PVICSLARARKEDIKAAAESIKPAVKGRIHTFIATSDIHLKYKLKKSREEVVA  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
              A  MVAYA+S    DVEFSPEDAGRSD EFLY +L   I AGATT+NIPDTVGYT P+E
Sbjct  127   IAEEMVAYAKSF-TDDVEFSPEDAGRSDPEFLYTVLERAIAAGATTVNIPDTVGYTTPSE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   FGAIIKGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VM L  R +     LG         T I+T+QI   S++V   TG+ VQP+KAIV
Sbjct  246   ALEELVMGLHVRRQYFNPFLGRAVESEAPLTNIDTKQIYKTSRLVSNLTGMLVQPNKAIV  305

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDG+LK+K TYEI+  + IGL   N++ IVLGK SGR+A + ++ ELG
Sbjct  306   GANAFAHESGIHQDGVLKNKLTYEIMDAQLIGL---NDNQIVLGKHSGRNAFRTRLRELG  362

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             YE+   EL   F RFK VA++KK+++D DL A+V+DE+ Q    ++L  VQV+CGS    
Sbjct  363   YELSETELNKAFVRFKEVADKKKEISDWDLEAIVNDEIQQAPDLFKLELVQVSCGSNAKP  422

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV L +  GEE +  ++GTGPVDA YKA++ V  +P  L+E+S+ +VT GIDAI    
Sbjct  423   TATVTLRNPQGEELMDAAIGTGPVDAVYKAINRVVDIPNQLIEFSVQSVTAGIDAIGEVT  482

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             + ++ +            +R F+G  A  D++++S +AYV ALN+L
Sbjct  483   IRLKYE------------DRVFSGRSANTDIIVASAQAYVNALNRL  516



>ref|WP_002736592.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 gb|ELP54125.1| 2-isopropylmalate synthase [Microcystis aeruginosa TAIHU98]
Length=533

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_006509230.1| 2-isopropylmalate synthase [Xenococcus sp. PCC 7305]
 gb|ELS03692.1| 2-isopropylmalate synthase [Xenococcus sp. PCC 7305]
Length=532

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/527 (55%), Positives = 362/527 (69%), Gaps = 30/527 (6%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGAT+  +EKL VA  LARLGVD+IEAGFP +S  D +AV+ +A  VG
Sbjct  10    IFDTTLRDGEQSPGATLNVEEKLEVAHALARLGVDVIEAGFPYASPGDFDAVQKVAAAVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P ICGLAR  K DI  A EA+K A   RIHTFIATS+IH+ YKL+ SR +V+ 
Sbjct  70    TENG---PTICGLARATKNDIKTAAEALKPAANGRIHTFIATSDIHLEYKLRKSRAEVLA  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
              A  MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  127   IAPEMVAYAKSF-VNDVEFSPEDAGRSDPEFLYQVLEAAIAAGATTVNIPDTVGYTTPSE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   FGALIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQVLGGLY----------TGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             +LEE+VMAL  R  Q     +          T ++T+QI   S++V   TG+ VQP+KAI
Sbjct  246   ALEELVMALHVR-RQYFNPFFGRPAESTEPLTQVDTKQIYKTSRLVSNLTGMAVQPNKAI  304

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VGANAFAHESGIHQDG+LK+K TYEI+    IGL    ++ IVLGKLSGR+A + ++ EL
Sbjct  305   VGANAFAHESGIHQDGVLKNKLTYEIMDATSIGL---TDNQIVLGKLSGRNAFRTRLKEL  361

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             G+E+   EL   F RFK VA++KK++TD D+ A+V+DE+ QP   +RL  VQV+CG    
Sbjct  362   GFELSENELNKAFIRFKDVADKKKEITDWDIEAIVNDEIRQPPELFRLELVQVSCGDNSC  421

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
              TATV +   +GEE    ++GTGPVDA YKA++ V +VP  L+E+S+ +VT GIDA+   
Sbjct  422   PTATVTIRTPEGEELTDAAIGTGPVDAIYKAINRVAEVPNELIEFSVQSVTGGIDAMGEV  481

Query  1720  RVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
              + +R D            N+ ++G  A  D+V++S RAYV ALN+L
Sbjct  482   TIRLRYD------------NQVYSGYSANTDIVVASARAYVKALNRL  516



>ref|WP_017293571.1| 2-isopropylmalate synthase [Geminocystis herdmanii]
Length=530

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/526 (54%), Positives = 365/526 (69%), Gaps = 28/526 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA++   EKL +AR LA+LGVD+IEAGFP +S+ D  AV+ IAE VG
Sbjct  10    IFDTTLRDGEQSPGASLNVDEKLTIARALAKLGVDVIEAGFPHASQGDFNAVQRIAETVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P ICGLAR  K+DI  A EA++ A K RIHTF+ATS+IH+ YKLK +R  V+ 
Sbjct  70    TQSG---PTICGLARATKQDIKSAGEALQPAFKRRIHTFLATSDIHLEYKLKKTRADVLA  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
                 MVAYA++    DVEFSPEDAGRSD EFLYQ+L   IKAGATT+NIPDTVGYT P+E
Sbjct  127   IVPEMVAYAKTF-TDDVEFSPEDAGRSDPEFLYQVLELAIKAGATTVNIPDTVGYTTPSE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             +G +I  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   YGAIIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VMAL  R +     L          T I+T+QI   S++V   TG+ VQP+KAIV
Sbjct  246   ALEELVMALHVRRQYFNPFLGRDVNSIEPLTNIDTKQIYKTSRLVSNLTGMIVQPNKAIV  305

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDG+LK++ TYEI+  E IGL     + IVLGKLSGR+A +++++ELG
Sbjct  306   GANAFAHESGIHQDGVLKNRLTYEIMDAESIGL---TTNQIVLGKLSGRNAFRSRLVELG  362

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +E+   +L   F RFK VA++K+++TD DL A+V+DE+ QP   +RL  VQV+CG     
Sbjct  363   FELSEDDLNKAFLRFKEVADKKREITDWDLEAIVNDEIQQPPELFRLELVQVSCGDHSSP  422

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TAT+ L   DG E    ++GTGPVDA YKA++ V ++P  L+EYS+ +VT GIDA+    
Sbjct  423   TATITLRTPDGSELSDAAIGTGPVDAVYKAINRVVQIPNELIEYSVKSVTAGIDAMGEVT  482

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             + ++ +            N++++G  A  DV+++S RAY+ ALN+L
Sbjct  483   IRLKHE------------NKTYSGYAANTDVIVASARAYISALNRL  516



>ref|WP_016516646.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 gb|EPF19322.1| 2-isopropylmalate synthase [Microcystis aeruginosa SPC777]
Length=533

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|XP_003541255.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=414

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/392 (66%), Positives = 314/392 (80%), Gaps = 2/392 (1%)
 Frame = +1

Query  262   RPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPAS  441
             RP+YIPN I D +YV I DTTLRDGEQSPGATMT KEKL +ARQL +LGV I++ GFP++
Sbjct  19    RPQYIPNHIPDSSYVCILDTTLRDGEQSPGATMTAKEKLDIARQLVKLGVHILQPGFPSA  78

Query  442   SEADLEAVRLIAEEVGRGEGD--HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIAT  615
             S +D  AV++IA+EVG   GD  +VPVI G  RC ++DI  AWEAVK+AK+PR+ T IAT
Sbjct  79    SNSDFMAVKMIAQEVGNAVGDDGYVPVIAGFCRCVEKDISTAWEAVKYAKRPRLCTSIAT  138

Query  616   SEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  795
             S IHM +KL+ S++QV++ A  MV +ARSLGC+D++F  EDA RSDREFLY+ILG VI+ 
Sbjct  139   SPIHMEHKLRKSKDQVIQIARDMVEFARSLGCNDIQFGAEDATRSDREFLYEILGVVIEV  198

Query  796   GATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAG  975
             GATT+NI DTVG  +P E G+LI DIK NTPGI NVIISTHC NDLGL+TANT+ GA  G
Sbjct  199   GATTVNIADTVGIVMPLELGKLIVDIKDNTPGIANVIISTHCHNDLGLATANTIEGARTG  258

Query  976   ARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGL  1155
             ARQLEVTINGIGERAGNASLEEVVM L  +G+  L GLYT INT+ I+  SKMVEEY+G+
Sbjct  259   ARQLEVTINGIGERAGNASLEEVVMVLASKGDHALNGLYTRINTRHILETSKMVEEYSGM  318

Query  1156  HVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHA  1335
             H+QPHK +VGANAF H SGIHQDGMLKHK TYE ISPE+IG  R    GIVLGKLSG  A
Sbjct  319   HLQPHKPLVGANAFVHASGIHQDGMLKHKGTYETISPEEIGHKRTTRIGIVLGKLSGSQA  378

Query  1336  LQAKMLELGYEIEGKELEDLFWRFKSVAERKK  1431
             L+ ++ ELGY+++  E++ +FW+FK++AE+KK
Sbjct  379   LRKRLEELGYDLKEDEVDSVFWQFKAMAEKKK  410



>ref|WP_012267775.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 ref|YP_001660460.1| 2-isopropylmalate synthase [Microcystis aeruginosa NIES-843]
 sp|B0JGK2.1|LEU1_MICAN RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Microcystis aeruginosa NIES-843]
 dbj|BAG05268.1| 2-isopropylmalate synthase [Microcystis aeruginosa NIES-843]
Length=533

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD +FLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPDFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V K+P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSAHAADTDIIVASARAYVSALNRL  517



>ref|XP_001696603.1| isopropylmalate synthase [Chlamydomonas reinhardtii]
 gb|EDP08580.1| isopropylmalate synthase [Chlamydomonas reinhardtii]
Length=444

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 345/454 (76%), Gaps = 26/454 (6%)
 Frame = +1

Query  544   RDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVE  723
             +D+++AW+AV+HAK+PR+HTFIATSEIHM    + S    +  A + V + RSLGC+D+E
Sbjct  1     QDLERAWDAVRHAKRPRVHTFIATSEIHMKVSQQGSATSGLHNAVAAVKHLRSLGCTDIE  60

Query  724   FSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENV  903
             FS EDAGRSD +FLY+ILGEVIKAGATTLNIPDT G+ +P+EFG+LIA IK NTPG +NV
Sbjct  61    FSSEDAGRSDPKFLYRILGEVIKAGATTLNIPDTTGWCLPHEFGELIAAIKKNTPGADNV  120

Query  904   IISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLG  1083
             IISTHCQNDLGLSTAN+LAGA AGARQ+E TINGIGERAGNASLEEVVMA+K RG     
Sbjct  121   IISTHCQNDLGLSTANSLAGAQAGARQIECTINGIGERAGNASLEEVVMAIKLRG-----  175

Query  1084  GLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIIS  1263
                            KMV +Y+G+ VQ HKAIVGANAFAHESGIHQDGMLK+++TYEI+S
Sbjct  176   ---------------KMVSDYSGMVVQAHKAIVGANAFAHESGIHQDGMLKNRETYEIMS  220

Query  1264  PEDIGLFRANES-GIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVT  1440
             PE IGL R  +  GIVLGK SGR+AL +++  LGYE+   EL+D+F RFK++A++KK +T
Sbjct  221   PESIGLPRQEQDRGIVLGKHSGRNALNSRLRTLGYELSQSELDDVFKRFKALADKKKGIT  280

Query  1441  DDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDA  1620
             D+D++AL+SDE+ QP+V W L D+QV CG++G+ TATV++   DG   +   VGTGPVDA
Sbjct  281   DEDILALMSDELHQPKVIWELLDLQVVCGTMGMPTATVQMKGPDGIARIGVGVGTGPVDA  340

Query  1621  AYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR-----EDQASIHGSTGGSANRS  1785
             AYKAVD + +V   L +YS+++VT+GI+A+A TRV+IR      D      +  G+  R 
Sbjct  341   AYKAVDSLVRVEAELSDYSVSSVTQGIEALAHTRVMIRPSGKMSDAGYSEHAALGTVQRQ  400

Query  1786  FNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSR  1887
             F+G+GA  D+V++S RAYV ALNK++G++ +  R
Sbjct  401   FSGSGANEDIVVASARAYVSALNKMIGWRRVGRR  434



>ref|WP_011956698.1| 2-isopropylmalate synthase [Roseiflexus sp. RS-1]
 ref|YP_001276302.1| 2-isopropylmalate synthase [Roseiflexus sp. RS-1]
 gb|ABQ90352.1| 2-isopropylmalate synthase [Roseiflexus sp. RS-1]
Length=556

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/527 (54%), Positives = 370/527 (70%), Gaps = 14/527 (3%)
 Frame = +1

Query  298   NYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIA  477
             ++VRIFDTTLRDGEQ+PG TMT +EKL VARQLARLGVDIIEAGFPA+S  D  AV  IA
Sbjct  3     DHVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLARLGVDIIEAGFPAASPGDWAAVHEIA  62

Query  478   EEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSRE  657
               VG  +G   P+I  LAR NK DIDKAW A++ A K RIHTFI++S+IH+ ++L+ +RE
Sbjct  63    RTVGTPDG---PIIAALARANKDDIDKAWSAIQPAAKKRIHTFISSSDIHIEHQLRSTRE  119

Query  658   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  837
             +V+E+A  MV YARSL C DVEFSP DA RSD E++Y++L  V++ GATTLNIPDTVGY 
Sbjct  120   EVLERARMMVRYARSL-CDDVEFSPMDATRSDPEYVYRMLAAVVEEGATTLNIPDTVGYA  178

Query  838   IPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGER  1017
              P E+ +LIA I  + PG E VIISTHC +DLG++ AN+LAG  AGARQ+E TINGIGER
Sbjct  179   TPEEYAELIAGIYRHVPGAEKVIISTHCHDDLGMAVANSLAGVRAGARQIECTINGIGER  238

Query  1018  AGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAF  1197
             AGNASLEEVVMALK R  +   G+ T INT+++  +S++V    G+ V P+KAIVGANAF
Sbjct  239   AGNASLEEVVMALKTR--RSFFGVDTRINTRELARSSRLVSTIIGMPVPPNKAIVGANAF  296

Query  1198  AHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYEIEG  1377
             AHESGIHQDG+LKH+ TYEI+    IGL   + + IVLGK SGR+AL+ K+  +GYE + 
Sbjct  297   AHESGIHQDGVLKHRMTYEIMDATTIGL---DGNAIVLGKHSGRNALRTKLAAMGYEFDS  353

Query  1378  -KELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTATV  1554
              +E   +F RFK + ++KK V D DL  L +         +RL  VQVTCG+     ATV
Sbjct  354   EEEFNQVFQRFKELCDKKKVVDDRDLEVLATGGSLHTPDLYRLDHVQVTCGTGVTPVATV  413

Query  1555  KLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVLIR  1734
             ++ D DG  H   + GTGPVDA YKA+D +   P  L+E+S+ AVTEGIDA+A   V IR
Sbjct  414   RITDPDGNTHTTAAHGTGPVDAIYKAIDKIVGRPNELIEFSIKAVTEGIDAVAEVSVRIR  473

Query  1735  EDQASIH-GSTGGSANRS---FNGTGAAMDVVISSVRAYVGALNKLL  1863
             E    +  G      +R    ++G  A  D ++++  +Y+ ALNK++
Sbjct  474   EPGNEVQEGEYRVGRHRGPQIYSGYSANTDTIVAAAESYMTALNKMI  520



>ref|WP_002796207.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI22861.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9809]
Length=533

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AASVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA++ V K+P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAINRVVKIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSAHAADTDIIVASARAYVSALNRL  517



>ref|WP_024544389.1| 2-isopropylmalate synthase [Synechococcus sp. NKBG15041c]
Length=533

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/526 (55%), Positives = 362/526 (69%), Gaps = 28/526 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGAT+   EKLA+AR LARLGVD+IEAGFP +S  D +AV+ IA EVG
Sbjct  10    IFDTTLRDGEQSPGATLNGDEKLAIARALARLGVDVIEAGFPRASRGDFDAVQRIAAEVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P+ICGLAR  K DI+ A  A+K A K RIHTFIATS+IH+ YKL+ +R++V+E
Sbjct  70    TETG---PIICGLARATKGDIEAAGNALKSAFKHRIHTFIATSDIHLEYKLRKTRKEVLE  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
              A  MVAYA++   +DVEFSPEDAGRSD EFLYQIL  VI AGATT+NIPDTVGYT P E
Sbjct  127   IAPEMVAYAKTF-TNDVEFSPEDAGRSDPEFLYQILEAVIDAGATTVNIPDTVGYTTPAE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   FGALIKGIKENVPNIDRAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VM L  R +     L          T INT++I   S++V   TGL VQ +KAIV
Sbjct  246   ALEELVMGLHVRRQYFNPFLGRPVDSEVPLTNINTKEIYKTSRLVSNLTGLSVQANKAIV  305

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             G NAFAHESGIHQDG+LK+K TYEI+  + IGL    ++ I+LGK SGR+A + ++ ELG
Sbjct  306   GLNAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---TDNQIILGKHSGRNAFRTRLAELG  362

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +E+   +L   F RFK +A++KK++TD DL A+V DE  QP   +RL  VQV+CG     
Sbjct  363   FELSDNDLNKAFLRFKDLADKKKEITDWDLEAIVKDETQQPPELFRLELVQVSCGDNAQP  422

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TAT+ +   DG+E    ++GTGPVDA YKA++ V +VP  L+EYS+ +VT GIDAI    
Sbjct  423   TATIAIRTPDGKELTDAAIGTGPVDAIYKAINRVVQVPNELIEYSVQSVTAGIDAIGEVT  482

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             + +R +             R ++G  A  D++++S RAY+ ALN+L
Sbjct  483   IRLRHE------------GRIYSGHAANTDIIVASARAYISALNRL  516



>emb|CAJ55506.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. petraea]
Length=507

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/411 (61%), Positives = 332/411 (81%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE V+ IA+ VG     E  +VPVIC +AR  +RDI+ AWEAVK+AK+PRI  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEETGYVPVICAIARSKQRDIEAAWEAVKYAKRPRILIFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S +  A+SLG +D++   ED GRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAVSSIRLAKSLGFNDIQLGCEDGGRSDKEFLCKILGEAI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAG T +N+ DTVG  +P+E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGVTVVNVADTVGINMPHEYGELVTYLKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMALKCRG  V+ G+YT I+T+QI+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVINGVYTRIDTRQIMATSKMVQEYT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPEDIG+ ++  SG+VLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDIGVVKSQNSGLVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD D+ ALV  SDE+
Sbjct  430   HAVKDRLNELGYELDDEKLNDVFSRFRDLTKHKKRITDADMKALVTSSDEI  480



>ref|WP_002773852.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI09342.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 7941]
Length=533

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 366/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG GE D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AGSVG-GEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA++ V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAINRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_006622399.1| MULTISPECIES: 2-isopropylmalate synthase [Arthrospira]
 emb|CCE20079.1| 2-isopropylmalate synthase [Arthrospira sp. PCC 8005]
 gb|EKD09588.1| 2-isopropylmalate synthase [Arthrospira platensis C1]
 emb|CDM98586.1| 2-isopropylmalate synthase [Arthrospira sp. PCC 8005]
Length=538

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/532 (55%), Positives = 366/532 (69%), Gaps = 30/532 (6%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQ PGAT+   EKL +ARQLARLGVD+IEAGF  +S  D EAV+ I
Sbjct  7     PDRVIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASSGDFEAVQRI  66

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             AE VG   G   P+IC LAR  K DI+ A +A+K A  PRIHTFIATS+IH+ YKLK +R
Sbjct  67    AETVGTENG---PIICSLARSVKADIEAAAKALKPAAHPRIHTFIATSDIHLKYKLKKTR  123

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V++  + MVAYA+SL C D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   QEVLDITSEMVAYAKSL-CQDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  182

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  183   TTPSEFGGLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  242

Query  1015  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQQIIMASKMVEEYTGLHVQ  1164
             RAGNA+LEE+VMAL  R  Q     +          T INT++I   S++V   TG+ VQ
Sbjct  243   RAGNAALEELVMALHVR-RQFFNPFFGRPADSEAPITNINTREIYKTSRLVSNLTGMLVQ  301

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IGL   N++ IVLGK SGRHA Q 
Sbjct  302   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQN  358

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELG+++   E+   F RFK VA++KK+VT+ D+ A+V+DE+ Q    +RL  VQV+C
Sbjct  359   RLQELGFDLSDDEINKAFVRFKDVADKKKEVTNWDIEAIVNDEIQQTPELFRLELVQVSC  418

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+    TATV L    G+E    + GTGPVDA YKA++ V  VP  L+E+S+ +VT GID
Sbjct  419   GNNARPTATVTLRTPQGQELTDAATGTGPVDAVYKAINRVVNVPNELIEFSVQSVTAGID  478

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R               R F+G  A  D++++S +AY+ ALN+L
Sbjct  479   AIGEVTIRLR------------YQGRVFSGHAANTDIIVASAQAYINALNRL  518



>ref|XP_006290200.1| hypothetical protein CARUB_v10003885mg [Capsella rubella]
 gb|EOA23098.1| hypothetical protein CARUB_v10003885mg [Capsella rubella]
Length=499

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/405 (62%), Positives = 324/405 (80%), Gaps = 3/405 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVRI DTTLRDGEQSPGA +T  +KL +ARQL +L VDI+E GFP 
Sbjct  70    RCPEYIPNKLPDTNYVRILDTTLRDGEQSPGAALTPPQKLEIARQLVKLRVDIMEVGFPV  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  +VPVI  LARC K DID AWEAVK+AK+PR+  F 
Sbjct  130   SSEEEFETIKTIAKTVGNEVDEETGYVPVIAALARCKKGDIDAAWEAVKYAKRPRVTLFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM +KLK ++E+++E   S + YA+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  190   STSDIHMKHKLKKTKEELIEITVSSIKYAKSLGFTDIQIGCEDGGRSDKDFLCKILGESI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATT+   DTVG  +P EFG+L+A +KANTPG +NV+ + HC NDLG++TANT++G C
Sbjct  250   KAGATTVGFADTVGINMPPEFGELVAYVKANTPGSDNVVFAIHCHNDLGVATANTISGIC  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRGE  + G+YT INT QI+  SKMV+E+T
Sbjct  310   AGARQIEVTINGIGERSGNAPLEEVVMALKCRGEYQMDGVYTKINTHQIMATSKMVQEHT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G++VQPHK IVG N F HESGIHQDGMLK++ TYEI+SPEDIG+ ++ +SG+VLGKLSGR
Sbjct  370   GMYVQPHKPIVGDNCFVHESGIHQDGMLKNRSTYEILSPEDIGIVKSLKSGLVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV  1464
             HA++ ++ ELGYEI  ++L D+F RFK++ ++KK++TDDDL ALV
Sbjct  430   HAVKDRLKELGYEINDEKLNDIFSRFKNLTKQKKRITDDDLKALV  474



>ref|WP_017714000.1| 2-isopropylmalate synthase [Prochlorothrix hollandica]
Length=549

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/527 (55%), Positives = 364/527 (69%), Gaps = 29/527 (6%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA++   EKL +ARQLARLGVDIIEAGFP +S  D EAV+ IAE VG
Sbjct  17    IFDTTLRDGEQSPGASLNLDEKLTIARQLARLGVDIIEAGFPYASSGDFEAVQRIAETVG  76

Query  490   RG-EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVV  666
                +G   P ICGLAR  + DI  A +A+K A KPRIHTF+A+S+IH+ YKLK +R +V+
Sbjct  77    ASLDG---PTICGLARATRHDIKAAGDALKPAAKPRIHTFLASSDIHLQYKLKKTRAEVL  133

Query  667   EKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPN  846
             E A  MVAYA++    DVEFSPEDAGRSD EFLY +L  VI AGATT+NIPDTVGYT P 
Sbjct  134   EIAPEMVAYAKTF-VDDVEFSPEDAGRSDPEFLYPLLEAVIAAGATTVNIPDTVGYTTPG  192

Query  847   EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGN  1026
             EFG LI  IK N   I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGN
Sbjct  193   EFGALIRGIKDNVSNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGN  252

Query  1027  ASLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             A+LEE+VMAL  R +     LG         T I TQ+I   S++V   TG+ VQP+KAI
Sbjct  253   AALEELVMALHVRRQYFNPFLGRDPESEAPLTQIQTQEIYKTSRLVSNLTGMSVQPNKAI  312

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VG NAFAHESGIHQDGMLK+K TYEI+  E IGL   N + I LGKLSGR+A +++++EL
Sbjct  313   VGTNAFAHESGIHQDGMLKNKRTYEIMDAELIGL---NTNRITLGKLSGRNAFRSRLMEL  369

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             G+E+  +EL   F RFK VA++K++VTD DL A+V+DE  Q    ++L  VQV+CGS   
Sbjct  370   GFELADEELNKAFARFKDVADKKREVTDWDLEAIVNDETQQAADLFQLKRVQVSCGSPAC  429

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
              TAT+ L   DG      + GTGPVDA Y+A++ + KVP  L+E+S+ +VTEGIDA+   
Sbjct  430   PTATITLQTPDGALLTDAATGTGPVDAVYRAINRMVKVPNELIEFSVKSVTEGIDAMGEV  489

Query  1720  RVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
              + +R +            +R F+G  A  D++++S +AYV ALN+L
Sbjct  490   TIRLRHE------------SRIFSGHAANTDIIVASAQAYVHALNRL  524



>ref|WP_002786970.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI16638.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9807]
Length=533

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG  E D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AGSVG-SEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V++    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLDIVPEMVAYAKSF-LKDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA+D V ++P  L+ +S+  VTEGIDA
Sbjct  419   NNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>emb|CAQ56035.1| 2-isopropylmalate synthase, B genome specific 1 [Brassica juncea]
 emb|CAQ56036.1| 2-isopropylmalate synthase, B genome specific 1 [Brassica juncea]
Length=505

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/412 (61%), Positives = 329/412 (80%), Gaps = 5/412 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T  +K+ +ARQLA+L VDI+E GFP 
Sbjct  66    RWPEYIPNKVPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  125

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+A++PRI  F 
Sbjct  126   SSEEEFETIKTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAERPRIVVFT  185

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLK +RE+VVE   S + +A+SLG  D+EF  ED GRSD++++ ++  E I
Sbjct  186   STSDIHLKYKLKTTREEVVEITKSSIRFAKSLGFKDIEFGCEDGGRSDKDYVCKVFEEAI  245

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATT+  PDTVG  +P E+G+L+  +KANTPGI++VI S HC NDLG++TANT+AG C
Sbjct  246   KAGATTVAFPDTVGINMPQEYGELVRYVKANTPGIDDVIFSVHCHNDLGVATANTIAGVC  305

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRG  ++GG+YT I+T+QI+  SKMV+EYT
Sbjct  306   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAYLMGGVYTRIDTRQIMATSKMVQEYT  365

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  366   GLYVQPHKPIVGANCFVHESGIHQDGVLKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  425

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEVF  1479
             HA++ ++ ELGYEI  ++L ++F RF+ + ++KK+VTDDDL ALV   D +F
Sbjct  426   HAVKGRLKELGYEINDEKLNEVFSRFRDLTKQKKRVTDDDLKALVMCGDAIF  477



>ref|WP_018399927.1| 2-isopropylmalate synthase [filamentous cyanobacterium ESFC-1]
Length=535

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/533 (54%), Positives = 359/533 (67%), Gaps = 28/533 (5%)
 Frame = +1

Query  289   LDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVR  468
             + P+ + IFDTTLRDGEQSPGAT+  +EKL +AR LA+LGVD+IEAGFP +S  D EAV+
Sbjct  3     IQPDRIIIFDTTLRDGEQSPGATLNVEEKLLIARSLAKLGVDVIEAGFPFASPGDFEAVQ  62

Query  469   LIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKM  648
              IA+ VG  +G   P ICGLAR  K DI +A EA+K A K RIHTFIATS+IH+ YKL+ 
Sbjct  63    KIADTVGTQDG---PTICGLARARKDDIKRAGEALKPAAKGRIHTFIATSDIHLKYKLRK  119

Query  649   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  828
             SRE V+     MV YA+S    DVEFSPEDAGRSD EFLYQ+L   I +GATT+NIPDTV
Sbjct  120   SREDVLATIPEMVGYAKSF-VDDVEFSPEDAGRSDPEFLYQVLETAIASGATTVNIPDTV  178

Query  829   GYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGI  1008
             GY  P EFGQLI  I  N P I   IIS H  NDLGL+ AN L     GARQLE TINGI
Sbjct  179   GYLTPGEFGQLIRGITENVPNINQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1009  GERAGNASLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHV  1161
             GERAGNA+LEE+VMAL  R +     LG         T I+T+QI   S++V   TG+ V
Sbjct  239   GERAGNAALEELVMALYVRRQYYNPFLGRPPESEAPLTNIDTKQIYKTSRLVSNLTGMTV  298

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QP+KAIVGANAFAHESGIHQDG+LK+K TYEI+  E IGL   NE+ IVLGK SGRHA  
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---NENQIVLGKHSGRHAFS  355

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELGY +   EL   F  FK VA++KK +TD DL A+V DE  QP   +RL  VQV+
Sbjct  356   KRLQELGYNLSDTELNRAFLVFKDVADKKKVITDWDLEAIVGDETQQPPELFRLEYVQVS  415

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG     TATV +   +G E    ++GTGPVDA YKA++ V  V   L E+++ +VTEGI
Sbjct  416   CGDRAQPTATVTIRTPEGRELTDAAIGTGPVDAVYKAINRVVNVSNQLSEFAVKSVTEGI  475

Query  1702  DAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             DA+    + +R +            N++++G  A  D++++S RAY+ ALN+L
Sbjct  476   DAMGEVTIRLRHE------------NQTYSGHAADTDIIVASARAYINALNRL  516



>gb|KDR56307.1| 2-isopropylmalate synthase [Arthrospira platensis str. Paraca]
Length=536

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/532 (55%), Positives = 367/532 (69%), Gaps = 30/532 (6%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQ PGAT+   EKL +ARQLARLGVD+IEAGF  +S  D EAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASSGDFEAVQRI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             AE VG   G   P+IC LAR  K DI+ A +A+K A  PRIHTFIATS+IH+ YKLK +R
Sbjct  65    AETVGTENG---PIICSLARSVKADIEAAAKALKPAAHPRIHTFIATSDIHLKYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V++  + MVAYA+SL C D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLDITSEMVAYAKSL-CEDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEFGGLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQQIIMASKMVEEYTGLHVQ  1164
             RAGNA+LEE+VMAL  R  Q     +          T INT++I   S++V   TG+ VQ
Sbjct  241   RAGNAALEELVMALHVR-RQFFNPFFGRPADSEVPITNINTREIYKTSRLVSNLTGMLVQ  299

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IGL   N++ IVLGK SGRHA Q 
Sbjct  300   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQN  356

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELG+++   E+   F RFK VA++KK+VT+ D+ A+V+DE+ Q    +RL  VQV+C
Sbjct  357   RLQELGFDLSDDEINKAFVRFKDVADKKKEVTNWDIEAIVNDEIQQTPELFRLELVQVSC  416

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+    TATV L   +G+E    + GTGPVDA YKA++ V  VP  L+E+++ +VT GID
Sbjct  417   GNNARPTATVTLRTPEGQELTDAATGTGPVDAVYKAINRVVNVPNELIEFAVQSVTAGID  476

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R               R F+G  A  D++++S +AY+ ALN+L
Sbjct  477   AIGEVTIRLR------------YQGRVFSGHAANTDIIVASAQAYINALNRL  516



>emb|CAJ55510.1| methylthioalkylmalate synthase b [Arabidopsis cebennensis]
Length=502

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/411 (60%), Positives = 328/411 (80%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEYIPN++   NYVR+ DTTLRDGEQSPGA +T  +KL +ARQLA+L VDI+E GFP 
Sbjct  69    RRPEYIPNKLPHKNYVRVLDTTLRDGEQSPGAALTPPQKLEIARQLAKLRVDIMEVGFPV  128

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + EA++ IA+ VG     E  +VPVICG+ARC  RDI+ AWEA+K+AK+PR+  F 
Sbjct  129   SSEEEFEAIKTIAKTVGNEVDEETGYVPVICGIARCKNRDIEAAWEALKYAKRPRVILFT  188

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A + V YA+SLG  D+EF  ED GR++++FL +ILGE I
Sbjct  189   STSDIHMKYKLKKTKEEVIEMAVNSVKYAKSLGFKDIEFGCEDGGRTEKDFLCKILGESI  248

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATT+   DTVG  +P EFG+L+A +K NTPG ++++ + HC NDLG++TANT++G C
Sbjct  249   KAGATTVGFADTVGINMPPEFGELVAYVKENTPGADDIVFTIHCHNDLGVATANTISGIC  308

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+QI+  SKMV+E+T
Sbjct  309   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGEYLMDGVYTKIDTRQIMATSKMVQEHT  368

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G++VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGI+ GKLSGR
Sbjct  369   GMYVQPHKPIVGDNCFVHESGIHQDGILKNRSTYEILSPEDVGIVKSENSGIIFGKLSGR  428

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYEI  ++  D+F R++ + + KK++TDDDL ALV   DE+
Sbjct  429   HAVKDRLKELGYEISDEKFNDIFSRYRELTKEKKRITDDDLKALVVNGDEI  479



>ref|XP_009144531.1| PREDICTED: methylthioalkylmalate synthase 1, chloroplastic-like 
[Brassica rapa]
Length=497

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/425 (59%), Positives = 332/425 (78%), Gaps = 4/425 (1%)
 Frame = +1

Query  205   SFQSFSAAAVRCESSPPARR-PEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLA  381
             S +S  AA    +  P  +R PEYIPN+I D NYVR+FDTTLRDGEQSPG  +T  +K+ 
Sbjct  52    SSKSQKAATSSIDLQPVMKRWPEYIPNKIADKNYVRVFDTTLRDGEQSPGGALTPLQKVE  111

Query  382   VARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVGR---GEGDHVPVICGLARCNKRDI  552
             +ARQLA+L VD+++ GFPASSE +LEAV+ IA+ VG     E  +VPVIC +ARC   DI
Sbjct  112   IARQLAKLRVDVMDVGFPASSEEELEAVKSIAKTVGNEVDAETGYVPVICVIARCKHEDI  171

Query  553   DKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSP  732
             + AWEA+K+AK+PRI  FI TSEIHM YKLK ++++V+E A S + +A+ +G SD++F  
Sbjct  172   EAAWEALKYAKRPRIFLFICTSEIHMKYKLKKTKDEVIEMAKSSIRFAKRIGFSDIQFGC  231

Query  733   EDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIIS  912
             ED GRSD++FL +I+G+ I  G TT+ + DTVG  IP EFG+++  +K NTPGI++V+ S
Sbjct  232   EDGGRSDKDFLCKIMGDAINEGVTTVTLADTVGNNIPQEFGEMVTYLKTNTPGIDDVVFS  291

Query  913   THCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLY  1092
              HC NDLGL+TANT++G CAGARQ+EVTINGIGER+GNASLEEVV+ALKCRG  V+GG+Y
Sbjct  292   LHCHNDLGLATANTISGVCAGARQVEVTINGIGERSGNASLEEVVLALKCRGAYVMGGVY  351

Query  1093  TGINTQQIIMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPED  1272
             T I+T+ I+  SKMV+EYTGL+VQPHK IVG N F HESGIHQDG+LKH+ TYEI SPED
Sbjct  352   TRIDTRHIMATSKMVQEYTGLYVQPHKPIVGTNCFVHESGIHQDGILKHRSTYEIFSPED  411

Query  1273  IGLFRANESGIVLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDL  1452
             IG  ++ +S IVLGKLSGRHA++ ++ ++GYEI  ++  D+F RF+ + ++KK++TD DL
Sbjct  412   IGAEKSQDSCIVLGKLSGRHAVKDRLRKIGYEISDEKFNDIFSRFRELTKQKKRITDADL  471

Query  1453  IALVS  1467
             IALV+
Sbjct  472   IALVA  476



>ref|WP_006618368.1| 2-isopropylmalate synthase [Arthrospira platensis]
 ref|YP_005066483.1| 2-isopropylmalate synthase [Arthrospira platensis NIES-39]
 dbj|BAI87945.1| 2-isopropylmalate synthase [Arthrospira platensis NIES-39]
Length=538

 Score =   541 bits (1393),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 290/532 (55%), Positives = 367/532 (69%), Gaps = 30/532 (6%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQ PGAT+   EKL +ARQLARLGVD+IEAGF  +S  D EAV+ I
Sbjct  7     PDRVIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASSGDFEAVQRI  66

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             AE VG   G   P+IC LAR  K DI+ A +A+K A  PRIHTFIATS+IH+ YKLK +R
Sbjct  67    AETVGTENG---PIICSLARSVKADIEAAAKALKPAAHPRIHTFIATSDIHLKYKLKKTR  123

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V++  + MVAYA+SL C D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   QEVLDITSEMVAYAKSL-CEDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  182

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  183   TTPSEFGGLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  242

Query  1015  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQQIIMASKMVEEYTGLHVQ  1164
             RAGNA+LEE+VMAL  R  Q     +          T INT++I   S++V   TG+ VQ
Sbjct  243   RAGNAALEELVMALHVR-RQFFNPFFGRPADSEVPITNINTREIYKTSRLVSNLTGMLVQ  301

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IGL   N++ IVLGK SGRHA Q 
Sbjct  302   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQN  358

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             ++ ELG+++   E+   F RFK VA++KK+VT+ D+ A+V+DE+ Q    +RL  VQV+C
Sbjct  359   RLQELGFDLSDDEINKAFVRFKDVADKKKEVTNWDIEAIVNDEIQQTPELFRLELVQVSC  418

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+    TATV L   +G+E    + GTGPVDA YKA++ V  VP  L+E+++ +VT GID
Sbjct  419   GNNARPTATVTLRTPEGQELTDAATGTGPVDAVYKAINRVVNVPNELIEFAVQSVTAGID  478

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R               R F+G  A  D++++S +AY+ ALN+L
Sbjct  479   AIGEVTIRLR------------YQGRVFSGHAANTDIIVASAQAYINALNRL  518



>ref|WP_017750120.1| 2-isopropylmalate synthase [Scytonema hofmanni]
Length=532

 Score =   540 bits (1392),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 291/533 (55%), Positives = 366/533 (69%), Gaps = 28/533 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P  + IFDTTLRDGEQ PGAT+   EKLA+A+QLARLGVDIIEAGF  +S  D EAV  I
Sbjct  5     PERIIIFDTTLRDGEQCPGATLNIDEKLAIAKQLARLGVDIIEAGFAFASPGDFEAVSKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG  +G   PVIC LAR    DI  A EA+K A K RIHTFIATS+IH+ YKLK ++
Sbjct  65    AQTVGTEDG---PVICSLARARHDDIKAAAEAIKPAVKGRIHTFIATSDIHLKYKLKKNK  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
              +V+  A  MVAYA+S    D+EFSPEDAGRS+ EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   AEVLAIAEEMVAYAKSF-TDDIEFSPEDAGRSEAEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEFGSLIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLESVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGE---QVLGGL------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     LG L       T I+T+QI   S++V   TGL VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNSFLGRLVESEEPLTNIDTRQIYKTSRLVSNLTGLLVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IGL    ++ IVLGK SGR+A + +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQLIGL---TQNQIVLGKHSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELGYE+   EL   F RFK +A++KK++TD DL A+V+DE+ Q    +RL  VQV+CG
Sbjct  358   LRELGYELTETELNKAFVRFKEIADKKKEITDWDLEAIVNDEIQQAPDLFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             S    TATV +   +GEE +  ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA
Sbjct  418   SNARPTATVTIRTPEGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             +    + ++ +            +R F+G  A  D++++S +AYV ALN+L  
Sbjct  478   LGEVTIRLKYE------------DRVFSGHAANTDIIVASAQAYVNALNRLFA  518



>ref|WP_008276101.1| 2-isopropylmalate synthase [Cyanothece sp. CCY0110]
 gb|EAZ90794.1| 2-isopropylmalate synthase [Cyanothece sp. CCY0110]
Length=537

 Score =   541 bits (1393),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 296/548 (54%), Positives = 375/548 (68%), Gaps = 28/548 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ + IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D +AV+ I
Sbjct  5     PDRIIIFDTTLRDGEQSPGASLTVEEKLTIARSLARLGVDIIEAGFPYASPGDFKAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG   G   P ICGLAR  K DI  A EA+K A K RIHTFIATS+IH+ +KLK +R
Sbjct  65    AQTVGTENG---PTICGLARATKNDIKTAAEALKPAFKSRIHTFIATSDIHLKHKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             E+V+  A  MVAYA++    DVEFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGY
Sbjct  122   EEVLAIAPEMVAYAKTF-TDDVEFSPEDAGRSDPEFMYQVLEAAIAAGATTINIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEFGALIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T INTQ+I   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNPFLGRSVDATEPLTNINTQEIYKTSRLVSNLTGMIVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK+K TYEI+  E IGL     + IVLGKLSGR+A + +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F RFK VA++KK++TD DL A+V+DE+ Q    +RL  VQV+CG
Sbjct  358   LNELGFELSETELNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
                  TATV L + +G+E    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA
Sbjct  418   DHSAPTATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQNLVSR  1887
             +    + +R +             R ++G  A  D++ +S RAY+ ALN+L G     S+
Sbjct  478   MGEVTIRLRYE------------GRIYSGYAANTDIITASARAYISALNRLYGSIQEESK  525

Query  1888  YNKTQGTV  1911
              N +QG +
Sbjct  526   ENSSQGVL  533



>ref|XP_009137065.1| PREDICTED: methylthioalkylmalate synthase 2, chloroplastic-like, 
partial [Brassica rapa]
Length=442

 Score =   537 bits (1383),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 252/412 (61%), Positives = 333/412 (81%), Gaps = 7/412 (2%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIP+++ D NYVR+FDTTLRDGEQ+PG  +T  +KL +ARQLA+L VDI+E GFP 
Sbjct  8     RWPEYIPHKLPDKNYVRVFDTTLRDGEQAPGGALTPPQKLEIARQLAKLRVDIMEVGFPV  67

Query  439   SSEADLEAVRLIAEEVGRGEGD----HVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTF  606
             SSE + E V+ IA+ VG  E D    +VPVIC +AR    DI+ AWEAVK+AK+P+I  F
Sbjct  68    SSEEEFETVKTIAKTVG-NEVDEATGYVPVICAIARSKPEDIEAAWEAVKYAKRPKILIF  126

Query  607   IATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  786
              +TS+IHM YKLK ++E+V+E A S V +A+SLG  DV+   ED GRS++EFL +ILGE 
Sbjct  127   TSTSDIHMKYKLKKTKEEVIEMAASSVKFAKSLGFVDVQLGCEDGGRSEKEFLCKILGES  186

Query  787   IKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  966
             IKAGATT+N+ DTVG  +P+E+G+L++ +KANTPGI++VI S HC NDLG++TANT+AG 
Sbjct  187   IKAGATTVNVADTVGINMPDEYGELVSYLKANTPGIDDVIFSVHCHNDLGVATANTIAGV  246

Query  967   CAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEY  1146
             CAGARQ+EVT+NGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+QI+  S+MV+EY
Sbjct  247   CAGARQVEVTVNGIGERSGNAPLEEVVMALKCRGEYLMDGVYTRIDTRQIMATSQMVQEY  306

Query  1147  TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSG  1326
             TGL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  + IVLGKLSG
Sbjct  307   TGLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQSASIVLGKLSG  366

Query  1327  RHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEV  1476
             RHA++ ++ ELGYE++ ++L D+F RF+ + + KK++TDDDL ALV+  DEV
Sbjct  367   RHAVKDRLKELGYELDDEKLNDIFSRFRDLTKHKKRITDDDLKALVTCRDEV  418



>ref|WP_015116700.1| 2-isopropylmalate synthase [Rivularia sp. PCC 7116]
 ref|YP_007053669.1| 2-isopropylmalate synthase [Rivularia sp. PCC 7116]
 gb|AFY53122.1| 2-isopropylmalate synthase [Rivularia sp. PCC 7116]
Length=530

 Score =   540 bits (1392),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 292/533 (55%), Positives = 367/533 (69%), Gaps = 31/533 (6%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA +   EKL +A+QLARLGVD+IEAGF  +S  D EAV  IA+ VG
Sbjct  10    IFDTTLRDGEQSPGAALNIDEKLTIAKQLARLGVDVIEAGFAFTSPGDFEAVSRIAQTVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   PVIC LAR  K DI  A EA+K A K RIHTF+ATS+IH+ YKL+ +RE+V+ 
Sbjct  70    TENG---PVICSLARAKKDDIKTAAEAIKPAAKGRIHTFLATSDIHLKYKLRKTREEVLS  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
              A  MVAYA+S   +D+EFSPEDAGRSD EFLYQ+L  VI AGATT+NIPDTVGY  P+E
Sbjct  127   IAEEMVAYAKSF-TNDIEFSPEDAGRSDPEFLYQVLERVIAAGATTVNIPDTVGYITPSE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG LI  I  N   I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   FGALIKGINDNVSNIDKAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQ---VLG-------GLYTGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             +LEE+VMAL  R +     LG       GL T I+TQQI   S++V   TG+ VQP+KAI
Sbjct  246   ALEELVMALHVRRQYFNPFLGRAVDSEAGL-TNIDTQQIYKTSRLVSNLTGMLVQPNKAI  304

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VG NAFAHESGIHQDG+LK+K TYEI+  + IGL    E+ IVLGKLSGR+A++ ++ EL
Sbjct  305   VGTNAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---TENQIVLGKLSGRNAVRTRLKEL  361

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             G+E+   +L   F RFK VA++KK++TD DL ALV+DE+ Q    ++L  VQV+CGS   
Sbjct  362   GFELSENDLNKAFVRFKEVADKKKEITDWDLEALVNDEIQQAPDLFKLELVQVSCGSNAS  421

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
              TATV L +  GEE    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDAI   
Sbjct  422   PTATVTLRNPQGEELTDAAIGTGPVDAIYKAINRVVNVPNKLIEFSVQSVTAGIDAIGEV  481

Query  1720  RVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG-FQN  1875
              + ++ +            ++ ++G  A  D++++S +AYV ALN+L G  QN
Sbjct  482   TIRLKYE------------DKIYSGRSANTDIIVASAQAYVNALNRLYGALQN  522



>ref|WP_024970954.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
Length=533

 Score =   540 bits (1392),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 287/531 (54%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG GE D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AGSVG-GEADS-PIICGLARATQKDIKSAADAIRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MV YA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVDYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA++ V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAINRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_026797078.1| 2-isopropylmalate synthase [Planktothrix prolifica]
 gb|KEI66589.1| LeuA [Planktothrix agardhii NIVA-CYA 126/8]
Length=539

 Score =   540 bits (1392),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 287/532 (54%), Positives = 363/532 (68%), Gaps = 28/532 (5%)
 Frame = +1

Query  292   DPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRL  471
             +P+ + IFDTTLRDGEQ PGAT+   EKL +ARQLARLGVD+IEAGF  +S  D +AV  
Sbjct  6     NPDRIIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASHGDFDAVSR  65

Query  472   IAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMS  651
             IAE VG  +G   PVIC LAR  K DI+ A +AV  A   RIHTFIATS+IH+ YKLK +
Sbjct  66    IAEAVGTEDG---PVICSLARSVKGDIEAAAKAVSPAFHRRIHTFIATSDIHLQYKLKKT  122

Query  652   REQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVG  831
             R +V++  + MVAYA+S    D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVG
Sbjct  123   RSEVLDITSEMVAYAKSF-VDDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVG  181

Query  832   YTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIG  1011
             YT P EFG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIG
Sbjct  182   YTTPAEFGAIIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIG  241

Query  1012  ERAGNASLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             ERAGNA+LEE+VMAL  R +     LG         T I+T+QI   S++V   TG+ VQ
Sbjct  242   ERAGNAALEELVMALHVRRQYFNPFLGREPESEASLTNIDTRQIYKTSRLVSNLTGMLVQ  301

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LKHK TYEI+  + IGL   N++ IVLGK SGRHA Q+
Sbjct  302   PNKAIVGANAFAHESGIHQDGILKHKRTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQS  358

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             +M ELG+E+   E+   F RFK +A++KK++TD DL A+V DE+ Q    + L  VQV+C
Sbjct  359   RMRELGFELTDPEVNKAFVRFKELADKKKEITDWDLEAIVKDEIQQTPELFHLEFVQVSC  418

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+    TATV +   DG+E    ++GTGPVDA Y+A++ V  VP  L+E+S+ +VT GID
Sbjct  419   GNQARPTATVTVRTPDGQELTDAAIGTGPVDAVYQAINRVANVPNELIEFSVQSVTAGID  478

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R              +R F+G     D++++S +AY+ ALN+L
Sbjct  479   AIGEVTIRLR------------YQDRVFSGHAVNTDIIVASAQAYLNALNRL  518



>gb|AGS49163.1| methylthioalkylmalate synthase [Eruca vesicaria subsp. sativa]
Length=484

 Score =   538 bits (1386),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 249/415 (60%), Positives = 331/415 (80%), Gaps = 5/415 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQSPGA +T   K+ +A QLA+L VDI+E GFPA
Sbjct  48    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPHKIEIAWQLAKLRVDIMEVGFPA  107

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  ++PVIC +AR  +RDI  AWE+VK+AK+PRI  F 
Sbjct  108   SSEEEFETIKTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRILIFT  167

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IH+ YKLKM+R++V+E     + +A+SLG  D+EF  ED GRSD++++ ++  E I
Sbjct  168   STSDIHLKYKLKMNRDEVLEMVVRSIKFAKSLGFEDIEFGCEDGGRSDKDYICKVFEEAI  227

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTL  PDTVG  +P E+G+L+  +KANTPGI++VI+STHC NDLG++TANT+AG C
Sbjct  228   KAGATTLACPDTVGINMPREYGELLRYVKANTPGIDDVILSTHCHNDLGVATANTIAGIC  287

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ++VTINGIGER+GNA LEEVVMALKCRG  ++GG+YT I+T+QI+  SKMV+EYT
Sbjct  288   AGARQVDVTINGIGERSGNAPLEEVVMALKCRGAYLMGGVYTRIDTRQIMATSKMVQEYT  347

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPEDIG+ ++ +SGIVLG+LSGR
Sbjct  348   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDIGIVKSEKSGIVLGRLSGR  407

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEVFQPQ  1488
             HA++ ++ ELGYE   ++L ++F RF+ + + KK++TDDDL ALV   DE+F  +
Sbjct  408   HAVKGRLKELGYETNDEKLNEVFSRFRDLTKEKKRITDDDLKALVMCGDEIFSSE  462



>ref|WP_015224126.1| 2-isopropylmalate synthase [Cyanobacterium stanieri]
 ref|YP_007166462.1| 2-isopropylmalate synthase [Cyanobacterium stanieri PCC 7202]
 gb|AFZ48813.1| 2-isopropylmalate synthase [Cyanobacterium stanieri PCC 7202]
Length=529

 Score =   540 bits (1390),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 284/531 (53%), Positives = 365/531 (69%), Gaps = 28/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ + IFDTTLRDGEQSPGA++   EKL +AR LA+LGVD+IEAGFP +S  D +AV  I
Sbjct  5     PDRIIIFDTTLRDGEQSPGASLNVDEKLTIARALAKLGVDVIEAGFPHASPGDFDAVSKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG   G   P ICGLAR  ++DI  A +A++ A K RIHTF+ATS+IH+ YKLK +R
Sbjct  65    AQAVGVENG---PSICGLARATQKDIKSAGDALQGAYKKRIHTFLATSDIHLQYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
               V+     MVAYA++    DVEFSPEDAGRSD EFLYQ+L   IKAGATT+NIPDTVGY
Sbjct  122   ADVLAMVPDMVAYAKTF-TDDVEFSPEDAGRSDPEFLYQVLELAIKAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+E+G LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEYGALIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGE---QVLGGL------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     LG         T I+T+QI   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQFYNPFLGRAPESTEPLTNIDTKQIYKTSRLVSNLTGMLVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAF+HESGIHQDG+LK++ TYEI+  E IGL     + IVLGKLSGR+A + +
Sbjct  301   NKAIVGANAFSHESGIHQDGVLKNRLTYEIMDAESIGL---TTNQIVLGKLSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   +L   F RFK VA++K+++TD DL A+V+DE+ QP   +RL  VQV+CG
Sbjct  358   LQELGFELSENDLNKAFLRFKEVADKKREITDWDLEAIVNDEIQQPPELFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
                  TAT+ L + DGEE    ++GTGPVDA YKA++ V  +P  L EYS+ +VT GIDA
Sbjct  418   DHSSPTATITLRNPDGEELSDAAIGTGPVDAVYKAINRVVNIPNELTEYSVKSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + ++ +             R+++G  A  DV+++S RAYV ALN+L
Sbjct  478   MGEVTIRLKHE------------GRTYSGYAANTDVIVASARAYVSALNRL  516



>ref|WP_002755985.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCH94330.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9432]
Length=533

 Score =   540 bits (1391),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 287/531 (54%), Positives = 365/531 (69%), Gaps = 27/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ V IFDTTLRDGEQSPGA +   EKL +AR LARLGVD+IEAGFP +S  D +AV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A  VG GE D  P+ICGLAR  ++DI  A +A++ A KPRIHTF+ATS+IH+ YKLK +R
Sbjct  65    AGSVG-GEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKKTR  122

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E    MV YA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  123   QEVLEIVPEMVDYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  181

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQLE TINGIGE
Sbjct  182   TTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGE  241

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNASLEE+VMAL  R       L          T INT++I   S++V   TG+ VQP
Sbjct  242   RAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIVQP  301

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LKHK TYEI+  E IGL     + IVLGKLSGR+A +++
Sbjct  302   NKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFRSR  358

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL + F +FK +A+RKK++TD DL A+V+DE+      +RL  VQV+CG
Sbjct  359   LQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVSCG  418

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TATV +   DG E    ++GTGPVDA  KA++ V ++P  L+ +S+  VTEGIDA
Sbjct  419   NSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAINRVVQIPNELISFSVREVTEGIDA  478

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + +R +             R+++   A  D++++S RAYV ALN+L
Sbjct  479   LGEVTIRLRYE------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|XP_002872029.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. lyrata]
 emb|CAJ55515.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48288.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   539 bits (1388),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/411 (61%), Positives = 330/411 (80%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE V+ IA+ VG     E  +VPVIC +AR   RDI+ AWEAVK+AK+PRI  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEETGYVPVICAIARSKHRDIEAAWEAVKYAKRPRILIFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S +  A+SLG +D++   ED GRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAVSSIRLAKSLGFNDIQLGCEDGGRSDKEFLCKILGEAI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAG T +N+ DTVG  +P+E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGVTVVNVADTVGINMPHEYGELVTYLKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMALKCRG  V+ G+YT I+T+QI+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVINGVYTRIDTRQIMATSKMVQEYT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPEDIG+ ++  SG+VLGKLSGR
Sbjct  370   GLYVQPHKPIVGTNCFVHESGIHQDGILKNRSTYEILSPEDIGVVKSQNSGLVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD D+ ALV  SDE+
Sbjct  430   HAVKDRLNELGYELDDEKLNDVFSRFRDLTKHKKRITDADMKALVTSSDEI  480



>dbj|BAP17925.1| 2-isopropylmalate synthase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=532

 Score =   540 bits (1390),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 283/529 (53%), Positives = 364/529 (69%), Gaps = 30/529 (6%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGA++T +EKL +AR LARLGVDIIEAGFP +S  D EAV+ IA+ VG
Sbjct  10    IFDTTLRDGEQSPGASLTVEEKLIIARSLARLGVDIIEAGFPYASPGDFEAVQKIAQTVG  69

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
                G   P ICGLAR  K+DI  A EA+K A K RIHTF+ATS+IH+ YKLK +R++V+ 
Sbjct  70    TKTG---PTICGLARATKKDIQSAGEALKPAAKARIHTFLATSDIHLEYKLKKTRQEVLA  126

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
                 MVAYA++    DVEFSPEDA RSD +FLY++L + I AGATTLNIPDTVGYT P+E
Sbjct  127   IVPEMVAYAKTF-VDDVEFSPEDAVRSDPKFLYEVLEKAILAGATTLNIPDTVGYTTPSE  185

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG LI  I+ N P IE  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  186   FGALIGSIRENVPNIEQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1030  SLEEVVMALKCRGEQVLGGLY----------TGINTQQIIMASKMVEEYTGLHVQPHKAI  1179
             +LEE+VMAL  R  Q     +          T I+T++I   S++V + TG+ VQP+KAI
Sbjct  246   ALEELVMALHVR-RQYFNPFFGRSPDSSEPLTQIHTKEIYRTSRLVSQLTGMVVQPNKAI  304

Query  1180  VGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLEL  1359
             VG NAFAHESGIHQDG+LKHK TYEI+  E IGL    ++ I+LGKLSGR+A ++ + EL
Sbjct  305   VGTNAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TKNKIILGKLSGRNAFRSCLKEL  361

Query  1360  GYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGL  1539
             G+E+   E+ + F RFK VA++KK++TD DL A+++DE+ Q    +RL  VQV+CG   +
Sbjct  362   GFELSDTEINNAFLRFKEVADKKKRITDWDLAAIINDEIQQAPELFRLELVQVSCGDHAV  421

Query  1540  STATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIAST  1719
              TATV L   +G++    ++GTGP+DA YKA++ V  VP  L+E+S+ +VT GIDAI   
Sbjct  422   PTATVTLKTPNGQKLTDAAIGTGPIDAIYKAINRVVNVPNELIEFSVKSVTAGIDAIGEV  481

Query  1720  RVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
              + +  +            +R + G  A  D++ +S RAY+ ALN L G
Sbjct  482   TIRLSHE------------DRIYLGYAANTDIITASARAYISALNHLYG  518



>ref|WP_015202275.1| 2-isopropylmalate synthase [Crinalium epipsammum]
 ref|YP_007141663.1| 2-isopropylmalate synthase [Crinalium epipsammum PCC 9333]
 gb|AFZ12153.1| 2-isopropylmalate synthase [Crinalium epipsammum PCC 9333]
Length=550

 Score =   540 bits (1392),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 290/533 (54%), Positives = 371/533 (70%), Gaps = 28/533 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ + IFDTTLRDGEQSPGAT+   EKL +ARQLA+LGVD+IEAGFP +S  D EAV+ I
Sbjct  7     PDRIIIFDTTLRDGEQSPGATLNVDEKLTIARQLAKLGVDVIEAGFPYASSGDFEAVQKI  66

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG   G   P ICGLAR  ++DI  A EA+K A K RIHTFIATS+IH+ YKLK +R
Sbjct  67    AQVVGVESG---PTICGLARATRQDIKAAAEALKPAAKHRIHTFIATSDIHLEYKLKKTR  123

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++V+E A+ MVAYA+SL   DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   QEVIEIASEMVAYAKSL-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTINIPDTVGY  182

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  183   TTPSEFGAIIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  242

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T I+T+QI   S++V   TG+ VQP
Sbjct  243   RAGNAALEELVMALHVRRQYYNPFLGRAVDSEEPLTNIDTRQIYKTSRLVSSLTGMLVQP  302

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAF+HESGIHQDG+LK+K TYEI+  + IGL    ++ IVLGKLSGR+A + +
Sbjct  303   NKAIVGANAFSHESGIHQDGVLKNKRTYEIMDAQLIGL---TDNQIVLGKLSGRNAFRTR  359

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   EL   F +FK +A++KK++TD DL A+V+DE+ Q    +RL  VQV+CG
Sbjct  360   LQELGFELSETELNKAFVKFKELADKKKEITDWDLEAIVNDEIQQAPELFRLEFVQVSCG  419

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             +    TAT+ L    GEE    ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA
Sbjct  420   NQARPTATITLRTPTGEELTDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDA  479

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             I    + ++  +            R ++G  A  D++++S +AYV ALN+L G
Sbjct  480   IGEVTIRLKHKE------------RIYSGHAANTDIIVASAQAYVNALNRLYG  520



>ref|WP_017661774.1| 2-isopropylmalate synthase [Geitlerinema sp. PCC 7105]
Length=537

 Score =   540 bits (1390),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 289/535 (54%), Positives = 363/535 (68%), Gaps = 29/535 (5%)
 Frame = +1

Query  292   DP-NYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVR  468
             DP + + IFDTTLRDGEQSPGAT+   EKL +ARQLARLGVD+IEAGFP +S  D EAV+
Sbjct  3     DPLDRIIIFDTTLRDGEQSPGATLNKDEKLTIARQLARLGVDVIEAGFPFASPGDFEAVQ  62

Query  469   LIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKM  648
              IAE+VG  +G   P ICGLAR    DI  A EA++ A   RIHTFIATS+IH+ YKL+ 
Sbjct  63    TIAEQVGTPDG---PTICGLARATGADIKAAGEALEPAAHKRIHTFIATSDIHLEYKLRK  119

Query  649   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  828
             SR++V+  A  MVAYA++    DVEFSPEDAGRSD EFLY++L  VI AGATT+NIPDTV
Sbjct  120   SRDEVLAIAPEMVAYAKTF-TDDVEFSPEDAGRSDPEFLYRVLEAVIDAGATTVNIPDTV  178

Query  829   GYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGI  1008
             GYT P EFG LI  I+ N   I+  IIS H  NDLGL+ AN L     GARQLE TINGI
Sbjct  179   GYTTPTEFGALIGGIEENVRNIDKAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1009  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHV  1161
             GERAGNA+LEE+VMAL  R +     L          T INT++I   S++V   TG+ V
Sbjct  239   GERAGNAALEELVMALHVRRQYFNPFLGRPAESEEPLTNINTREIYKTSRLVSNLTGMFV  298

Query  1162  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQ  1341
             QP+KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IG+   NE+ IVLGK SGR+A +
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGV---NENQIVLGKHSGRNAFK  355

Query  1342  AKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVT  1521
              ++ ELG+E+   EL   F  FK  A+RKK++TD DL ++V+D++ QP   ++L   QV+
Sbjct  356   TRLKELGFELSENELNKAFLNFKKFADRKKEITDWDLESIVNDQIQQPPELYKLELAQVS  415

Query  1522  CGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGI  1701
             CG     TATV L   DGEE    ++GTGPVDA YKA+  +  +P  L+EY++ +VT GI
Sbjct  416   CGDRLRPTATVTLRTPDGEERTEVALGTGPVDAVYKAIHQIIDLPSELIEYTVQSVTAGI  475

Query  1702  DAIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLG  1866
             DA+    V +R +             R F+G  A  DV+++S  AYV ALN+L G
Sbjct  476   DALGEVTVRLRHE------------GRVFSGHAANTDVIVASAHAYVNALNRLYG  518



>ref|WP_036001000.1| 2-isopropylmalate synthase [Leptolyngbya sp. JSC-1]
Length=538

 Score =   539 bits (1389),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 290/526 (55%), Positives = 368/526 (70%), Gaps = 28/526 (5%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGAT+  +EKL +ARQLARLGVD+IEAGFP +S  D EAV  IA++VG
Sbjct  11    IFDTTLRDGEQSPGATLNVEEKLTIARQLARLGVDVIEAGFPFASPGDFEAVTKIAQQVG  70

Query  490   RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSREQVVE  669
               +G   P ICGLAR  K+DI+ A +A+  A KPRIHTFIATS+IH+ YKLK +R++V++
Sbjct  71    TPDG---PTICGLARATKQDIEAAAKALAPAAKPRIHTFIATSDIHLEYKLKKTRQEVLQ  127

Query  670   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTIPNE  849
                 MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGYT P E
Sbjct  128   IGPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLEAAIAAGATTVNIPDTVGYTTPAE  186

Query  850   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGERAGNA  1029
             FG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGERAGNA
Sbjct  187   FGALIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAIKNGARQLECTINGIGERAGNA  246

Query  1030  SLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQPHKAIV  1182
             +LEE+VMAL  R +     LG         T I+T+QI   S++V   TG+ VQP+KAIV
Sbjct  247   ALEELVMALHVRRQYFNPFLGRPPESEAPLTRIDTRQIYKTSRLVSNLTGMLVQPNKAIV  306

Query  1183  GANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELG  1362
             GANAFAHESGIHQDG+LKHK TYEI+  + IGL   N++ IVLGK SGR+A + ++ ELG
Sbjct  307   GANAFAHESGIHQDGVLKHKLTYEIMDAQSIGL---NDNQIVLGKHSGRNAFRTRLKELG  363

Query  1363  YEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLS  1542
             +E+  +EL   F RFK +A++KK++TD DL A+V+DE  Q    ++L  VQV+CG     
Sbjct  364   FELSEQELNRAFLRFKEMADKKKEITDRDLEAIVNDETQQAPELFKLEHVQVSCGDHARP  423

Query  1543  TATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTR  1722
             TATV +   +GEE +  ++GTGPVDA YKA++ V  VP  L+EYS+ +VT GIDA+    
Sbjct  424   TATVIIRTPNGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEYSVQSVTAGIDALGEVT  483

Query  1723  VLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             + ++ +            +R F+G  A  D++++S  AY+ ALN+L
Sbjct  484   IRLKHN------------DRIFSGHAANTDIIVASAMAYMSALNRL  517



>ref|WP_015219510.1| 2-isopropylmalate synthase [Cyanobacterium aponinum]
 ref|YP_007161827.1| 2-isopropylmalate synthase [Cyanobacterium aponinum PCC 10605]
 gb|AFZ53783.1| 2-isopropylmalate synthase [Cyanobacterium aponinum PCC 10605]
Length=534

 Score =   539 bits (1389),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 283/531 (53%), Positives = 364/531 (69%), Gaps = 28/531 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P+ + IFDTTLRDGEQSPGA++  +EKL +A+ L++LGVD+IEAGFP +S  D  AV+ I
Sbjct  5     PDRIIIFDTTLRDGEQSPGASLNVEEKLNIAKALSKLGVDVIEAGFPHASPGDFNAVQRI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             AE VG   G   P ICGLAR  K+DI  A EA+K A K RIHTF+ATS+IH+ YKLK +R
Sbjct  65    AETVGTENG---PTICGLARATKQDIKSAGEALKPAFKRRIHTFLATSDIHLEYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
               V++    MVAYA++    DVEFSPEDAGRSD EFLYQ+L   I +GATT+NIPDTVGY
Sbjct  122   ADVLQIVPEMVAYAKTF-TDDVEFSPEDAGRSDPEFLYQVLEAAIASGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+E+G LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEYGALIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T I+T+QI   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNPFLGRPTDSTEPLTNIDTKQIYKTSRLVSNLTGMMVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK++ TYEI+  E IGL     + IVLGKLSGR+A + +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNRLTYEIMDAESIGL---TTNQIVLGKLSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELG+E+   +L   F RFK VA++K+++TD DL A+V+DE+ QP   +RL  VQV+CG
Sbjct  358   LQELGFELSEDDLNKAFLRFKEVADKKREITDWDLEAIVNDEIQQPPELFRLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
                  TAT+ L   DG+E    S+GTGPVDA YKA++ V  +P  L EYS+ +VT GIDA
Sbjct  418   DHSSPTATITLRTPDGKELSDASIGTGPVDAVYKAINRVVNIPNELTEYSVKSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             +    + ++ +             ++++G  A  DV+++S RAYV ALN+L
Sbjct  478   MGEVTIRLKHE------------GKTYSGYAANTDVIVASARAYVSALNRL  516



>ref|XP_006394566.1| hypothetical protein EUTSA_v10003976mg [Eutrema salsugineum]
 gb|ESQ31852.1| hypothetical protein EUTSA_v10003976mg [Eutrema salsugineum]
Length=532

 Score =   539 bits (1388),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 248/411 (60%), Positives = 331/411 (81%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIP+++ D NYVR+FDTTLRDGEQ+PG  +T  +KL +ARQLA+L VD++E GFP 
Sbjct  96    RWPEYIPHKLPDKNYVRVFDTTLRDGEQAPGGALTPPQKLEIARQLAKLRVDVMEVGFPG  155

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E VR IA+ VG     E  +VPVIC +AR  +RDI+ AWEAVK+AK+P+I  F 
Sbjct  156   SSEEEFETVRTIAKTVGNEVDEETGYVPVICAIARSKERDIEAAWEAVKYAKRPKILIFT  215

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S + +A+SLG  DV+   ED GRS++EFL +ILGE I
Sbjct  216   STSDIHMKYKLKKTKEEVIEMAASSIRFAKSLGFIDVQLGCEDGGRSEKEFLCKILGEAI  275

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT +N+ DTVG  +P E+G+L+  +KANTPGI++++ S HC NDLG++TANT+AG C
Sbjct  276   KAGATAVNVADTVGINMPEEYGELVRYLKANTPGIDDILFSVHCHNDLGVATANTIAGVC  335

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVT+NGIGER+GNA LEEVVMALKCRG  V+ G+YT I+T+QI+  SKMV+EYT
Sbjct  336   AGARQVEVTVNGIGERSGNAPLEEVVMALKCRGAYVMDGVYTRIDTRQIMATSKMVQEYT  395

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESG+HQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  396   GLYVQPHKPIVGANCFVHESGVHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  455

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS--DEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + ++KK++TD DL ALV+  DE+
Sbjct  456   HAVKDRLKELGYELDDEKLNDIFSRFRDLTKQKKRITDADLKALVTCGDEI  506



>ref|WP_026788800.1| MULTISPECIES: 2-isopropylmalate synthase [Planktothrix]
Length=539

 Score =   539 bits (1388),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 286/532 (54%), Positives = 363/532 (68%), Gaps = 28/532 (5%)
 Frame = +1

Query  292   DPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRL  471
             +P+ + IFDTTLRDGEQ PGAT+   EKL +ARQLARLGVD+IEAGF  +S  D +AV  
Sbjct  6     NPDRIIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASHGDFDAVSR  65

Query  472   IAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMS  651
             IAE VG  +G   PVIC LAR  K DI+ A +AV  A   RIHTFIATS+IH+ YKLK +
Sbjct  66    IAEAVGTEDG---PVICSLARSVKGDIEAAAKAVSPAFHRRIHTFIATSDIHLQYKLKKT  122

Query  652   REQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVG  831
             R +V++  + MVA+A+S    D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVG
Sbjct  123   RSEVLDITSEMVAFAKSF-VDDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVG  181

Query  832   YTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIG  1011
             YT P EFG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIG
Sbjct  182   YTTPAEFGAIIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIG  241

Query  1012  ERAGNASLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             ERAGNA+LEE+VMAL  R +     LG         T I+T+QI   S++V   TG+ VQ
Sbjct  242   ERAGNAALEELVMALHVRRQYFNPFLGREPESEASLTNIDTRQIYKTSRLVSNLTGMLVQ  301

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LKHK TYEI+  + IGL   N++ IVLGK SGRHA Q+
Sbjct  302   PNKAIVGANAFAHESGIHQDGILKHKRTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQS  358

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             +M ELG+E+   E+   F RFK +A++KK++TD DL A+V DE+ Q    + L  VQV+C
Sbjct  359   RMRELGFELTDPEVNKAFVRFKELADKKKEITDWDLEAIVKDEIQQTPELFHLEFVQVSC  418

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+    TATV +   DG+E    ++GTGPVDA Y+A++ V  VP  L+E+S+ +VT GID
Sbjct  419   GNQARPTATVTVRTPDGQELTDAAIGTGPVDAVYQAINRVANVPNELIEFSVQSVTAGID  478

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R              +R F+G     D++++S +AY+ ALN+L
Sbjct  479   AIGEVTIRLR------------YQDRVFSGHAVNTDIIVASAQAYLNALNRL  518



>emb|CAJ55509.1| methylthioalkylmalate synthase a [Arabidopsis cebennensis]
Length=507

 Score =   537 bits (1384),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 250/411 (61%), Positives = 331/411 (81%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D NYVR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDNNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE V+ IA+ VG     +  +VPVIC +AR   RDI+ AWEAVK+AK+PRI  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEDTGYVPVICAIARSKHRDIEAAWEAVKYAKRPRILIFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S +  A+SLG +D++   EDAGRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAVSSIRLAKSLGFNDIQLGCEDAGRSDKEFLCKILGEAI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAG   +N+ DTVG  +P+E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGVMVVNVADTVGINMPHEYGELVTYLKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMALKCRG  V+ G+YT I+T+QI+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVINGVYTRIDTRQIMATSKMVQEYT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SP+DIG+ ++  SG+VLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPDDIGIVKSQNSGLVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD D+ ALV  SDE+
Sbjct  430   HAVKDRLNELGYELDDEKLNDVFSRFRDLTKHKKRITDADMKALVTSSDEI  480



>ref|XP_010493409.1| PREDICTED: methylthioalkylmalate synthase 2, chloroplastic-like 
[Camelina sativa]
Length=504

 Score =   537 bits (1383),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 252/411 (61%), Positives = 330/411 (80%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D N VR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNCVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE VR IA+ VG     E  +VPVIC +AR   RDI+ AWEAVK+AK+PRI  F 
Sbjct  130   SSEEELETVRTIAKTVGNEVDEETGYVPVICAIARSKPRDIEAAWEAVKYAKRPRILIFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S V +A+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQLGCEDGGRSDKDFLCKILGESI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT +N+ DTVG  +P+E+G+L+  +KANTPGI +++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGATVVNVADTVGINMPHEYGELVTYLKANTPGINDIVFSVHCHNDLGLATANSIAGIR  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMA+KCRG  VL G+YT I+T +I+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMAMKCRGAYVLDGVYTNIDTPEIMATSKMVQEYT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSENSGIVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD D+ ALV  SDE+
Sbjct  430   HAVKDRLKELGYELDDEKLNDVFSRFRDLTKHKKRITDADIKALVTASDEI  480



>ref|WP_017323659.1| 2-isopropylmalate synthase [cyanobacterium PCC 7702]
Length=531

 Score =   538 bits (1386),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 294/534 (55%), Positives = 368/534 (69%), Gaps = 28/534 (5%)
 Frame = +1

Query  295   PNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLI  474
             P  + IFDTTLRDGEQ PGAT+   EKL +A+QLARLGVDIIEAGF  +S  D EA+  I
Sbjct  5     PERIIIFDTTLRDGEQCPGATLNIDEKLTIAKQLARLGVDIIEAGFAFASPGDFEAISKI  64

Query  475   AEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
             A+ VG  +G   PVIC LAR  K DI  A EA+K A K RIHTFIATS+IH+ YKLK +R
Sbjct  65    AQTVGTEDG---PVICSLARARKEDIKAAAEAIKPAAKGRIHTFIATSDIHLKYKLKKTR  121

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++VV  A  MVAYA++   SDVEFSPEDAGRSD EFLY++L  VI AGATT+NIPDTVGY
Sbjct  122   QEVVAIAEEMVAYAKNF-TSDVEFSPEDAGRSDPEFLYEVLERVISAGATTVNIPDTVGY  180

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIGE
Sbjct  181   TTPSEFGALIKGIKENVPNIDKAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1015  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQQIIMASKMVEEYTGLHVQP  1167
             RAGNA+LEE+VMAL  R +     L          T I+T+QI   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNPFLGRPVDSEEPLTNIDTKQIYRTSRLVSNLTGILVQP  300

Query  1168  HKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAK  1347
             +KAIVGANAFAHESGIHQDG+LK+K TYEI+  + IGL    E+ IVLGK SGR+A + +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---TENQIVLGKHSGRNAFRTR  357

Query  1348  MLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCG  1527
             + ELGYE+   EL   F RFK +A++KK++TD DL A+V+DE+ Q    ++L  VQV+CG
Sbjct  358   LRELGYELTETELNQAFIRFKEIADKKKEITDWDLQAIVNDEIQQAPELFKLELVQVSCG  417

Query  1528  SLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDA  1707
             S    TATV L   +GEE +  ++GTGPVDA YKA++ V  VP  L+E+S+ +VT GIDA
Sbjct  418   SNAKPTATVTLRTPEGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDA  477

Query  1708  IASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGF  1869
             I    + ++ +            NR F+G  A  D++++S +AYV ALN+L  +
Sbjct  478   IGEVTIRLKHE------------NRVFSGHAANTDIIVASAQAYVNALNRLYAW  519



>ref|XP_009515886.1| hypothetical protein PHYSODRAFT_552331 [Phytophthora sojae]
 gb|EGZ28611.1| hypothetical protein PHYSODRAFT_552331 [Phytophthora sojae]
Length=575

 Score =   539 bits (1389),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 281/537 (52%), Positives = 379/537 (71%), Gaps = 23/537 (4%)
 Frame = +1

Query  310   IFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRLIAEEVG  489
             IFDTTLRDGEQSPGAT+  KEKL +AR L+ LGVD+ EAGFP SS  D +AV  IA+E+G
Sbjct  35    IFDTTLRDGEQSPGATLNFKEKLDIARGLSALGVDVCEAGFPISSPGDFDAVSAIAKEIG  94

Query  490   -----RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMSR  654
                  R  G+ +  ICGLAR  ++DI + ++AVKHA K RIHTF+ATS+IH+ YKLK+SR
Sbjct  95    PLTANRATGEPM-TICGLARAMEKDIQRCYDAVKHAPKHRIHTFLATSDIHLKYKLKISR  153

Query  655   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  834
             ++ + +A   V +A+SL   D+EFS EDAGRSD +FL ++L EVIKAGATTLNIPDTVGY
Sbjct  154   DECIRRAVDAVKFAKSL-TPDIEFSTEDAGRSDPDFLCEVLAEVIKAGATTLNIPDTVGY  212

Query  835   TIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIGE  1014
             T+P E+G L + +  NT G +  I STHC NDLGL+TANTLA    GARQ+EVTINGIGE
Sbjct  213   TVPGEYGSLFSYLIENTEGSDKAIFSTHCHNDLGLATANTLAAVQGGARQVEVTINGIGE  272

Query  1015  RAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGANA  1194
             RAGN +LEE+VMALK R +     +YT +++ QI   S+MV  YTG+ +QP+KAIVG+NA
Sbjct  273   RAGNTALEELVMALKTRPQHF--PVYTSVDSTQITRCSRMVSHYTGMSIQPNKAIVGSNA  330

Query  1195  FAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGY-EI  1371
             FAHESGIHQDG+LKH+ TYEI+ PE +GL   +E+ +VLGK SGRHA   ++ +LGY  +
Sbjct  331   FAHESGIHQDGVLKHQATYEIMLPESVGL---SENKMVLGKHSGRHAYSKRLQQLGYTNL  387

Query  1372  EGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTAT  1551
               +EL+    +FK +A+ KK VTD D+ A+VSDE+F+P+VFW L  V VT G+L   TAT
Sbjct  388   TPEELDYYVEKFKVLADEKKTVTDADMEAIVSDELFKPEVFWTLQSVHVTAGNLVKPTAT  447

Query  1552  VKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKV-PVTLLEYSMNAVTEGIDAIASTRVL  1728
             V L   DG+E    ++GTGP+DA Y A+   T +  + L ++S+ +VT+G  A+    V 
Sbjct  448   VTLAHKDGQEVSEAAMGTGPIDAIYVAIKRATGMDSIKLNDFSVESVTDGTYALGEVTVR  507

Query  1729  IREDQAS---------IHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLLGFQ  1872
             ++E++           ++  TG + +R F G GA  D++++S  AYV A+N+++  Q
Sbjct  508   VQEEKEEEEKTEDEKHVNAQTGVTRDRQFVGHGANTDILVASATAYVNAVNRMMASQ  564



>ref|XP_010421098.1| PREDICTED: methylthioalkylmalate synthase 2, chloroplastic-like 
[Camelina sativa]
Length=504

 Score =   536 bits (1382),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/411 (61%), Positives = 331/411 (81%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D N VR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNCVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE VR IA+ VG     E  +VPVIC +AR   RDI+ AWEAVK+AK+PRI  F 
Sbjct  130   SSEEELETVRTIAKTVGNEVDEETGYVPVICAIARSKPRDIEAAWEAVKYAKRPRILIFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S V +A+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQLGCEDGGRSDKDFLCKILGESI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT +N+ DTVG  +P+E+G+L+  +KANTPGI +++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGATVVNVADTVGINMPHEYGELVTYLKANTPGINDIVFSVHCHNDLGLATANSIAGIR  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMA+KCRG  VL G+YT I+T++I+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMAMKCRGAYVLDGVYTKIDTREIMATSKMVQEYT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK++TD D+ ALV  +DE+
Sbjct  430   HAVKDRLKELGYELDDEKLNDVFSRFRDLTKHKKRITDADIKALVTATDEI  480



>emb|CAJ55507.1| methylthioalkylmalate synthase b [Arabidopsis lyrata subsp. petraea]
Length=502

 Score =   536 bits (1381),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 244/411 (59%), Positives = 330/411 (80%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEYIPN++   NYVR+ DTTLRDGEQSPGA +T  +KL +ARQLA+L VDI+E GFP 
Sbjct  69    RRPEYIPNKLPHKNYVRVLDTTLRDGEQSPGAALTPPQKLEIARQLAKLRVDIMEVGFPV  128

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + EA++ IA+ VG     E  +VPVICG+ARC  RDI+ AWEA+K+AK+PR+  F 
Sbjct  129   SSEEEFEAIKTIAKTVGNEVDEETGYVPVICGIARCKNRDIEAAWEALKYAKRPRVLLFT  188

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A + + YA+SLG +D+E   ED GR++++FL +ILGE+I
Sbjct  189   STSDIHMKYKLKKTKEEVIEMAVNSIKYAKSLGFTDIECGCEDGGRTEKDFLCKILGEMI  248

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATT+   DTVG  +P EFG+L+A +K NTPG ++++++ HC NDLG++TANT++G C
Sbjct  249   KAGATTVGFADTVGINMPPEFGELVAYVKENTPGADDIVLTIHCHNDLGVATANTISGIC  308

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+QI+  SKMV+E+T
Sbjct  309   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGEYLMNGVYTNIDTRQIMATSKMVQEHT  368

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G++VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  369   GMYVQPHKPIVGDNCFVHESGIHQDGILKNRSTYEILSPEDVGIVKSENSGIVLGKLSGR  428

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGY+I  ++  D+F R++ + + KK++TD DL ALV   DE+
Sbjct  429   HAVRDRLKELGYDISDEKFNDIFSRYRELTKEKKRITDADLKALVVNGDEI  479



>ref|XP_010493410.1| PREDICTED: methylthioalkylmalate synthase 3, chloroplastic-like 
[Camelina sativa]
Length=499

 Score =   536 bits (1381),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 247/405 (61%), Positives = 324/405 (80%), Gaps = 3/405 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D  YVRI DTTLRDGEQSPGA +T  +KL +ARQLA+L VDI+E GFP 
Sbjct  71    RWPEYIPNKLPDKRYVRILDTTLRDGEQSPGAALTPPQKLEIARQLAKLRVDIMEVGFPV  130

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E ++ IA+ VG     E  +VPVI  +ARC K DID AWEA+K+AK+PR+  F 
Sbjct  131   SSEEEFETIKTIAKTVGNEVDEETGYVPVIAAIARCKKSDIDAAWEALKYAKRPRVTLFT  190

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+++E A S + YA+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  191   STSDIHMKYKLKKTQEELIEIAVSSIKYAKSLGFTDIQLGCEDGGRSDKDFLCKILGESI  250

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATT+   DTVG  +P EFG+L+A +KANTPG ++V+ + HC NDLG++TANT++G C
Sbjct  251   KAGATTVGFADTVGINMPPEFGELVAYVKANTPGSDDVVFAIHCHNDLGVATANTISGIC  310

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT INT+QI+  SKMV+E+T
Sbjct  311   AGARQIEVTINGIGERSGNAPLEEVVMALKCRGEYLMDGVYTNINTRQIMATSKMVQEHT  370

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G++ QPHK IVG N F HESGIHQDGMLK++ TYEI+SPEDIG+ ++ +SG+VLGKLSGR
Sbjct  371   GMYAQPHKPIVGDNCFVHESGIHQDGMLKNRSTYEILSPEDIGIVKSLKSGLVLGKLSGR  430

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV  1464
             HA+  ++ ELGYEI  ++L+D+F RF+ + ++KK++TD DL ALV
Sbjct  431   HAVNDRLKELGYEINDEQLKDIFLRFRELTKQKKRITDADLKALV  475



>ref|XP_008907606.1| 2-isopropylmalate synthase [Phytophthora parasitica INRA-310]
 gb|ETI43502.1| 2-isopropylmalate synthase [Phytophthora parasitica P1569]
 gb|ETK83643.1| 2-isopropylmalate synthase [Phytophthora parasitica]
 gb|ETL37060.1| 2-isopropylmalate synthase [Phytophthora parasitica]
 gb|ETL90241.1| 2-isopropylmalate synthase [Phytophthora parasitica]
 gb|ETM43524.1| 2-isopropylmalate synthase [Phytophthora parasitica]
 gb|ETN07230.1| 2-isopropylmalate synthase [Phytophthora parasitica INRA-310]
 gb|ETO72241.1| 2-isopropylmalate synthase [Phytophthora parasitica P1976]
 gb|ETP13393.1| 2-isopropylmalate synthase [Phytophthora parasitica CJ01A1]
 gb|ETP41460.1| 2-isopropylmalate synthase [Phytophthora parasitica P10297]
Length=576

 Score =   539 bits (1388),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 284/552 (51%), Positives = 385/552 (70%), Gaps = 29/552 (5%)
 Frame = +1

Query  265   PEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASS  444
             PE   +R++      +FDTTLRDGEQSPGAT+  KEKL +AR L+ LGVD+ EAGFP SS
Sbjct  27    PEAGKDRLI------LFDTTLRDGEQSPGATLNFKEKLDIARALSTLGVDVCEAGFPISS  80

Query  445   EADLEAVRLIAEEVG-----RGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
               D +AV  IA+E+G     R  G+ +  ICGLAR  ++DI + ++AVKHA K RIHTF+
Sbjct  81    PGDFDAVSAIAKEIGPITANRATGEPM-TICGLARAMEKDIQRCYDAVKHAPKHRIHTFL  139

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             ATS+IH+ YKLK+SR++ + +A   V +A+SL   DVEFS EDAGRSD +FL ++L EVI
Sbjct  140   ATSDIHLKYKLKISRDECIRRAVDAVKFAKSL-TPDVEFSTEDAGRSDPDFLCEVLAEVI  198

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATTLNIPDTVGYT+P E+G L + +  NT G E  + STHC NDLGL+TANTLA   
Sbjct  199   KAGATTLNIPDTVGYTVPGEYGSLFSYLIDNTEGSEKAVFSTHCHNDLGLATANTLAAVQ  258

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
              GARQ+EVTINGIGERAGN +LEE+VMALK R +     +YT +++ QI   S+MV  YT
Sbjct  259   GGARQVEVTINGIGERAGNTALEELVMALKTRPQHF--PVYTTVDSTQITRCSRMVSHYT  316

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G+ +QP+KAIVG+NAFAHESGIHQDG+LKH+ TYEI+ PE +GL   +E+ +VLGK SGR
Sbjct  317   GMSIQPNKAIVGSNAFAHESGIHQDGVLKHQATYEIMLPESVGL---SENKMVLGKHSGR  373

Query  1330  HALQAKMLELGY-EIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLG  1506
             HA   ++ +LGY ++  +EL+    +FK +A+ KK VTD D+ A+VSDE+F+P+ FW L 
Sbjct  374   HAYSKRLQQLGYTDLTPEELDYYVEKFKVLADEKKTVTDADMEAIVSDELFKPETFWTLQ  433

Query  1507  DVQVTCGSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKV-PVTLLEYSMN  1683
              V VT G+L   TATV L   DG+E    ++GTGP+DA Y A+   T +  + L ++S+ 
Sbjct  434   SVHVTAGNLVKPTATVTLAHKDGQEVSEAAMGTGPIDAVYVAIKRATGMESIKLNDFSVE  493

Query  1684  AVTEGIDAIASTRVLIREDQAS---------IHGSTGGSANRSFNGTGAAMDVVISSVRA  1836
             +VT+G  A+    V ++ED+           ++  TG + +R F G GA  D++++S  A
Sbjct  494   SVTDGTYALGEVTVRVQEDKEEEEKTDDEKHVNAQTGLTRDRQFVGHGANTDILVASATA  553

Query  1837  YVGALNKLLGFQ  1872
             YV A+N+++  Q
Sbjct  554   YVNAVNRMMASQ  565



>ref|WP_026794579.1| MULTISPECIES: 2-isopropylmalate synthase [Planktothrix]
Length=539

 Score =   537 bits (1384),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 286/532 (54%), Positives = 363/532 (68%), Gaps = 28/532 (5%)
 Frame = +1

Query  292   DPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVRL  471
             +P+ + IFDTTLRDGEQ PGAT+   EKL +ARQLARLGVD+IEAGF  +S  D +AV  
Sbjct  6     NPDRIIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASHGDFDAVSR  65

Query  472   IAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKMS  651
             IAE VG  +G   PVIC LAR  K DI+ A +AV  A   RIHTFIATS+IH+ YKLK +
Sbjct  66    IAEAVGTEDG---PVICSLARSVKGDIEAAAKAVSPAFHRRIHTFIATSDIHLQYKLKKT  122

Query  652   REQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVG  831
             R +V++  + MVA+A+S    D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVG
Sbjct  123   RSEVLDITSEMVAFAKSF-VDDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVG  181

Query  832   YTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGIG  1011
             YT P EFG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQLE TINGIG
Sbjct  182   YTTPAEFGAIIKGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIG  241

Query  1012  ERAGNASLEEVVMALKCRGEQ---VLG------GLYTGINTQQIIMASKMVEEYTGLHVQ  1164
             ERAGNA+LEE+VMAL  R +     LG         T I+T+QI   S++V   TG+ VQ
Sbjct  242   ERAGNAALEELVMALHVRRQYFNPFLGREPESEASLTNIDTRQIYKTSRLVSNLTGMLVQ  301

Query  1165  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQA  1344
             P+KAIVGANAFAHESGIHQDG+LKHK TYEI+  + IGL   N++ IVLGK SGRHA Q+
Sbjct  302   PNKAIVGANAFAHESGIHQDGILKHKRTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQS  358

Query  1345  KMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTC  1524
             +M ELG+E+   E+   F RFK +A++KK++TD DL A+V DE+ Q    + L  VQV+C
Sbjct  359   RMRELGFELTDPEVNKAFVRFKELADKKKEITDWDLEAIVKDEIQQTPELFHLEFVQVSC  418

Query  1525  GSLGLSTATVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGID  1704
             G+    TATV +   DG+E    ++GTGPVDA Y+A++ V  V   L+E+S+ +VT GID
Sbjct  419   GNQARPTATVTVRTPDGQELTDAAIGTGPVDAVYQAINRVANVSNELIEFSVQSVTAGID  478

Query  1705  AIASTRVLIREDQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKL  1860
             AI    + +R              +R F+G  A  D++++S +AY+ ALN+L
Sbjct  479   AIGEVTIRLR------------YQDRVFSGHAANTDIIVASAQAYLNALNRL  518



>emb|CAQ56037.1| 2-isopropylmalate synthase, B genome specific 2 [Brassica juncea]
 emb|CAQ56038.1| 2-isopropylmalate synthase, B genome specific 2 [Brassica juncea]
Length=503

 Score =   536 bits (1380),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 247/406 (61%), Positives = 327/406 (81%), Gaps = 3/406 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIP+++ D NYVR+FDTTLRDGEQ+PG  +T  +KL +ARQLA+L VDI+E GFPA
Sbjct  71    RWPEYIPHKLPDKNYVRVFDTTLRDGEQAPGGALTPPQKLEIARQLAKLRVDIMEVGFPA  130

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + E V+ IA+ VG     E  +VPVIC +AR    D+  AWEAVK+AK+P+I  F 
Sbjct  131   SSEEEFETVKTIAKTVGNEVDEETGYVPVICAIARSKLEDVKAAWEAVKYAKRPKILIFT  190

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E ATS V +A+SLG  DV+   ED GRS++EFL +ILGE I
Sbjct  191   STSDIHMKYKLKKTKEEVIEMATSSVRFAKSLGFVDVQLGCEDGGRSEKEFLCKILGESI  250

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT++N+ DTVG  +P E+G+L+  +KANTPGI+++I S HC NDLGL+TANT+AG C
Sbjct  251   KAGATSVNVADTVGINLPEEYGELVRYLKANTPGIDDIIFSAHCHNDLGLATANTIAGVC  310

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVT+NGIGER+GNA LEEVVMALKCRGE ++ G+YT INT+QI+  S+MV+EYT
Sbjct  311   AGARQVEVTVNGIGERSGNAPLEEVVMALKCRGEYLMDGVYTRINTRQIMATSQMVQEYT  370

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGA+ F HESGIHQDG+LK++ TYEI+SPED+G+ ++  S IVLGKLSGR
Sbjct  371   GLYVQPHKPIVGASCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSPSSSIVLGKLSGR  430

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALVS  1467
             HA+  ++ E+GYE++ ++L D+F +F+ + + KK++TDDDL ALV+
Sbjct  431   HAVNDRLKEMGYELDDEKLNDIFSKFRGLTKHKKRITDDDLKALVT  476



>emb|CAC80103.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAD31196.1| methylthioalkylmalate synthase-like protein [Arabidopsis thaliana]
 emb|CAD31202.1| methylthioalkylmalate synthase-like protein [Arabidopsis thaliana]
 emb|CAD31210.1| methylthioalkylmalate synthase-like protein [Arabidopsis thaliana]
 emb|CAD31211.1| methylthioalkylmalate synthase-like protein [Arabidopsis thaliana]
 emb|CAJ55502.1| methylthioalkylmalate synthase L [Arabidopsis thaliana]
Length=503

 Score =   536 bits (1380),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 243/405 (60%), Positives = 324/405 (80%), Gaps = 3/405 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             RRPEYIPN++   NYVR+ DTTLRDGEQSPGA +T  +KL +ARQLA+L VDI+E GFP 
Sbjct  70    RRPEYIPNKLPHKNYVRVLDTTLRDGEQSPGAALTPPQKLEIARQLAKLRVDIMEVGFPV  129

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE + EA++ IA+ VG     E  +VPVICG+ARC KRDI+  WEA+K+AK+PR+  F 
Sbjct  130   SSEEEFEAIKTIAKTVGNEVDEETGYVPVICGIARCKKRDIEATWEALKYAKRPRVMLFT  189

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TSEIHM YKLK ++E+V+E A + V YA+SLG  D++F  ED GR++++FL +ILGE I
Sbjct  190   STSEIHMKYKLKKTKEEVIEMAVNSVKYAKSLGFKDIQFGCEDGGRTEKDFLCKILGESI  249

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGATT+   DTVG  +P EFG+L+A +  NTPG ++++ + HC NDLG++TANT++G C
Sbjct  250   KAGATTVGFADTVGINMPQEFGELVAYVIENTPGADDIVFAIHCHNDLGVATANTISGIC  309

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT I+++QI+  SKMV+E+T
Sbjct  310   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGESLMDGVYTKIDSRQIMATSKMVQEHT  369

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             G++VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  370   GMYVQPHKPIVGDNCFVHESGIHQDGILKNRSTYEILSPEDVGIVKSENSGIVLGKLSGR  429

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV  1464
             HA++ ++ ELGYEI  ++  D+F R++ + + KK++TD DL ALV
Sbjct  430   HAVKDRLKELGYEISDEKFNDIFSRYRELTKDKKRITDADLKALV  474



>ref|XP_009358943.1| PREDICTED: 2-isopropylmalate synthase A-like [Pyrus x bretschneideri]
Length=473

 Score =   535 bits (1377),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 323/413 (78%), Gaps = 3/413 (1%)
 Frame = +1

Query  235   RCES-SPPARRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGV  411
             RC + S     PEYIPNRI +  YVR+ DTTLRDGEQ+PGA+MT  EKLA+A QLA+L V
Sbjct  56    RCSALSQSPTHPEYIPNRIPNETYVRVVDTTLRDGEQAPGASMTRLEKLAIAHQLAKLRV  115

Query  412   DIIEAGFPASSEADLEAVRLIAEEVGR--GEGDHVPVICGLARCNKRDIDKAWEAVKHAK  585
             D+IEAGFPASS+ DLE V+LIA+EVG    E  +VPVI    RC + D+D AWE+VK A 
Sbjct  116   DVIEAGFPASSKYDLETVKLIAKEVGSRVDECGYVPVISAYCRCVRSDVDAAWESVKDAT  175

Query  586   KPRIHTFIATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  765
             +PR+  FI+TS+IHM YKL  + +QV+E A   V YARSLG  D+ F  EDAGRS++EFL
Sbjct  176   RPRLCIFISTSKIHMKYKLNKTADQVLELAKESVRYARSLGAQDITFVCEDAGRSEKEFL  235

Query  766   YQILGEVIKAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLST  945
             Y+I GE IKAGATTL   DTVGY  P+E  Q + D+KAN  GIENVI+S HC ND GL+ 
Sbjct  236   YRIYGEAIKAGATTLTFTDTVGYNFPSEVEQFVKDLKANVIGIENVILSMHCHNDFGLAN  295

Query  946   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMA  1125
             ANT+AGA AGARQ+EVTINGIGERAGNASLEE VMA+K RG+ +LGGL+TGINT+ I+ A
Sbjct  296   ANTIAGAYAGARQVEVTINGIGERAGNASLEEFVMAVKTRGKDMLGGLHTGINTKHIVAA  355

Query  1126  SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGI  1305
             SKMVEEY+GL VQPHKAIVGAN F+H SGIHQDG+LK+K TYEII  EDIG   ++++GI
Sbjct  356   SKMVEEYSGLSVQPHKAIVGANIFSHASGIHQDGVLKNKSTYEIILAEDIGYVHSHDTGI  415

Query  1306  VLGKLSGRHALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV  1464
             VLGK SGRHAL++++L+LG++++ K+  ++F  FKS+AE KK +T +DL +LV
Sbjct  416   VLGKHSGRHALKSRLLQLGHDLDEKKFHEVFEHFKSLAETKKSLTKEDLESLV  468



>ref|XP_010454580.1| PREDICTED: methylthioalkylmalate synthase 1, chloroplastic [Camelina 
sativa]
Length=474

 Score =   535 bits (1377),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 252/411 (61%), Positives = 330/411 (80%), Gaps = 5/411 (1%)
 Frame = +1

Query  259   RRPEYIPNRILDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPA  438
             R PEYIPN++ D N VR+FDTTLRDGEQ+PG ++T  +KL +ARQLA+L VDI+E GFP 
Sbjct  40    RWPEYIPNKLPDKNCVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  99

Query  439   SSEADLEAVRLIAEEVGRG---EGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFI  609
             SSE +LE VR IA+ VG     E  +VPVIC +AR   RDI+ AWEAVK+AK+PRI  F 
Sbjct  100   SSEEELETVRTIAKTVGNEVDEETGYVPVICAIARSKPRDIEAAWEAVKYAKRPRILIFT  159

Query  610   ATSEIHMNYKLKMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  789
             +TS+IHM YKLK ++E+V+E A S V +A+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  160   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQLGCEDGGRSDKDFLCKILGESI  219

Query  790   KAGATTLNIPDTVGYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAC  969
             KAGAT +N+ DTVG  +P+E+GQL+  +KANTPGI +++ S HC NDLGL+TAN++AG  
Sbjct  220   KAGATVVNVADTVGINMPHEYGQLVTYLKANTPGINDIVFSVHCHNDLGLATANSIAGIR  279

Query  970   AGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYT  1149
             AGARQ+EVTINGIGER+GNASLEEVVMA+KCRG  VL G+YT I+T++I+  SKMV+EYT
Sbjct  280   AGARQVEVTINGIGERSGNASLEEVVMAMKCRGAYVLDGVYTKIDTREIMATSKMVQEYT  339

Query  1150  GLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGR  1329
             GL+VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  340   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  399

Query  1330  HALQAKMLELGYEIEGKELEDLFWRFKSVAERKKKVTDDDLIALV--SDEV  1476
             HA++ ++ ELGYE++ ++L D+F RF+ + + KK +TD D+ ALV  +DE+
Sbjct  400   HAVKDRLKELGYELDDEKLNDVFSRFRDLTKHKKGITDADIKALVTATDEI  450



>ref|WP_006560911.1| 2-isopropylmalate synthase [Oscillochloris trichoides]
 gb|EFO81777.1| hypothetical protein OSCT_0354 [Oscillochloris trichoides DG-6]
Length=546

 Score =   537 bits (1383),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 280/534 (52%), Positives = 375/534 (70%), Gaps = 18/534 (3%)
 Frame = +1

Query  289   LDPNYVRIFDTTLRDGEQSPGATMTTKEKLAVARQLARLGVDIIEAGFPASSEADLEAVR  468
             +D ++VRIFDTTLRDGEQ+PG TMT +EKL VARQLAR+ VDIIEAGFPA+S  D  AV 
Sbjct  1     MDVDHVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLARMRVDIIEAGFPAASPGDWAAVH  60

Query  469   LIAEEVGRGEGDHVPVICGLARCNKRDIDKAWEAVKHAKKPRIHTFIATSEIHMNYKLKM  648
              IA EVG  +G   P I  LAR NK DIDKAW A++ A   RIHTF++TS+IH+ ++ + 
Sbjct  61    EIAREVGTPDG---PTIAALARANKDDIDKAWTAIQPAAHKRIHTFMSTSDIHLEHQFRK  117

Query  649   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  828
             SR + +E    MV+YARSL C DVEFSP DA RSD E+L+Q L   ++ GATTLNIPDTV
Sbjct  118   SRGEALELIGEMVSYARSL-CDDVEFSPMDATRSDPEYLFQALKIAVECGATTLNIPDTV  176

Query  829   GYTIPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQLEVTINGI  1008
             GY+ P E+G LIA I+ N PG + VIISTHC +DLG++ AN+LAG  AGARQ+E TINGI
Sbjct  177   GYSTPQEYGDLIAAIRQNVPGADKVIISTHCHDDLGVAVANSLAGVYAGARQIECTINGI  236

Query  1009  GERAGNASLEEVVMALKCRGEQVLGGLYTGINTQQIIMASKMVEEYTGLHVQPHKAIVGA  1188
             GERAGNASLEEVVMAL  R EQ   GL T + T+++  AS+ V  + G+ V P+KAIVGA
Sbjct  237   GERAGNASLEEVVMALHTR-EQFY-GLKTQVVTRELARASRTVSSFIGVPVPPNKAIVGA  294

Query  1189  NAFAHESGIHQDGMLKHKDTYEIISPEDIGLFRANESGIVLGKLSGRHALQAKMLELGYE  1368
             N FAHESGIHQDG+LK++ TYEI+S E +GL   + + ++LGK SGRHA +  +  +GY+
Sbjct  295   NTFAHESGIHQDGVLKNRMTYEIMSAETVGL---DGNALILGKHSGRHAFRKHVEAMGYD  351

Query  1369  IEGKELEDLFWRFKSVAERKKKVTDDDLIALVSDEVFQPQVFWRLGDVQVTCGSLGLSTA  1548
             +  ++ + +F RFK + +RKK+V D D+ AL+S E+      ++L  VQ + G+  + TA
Sbjct  352   LNDEDFQHVFARFKDLCDRKKRVDDRDIEALISGEIQHTPQIYKLAHVQYSSGTGMIPTA  411

Query  1549  TVKLIDADGEEHVACSVGTGPVDAAYKAVDLVTKVPVTLLEYSMNAVTEGIDAIASTRVL  1728
             TV+L+  D  E +  ++GTGPVDA Y+A++ +   P  L+E+S+ A+TEG+DA+A   V 
Sbjct  412   TVRLLGPDETEQIDSALGTGPVDAIYQAINRMINRPNELIEFSIKAITEGLDAVAEVTVR  471

Query  1729  IRE---------DQASIHGSTGGSANRSFNGTGAAMDVVISSVRAYVGALNKLL  1863
             IRE         D  SI+ +   +  + F+G G   D V+++  AY+GALNK+L
Sbjct  472   IREQSEEARTVDDPTSINLTGKRAVQQIFSGYGIHTDSVLAAAEAYMGALNKML  525



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7261313031584