BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24703_g1_i1 len=3507 path=[11011:0-1221 4378:1222-1253
4410:1254-1342 4499:1343-1373 4530:1374-1510 4667:1511-1535
4692:1536-1730 4887:1731-1766 4923:1767-2650 @5807@!:2651-2776
5933:2777-2836 5993:2837-2868 6025:2869-2874 6031:2875-2917
6074:2918-3141 14834:3142-3156 13984:3157-3194 14022:3195-3224
14052:3225-3249 14077:3250-3275 14103:3276-3314 14142:3315-3331
14159:3332-3360 14186:3361-3382 14208:3383-3506]

Length=3507
                                                                      Score     E

ref|XP_009776176.1|  PREDICTED: 2-isopropylmalate synthase B            997   0.0      
gb|ACF17660.1|  putative isopropylmalate synthase                       997   0.0      Capsicum annuum
ref|XP_009602443.1|  PREDICTED: 2-isopropylmalate synthase B            996   0.0      
ref|XP_006350708.1|  PREDICTED: 2-isopropylmalate synthase B-like       996   0.0      
ref|XP_004240995.1|  PREDICTED: 2-isopropylmalate synthase B            989   0.0      
ref|XP_009604558.1|  PREDICTED: 2-isopropylmalate synthase A            988   0.0      
ref|XP_009800501.1|  PREDICTED: 2-isopropylmalate synthase A            988   0.0      
ref|XP_010324700.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    983   0.0      
sp|O04973.1|LEU1A_SOLPN  RecName: Full=2-isopropylmalate synthase...    982   0.0      Solanum pennellii
ref|XP_011084168.1|  PREDICTED: 2-isopropylmalate synthase A-like       976   0.0      
gb|EYU26034.1|  hypothetical protein MIMGU_mgv1a003059mg                972   0.0      
sp|O04974.1|LEU1B_SOLPN  RecName: Full=2-isopropylmalate synthase...    971   0.0      Solanum pennellii
ref|XP_011073908.1|  PREDICTED: 2-isopropylmalate synthase A-like       950   0.0      
ref|XP_002268942.2|  PREDICTED: 2-isopropylmalate synthase A-like       924   0.0      Vitis vinifera
emb|CDP16992.1|  unnamed protein product                                924   0.0      
ref|NP_177544.1|  2-isopropylmalate synthase 2                          921   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428367.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    920   0.0      
ref|XP_007034042.1|  2-isopropylmalate synthase 1 isoform 2             920   0.0      
ref|XP_010471495.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    918   0.0      
ref|XP_002530549.1|  isopropylmalate synthase, putative                 917   0.0      Ricinus communis
ref|XP_010539993.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    916   0.0      
ref|XP_006478856.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    915   0.0      
ref|XP_006300309.1|  hypothetical protein CARUB_v10019832mg             915   0.0      
gb|KDO41314.1|  hypothetical protein CISIN_1g0069691mg                  915   0.0      
ref|XP_010416235.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    914   0.0      
gb|KFK44007.1|  hypothetical protein AALP_AA1G202700                    913   0.0      
ref|XP_011021916.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    912   0.0      
ref|XP_006390475.1|  hypothetical protein EUTSA_v10018267mg             912   0.0      
gb|KHG02682.1|  2-isopropylmalate synthase 2, chloroplastic -like...    912   0.0      
gb|ABA26446.1|  2-isopropylmalate synthase 1                            911   0.0      Brassica insularis
gb|KGN57885.1|  hypothetical protein Csa_3G363180                       910   0.0      
gb|AAW81741.1|  Putative 2-isopropylmalate synthase                     910   0.0      Brassica oleracea
ref|XP_004165080.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    909   0.0      
gb|KDP42866.1|  hypothetical protein JCGZ_23808                         909   0.0      
ref|XP_008457079.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    908   0.0      
ref|XP_008232677.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    907   0.0      
ref|XP_006416598.1|  hypothetical protein EUTSA_v10007073mg             906   0.0      
emb|CDY19217.1|  BnaC05g14180D                                          903   0.0      
ref|XP_008232670.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    903   0.0      
emb|CDY21704.1|  BnaA09g44550D                                          902   0.0      
ref|XP_007034041.1|  2-isopropylmalate synthase 1 isoform 1             902   0.0      
ref|XP_009117611.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    902   0.0      
ref|XP_004149446.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    902   0.0      
ref|XP_010064504.1|  PREDICTED: 2-isopropylmalate synthase A-like       901   0.0      
ref|XP_010477031.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    900   0.0      
ref|XP_009149293.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    900   0.0      
ref|XP_010274930.1|  PREDICTED: 2-isopropylmalate synthase A-like       899   0.0      
emb|CDY26154.1|  BnaA06g12630D                                          899   0.0      
ref|XP_010459471.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    899   0.0      
ref|NP_173285.2|  2-isopropylmalate synthase                            899   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACB59195.1|  2-isopropylmalate synthase                              898   0.0      Brassica oleracea
ref|XP_010672456.1|  PREDICTED: 2-isopropylmalate synthase A-like...    897   0.0      
ref|XP_010498246.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    897   0.0      
emb|CDX81876.1|  BnaC08g37250D                                          897   0.0      
gb|KHF98529.1|  2-isopropylmalate synthase 2, chloroplastic -like...    895   0.0      
ref|XP_002890281.1|  hypothetical protein ARALYDRAFT_472070             894   0.0      
ref|XP_010672455.1|  PREDICTED: 2-isopropylmalate synthase A-like...    891   0.0      
ref|XP_010097501.1|  2-isopropylmalate synthase 2                       890   0.0      
ref|XP_009411766.1|  PREDICTED: 2-isopropylmalate synthase A-like       887   0.0      
ref|XP_010931990.1|  PREDICTED: 2-isopropylmalate synthase A-like       887   0.0      
ref|XP_003592827.1|  2-isopropylmalate synthase                         884   0.0      
ref|XP_010498244.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    883   0.0      
gb|KHG05648.1|  2-isopropylmalate synthase 2, chloroplastic -like...    880   0.0      
ref|XP_008786904.1|  PREDICTED: 2-isopropylmalate synthase A-like       880   0.0      
ref|XP_003556565.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    879   0.0      
gb|AAF26002.1|AC013354_21  F15H18.3                                     875   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289267.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    875   0.0      
gb|KCW87847.1|  hypothetical protein EUGRSUZ_A00248                     873   0.0      
ref|XP_004497478.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    872   0.0      
ref|NP_001066116.1|  Os12g0138900                                       870   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABA91408.1|  2-isopropylmalate synthase B, putative, expressed       870   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006858638.1|  hypothetical protein AMTR_s00066p00043610          867   0.0      
emb|CBX25286.1|  hypothetical_protein                                   867   0.0      
gb|EMT05050.1|  2-isopropylmalate synthase A                            866   0.0      
dbj|BAJ93533.1|  predicted protein                                      863   0.0      
gb|AFW64772.1|  2-isopropylmalate synthase B                            863   0.0      
ref|XP_003536802.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    862   0.0      
ref|XP_002887519.1|  hypothetical protein ARALYDRAFT_476544             862   0.0      
ref|XP_006664321.1|  PREDICTED: 2-isopropylmalate synthase A-like       861   0.0      
ref|XP_003578949.1|  PREDICTED: 2-isopropylmalate synthase A-like       861   0.0      
ref|NP_001146593.1|  uncharacterized protein LOC100280189               862   0.0      Zea mays [maize]
ref|XP_006663190.1|  PREDICTED: 2-isopropylmalate synthase A-like       860   0.0      
ref|XP_002448963.1|  hypothetical protein SORBIDRAFT_05g002540          858   0.0      Sorghum bicolor [broomcorn]
gb|ACR35826.1|  unknown                                                 858   0.0      Zea mays [maize]
ref|NP_001147962.1|  LOC100281571                                       857   0.0      Zea mays [maize]
ref|XP_004977502.1|  PREDICTED: 2-isopropylmalate synthase A-like       855   0.0      
ref|XP_004978642.1|  PREDICTED: 2-isopropylmalate synthase A-like       855   0.0      
ref|XP_009336349.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    853   0.0      
gb|ACG29264.1|  2-isopropylmalate synthase B                            852   0.0      Zea mays [maize]
ref|XP_002442681.1|  hypothetical protein SORBIDRAFT_08g001160          846   0.0      Sorghum bicolor [broomcorn]
ref|XP_001775199.1|  predicted protein                                  844   0.0      
ref|XP_010035134.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    841   0.0      
gb|KCW87848.1|  hypothetical protein EUGRSUZ_A00249                     840   0.0      
ref|NP_001146891.1|  2-isopropylmalate synthase B                       844   0.0      Zea mays [maize]
emb|CBX25373.1|  hypothetical_protein                                   840   0.0      
gb|ACN29300.1|  unknown                                                 843   0.0      Zea mays [maize]
ref|XP_001761198.1|  predicted protein                                  838   0.0      
emb|CBX24424.1|  hypothetical_protein                                   830   0.0      
gb|ABG21878.1|  2-isopropylmalate synthase B, putative, expressed       827   0.0      
gb|EEC67654.1|  hypothetical protein OsI_35067                          821   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009368425.1|  PREDICTED: LOW QUALITY PROTEIN: 2-isopropylm...    820   0.0      
gb|KCW87662.1|  hypothetical protein EUGRSUZ_A00052                     811   0.0      
ref|XP_002980035.1|  hypothetical protein SELMODRAFT_111991             814   0.0      
ref|XP_002992921.1|  hypothetical protein SELMODRAFT_187069             813   0.0      
gb|KHN27115.1|  2-isopropylmalate synthase 2, chloroplastic             804   0.0      
emb|CBX25469.1|  hypothetical_protein                                   792   0.0      
dbj|BAH20374.1|  AT1G74040                                              786   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMS63121.1|  2-isopropylmalate synthase A                            788   0.0      
ref|XP_002307122.2|  hypothetical protein POPTR_0005s08480g             783   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN37280.1|  2-isopropylmalate synthase 2, chloroplastic             786   0.0      
ref|XP_007207420.1|  hypothetical protein PRUPE_ppa004868mg             771   0.0      
ref|XP_010064495.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    769   0.0      
dbj|BAI49592.1|  homocitrate synthase                                   751   0.0      Lotus japonicus
ref|XP_002945733.1|  2-isopropylmalate synthase                         754   0.0      
ref|XP_005648878.1|  2-isopropylmalate synthase                         744   0.0      
gb|KHN34615.1|  Putative 2-isopropylmalate synthase                     742   0.0      
ref|XP_010546219.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    743   0.0      
ref|XP_006604280.1|  PREDICTED: probable 2-isopropylmalate syntha...    741   0.0      
ref|XP_003521867.1|  PREDICTED: probable 2-isopropylmalate syntha...    738   0.0      
ref|XP_003554069.1|  PREDICTED: probable 2-isopropylmalate syntha...    737   0.0      
ref|XP_010546232.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    735   0.0      
ref|NP_001237749.1|  probable 2-isopropylmalate synthase                724   0.0      
ref|XP_006307272.1|  hypothetical protein CARUB_v10008887mg             709   0.0      
ref|XP_003538074.1|  PREDICTED: probable 2-isopropylmalate syntha...    709   0.0      
ref|XP_006443113.1|  hypothetical protein CICLE_v10020218mg             700   0.0      
ref|XP_002508720.1|  2-isopropylmalate synthase                         689   0.0      Micromonas commoda
gb|KHN42168.1|  Putative 2-isopropylmalate synthase                     681   0.0      
gb|KFM22835.1|  2-isopropylmalate synthase A                            681   0.0      
gb|ACJ85684.1|  unknown                                                 676   0.0      Medicago truncatula
ref|WP_013558760.1|  2-isopropylmalate synthase                         671   0.0      
gb|KCW87846.1|  hypothetical protein EUGRSUZ_A00246                     663   0.0      
gb|EPS60107.1|  hypothetical protein M569_14697                         657   0.0      
ref|XP_001415634.1|  predicted protein                                  666   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_002286323.1|  predicted protein                                  666   0.0      Thalassiosira pseudonana CCMP1335
ref|XP_005851963.1|  hypothetical protein CHLNCDRAFT_133663             659   0.0      
ref|XP_002178632.1|  2-isopropylmalate synthase                         662   0.0      Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008392601.1|  PREDICTED: 2-isopropylmalate synthase 2, chl...    649   0.0      
ref|XP_003074581.1|  Putative 2-isopropylmalate synthase (ISS)          653   0.0      
ref|XP_003063010.1|  2-isopropylmalate synthase                         654   0.0      
emb|CEF96841.1|  2-isopropylmalate synthase, bacterial-type             653   0.0      
gb|KDO41316.1|  hypothetical protein CISIN_1g0069691mg                  642   0.0      
ref|XP_008342849.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    643   0.0      
ref|XP_009768817.1|  PREDICTED: 2-isopropylmalate synthase A-like       656   0.0      
gb|KHN34617.1|  Putative 2-isopropylmalate synthase                     640   0.0      
ref|XP_007508841.1|  2-isopropylmalate synthase                         638   0.0      
gb|KDO41315.1|  hypothetical protein CISIN_1g0069691mg                  627   0.0      
ref|XP_009351137.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    625   0.0      
gb|KFK41842.1|  hypothetical protein AALP_AA2G178400                    629   0.0      
gb|EJK57969.1|  hypothetical protein THAOC_21945                        622   0.0      
ref|XP_009039595.1|  hypothetical protein AURANDRAFT_54528              616   0.0      
ref|XP_007142640.1|  hypothetical protein PHAVU_007G004600g             607   0.0      
ref|WP_020736424.1|  2-isopropylmalate synthase                         612   0.0      
ref|XP_009040112.1|  hypothetical protein AURANDRAFT_38625              612   0.0      
ref|WP_012236363.1|  2-isopropylmalate synthase                         610   0.0      
gb|KCW44560.1|  hypothetical protein EUGRSUZ_L01927                     592   0.0      
ref|WP_026370668.1|  2-isopropylmalate synthase                         600   0.0      
ref|WP_014434671.1|  2-isopropylmalate synthase                         601   0.0      
ref|XP_010324707.1|  PREDICTED: 2-isopropylmalate synthase A-like       593   0.0      
ref|XP_006366147.1|  PREDICTED: 2-isopropylmalate synthase A-like       591   0.0      
gb|KEH22097.1|  2-isopropylmalate synthase                              588   0.0      
ref|WP_022848903.1|  2-isopropylmalate synthase                         590   0.0      
ref|XP_006366146.1|  PREDICTED: 2-isopropylmalate synthase A-like       576   0.0      
gb|ADO16122.1|  alpha isopropylmalate synthase                          566   0.0      
ref|XP_004244758.2|  PREDICTED: 2-isopropylmalate synthase A-like       572   0.0      
ref|XP_004513503.1|  PREDICTED: probable 2-isopropylmalate syntha...    571   0.0      
gb|ADO16131.1|  alpha isopropylmalate synthase                          562   0.0      
gb|ADO16114.1|  alpha isopropylmalate synthase                          562   0.0      
gb|ADO16128.1|  alpha isopropylmalate synthase                          561   0.0      
gb|ADO16129.1|  alpha isopropylmalate synthase                          561   0.0      
gb|ADO16119.1|  alpha isopropylmalate synthase                          561   0.0      
gb|ADO16117.1|  alpha isopropylmalate synthase                          560   0.0      
gb|ADO16116.1|  alpha isopropylmalate synthase                          559   0.0      
gb|ADO16130.1|  alpha isopropylmalate synthase                          558   0.0      
gb|ADO16115.1|  alpha isopropylmalate synthase                          558   0.0      
ref|XP_007034043.1|  2-isopropylmalate synthase 1 isoform 3             564   0.0      
gb|ADO16132.1|  alpha isopropylmalate synthase                          557   0.0      
gb|ADO16127.1|  alpha isopropylmalate synthase                          557   0.0      
gb|ADO16120.1|  alpha isopropylmalate synthase                          556   0.0      
gb|ADO16118.1|  alpha isopropylmalate synthase                          556   0.0      
gb|ADO16125.1|  alpha isopropylmalate synthase                          555   0.0      
gb|ADO16121.1|  alpha isopropylmalate synthase                          553   0.0      
gb|ADO16126.1|  alpha isopropylmalate synthase                          553   0.0      
dbj|BAL52895.1|  2-isopropylmalate synthase                             562   0.0      
ref|XP_010534037.1|  PREDICTED: 2-isopropylmalate synthase 1, chl...    556   0.0      
ref|XP_001696603.1|  isopropylmalate synthase                           555   0.0      Chlamydomonas reinhardtii
gb|ADO16123.1|  alpha isopropylmalate synthase                          547   0.0      
ref|WP_012594190.1|  MULTISPECIES: 2-isopropylmalate synthase           555   0.0      
ref|WP_013324885.1|  2-isopropylmalate synthase                         555   0.0      
ref|XP_003541255.1|  PREDICTED: probable 2-isopropylmalate syntha...    549   0.0      
ref|WP_012598523.1|  2-isopropylmalate synthase                         553   0.0      
ref|WP_017296798.1|  2-isopropylmalate synthase                         550   2e-179   
ref|WP_015147156.1|  2-isopropylmalate synthase                         548   9e-179   
ref|WP_011956698.1|  2-isopropylmalate synthase                         548   2e-178   
ref|WP_006560911.1|  2-isopropylmalate synthase                         547   3e-178   
ref|WP_010873307.1|  2-isopropylmalate synthase                         546   3e-178   
emb|CAJ55512.1|  methylthioalkylmalate synthase a                       545   5e-178   Boechera divaricarpa
ref|WP_007306993.1|  2-isopropylmalate synthase                         546   7e-178   
ref|WP_021829821.1|  2-isopropylmalate synthase                         546   9e-178   
gb|AIE73388.1|  2-isopropylmalate synthase                              545   9e-178   
ref|WP_021832269.1|  2-isopropylmalate synthase                         545   1e-177   
ref|XP_009358943.1|  PREDICTED: 2-isopropylmalate synthase A-like       542   2e-177   
ref|WP_023652298.1|  2-isopropylmalate synthase                         543   2e-177   
ref|XP_006367400.1|  PREDICTED: 2-isopropylmalate synthase A-like       538   3e-177   
ref|XP_006289820.1|  hypothetical protein CARUB_v10003425mg             543   3e-177   
ref|WP_009556473.1|  2-isopropylmalate synthase                         544   3e-177   
ref|WP_035153322.1|  2-isopropylmalate synthase                         543   3e-177   
ref|WP_009543901.1|  MULTISPECIES: 2-isopropylmalate synthase           544   4e-177   
gb|AAR36908.1|  isopropylmalate synthase                                542   4e-177   Brassica oleracea
gb|AAV25874.1|  2-isopropylmalate synthase                              543   4e-177   Brassica oleracea
ref|WP_010936558.1|  2-isopropylmalate synthase                         541   8e-177   
ref|WP_015224126.1|  2-isopropylmalate synthase                         542   1e-176   
emb|CAJ55510.1|  methylthioalkylmalate synthase b                       541   1e-176   Arabidopsis cebennensis
ref|WP_002794932.1|  2-isopropylmalate synthase                         542   2e-176   
ref|WP_023073959.1|  2-isopropylmalate synthase                         542   2e-176   
ref|WP_012882024.1|  2-isopropylmalate synthase                         541   2e-176   
emb|CAJ55506.1|  methylthioalkylmalate synthase a                       541   2e-176   Arabidopsis lyrata subsp. petraea
ref|WP_017750120.1|  2-isopropylmalate synthase                         541   2e-176   
ref|WP_012120074.1|  2-isopropylmalate synthase                         542   3e-176   
ref|WP_002803918.1|  2-isopropylmalate synthase                         541   4e-176   
dbj|GAL93306.1|  2-isopropylmalate synthase                             541   4e-176   
emb|CAJ55507.1|  methylthioalkylmalate synthase b                       540   4e-176   Arabidopsis lyrata subsp. petraea
ref|WP_017304848.1|  2-isopropylmalate synthase                         541   6e-176   
ref|WP_008198795.1|  2-isopropylmalate synthase                         540   6e-176   
ref|WP_035985134.1|  2-isopropylmalate synthase                         541   7e-176   
gb|AII57910.1|  2-isopropylmalate synthase                              539   1e-175   
emb|CAQ56039.1|  2-isopropylmalate synthase, A genome specific 1        539   1e-175   Brassica juncea [brown mustard]
ref|XP_008346777.1|  PREDICTED: 2-isopropylmalate synthase A-like       538   1e-175   
gb|ACH41738.1|  glucosinolate GS-Elong                                  538   1e-175   Brassica rapa subsp. rapa
ref|WP_002758694.1|  2-isopropylmalate synthase                         539   2e-175   
ref|WP_002746244.1|  2-isopropylmalate synthase                         539   2e-175   
sp|P94907.1|LEU1_MICAE  RecName: Full=2-isopropylmalate synthase;...    539   2e-175   Microcystis aeruginosa
ref|XP_009144531.1|  PREDICTED: methylthioalkylmalate synthase 1,...    538   2e-175   
ref|XP_002872030.1|  methylthioalkylmalate synthase b                   538   3e-175   
ref|XP_009130133.1|  PREDICTED: methylthioalkylmalate synthase 1,...    539   3e-175   
ref|WP_018399927.1|  2-isopropylmalate synthase                         538   3e-175   
ref|XP_005704188.1|  2-isopropylmalate synthase                         543   4e-175   
ref|WP_006622399.1|  MULTISPECIES: 2-isopropylmalate synthase           538   5e-175   
ref|XP_009137065.1|  PREDICTED: methylthioalkylmalate synthase 2,...    535   5e-175   
gb|KDR56307.1|  2-isopropylmalate synthase                              538   5e-175   
ref|WP_015202275.1|  2-isopropylmalate synthase                         539   5e-175   
ref|WP_017323659.1|  2-isopropylmalate synthase                         538   5e-175   
ref|WP_006509230.1|  2-isopropylmalate synthase                         538   5e-175   
ref|WP_002736592.1|  2-isopropylmalate synthase                         538   6e-175   
ref|WP_011309308.1|  2-isopropylmalate synthase                         537   6e-175   
ref|WP_016516646.1|  2-isopropylmalate synthase                         538   6e-175   
ref|XP_002872029.1|  methylthioalkylmalate synthase a                   537   6e-175   
ref|WP_006618368.1|  2-isopropylmalate synthase                         538   7e-175   
ref|WP_002765307.1|  2-isopropylmalate synthase                         538   7e-175   
ref|WP_002783894.1|  2-isopropylmalate synthase                         538   7e-175   
ref|WP_002773852.1|  2-isopropylmalate synthase                         537   1e-174   
emb|CAJ55509.1|  methylthioalkylmalate synthase a                       536   1e-174   Arabidopsis cebennensis
ref|WP_036001000.1|  2-isopropylmalate synthase                         537   1e-174   
ref|WP_012267775.1|  2-isopropylmalate synthase                         537   1e-174   
ref|WP_015219510.1|  2-isopropylmalate synthase                         537   2e-174   
ref|WP_015116700.1|  2-isopropylmalate synthase                         536   2e-174   
ref|WP_002786970.1|  2-isopropylmalate synthase                         537   2e-174   
ref|WP_002796207.1|  2-isopropylmalate synthase                         536   2e-174   
ref|XP_006394566.1|  hypothetical protein EUTSA_v10003976mg             536   2e-174   
ref|XP_010493409.1|  PREDICTED: methylthioalkylmalate synthase 2,...    535   2e-174   
emb|CAQ56035.1|  2-isopropylmalate synthase, B genome specific 1        535   2e-174   Brassica juncea [brown mustard]
emb|CAC80103.1|  hypothetical protein                                   535   2e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290200.1|  hypothetical protein CARUB_v10003885mg             535   3e-174   
ref|XP_010421098.1|  PREDICTED: methylthioalkylmalate synthase 2,...    535   3e-174   
gb|AGS49163.1|  methylthioalkylmalate synthase                          534   4e-174   
emb|CAD31197.1|  methylthioalkylmalate synthase-like protein            535   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454580.1|  PREDICTED: methylthioalkylmalate synthase 1,...    533   4e-174   
ref|WP_024970954.1|  2-isopropylmalate synthase                         535   5e-174   
ref|XP_009128497.1|  PREDICTED: methylthioalkylmalate synthase 1,...    534   5e-174   
ref|WP_016868266.1|  2-isopropylmalate synthase                         535   5e-174   
emb|CAD31205.1|  methylthioalkylmalate synthase-like protein            534   5e-174   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197693.1|  methylthioalkylmalate synthase 3                      534   6e-174   Arabidopsis thaliana [mouse-ear cress]
ref|WP_017661774.1|  2-isopropylmalate synthase                         535   8e-174   
emb|CAD31201.1|  methylthioalkylmalate synthase-like protein            534   8e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005715553.1|  2-isopropylmalate synthase                         536   9e-174   
ref|WP_002755985.1|  2-isopropylmalate synthase                         535   9e-174   
dbj|BAP17925.1|  2-isopropylmalate synthase                             535   1e-173   
emb|CAD31198.1|  methylthioalkylmalate synthase-like protein            533   1e-173   Arabidopsis thaliana [mouse-ear cress]
ref|WP_009454099.1|  MULTISPECIES: 2-isopropylmalate synthase           534   1e-173   
ref|WP_008276101.1|  2-isopropylmalate synthase                         534   2e-173   
gb|KFK27623.1|  hypothetical protein AALP_AA8G407500                    532   2e-173   
ref|WP_011057237.1|  2-isopropylmalate synthase                         534   2e-173   
ref|WP_017293571.1|  2-isopropylmalate synthase                         533   3e-173   
emb|CAQ56037.1|  2-isopropylmalate synthase, B genome specific 2        532   3e-173   
emb|CAD31140.1|  methylthioalkylmalate synthase                         532   3e-173   
emb|CAD31141.1|  methylthioalkylmalate synthase                         532   3e-173   
ref|NP_197692.1|  methylthioalkylmalate synthase 1                      532   3e-173   
gb|KDD73024.1|  HMGL-like protein                                       530   3e-173   
emb|CDY02195.1|  BnaA03g39720D                                          532   4e-173   
ref|WP_024544389.1|  2-isopropylmalate synthase                         533   6e-173   
ref|WP_017311976.1|  2-isopropylmalate synthase                         533   6e-173   
ref|WP_015172715.1|  2-isopropylmalate synthase                         533   8e-173   
ref|WP_009787534.1|  2-isopropylmalate synthase                         532   8e-173   
ref|WP_011611850.1|  2-isopropylmalate synthase                         533   9e-173   
ref|WP_008190372.1|  2-isopropylmalate synthase                         533   1e-172   
ref|WP_012191970.1|  2-isopropylmalate synthase                         533   1e-172   
ref|WP_016860676.1|  2-isopropylmalate synthase                         532   1e-172   
ref|WP_008312613.1|  2-isopropylmalate synthase                         532   2e-172   
ref|WP_024124257.1|  2-isopropylmalate synthase LeuA                    531   2e-172   
gb|AAG52883.1|AF327648_1  2-isopropylmalate synthase                    530   2e-172   
ref|WP_006101349.1|  2-isopropylmalate synthase                         531   2e-172   
emb|CAJ55513.1|  methylthioalkylmalate synthase b                       530   2e-172   
ref|XP_008907606.1|  2-isopropylmalate synthase                         533   3e-172   
ref|WP_017714000.1|  2-isopropylmalate synthase                         531   4e-172   
ref|XP_006289994.1|  hypothetical protein CARUB_v10003624mg             529   5e-172   
ref|WP_026731425.1|  2-isopropylmalate synthase                         530   5e-172   
ref|XP_006394567.1|  hypothetical protein EUTSA_v10004072mg             529   5e-172   
ref|WP_015191686.1|  2-isopropylmalate synthase                         530   6e-172   
ref|XP_009515886.1|  hypothetical protein PHYSODRAFT_552331             531   8e-172   
ref|WP_038027097.1|  2-isopropylmalate synthase                         530   1e-171   
ref|XP_010493410.1|  PREDICTED: methylthioalkylmalate synthase 3,...    528   1e-171   
ref|WP_015738274.1|  2-isopropylmalate synthase                         529   2e-171   
ref|WP_026797078.1|  2-isopropylmalate synthase                         529   2e-171   
ref|WP_012306975.1|  2-isopropylmalate synthase                         528   3e-171   
ref|WP_015143878.1|  2-isopropylmalate synthase                         528   3e-171   
emb|CAD18966.1|  2-isopropylmalate synthase                             527   3e-171   
ref|WP_015174514.1|  2-isopropylmalate synthase                         529   3e-171   
emb|CDY51627.1|  BnaCnng21190D                                          527   3e-171   
ref|XP_010421099.1|  PREDICTED: methylthioalkylmalate synthase 3,...    526   4e-171   
ref|WP_006633076.1|  2-isopropylmalate synthase                         528   5e-171   
gb|EDX84870.1|  2-isopropylmalate synthase                              528   6e-171   
ref|WP_011431034.1|  2-isopropylmalate synthase                         528   6e-171   
emb|CAD31151.1|  methylthioalkylmalate synthase                         526   7e-171   
ref|WP_026788800.1|  MULTISPECIES: 2-isopropylmalate synthase           528   7e-171   
ref|WP_015199746.1|  2-isopropylmalate synthase                         527   8e-171   
ref|WP_006518723.1|  2-isopropylmalate synthase                         527   8e-171   
emb|CAD31150.1|  methylthioalkylmalate synthase                         526   9e-171   
ref|WP_031460254.1|  2-isopropylmalate synthase                         528   1e-170   
ref|WP_011863123.1|  2-isopropylmalate synthase                         527   1e-170   
ref|WP_038018887.1|  2-isopropylmalate synthase                         526   1e-170   
ref|WP_007353498.1|  MULTISPECIES: 2-isopropylmalate synthase           527   1e-170   
ref|XP_006289473.1|  hypothetical protein CARUB_v10003002mg             525   1e-170   
ref|WP_026723592.1|  2-isopropylmalate synthase                         526   2e-170   
ref|WP_026794579.1|  MULTISPECIES: 2-isopropylmalate synthase           526   2e-170   
ref|WP_016876245.1|  2-isopropylmalate synthase                         526   2e-170   
ref|WP_037220324.1|  2-isopropylmalate synthase                         526   2e-170   
ref|WP_036530787.1|  2-isopropylmalate synthase                         526   2e-170   
emb|CDN13429.1|  2-isopropylmalate synthase                             526   2e-170   
ref|WP_039728505.1|  2-isopropylmalate synthase                         526   3e-170   
ref|WP_015137916.1|  2-isopropylmalate synthase                         525   4e-170   
ref|WP_012625838.1|  2-isopropylmalate synthase                         525   5e-170   
ref|WP_013782329.1|  2-isopropylmalate synthase                         524   7e-170   
ref|WP_010998968.1|  2-isopropylmalate synthase                         524   9e-170   
ref|WP_015229714.1|  2-isopropylmalate synthase                         524   1e-169   
sp|Q8VX04.1|MAM2_ARATH  RecName: Full=Methylthioalkylmalate synth...    523   1e-169   
emb|CAD31157.1|  methylthioalkylmalate synthase                         523   1e-169   
ref|WP_011318900.1|  2-isopropylmalate synthase                         524   1e-169   
ref|WP_015114632.1|  2-isopropylmalate synthase                         524   1e-169   
ref|WP_028459375.1|  2-isopropylmalate synthase                         525   1e-169   
gb|AFK79173.1|  2-isopropylmalate synthase                              523   1e-169   
ref|XP_002906784.1|  2-isopropylmalate synthase                         525   2e-169   
ref|XP_010454581.1|  PREDICTED: methylthioalkylmalate synthase 3,...    522   2e-169   
ref|WP_015160320.1|  2-isopropylmalate synthase, bacterial type         523   2e-169   
ref|WP_012616515.1|  2-isopropylmalate synthase                         525   3e-169   
ref|WP_015185786.1|  2-isopropylmalate synthase                         524   3e-169   
ref|WP_006528662.1|  2-isopropylmalate synthase                         523   3e-169   
ref|XP_006394565.1|  hypothetical protein EUTSA_v10003976mg             522   4e-169   
emb|CDY43640.1|  BnaA04g20510D                                          520   4e-169   
ref|WP_015163372.1|  2-isopropylmalate synthase                         523   5e-169   
ref|WP_038074986.1|  2-isopropylmalate synthase                         522   9e-169   
ref|WP_012256076.1|  MULTISPECIES: 2-isopropylmalate synthase           523   1e-168   
ref|WP_011393738.1|  2-isopropylmalate synthase                         521   1e-168   
emb|CAQ56042.1|  2-isopropylmalate synthase, A genome specific 4        518   2e-168   
ref|WP_027843027.1|  2-isopropylmalate synthase                         521   2e-168   
ref|XP_010421100.1|  PREDICTED: methylthioalkylmalate synthase 3,...    520   2e-168   
ref|WP_010473417.1|  2-isopropylmalate synthase                         521   3e-168   
emb|CAQ56043.1|  2-isopropylmalate synthase, A genome specific 4        518   3e-168   
ref|WP_012407682.1|  2-isopropylmalate synthase                         520   4e-168   
gb|KFK27841.1|  hypothetical protein AALP_AA8G436800                    518   4e-168   
ref|WP_036946315.1|  2-isopropylmalate synthase                         519   5e-168   
ref|WP_009626407.1|  2-isopropylmalate synthase                         520   6e-168   
ref|WP_038653566.1|  2-isopropylmalate synthase                         520   6e-168   
ref|WP_025748724.1|  2-isopropylmalate synthase                         518   9e-168   
ref|WP_015128970.1|  2-isopropylmalate synthase                         519   1e-167   
ref|WP_013218122.1|  2-isopropylmalate synthase                         518   1e-167   
ref|WP_013119272.1|  2-isopropylmalate synthase                         518   2e-167   
emb|CAJ55514.1|  methylthioalkylmalate synthase c                       516   2e-167   
ref|WP_036920316.1|  2-isopropylmalate synthase                         519   2e-167   
ref|WP_011433057.1|  2-isopropylmalate synthase                         519   2e-167   
ref|WP_015135498.1|  2-isopropylmalate synthase                         518   2e-167   
ref|XP_010454582.1|  PREDICTED: methylthioalkylmalate synthase 3,...    517   2e-167   
ref|WP_023069584.1|  2-isopropylmalate synthase                         518   3e-167   
ref|WP_015079696.1|  2-isopropylmalate synthase                         518   3e-167   
ref|WP_019491763.1|  2-isopropylmalate synthase                         517   4e-167   
ref|WP_038296223.1|  2-isopropylmalate synthase [                       518   4e-167   
ref|WP_028084518.1|  2-isopropylmalate synthase                         517   4e-167   
ref|WP_012161337.1|  2-isopropylmalate synthase                         518   5e-167   
ref|WP_025778890.1|  2-isopropylmalate synthase                         516   6e-167   
ref|XP_010472038.1|  PREDICTED: methylthioalkylmalate synthase 3,...    514   6e-167   
ref|WP_029716816.1|  2-isopropylmalate synthase                         516   6e-167   
emb|CAA87005.1|  alpha-isopropylmalate synthase                         517   6e-167   
ref|WP_028089828.1|  2-isopropylmalate synthase                         517   7e-167   
ref|WP_034424034.1|  2-isopropylmalate synthase                         516   8e-167   
ref|WP_002808360.1|  2-isopropylmalate synthase                         517   9e-167   
ref|WP_036906618.1|  2-isopropylmalate synthase                         517   9e-167   
ref|WP_011142287.1|  2-isopropylmalate synthase                         516   1e-166   
ref|WP_027402275.1|  2-isopropylmalate synthase                         516   1e-166   
gb|KFK27840.1|  hypothetical protein AALP_AA8G436700                    514   2e-166   
ref|WP_015227231.1|  2-isopropylmalate synthase                         516   2e-166   
ref|WP_039200304.1|  2-isopropylmalate synthase                         516   2e-166   
ref|WP_025906611.1|  MULTISPECIES: 2-isopropylmalate synthase           516   2e-166   
ref|WP_006278854.1|  2-isopropylmalate synthase                         515   3e-166   
ref|WP_017315896.1|  2-isopropylmalate synthase                         515   3e-166   
ref|WP_011294775.1|  2-isopropylmalate synthase                         515   4e-166   
ref|WP_032515048.1|  2-isopropylmalate synthase                         515   4e-166   
ref|WP_018205329.1|  MULTISPECIES: hypothetical protein                 514   4e-166   
ref|WP_011824098.1|  2-isopropylmalate synthase                         515   5e-166   
emb|CAJ55508.1|  methylthioalkylmalate synthase c                       513   5e-166   
ref|WP_012007891.1|  2-isopropylmalate synthase                         515   6e-166   
ref|WP_032525700.1|  2-isopropylmalate synthase                         514   6e-166   
ref|WP_025952902.1|  2-isopropylmalate synthase                         515   6e-166   
ref|WP_025888605.1|  MULTISPECIES: 2-isopropylmalate synthase           514   7e-166   
ref|WP_015205803.1|  2-isopropylmalate synthase                         514   8e-166   
ref|WP_028951563.1|  2-isopropylmalate synthase                         514   8e-166   
gb|AGS49164.2|  methylthioalkylmalate synthase                          509   8e-166   
ref|WP_025942957.1|  MULTISPECIES: 2-isopropylmalate synthase           514   8e-166   
ref|WP_017286267.1|  2-isopropylmalate synthase                         514   8e-166   
ref|WP_025979794.1|  2-isopropylmalate synthase                         514   9e-166   
ref|WP_025964335.1|  2-isopropylmalate synthase                         514   1e-165   
ref|WP_025961265.1|  2-isopropylmalate synthase                         514   1e-165   
ref|WP_023174923.1|  2-isopropylmalate synthase                         513   2e-165   
ref|WP_011132699.1|  2-isopropylmalate synthase                         514   2e-165   
emb|CCA14652.1|  unnamed protein product                                516   2e-165   
ref|WP_025959797.1|  2-isopropylmalate synthase                         513   2e-165   
ref|WP_011818602.1|  2-isopropylmalate synthase                         513   3e-165   
ref|WP_008235779.1|  2-isopropylmalate synthase                         513   3e-165   
ref|XP_010416806.1|  PREDICTED: methylthioalkylmalate synthase 3,...    510   3e-165   
ref|WP_025881676.1|  MULTISPECIES: 2-isopropylmalate synthase           513   3e-165   
ref|WP_013565527.1|  2-isopropylmalate synthase                         512   3e-165   
ref|XP_007161708.1|  hypothetical protein PHAVU_001G091600g             506   4e-165   
ref|WP_025954704.1|  2-isopropylmalate synthase                         513   5e-165   
ref|WP_025945235.1|  MULTISPECIES: 2-isopropylmalate synthase           513   5e-165   
ref|WP_011376627.1|  2-isopropylmalate synthase                         513   5e-165   
ref|WP_007059935.1|  2-isopropylmalate synthase                         511   5e-165   
ref|WP_032514184.1|  2-isopropylmalate synthase                         513   5e-165   
ref|WP_025980981.1|  2-isopropylmalate synthase                         513   5e-165   
ref|WP_025894669.1|  MULTISPECIES: 2-isopropylmalate synthase           512   6e-165   
ref|WP_025924598.1|  2-isopropylmalate synthase                         512   6e-165   
ref|WP_025893380.1|  MULTISPECIES: 2-isopropylmalate synthase           512   6e-165   
ref|WP_032519091.1|  2-isopropylmalate synthase                         512   6e-165   
ref|WP_025958418.1|  2-isopropylmalate synthase                         512   6e-165   
ref|WP_025933674.1|  2-isopropylmalate synthase                         512   6e-165   
ref|WP_025928497.1|  2-isopropylmalate synthase                         512   6e-165   
ref|WP_025932038.1|  2-isopropylmalate synthase                         512   6e-165   
gb|AII45788.1|  2-isopropylmalate synthase                              512   6e-165   
ref|WP_036917966.1|  MULTISPECIES: 2-isopropylmalate synthase           512   7e-165   
ref|WP_032524611.1|  2-isopropylmalate synthase                         512   7e-165   
ref|WP_022608838.1|  2-isopropylmalate synthase, bacterial type         512   7e-165   
ref|WP_009342763.1|  2-isopropylmalate synthase                         511   7e-165   
ref|WP_025925376.1|  MULTISPECIES: 2-isopropylmalate synthase           512   7e-165   
ref|WP_025923337.1|  2-isopropylmalate synthase                         512   7e-165   
ref|WP_025939136.1|  2-isopropylmalate synthase                         512   9e-165   
ref|WP_025968117.1|  2-isopropylmalate synthase                         511   1e-164   
ref|WP_025955862.1|  2-isopropylmalate synthase                         511   1e-164   
ref|WP_016951502.1|  2-isopropylmalate synthase                         511   1e-164   
ref|WP_032076333.1|  2-isopropylmalate synthase                         510   1e-164   
ref|WP_011876672.1|  2-isopropylmalate synthase                         509   2e-164   
ref|WP_025956776.1|  2-isopropylmalate synthase                         511   2e-164   
ref|WP_006421503.1|  2-isopropylmalate synthase                         510   2e-164   
ref|WP_025900661.1|  MULTISPECIES: 2-isopropylmalate synthase           511   2e-164   
ref|WP_007098257.1|  2-isopropylmalate synthase                         511   2e-164   
gb|AIQ95218.1|  2-isopropylmalate synthase                              511   2e-164   
ref|XP_010428949.1|  PREDICTED: methylthioalkylmalate synthase 3,...    508   2e-164   
ref|WP_038543869.1|  2-isopropylmalate synthase                         511   2e-164   
ref|WP_025963775.1|  2-isopropylmalate synthase                         511   2e-164   
ref|WP_025940727.1|  2-isopropylmalate synthase                         511   3e-164   
ref|WP_025969887.1|  MULTISPECIES: 2-isopropylmalate synthase           511   3e-164   
ref|WP_009790250.1|  2-isopropylmalate synthase                         510   3e-164   
ref|XP_008881007.1|  2-isopropylmalate synthase                         512   3e-164   
ref|WP_025973354.1|  2-isopropylmalate synthase                         510   3e-164   
ref|WP_011196809.1|  2-isopropylmalate synthase                         509   4e-164   
ref|XP_010493411.1|  PREDICTED: methylthioalkylmalate synthase 3,...    508   4e-164   
ref|WP_011820463.1|  2-isopropylmalate synthase                         510   5e-164   
ref|XP_007140775.1|  hypothetical protein PHAVU_008G140900g             504   5e-164   
ref|WP_006041761.1|  2-isopropylmalate synthase                         509   5e-164   
ref|WP_008410938.1|  2-isopropylmalate synthase                         508   6e-164   
ref|WP_011125286.1|  MULTISPECIES: 2-isopropylmalate synthase           509   6e-164   
ref|WP_032516706.1|  2-isopropylmalate synthase                         509   6e-164   
emb|CAJ55511.1|  methylthioalkylmalate synthase c                       508   6e-164   
emb|CAJ55517.1|  methylthioalkylmalate synthase c                       508   6e-164   
ref|WP_006196799.1|  2-isopropylmalate synthase                         509   7e-164   
emb|CCI41999.1|  unnamed protein product                                512   7e-164   
ref|WP_025935950.1|  2-isopropylmalate synthase                         509   7e-164   
ref|WP_017747288.1|  2-isopropylmalate synthase                         509   1e-163   
ref|WP_034108196.1|  2-isopropylmalate synthase                         508   1e-163   
ref|WP_034416693.1|  2-isopropylmalate synthase                         508   1e-163   
ref|WP_019507644.1|  2-isopropylmalate synthase                         508   1e-163   
ref|WP_015250393.1|  2-isopropylmalate synthase                         508   1e-163   
ref|WP_027363979.1|  2-isopropylmalate synthase                         507   2e-163   
ref|WP_039737559.1|  2-isopropylmalate synthase                         508   2e-163   
dbj|BAL54332.1|  2-isopropylmalate synthase                             507   2e-163   
ref|WP_011378025.1|  2-isopropylmalate synthase                         508   2e-163   
ref|WP_015217059.1|  2-isopropylmalate synthase                         508   2e-163   
ref|WP_011933489.1|  2-isopropylmalate synthase                         508   2e-163   
ref|WP_025930492.1|  2-isopropylmalate synthase                         508   3e-163   
ref|WP_006910464.1|  2-isopropylmalate synthase                         508   3e-163   
ref|WP_027300715.1|  2-isopropylmalate synthase                         506   3e-163   
ref|WP_012963454.1|  2-isopropylmalate synthase                         506   4e-163   
ref|WP_017314323.1|  2-isopropylmalate synthase                         507   4e-163   
ref|WP_013840433.1|  2-isopropylmalate synthase                         506   4e-163   
ref|XP_009830853.1|  2-isopropylmalate synthase                         509   5e-163   



>ref|XP_009776176.1| PREDICTED: 2-isopropylmalate synthase B [Nicotiana sylvestris]
Length=606

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/565 (85%), Positives = 526/565 (93%), Gaps = 4/565 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             ++ C +   RRP+Y P+ I DPNY+R+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV
Sbjct  43    IIHCAI--RRRPEYTPSHIPDPNYIRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  100

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFPA+SEAD EAV+LIA+EVGNG  E  HVPVICGL+RCN+RDID+AWEAVK+AK
Sbjct  101   DIIEAGFPASSEADLEAVKLIAKEVGNGVNEEGHVPVICGLARCNKRDIDKAWEAVKYAK  160

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSEIHMKFKL MSR++VVEKA SMVAYARS+GC DVEFSPEDAGRSD EFL
Sbjct  161   KPRIHTFIATSEIHMKFKLKMSRDEVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFL  220

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y ILGEVIKAGATTLNIPDTVGYT+P+EFG+LIADIKANTPGI +VIISTHCQNDLGLST
Sbjct  221   YHILGEVIKAGATTLNIPDTVGYTVPSEFGKLIADIKANTPGIGDVIISTHCQNDLGLST  280

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+M+
Sbjct  281   ANTLAGACAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMS  340

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SPEDIGL+R N+SGI
Sbjct  341   SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRVNESGI  400

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHAL+ KM ELGYDI+GKE +DLFWRFKSVAEKKKKITDDDLIAL+SDEVFQP
Sbjct  401   VLGKLSGRHALQAKMLELGYDIEGKELEDLFWRFKSVAEKKKKITDDDLIALMSDEVFQP  460

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             Q VW+L ++QVTCGSLGLSTATVKLIDAD +EHV+CSVGTGPVDAAYKAVDL+VKVPV L
Sbjct  461   QFVWQLENVQVTCGSLGLSTATVKLIDADGQEHVSCSVGTGPVDAAYKAVDLIVKVPVAL  520

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYSL AVTEGIDAIASTRVLIRG+N HTSTHALTG  V+R+FSGTGA MDIVISSVRAY
Sbjct  521   LEYSLNAVTEGIDAIASTRVLIRGENGHTSTHALTGETVHRSFSGTGADMDIVISSVRAY  580

Query  1895  VGALNKMLSFTTLVSRYNKTEDNVV  1969
             +GALNKMLSF  LVS+++K E + V
Sbjct  581   IGALNKMLSFRKLVSKHSKPEGSAV  605



>gb|ACF17660.1| putative isopropylmalate synthase [Capsicum annuum]
Length=602

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/565 (85%), Positives = 527/565 (93%), Gaps = 4/565 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             +VRC +    RP+Y P+ ISDPNY+R+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV
Sbjct  39    IVRCSIRC--RPEYTPSHISDPNYIRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  96

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFPA+SEAD EAV+LIA+EVGNG  E  HVPVICGL+RCN+RDID+AWEAVK+AK
Sbjct  97    DIIEAGFPASSEADLEAVKLIAKEVGNGVYEEGHVPVICGLARCNKRDIDKAWEAVKYAK  156

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSEIHMKFKL MSR++V+EKA SMVAYARS+GC DVEFSPEDAGRSD EFL
Sbjct  157   KPRIHTFIATSEIHMKFKLKMSRDEVIEKARSMVAYARSIGCQDVEFSPEDAGRSDPEFL  216

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA+IKANTPG+E+VIISTHCQNDLGLST
Sbjct  217   YHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIANIKANTPGVEDVIISTHCQNDLGLST  276

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+M+
Sbjct  277   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMS  336

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGL+RAN+SGI
Sbjct  337   SKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLNRANESGI  396

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHAL+ KM ELGY+I+GKE DDLFWRFKSVAEKKKKITDDDLIAL+SDEVFQP
Sbjct  397   VLGKLSGRHALQAKMLELGYEIEGKELDDLFWRFKSVAEKKKKITDDDLIALMSDEVFQP  456

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             Q VW+L ++QVTCGSLGLSTATVKLIDAD +EH++CSVGTGPVDAAYKAVDL+VK+PVTL
Sbjct  457   QFVWQLQNVQVTCGSLGLSTATVKLIDADGKEHISCSVGTGPVDAAYKAVDLIVKIPVTL  516

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYS+ AVT+GIDAIASTRVLIRG+N HTSTHALTG  V+RTFSGTGA MDIVISSVRAY
Sbjct  517   LEYSMNAVTQGIDAIASTRVLIRGENGHTSTHALTGETVHRTFSGTGADMDIVISSVRAY  576

Query  1895  VGALNKMLSFTTLVSRYNKTEDNVV  1969
             +GALNKM+SF  L+++  K E + V
Sbjct  577   IGALNKMMSFRKLLAKNTKAEGSAV  601



>ref|XP_009602443.1| PREDICTED: 2-isopropylmalate synthase B [Nicotiana tomentosiformis]
Length=606

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/556 (86%), Positives = 522/556 (94%), Gaps = 2/556 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDY P+ I DP Y+R+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA
Sbjct  50    RRPDYTPSHIPDPKYIRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  109

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             +SEAD EAV+LIA+EVGNG  E  HVPVICGL+RCN+RDID+AWEAVK+AKKPR+HTFIA
Sbjct  110   SSEADLEAVKLIAKEVGNGVYEEGHVPVICGLARCNKRDIDKAWEAVKYAKKPRIHTFIA  169

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHMKFKL MSR++VVEKA SMVAYARS+GC DVEFSPEDAGRSD EFLY ILGEVIK
Sbjct  170   TSEIHMKFKLKMSRDEVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFLYHILGEVIK  229

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYT+P+EFG+LIADIKANTPGI +VIISTHCQNDLGLSTANTLAGA A
Sbjct  230   AGATTLNIPDTVGYTVPSEFGKLIADIKANTPGIGDVIISTHCQNDLGLSTANTLAGACA  289

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+M+SKMVEEYTG
Sbjct  290   GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMSSKMVEEYTG  349

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SPEDIGL+RAN+SGIVLGKLSGRH
Sbjct  350   LHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRANESGIVLGKLSGRH  409

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             AL+ KM ELGYDI+GKE +DLFWRFKSVAEKKKKITDDDLIAL+SDEVFQPQ VW+L ++
Sbjct  410   ALQAKMLELGYDIEGKELEDLFWRFKSVAEKKKKITDDDLIALMSDEVFQPQFVWQLENV  469

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCGSLGLSTATVKLIDAD +EHV+CSVGTGPVDAAYKAVDL+VKVPV LLEYSL AVT
Sbjct  470   QVTCGSLGLSTATVKLIDADGQEHVSCSVGTGPVDAAYKAVDLIVKVPVALLEYSLNAVT  529

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIASTRVLIRG+N HTSTHALTG  V+R+FSGTGA MDIVISSVRAY+GALNKMLS
Sbjct  530   EGIDAIASTRVLIRGENGHTSTHALTGETVHRSFSGTGADMDIVISSVRAYIGALNKMLS  589

Query  1922  FTTLVSRYNKTEDNVV  1969
             F  LVS++++ E + V
Sbjct  590   FRKLVSKHSRPEGSAV  605



>ref|XP_006350708.1| PREDICTED: 2-isopropylmalate synthase B-like [Solanum tuberosum]
Length=612

 Score =   996 bits (2574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/565 (85%), Positives = 525/565 (93%), Gaps = 4/565 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             +VRC +   RRP+Y PN I DPNYVR+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV
Sbjct  49    IVRCSIR--RRPEYTPNHIPDPNYVRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  106

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFPA+SEAD EAV+LIA+EVGNG  E  HVPVICGL+RCN++DID+AWEAVK+AK
Sbjct  107   DIIEAGFPASSEADLEAVKLIAKEVGNGVYEEGHVPVICGLARCNKKDIDKAWEAVKYAK  166

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSEIHM +KL MSR QVVEKA SMVAYARS+GC DVEFSPEDAGRSD EFL
Sbjct  167   KPRIHTFIATSEIHMNYKLKMSRVQVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFL  226

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA IKANTPG+E+VIISTHCQNDLGLST
Sbjct  227   YHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIAKIKANTPGVEDVIISTHCQNDLGLST  286

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+M+
Sbjct  287   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMS  346

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SPEDIGL+RAN+SGI
Sbjct  347   SKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRANKSGI  406

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHAL+ KM ELGY+I+GKE DDLFWRFKSVAEKKKKITDDDLIAL+SDEVFQP
Sbjct  407   VLGKLSGRHALQAKMLELGYEIEGKELDDLFWRFKSVAEKKKKITDDDLIALMSDEVFQP  466

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             Q VW+L ++QVTCGSLGLSTATVKLIDAD +EH++CSVGTGPVDAAYKAVDL+VKVPVTL
Sbjct  467   QFVWQLQNVQVTCGSLGLSTATVKLIDADGQEHISCSVGTGPVDAAYKAVDLIVKVPVTL  526

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYS+ AVT+GIDAIASTRVLIRG+N HTSTHALTG  V+RTFSGTGA MDIVISSVRAY
Sbjct  527   LEYSMNAVTQGIDAIASTRVLIRGENGHTSTHALTGETVHRTFSGTGADMDIVISSVRAY  586

Query  1895  VGALNKMLSFTTLVSRYNKTEDNVV  1969
             VGALNKM+SF  L+++ NK E + V
Sbjct  587   VGALNKMMSFRKLLAKNNKPEGSAV  611



>ref|XP_004240995.1| PREDICTED: 2-isopropylmalate synthase B [Solanum lycopersicum]
Length=612

 Score =   989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/565 (84%), Positives = 524/565 (93%), Gaps = 4/565 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             VVRC +   RRP+Y P+ I DPNYVR+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV
Sbjct  49    VVRCSIR--RRPEYTPSHIPDPNYVRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  106

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFPA+SEAD EAV+LIA+EVGNG  E  +VPVICGL+RCN++DID+AWEAVK+AK
Sbjct  107   DIIEAGFPASSEADLEAVKLIAKEVGNGVYEEGYVPVICGLARCNKKDIDKAWEAVKYAK  166

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSEIHM +KL MSR+QVVEKA SMVAYARS+GC DVEFSPEDAGRSD EFL
Sbjct  167   KPRIHTFIATSEIHMNYKLKMSRDQVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFL  226

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA IKANTPG+E+VIISTHCQNDLGLST
Sbjct  227   YHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIAKIKANTPGVEDVIISTHCQNDLGLST  286

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+M+
Sbjct  287   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMS  346

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SPEDIGL+RAN+SGI
Sbjct  347   SKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRANESGI  406

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHAL+ KM ELGY+I+GKE DDLFWRFKSVAEKKKKITDDDL+AL+SDEVFQP
Sbjct  407   VLGKLSGRHALQAKMLELGYEIEGKELDDLFWRFKSVAEKKKKITDDDLVALMSDEVFQP  466

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             Q VW+L ++QVT GSLGLSTATVKLIDAD  EH++CSVGTGPVDAAYKAVDL+VKVPVTL
Sbjct  467   QFVWQLQNVQVTSGSLGLSTATVKLIDADGREHISCSVGTGPVDAAYKAVDLIVKVPVTL  526

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYS+ AVT+GIDAIASTRVLIRG+N HTSTHA+TG  ++RTFSGTGA MDIVISSVRAY
Sbjct  527   LEYSMNAVTQGIDAIASTRVLIRGENGHTSTHAVTGETIHRTFSGTGADMDIVISSVRAY  586

Query  1895  VGALNKMLSFTTLVSRYNKTEDNVV  1969
             VGALNKM+SF  L+++ NK E + V
Sbjct  587   VGALNKMMSFRKLMAKNNKPESSAV  611



>ref|XP_009604558.1| PREDICTED: 2-isopropylmalate synthase A [Nicotiana tomentosiformis]
Length=607

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/564 (84%), Positives = 528/564 (94%), Gaps = 3/564 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             V+RC +   +RP+YIP++ISD  YVR+FDTTLRDGEQSPGATMTTKEKLDVAR+LAKLGV
Sbjct  45    VIRCSI--QKRPEYIPSKISDHKYVRIFDTTLRDGEQSPGATMTTKEKLDVARKLAKLGV  102

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGN-GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKK  637
             DIIEAGFPA+SEADFEAVRLIA+E+GN  +G++VPVICGL+RCN+RDID+AWEAVK AK+
Sbjct  103   DIIEAGFPASSEADFEAVRLIAEEIGNNSDGDYVPVICGLARCNKRDIDKAWEAVKCAKR  162

Query  638   PRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  817
             PRVHTFIATSEIHMK+KL MS+E+VVEKA SMVAYARSLGC DVEFSPEDAGRS+REFLY
Sbjct  163   PRVHTFIATSEIHMKYKLKMSKEEVVEKARSMVAYARSLGCEDVEFSPEDAGRSEREFLY  222

Query  818   QILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  997
              ILGEVIKAGATTLNIPDTVGYT+PTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA
Sbjct  223   HILGEVIKAGATTLNIPDTVGYTVPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  282

Query  998   NTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMAS  1177
             NTLAGA AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIN+QHI+  S
Sbjct  283   NTLAGACAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINSQHIVPTS  342

Query  1178  KMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIV  1357
             KMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SPEDIGL+RAN++GIV
Sbjct  343   KMVEEYTGLQVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLNRANEAGIV  402

Query  1358  LGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQ  1537
             LGKLSGRHALK+KM ELGYDI+GKE +D+FWRFKSVAEKKKKITDDD+IAL+SDE+FQPQ
Sbjct  403   LGKLSGRHALKSKMLELGYDIEGKELEDIFWRFKSVAEKKKKITDDDIIALMSDEIFQPQ  462

Query  1538  LVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLL  1717
             +VW+L D+Q+TCGSLGLSTATVKLID+D ++HVACSVGTGPVDAAYKAVDL+VKVP+TLL
Sbjct  463   VVWQLADVQITCGSLGLSTATVKLIDSDGQDHVACSVGTGPVDAAYKAVDLIVKVPITLL  522

Query  1718  EYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYV  1897
             EYS+ AVTEGIDAIASTRVLIRG++ H  T+   G  ++RTFSGTGA MD+VISSVRAY+
Sbjct  523   EYSMNAVTEGIDAIASTRVLIRGEDDHAITNGSIGPTLHRTFSGTGADMDVVISSVRAYI  582

Query  1898  GALNKMLSFTTLVSRYNKTEDNVV  1969
             GALNKMLSF  LVSRY K E +VV
Sbjct  583   GALNKMLSFGKLVSRYKKPEGSVV  606



>ref|XP_009800501.1| PREDICTED: 2-isopropylmalate synthase A [Nicotiana sylvestris]
Length=608

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/565 (84%), Positives = 524/565 (93%), Gaps = 4/565 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             V+RC +   +RP+YIP++IS+  YVR+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV
Sbjct  45    VIRCSI--QKRPEYIPSKISNHKYVRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  102

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFPA+SEADFEAVRLIA+E+GN   +G++VPVICGLSRCN+RDID+AWEAVK AK
Sbjct  103   DIIEAGFPASSEADFEAVRLIAEEIGNNNSDGDYVPVICGLSRCNKRDIDKAWEAVKCAK  162

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PRVHTFIATSEIHMK+KL MS+E+VVEKA SMVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  163   RPRVHTFIATSEIHMKYKLKMSKEEVVEKARSMVAYARSLGCEDVEFSPEDAGRSEREFL  222

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y ILGEVIKAGATTLNIPDTVGYT+PTEFGQLIADIKANTPGIENVIISTHCQNDLGLST
Sbjct  223   YHILGEVIKAGATTLNIPDTVGYTVPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  282

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA AGARQVEVTINGIGERAGNASLEEVVMALKCRGE+VLGGLYTGINTQHII  
Sbjct  283   ANTLAGACAGARQVEVTINGIGERAGNASLEEVVMALKCRGEKVLGGLYTGINTQHIIPT  342

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SPEDIGL RAN++GI
Sbjct  343   SKMVEEYTGLQVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPEDIGLSRANEAGI  402

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHALK+KM ELGYDI+GKE +DLFWRFKSVAEKKKKITDDD+IAL+SDEVFQP
Sbjct  403   VLGKLSGRHALKSKMLELGYDIEGKELEDLFWRFKSVAEKKKKITDDDIIALMSDEVFQP  462

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             Q+VW+L D+Q+ CGSLGLSTATVKLID+D +EHVACSVGTGPVDAAYKAVDL+VKVP+TL
Sbjct  463   QVVWQLADVQIACGSLGLSTATVKLIDSDGQEHVACSVGTGPVDAAYKAVDLIVKVPITL  522

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYS+ AVTEGIDAIASTRVLIRG++ H  T+   G   +R FSGTGA MD+VISSVRAY
Sbjct  523   LEYSMNAVTEGIDAIASTRVLIRGEDDHAITNGSIGPTHHRIFSGTGADMDVVISSVRAY  582

Query  1895  VGALNKMLSFTTLVSRYNKTEDNVV  1969
             +GALNKMLSF  LVSRY K E +VV
Sbjct  583   IGALNKMLSFGKLVSRYKKPEGSVV  607



>ref|XP_010324700.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase A-like 
[Solanum lycopersicum]
Length=589

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/564 (84%), Positives = 522/564 (93%), Gaps = 3/564 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             +RC + + RRP+Y+P++ISDP YVR+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD
Sbjct  26    IRCSI-SNRRPEYVPSKISDPKYVRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  84

Query  464   IIEAGFPAASEADFEAVRLIAQEVGNGEGEH--VPVICGLSRCNQRDIDRAWEAVKHAKK  637
             IIEAGFPA+SEADFE+V+LIA+E+GN   E+  VPVICGLSRCN+ DID+AWEAVK+AKK
Sbjct  85    IIEAGFPASSEADFESVKLIAEEIGNNTDENGFVPVICGLSRCNKSDIDKAWEAVKYAKK  144

Query  638   PRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  817
             PRVHTFIATSEIHMK+KL MSREQVVEKA SMVAYARSLGC DVEFSPEDAGRSDREFLY
Sbjct  145   PRVHTFIATSEIHMKYKLKMSREQVVEKARSMVAYARSLGCEDVEFSPEDAGRSDREFLY  204

Query  818   QILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  997
              ILGEVIKAGATTLNIPDTVGYT+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTA
Sbjct  205   DILGEVIKAGATTLNIPDTVGYTVPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  264

Query  998   NTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMAS  1177
             NTLAGA AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+ +S
Sbjct  265   NTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIVPSS  324

Query  1178  KMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIV  1357
             KMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SP+D+GL R+N++GIV
Sbjct  325   KMVEEYSGLQVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPDDVGLSRSNEAGIV  384

Query  1358  LGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQ  1537
             LGKLSGRHALK+KM ELGYDIDGKE +DLFWRFKSVAEKKKKITDDDLIAL+SDEV QP 
Sbjct  385   LGKLSGRHALKSKMLELGYDIDGKELEDLFWRFKSVAEKKKKITDDDLIALMSDEVLQPN  444

Query  1538  LVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLL  1717
             + WKLGD+Q+ CGSLGLSTATVKLI+ D +EH+ACSVGTGPVDAAYKAVDL+VKVP+TLL
Sbjct  445   VYWKLGDVQIMCGSLGLSTATVKLINTDGQEHIACSVGTGPVDAAYKAVDLIVKVPITLL  504

Query  1718  EYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYV  1897
             EYS+ AVTEGIDAIASTRV I   + HT  +  TG  ++RTFSGTGA MD+VISSVRAY+
Sbjct  505   EYSMNAVTEGIDAIASTRVSICSIDRHTIMNGSTGQTIHRTFSGTGADMDVVISSVRAYI  564

Query  1898  GALNKMLSFTTLVSRYNKTEDNVV  1969
             GALNKMLS+  LVSRY+K ED+VV
Sbjct  565   GALNKMLSYEKLVSRYSKPEDSVV  588



>sp|O04973.1|LEU1A_SOLPN RecName: Full=2-isopropylmalate synthase A; AltName: Full=Alpha-IPM 
synthase A; AltName: Full=Alpha-isopropylmalate synthase 
A [Solanum pennellii]
 gb|AAB61598.1| 2-isopropylmalate synthase [Solanum pennellii]
Length=589

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/564 (83%), Positives = 521/564 (92%), Gaps = 3/564 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             +RC + + RRP+Y+P++ISDP YVR+FDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD
Sbjct  26    IRCSI-SNRRPEYVPSKISDPKYVRIFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  84

Query  464   IIEAGFPAASEADFEAVRLIAQEVGNGEGEH--VPVICGLSRCNQRDIDRAWEAVKHAKK  637
             IIEAGFPA+SEADFE+V+LIA+E+GN   E+  VPVICGLSRCN+ DID+AWEAVK+AKK
Sbjct  85    IIEAGFPASSEADFESVKLIAEEIGNNTDENGFVPVICGLSRCNKSDIDKAWEAVKYAKK  144

Query  638   PRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLY  817
             PRVHTFIATSEIHMK+KL MSREQVVEKA SMVAYARSLGC DVEFSPEDAGRSDREFLY
Sbjct  145   PRVHTFIATSEIHMKYKLKMSREQVVEKARSMVAYARSLGCEDVEFSPEDAGRSDREFLY  204

Query  818   QILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTA  997
              ILGEVIKAGATTLNIPDTVGYT+P+EFGQLI DIKANTPGIENVIISTHCQNDLGLSTA
Sbjct  205   DILGEVIKAGATTLNIPDTVGYTVPSEFGQLITDIKANTPGIENVIISTHCQNDLGLSTA  264

Query  998   NTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMAS  1177
             NTLAGA AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+ +S
Sbjct  265   NTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIVPSS  324

Query  1178  KMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIV  1357
             KMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEI+SP+D+GL R+N++GIV
Sbjct  325   KMVEEYSGLQVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIISPDDVGLSRSNEAGIV  384

Query  1358  LGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQ  1537
             LGKLSGRHALK+KM ELGYDIDGKE +DLFWRFKSVAEKKKKITDDDLIAL+SDEV QP 
Sbjct  385   LGKLSGRHALKSKMLELGYDIDGKELEDLFWRFKSVAEKKKKITDDDLIALMSDEVLQPN  444

Query  1538  LVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLL  1717
             + WKLGD+Q+ CGSLGLSTATVKLI+ D +EH+ACSVGTGPVDAAYKAVDL+VKVP+TLL
Sbjct  445   VYWKLGDVQIMCGSLGLSTATVKLINTDGQEHIACSVGTGPVDAAYKAVDLIVKVPITLL  504

Query  1718  EYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYV  1897
             EYS+ AVTEGIDAIASTRV I   + HT  +  TG  ++RTFSGTGA MD+VISSVRAY+
Sbjct  505   EYSMNAVTEGIDAIASTRVSICSIDRHTIMNGSTGQTIHRTFSGTGADMDVVISSVRAYI  564

Query  1898  GALNKMLSFTTLVSRYNKTEDNVV  1969
             GALNKMLS+  LVSRY+K ED+VV
Sbjct  565   GALNKMLSYEKLVSRYSKPEDSVV  588



>ref|XP_011084168.1| PREDICTED: 2-isopropylmalate synthase A-like [Sesamum indicum]
Length=607

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/562 (84%), Positives = 519/562 (92%), Gaps = 3/562 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VRC +   RRP+YIPNRI D  YVR+FDTTLRDGEQSPGATMTTKEKLD+ARQLA+LGVD
Sbjct  45    VRCSV---RRPEYIPNRIPDSKYVRIFDTTLRDGEQSPGATMTTKEKLDIARQLARLGVD  101

Query  464   IIEAGFPAASEADFEAVRLIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPR  643
             IIEAGFPA+S+ADFEAV+LIA+EVGN + +HVPVICGL+RCN+RDIDRAWEAVK AKKPR
Sbjct  102   IIEAGFPASSDADFEAVKLIAREVGNVDSDHVPVICGLARCNKRDIDRAWEAVKFAKKPR  161

Query  644   VHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  823
             +HTFIATSEIHMKFKL M+ EQV+EKA SMVA+ARSLGC+DVEFSPEDAGRSDREFLYQI
Sbjct  162   IHTFIATSEIHMKFKLKMTPEQVLEKARSMVAHARSLGCNDVEFSPEDAGRSDREFLYQI  221

Query  824   LGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  1003
             LGEVIKAGATTLNIPDTVGYTLP+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT
Sbjct  222   LGEVIKAGATTLNIPDTVGYTLPSEFGRLIADIKANTPGIENVIISTHCQNDLGLSTANT  281

Query  1004  LAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKM  1183
             LAGA+AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVL GLYTGINTQHI+MASKM
Sbjct  282   LAGAHAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLDGLYTGINTQHIVMASKM  341

Query  1184  VEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLG  1363
             VEEY+GL +QPHKAIVGANAFAHESGIHQDGMLK+K+TYEI+SPEDIGL R+N+SGIVLG
Sbjct  342   VEEYSGLRIQPHKAIVGANAFAHESGIHQDGMLKNKNTYEIISPEDIGLLRSNESGIVLG  401

Query  1364  KLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLV  1543
             KLSGRHALK KM ELGYDIDGKE DDLF RFK VA  KK ITDDDLIAL+SDEVFQP +V
Sbjct  402   KLSGRHALKAKMLELGYDIDGKELDDLFARFKDVAGNKKIITDDDLIALVSDEVFQPLVV  461

Query  1544  WKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEY  1723
             WKL D+QVTCGSLGLSTATVKLIDA+ +EH++CSVGTGPVDAAYKAVDL+VKVPVTLLEY
Sbjct  462   WKLEDVQVTCGSLGLSTATVKLIDANGDEHISCSVGTGPVDAAYKAVDLIVKVPVTLLEY  521

Query  1724  SLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGA  1903
             ++ AVTEGIDAIA+TRVLIRG++S TSTHALTG  +NR FSGTGA MDIVISSVRAYVGA
Sbjct  522   TMNAVTEGIDAIATTRVLIRGEDSITSTHALTGETINRAFSGTGAAMDIVISSVRAYVGA  581

Query  1904  LNKMLSFTTLVSRYNKTEDNVV  1969
             LNK+L F   V   + ++  V+
Sbjct  582   LNKLLGFKNRVETEDPSQSKVL  603



>gb|EYU26034.1| hypothetical protein MIMGU_mgv1a003059mg [Erythranthe guttata]
Length=611

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/562 (83%), Positives = 515/562 (92%), Gaps = 3/562 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             +RC +   RRP+YIPN I DP YVR+FDTTLRDGEQSPGATMTTKEKLD+ARQLA+LGVD
Sbjct  49    IRCSI---RRPEYIPNHIPDPKYVRIFDTTLRDGEQSPGATMTTKEKLDIARQLARLGVD  105

Query  464   IIEAGFPAASEADFEAVRLIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPR  643
             IIEAGFPA+S+ADFE V+LIA+EVGN + +HVPVICGL+RCN+RDIDRAWEAVK AKKPR
Sbjct  106   IIEAGFPASSDADFEGVKLIAREVGNADSDHVPVICGLARCNKRDIDRAWEAVKEAKKPR  165

Query  644   VHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  823
             +HTFIATSEIHM+FKL MSR+QVVEKATSMVAYARSLGC+DVEFSPEDAGRSDREFLYQI
Sbjct  166   IHTFIATSEIHMEFKLKMSRQQVVEKATSMVAYARSLGCNDVEFSPEDAGRSDREFLYQI  225

Query  824   LGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  1003
             LGEVIKAGATTLNIPDTVGYTLPTEFGQLIAD+KANTPGIENVIISTHCQNDLGLSTANT
Sbjct  226   LGEVIKAGATTLNIPDTVGYTLPTEFGQLIADLKANTPGIENVIISTHCQNDLGLSTANT  285

Query  1004  LAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKM  1183
             L+GA+AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVL GLYTGINTQHI+MASKM
Sbjct  286   LSGAHAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLDGLYTGINTQHIVMASKM  345

Query  1184  VEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLG  1363
             VEEY+GL +QPHKAIVGANAFAHESGIHQDGMLK+K+TYEI+SPEDIGL R+N+SGIVLG
Sbjct  346   VEEYSGLRIQPHKAIVGANAFAHESGIHQDGMLKNKNTYEIISPEDIGLLRSNESGIVLG  405

Query  1364  KLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLV  1543
             KLSGRHALK KM ELGYDIDGK  DDLF RFK VA  KK ITDDDLIAL+SDEVFQP ++
Sbjct  406   KLSGRHALKAKMLELGYDIDGKGLDDLFARFKGVAGNKKIITDDDLIALVSDEVFQPVVI  465

Query  1544  WKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEY  1723
             WK+ D+QVTCGSLGLSTATVKLIDAD  E+++CSVGTGPVDAAYKAVDL+VKVPV LLEY
Sbjct  466   WKVEDVQVTCGSLGLSTATVKLIDADGAEYISCSVGTGPVDAAYKAVDLVVKVPVRLLEY  525

Query  1724  SLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGA  1903
             S+ AVTEGIDAIA+TRVLIR ++S T+THA+TG  VNR FSGTGA MDIVISSVRAYVGA
Sbjct  526   SMNAVTEGIDAIATTRVLIRAEDSVTATHAMTGETVNRAFSGTGAAMDIVISSVRAYVGA  585

Query  1904  LNKMLSFTTLVSRYNKTEDNVV  1969
             LNK++ F   +   +  E  V+
Sbjct  586   LNKLIGFNIRLETEDSGETKVL  607



>sp|O04974.1|LEU1B_SOLPN RecName: Full=2-isopropylmalate synthase B; AltName: Full=Alpha-IPM 
synthase B; AltName: Full=Alpha-isopropylmalate synthase 
B [Solanum pennellii]
 gb|AAB61599.1| 2-isopropylmalate synthase [Solanum pennellii]
Length=612

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/565 (83%), Positives = 516/565 (91%), Gaps = 4/565 (1%)
 Frame = +2

Query  281   VVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             VVRC +   R P+Y P+ I DPNYVR+FDTTLRDGEQSPGATMTTKEKLDVARQ AKLGV
Sbjct  49    VVRCSIR--RIPEYTPSHIPDPNYVRIFDTTLRDGEQSPGATMTTKEKLDVARQSAKLGV  106

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFPA+SEAD EAV+LIA+EVGNG  E E+VPVICGL+RCN++DID+AWEAVK+AK
Sbjct  107   DIIEAGFPASSEADLEAVKLIAKEVGNGVYEEEYVPVICGLARCNKKDIDKAWEAVKYAK  166

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSE+HM +KL MSR+QVVEKA SMVAYARS+GC DVEFSPEDAGRSD EFL
Sbjct  167   KPRIHTFIATSEVHMNYKLKMSRDQVVEKARSMVAYARSIGCEDVEFSPEDAGRSDPEFL  226

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y ILGEVIKAGATTLNIPDTVGYT+P EFGQLIA IKANTPG+E+VIISTHCQNDLGLST
Sbjct  227   YHILGEVIKAGATTLNIPDTVGYTVPEEFGQLIAKIKANTPGVEDVIISTHCQNDLGLST  286

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+M+
Sbjct  287   ANTLAGACAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHILMS  346

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMVE  +GL VQPHKAIVGANAF HESGIHQDGMLKHKDTYEI+SPEDIGL+RAN+SGI
Sbjct  347   SKMVEGISGLHVQPHKAIVGANAFVHESGIHQDGMLKHKDTYEIISPEDIGLNRANESGI  406

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             V GKLSG    K KM ELGY+I+GKE DDLFWRFKSVAEKKKKITDDDL+AL+SDEVFQP
Sbjct  407   VFGKLSGVMLCKPKMLELGYEIEGKELDDLFWRFKSVAEKKKKITDDDLVALMSDEVFQP  466

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             Q VW+L ++QVTCGSLGLSTATVKLIDAD  EH++CSVGTGPVDAAYKAVDL+VKVPVTL
Sbjct  467   QFVWQLQNVQVTCGSLGLSTATVKLIDADGREHISCSVGTGPVDAAYKAVDLIVKVPVTL  526

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYS+ AVT+GIDAIASTRVLIRG+N HTSTHALTG  V+RTFSGTGA MDIVISSVRAY
Sbjct  527   LEYSMNAVTQGIDAIASTRVLIRGENGHTSTHALTGETVHRTFSGTGADMDIVISSVRAY  586

Query  1895  VGALNKMLSFTTLVSRYNKTEDNVV  1969
             VGALNKM+SF  L+++ NK E + V
Sbjct  587   VGALNKMMSFRKLMAKNNKPESSAV  611



>ref|XP_011073908.1| PREDICTED: 2-isopropylmalate synthase A-like [Sesamum indicum]
Length=605

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/547 (84%), Positives = 504/547 (92%), Gaps = 3/547 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             +RC L   RRP+YIPN I DP YVR+FDTTLRDGEQSPGATMTTKEKLD+ARQLA+LGVD
Sbjct  43    IRCSL---RRPEYIPNHIPDPKYVRIFDTTLRDGEQSPGATMTTKEKLDIARQLARLGVD  99

Query  464   IIEAGFPAASEADFEAVRLIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPR  643
             IIEAGFPA+S+ADFEAV LIA+EVGN + +HVPVIC LSRCN+RDI++AWEAVK+AKKPR
Sbjct  100   IIEAGFPASSDADFEAVTLIAREVGNADADHVPVICALSRCNKRDIEKAWEAVKYAKKPR  159

Query  644   VHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQI  823
             +HTFIATSEIHMK+KL M+ EQV++KA SMVAYARSLGC DVEFSPEDAGRS+REFLYQI
Sbjct  160   IHTFIATSEIHMKYKLRMTPEQVIDKARSMVAYARSLGCDDVEFSPEDAGRSEREFLYQI  219

Query  824   LGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT  1003
             L EVI AGATTLNIPDTVGYTLP EFGQLIADIKANT GI+NVIISTHCQNDLGLSTANT
Sbjct  220   LEEVINAGATTLNIPDTVGYTLPNEFGQLIADIKANTRGIDNVIISTHCQNDLGLSTANT  279

Query  1004  LAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKM  1183
             LAGA+AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQ+L GLYTGINTQHIIMASKM
Sbjct  280   LAGAHAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQLLDGLYTGINTQHIIMASKM  339

Query  1184  VEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLG  1363
             VEEY+GL VQPHKAIVGANAFAHESGIHQDGMLK+K+TYEI++PEDIGL R+N+SGIVLG
Sbjct  340   VEEYSGLRVQPHKAIVGANAFAHESGIHQDGMLKNKNTYEIIAPEDIGLLRSNESGIVLG  399

Query  1364  KLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLV  1543
             KLSGRHALK KM ELGYDIDGKE DDLF RFK+VA  KK ITDDDLIAL+SDEVFQPQ+V
Sbjct  400   KLSGRHALKAKMLELGYDIDGKELDDLFSRFKNVAGNKKIITDDDLIALVSDEVFQPQVV  459

Query  1544  WKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEY  1723
             WKL D+QVTCG+LGLSTATVKL  AD ++H+ACSVGTGPVDAAYKAVDL+VKVPVTL+EY
Sbjct  460   WKLEDVQVTCGTLGLSTATVKLSGADGKKHIACSVGTGPVDAAYKAVDLIVKVPVTLVEY  519

Query  1724  SLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGA  1903
             S+ AVTEGIDAIASTRVLIRG++S TST A TG  V RTFSGTGA MDIVISSVRAY+ A
Sbjct  520   SMNAVTEGIDAIASTRVLIRGEDSVTSTDAPTGETVKRTFSGTGAAMDIVISSVRAYISA  579

Query  1904  LNKMLSF  1924
             LNKML +
Sbjct  580   LNKMLGY  586



>ref|XP_002268942.2| PREDICTED: 2-isopropylmalate synthase A-like [Vitis vinifera]
Length=628

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/540 (81%), Positives = 494/540 (91%), Gaps = 2/540 (0%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPNRI DPNYVR+FDTTLRDGEQSPGATMT+KEKLD+ARQLAKLGVDIIEAGFPAA
Sbjct  72    RPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAA  131

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S+ D +AV++IA+EVGN   E  HVPVICGL+RCN+ DI  AWEAVK+AK+PR+HTFIAT
Sbjct  132   SKDDLDAVKIIAKEVGNAVDENGHVPVICGLARCNRNDISTAWEAVKYAKRPRIHTFIAT  191

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             SEIHMK+KL  S ++V+E A  MV YARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKA
Sbjct  192   SEIHMKYKLKKSEKEVIEIAREMVKYARSLGCDDVEFSPEDAGRSEREFLYKILGEVIKA  251

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDTVGYT+P EFGQLIADIK+NTPGIENVIISTHCQNDLGLSTANT+AGA AG
Sbjct  252   GATTLNIPDTVGYTVPNEFGQLIADIKSNTPGIENVIISTHCQNDLGLSTANTIAGACAG  311

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQVEVTINGIGERAGNASLEEVVMALKCRGE+ LGGLYTGIN +HI+  SKMV EY+GL
Sbjct  312   ARQVEVTINGIGERAGNASLEEVVMALKCRGEKALGGLYTGINIRHIVKTSKMVAEYSGL  371

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              VQPHKAIVGANAFAHESGIHQDGMLKHK+TYEI+SPEDIGL R+N+SGIVLGKLSGRHA
Sbjct  372   QVQPHKAIVGANAFAHESGIHQDGMLKHKETYEIISPEDIGLFRSNESGIVLGKLSGRHA  431

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ  1564
             LK+++ ELGY+I+G E DD+FWRFK VAEKKK +TD D+IAL+SDE+FQP++ WKLGDLQ
Sbjct  432   LKSRLLELGYEIEGMELDDIFWRFKEVAEKKKNLTDVDVIALVSDEIFQPKVFWKLGDLQ  491

Query  1565  VTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTE  1744
             VTCG+LGLSTATVKLIDAD ++HVACSVGTGPVD+AYKA+DLLVK  VTLLEY L AVTE
Sbjct  492   VTCGTLGLSTATVKLIDADGQKHVACSVGTGPVDSAYKAIDLLVKEQVTLLEYGLNAVTE  551

Query  1745  GIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             GIDAIA+TRVLIRG+ +HT T+ALTG  V+R+FSGTGAGMDIV+SSVRAY+ ALNKML F
Sbjct  552   GIDAIATTRVLIRGEKNHTLTNALTGETVHRSFSGTGAGMDIVVSSVRAYISALNKMLGF  611



>emb|CDP16992.1| unnamed protein product [Coffea canephora]
Length=621

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/545 (83%), Positives = 501/545 (92%), Gaps = 5/545 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPNRISDPNYVR+FDTTLRDGEQSPGATMTTK+KLD+ARQLAKLGVDIIEAGFPA+
Sbjct  70    RPEYIPNRISDPNYVRIFDTTLRDGEQSPGATMTTKQKLDIARQLAKLGVDIIEAGFPAS  129

Query  491   SEADFEAVRLIAQEVGN----GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             SEAD EAV+LIA+EVGN    G   H+PVICGLSRCN+RDID+AWEAVK+AKKPR+HTFI
Sbjct  130   SEADLEAVKLIAKEVGNVSPEGADGHLPVICGLSRCNKRDIDKAWEAVKYAKKPRIHTFI  189

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             ATSEIH+K KL  ++EQV+E A SMVAYARSLGC DVEFSPEDAGRSDREFLY+ILGEVI
Sbjct  190   ATSEIHLKHKLKKTKEQVLETARSMVAYARSLGCPDVEFSPEDAGRSDREFLYEILGEVI  249

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTLNIPDTVG  +  EF QLIADIKANTPGI+NVIISTHCQNDLGL+TAN++ GA 
Sbjct  250   KAGATTLNIPDTVGILVHDEFEQLIADIKANTPGIDNVIISTHCQNDLGLATANSIGGAI  309

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQ+EVTINGIGERAGNASLEEVVMA+KCRGEQV+GGLYTGINTQHI++ SKMVEE +
Sbjct  310   AGARQLEVTINGIGERAGNASLEEVVMAIKCRGEQVMGGLYTGINTQHIVVTSKMVEECS  369

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL +QPHKAIVGANAFAHESGIHQDGMLK+KDTYEIMSPEDIGL R+N+SGIVLGKLSGR
Sbjct  370   GLHIQPHKAIVGANAFAHESGIHQDGMLKNKDTYEIMSPEDIGLLRSNESGIVLGKLSGR  429

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGD  1558
             HALK K+ ELGYDIDGKE DDLF RFKSVAE KK ITD+DLIAL+SDEVFQPQ+ WKLGD
Sbjct  430   HALKAKLLELGYDIDGKELDDLFPRFKSVAENKKNITDEDLIALVSDEVFQPQVFWKLGD  489

Query  1559  LQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAV  1738
             +QVTCG+LGLSTATVKLIDAD +EH+ CSVGTGPVDAAYKA+DL+ KVP+ LLEYSL+AV
Sbjct  490   VQVTCGTLGLSTATVKLIDADGKEHIECSVGTGPVDAAYKAIDLITKVPLILLEYSLSAV  549

Query  1739  TEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             TEGIDAIA+TRVLIRGD S T+THALTG  ++RTFSGTGA MDIV+SSVRAY+GALNK L
Sbjct  550   TEGIDAIATTRVLIRGD-SQTATHALTGEAMSRTFSGTGAAMDIVVSSVRAYLGALNKKL  608

Query  1919  SFTTL  1933
             SF  L
Sbjct  609   SFKKL  613



>ref|NP_177544.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana]
 sp|Q9C550.1|LEU12_ARATH RecName: Full=2-isopropylmalate synthase 2, chloroplastic; AltName: 
Full=2-isopropylmalate synthase 1; AltName: Full=Methylthioalkylmalate 
synthase-like 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG52530.1|AC016662_24 putative 2-isopropylmalate synthase; 30920-27612 [Arabidopsis 
thaliana]
 gb|AAG52882.1|AF327647_1 2-isopropylmalate synthase [Arabidopsis thaliana]
 gb|AAL15290.1| At1g74040/F2P9_9 [Arabidopsis thaliana]
 gb|AAN33190.1| At1g74040/F2P9_9 [Arabidopsis thaliana]
 gb|AEE35540.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana]
Length=631

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/551 (79%), Positives = 503/551 (91%), Gaps = 2/551 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  72    RRPNYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  131

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  132   ASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  191

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+K+KL  S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  192   TSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  251

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA++
Sbjct  252   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHS  311

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG
Sbjct  312   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTG  371

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEIMSPE+IGL R+N +GIVLGKLSGRH
Sbjct  372   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNDAGIVLGKLSGRH  431

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL D+
Sbjct  432   ALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDM  491

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLST+TVKL D+D +EHVACSVGTGPVDAAYKAVDL+VK P TLLEYS+ AVT
Sbjct  492   QITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVT  551

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGDN+++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML 
Sbjct  552   EGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLG  611

Query  1922  FTTLVSRYNKT  1954
             F    S  +KT
Sbjct  612   FKEHTSTLSKT  622



>ref|XP_010428367.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic [Camelina 
sativa]
Length=627

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/541 (80%), Positives = 501/541 (93%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  68    RRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  127

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  128   ASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  187

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+K+KL  S+++V+E A +MVA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  188   TSDIHLKYKLKKSKDEVIEIARNMVAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  247

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA++
Sbjct  248   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHS  307

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG
Sbjct  308   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTG  367

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEIMSPE+IGL R+N++GIVLGKLSGRH
Sbjct  368   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSGRH  427

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL D+
Sbjct  428   ALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDM  487

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLST+TVKL D+D +EHVACSVGTGPVDAAYKAVDL+VK P TLLEYS+ AVT
Sbjct  488   QITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVT  547

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGDN+++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML 
Sbjct  548   EGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLG  607

Query  1922  F  1924
             F
Sbjct  608   F  608



>ref|XP_007034042.1| 2-isopropylmalate synthase 1 isoform 2 [Theobroma cacao]
 gb|EOY04968.1| 2-isopropylmalate synthase 1 isoform 2 [Theobroma cacao]
Length=624

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/553 (80%), Positives = 497/553 (90%), Gaps = 2/553 (0%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             +IPN I DPNYVRVFDTTLRDGEQSPGATMT+KEKLD+ARQLAKLGVDIIEAGFPAAS+ 
Sbjct  71    FIPNHIPDPNYVRVFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKD  130

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV+ IA+EVGN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  131   DFEAVKTIAKEVGNAVDEDGYVPVICGLSRCNEKDIKAAWEAVKYAKRPRIHTFIATSGI  190

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL  S+ +VV+ A SMV +ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  191   HMEYKLRKSKAEVVDIARSMVRFARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGAT  250

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG  LP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA AGARQ
Sbjct  251   TLNIPDTVGINLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  310

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             VEVTINGIGERAGNASLEEVVMALKCRGE VLGGLYTGINT+HI+MASKMVEEYTGL VQ
Sbjct  311   VEVTINGIGERAGNASLEEVVMALKCRGEHVLGGLYTGINTRHIVMASKMVEEYTGLHVQ  370

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N++GIVLGKLSGRHAL  
Sbjct  371   PHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNEAGIVLGKLSGRHALSD  430

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             +++ELGY++D ++  ++FWRFK+VAE+KK++TD DLIAL+SDEVFQP++VWKL DLQVTC
Sbjct  431   RLKELGYELDQEQLGNIFWRFKAVAEQKKRVTDADLIALVSDEVFQPEVVWKLHDLQVTC  490

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+LGLSTATVKLI AD EEHVACSVGTGPVD+AYKAVDL+ K  VTLLEYSL AVTEGID
Sbjct  491   GTLGLSTATVKLISADGEEHVACSVGTGPVDSAYKAVDLITKEAVTLLEYSLIAVTEGID  550

Query  1754  AIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTL  1933
             AIA+TRVLIR + SH STHALTG + +RTFSGTGAGMDIV+SSV+AY+GA+NKML F   
Sbjct  551   AIATTRVLIRTEKSHMSTHALTGEITHRTFSGTGAGMDIVVSSVKAYIGAINKMLGFKEQ  610

Query  1934  VSRYNKTEDNVVA  1972
             +      E   ++
Sbjct  611   IPTKGSAERTTIS  623



>ref|XP_010471495.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Camelina 
sativa]
Length=627

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/558 (78%), Positives = 506/558 (91%), Gaps = 4/558 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  68    RRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  127

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  128   ASKDDFEAVKTIAKTVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  187

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+ +KL  S+++V+E A +MVA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  188   TSDIHLMYKLKKSKDEVIEIARNMVAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  247

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGI+NV+ISTHCQNDLGLSTANTL+GA++
Sbjct  248   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVVISTHCQNDLGLSTANTLSGAHS  307

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG
Sbjct  308   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTG  367

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEIMSPE+IGL R+N++GIVLGKLSGRH
Sbjct  368   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSGRH  427

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL D+
Sbjct  428   ALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDM  487

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLST+TVKL D+D +EHVACSVGTGPVDAAYKAVDL+VK P TLLEYS+ AVT
Sbjct  488   QITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVT  547

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGD +++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML 
Sbjct  548   EGIDAIATTRVLIRGDKNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLG  607

Query  1922  FTTLVS--RYNKTEDNVV  1969
             F    S  R N +E N V
Sbjct  608   FKEHSSTLRKNPSEANKV  625



>ref|XP_002530549.1| isopropylmalate synthase, putative [Ricinus communis]
 gb|EEF31840.1| isopropylmalate synthase, putative [Ricinus communis]
Length=632

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/559 (78%), Positives = 501/559 (90%), Gaps = 4/559 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIP+ I DP+YVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQL+KLGVDIIEAGFPA
Sbjct  73    RRPEYIPSHIPDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLSKLGVDIIEAGFPA  132

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+EVGN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  133   ASKDDFEAVKTIAKEVGNAVDEDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  192

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM++KL  S+E+VVE A SMV +ARSLGC DVEFSPEDAGRSDREFLY ILGEVIK
Sbjct  193   TSAIHMEYKLRKSKEEVVEIARSMVKFARSLGCDDVEFSPEDAGRSDREFLYHILGEVIK  252

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGI+ VIISTHCQNDLGLSTANTLAGAYA
Sbjct  253   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIDKVIISTHCQNDLGLSTANTLAGAYA  312

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRGE +LGGLYTGIN + I MASKMVEEYTG
Sbjct  313   GARQVEVTINGIGERAGNASLEEVVMAIKCRGEHILGGLYTGINPRQITMASKMVEEYTG  372

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L +QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N +GIVLGKLSGRH
Sbjct  373   LHLQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNDAGIVLGKLSGRH  432

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK +++ELGY+++ ++   +FWRFK+VAE KK++TD DLIAL+SDEVFQP++VWKLGDL
Sbjct  433   ALKDRLKELGYELNDEQLGTIFWRFKAVAETKKRVTDADLIALVSDEVFQPEIVWKLGDL  492

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKLI+AD EEH+ACSVG+GPVDA YKAVDL+VK PV LLEYS+ AVT
Sbjct  493   QVTCGTLGLSTATVKLINADGEEHIACSVGSGPVDAGYKAVDLIVKEPVELLEYSMNAVT  552

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIR +++HTSTHALTG    RTFSG+GAGMDIV+SSV+AYVGALNKML+
Sbjct  553   EGIDAIATTRVLIRREDNHTSTHALTGEPFQRTFSGSGAGMDIVVSSVKAYVGALNKMLA  612

Query  1922  FTT--LVSRYNKTEDNVVA  1972
                  L  R + T+   V+
Sbjct  613   LKQQFLTKRVSSTDRTPVS  631



>ref|XP_010539993.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic [Tarenaya 
hassleriana]
Length=626

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/541 (79%), Positives = 501/541 (93%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP YIPNRI DPNYVR+FDTTLRDGEQSPGAT+T KEK+D+ARQLAKLGVDIIEAGFPA
Sbjct  69    RRPQYIPNRIPDPNYVRIFDTTLRDGEQSPGATLTAKEKIDIARQLAKLGVDIIEAGFPA  128

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DF+AV+ IA+ +GN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  129   ASKEDFQAVKTIAEIIGNTVDESGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  188

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+K+KL  S+E+V+E A SMV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIK
Sbjct  189   TSDIHLKYKLKKSKEEVIEIARSMVRFARSLGCEDVEFSPEDAGRSDREFLYRILGEVIK  248

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG+YA
Sbjct  249   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGSYA  308

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ +LGGL+TGI+T+HI+M SKMVE+YTG
Sbjct  309   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHILGGLFTGIDTRHIVMTSKMVEDYTG  368

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L +QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N++GIVLGKLSGRH
Sbjct  369   LHLQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNEAGIVLGKLSGRH  428

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             AL+ ++ ELGY++D ++ +++FWRFK+VAE+KK++TD D+IAL+SDEVFQP++VWKL D+
Sbjct  429   ALRDRLNELGYELDEEQLNNIFWRFKAVAEQKKRVTDADIIALVSDEVFQPEVVWKLLDV  488

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL +A+ +EHVACS GTGPVDAAYKA+DL+VK PVTLLEYS+ AVT
Sbjct  489   QVTCGTLGLSTATVKLAEANGKEHVACSTGTGPVDAAYKAIDLIVKEPVTLLEYSMNAVT  548

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGDN+ +ST+ALTG VV RTFSGTGAGMDIV+SSV+AYVGA+NKML 
Sbjct  549   EGIDAIATTRVLIRGDNNFSSTNALTGEVVQRTFSGTGAGMDIVVSSVKAYVGAVNKMLG  608

Query  1922  F  1924
             F
Sbjct  609   F  609



>ref|XP_006478856.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Citrus 
sinensis]
Length=620

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/541 (80%), Positives = 492/541 (91%), Gaps = 3/541 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPNRI DPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAA
Sbjct  63    RPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA  122

Query  491   SEADFEAVRLIAQEVGNG---EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             S+ DFEAVR IA+EVGN    E  +VPVICGLSRCN+RDI  AWEAVK+AK+PR+HTFIA
Sbjct  123   SKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIA  182

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM+ KL  +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILGEVIK
Sbjct  183   TSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIK  242

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
              GATTLNIPDTVG T+PTEFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+AGA A
Sbjct  243   VGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACA  302

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+HI+MASKMVEEYTG
Sbjct  303   GARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTG  362

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R++++GIVLGKLSGRH
Sbjct  363   LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRH  422

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK +++ELGY+++ ++   +FW FK+VAE+KK++TD DLIAL+SDEVFQP++VWKL D+
Sbjct  423   ALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEVFQPEVVWKLLDM  482

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+DA+ EEHVACS GTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  483   QVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  542

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
              GIDAIA+TRVLIRG+ S  STHA TG  V RTFSGTGAGMDIV+SSV+AY+GALNKML 
Sbjct  543   AGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLG  602

Query  1922  F  1924
             F
Sbjct  603   F  603



>ref|XP_006300309.1| hypothetical protein CARUB_v10019832mg [Capsella rubella]
 gb|EOA33207.1| hypothetical protein CARUB_v10019832mg [Capsella rubella]
Length=781

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/543 (80%), Positives = 499/543 (92%), Gaps = 3/543 (1%)
 Frame = +2

Query  305   PR-RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             PR RPDYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGF
Sbjct  220   PRLRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGF  279

Query  482   PAASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTF
Sbjct  280   PAASKDDFEAVKTIAETVGNTMDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTF  339

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATS+IH+K+KL  S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEV
Sbjct  340   IATSDIHLKYKLKKSKEEVIEIARNMVGFARSLGCQDVEFSPEDAGRSEREYLYEILGEV  399

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVG TLP+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA
Sbjct  400   IKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGA  459

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
             ++GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEY
Sbjct  460   HSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEY  519

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             TG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEIMSPE+IGL R+N++GIVLGKLSG
Sbjct  520   TGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSG  579

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHALK ++ ELGY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL 
Sbjct  580   RHALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLL  639

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
             D+Q+TCG+LGLST+TVKL D+D +EHVACS+GTGPVDAAYKAVDL+VK P TLLEYS+ A
Sbjct  640   DIQITCGTLGLSTSTVKLSDSDGKEHVACSIGTGPVDAAYKAVDLIVKEPATLLEYSMNA  699

Query  1736  VTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             VTEGIDAIASTRVLIRG N ++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKM
Sbjct  700   VTEGIDAIASTRVLIRGGNYYSSTNAITGESVERTFSGTGAGMDIVVSSVKAYVGALNKM  759

Query  1916  LSF  1924
             L F
Sbjct  760   LGF  762



>gb|KDO41314.1| hypothetical protein CISIN_1g0069691mg [Citrus sinensis]
Length=620

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/541 (80%), Positives = 492/541 (91%), Gaps = 3/541 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPNRI DPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAA
Sbjct  63    RPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA  122

Query  491   SEADFEAVRLIAQEVGNG---EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             S+ DFEAVR IA+EVGN    E  +VPVICGLSRCN+RDI  AWEAVK+AK+PR+HTFIA
Sbjct  123   SKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIA  182

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM+ KL  +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILGEVIK
Sbjct  183   TSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIK  242

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
              GATTLNIPDTVG T+PTEFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+AGA A
Sbjct  243   VGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACA  302

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+HI+MASKMVEEYTG
Sbjct  303   GARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTG  362

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R++++GIVLGKLSGRH
Sbjct  363   LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRH  422

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK +++ELGY+++ ++   +FW FK+VAE+KK++TD DLIAL+SDE+FQP++VWKL D+
Sbjct  423   ALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDM  482

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+DA+ EEHVACS GTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  483   QVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  542

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
              GIDAIA+TRVLIRG+ S  STHA TG  V RTFSGTGAGMDIV+SSV+AY+GALNKML 
Sbjct  543   AGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLG  602

Query  1922  F  1924
             F
Sbjct  603   F  603



>ref|XP_010416235.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Camelina 
sativa]
Length=627

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/550 (78%), Positives = 500/550 (91%), Gaps = 2/550 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDYIPNRISDPNY+R+FDTTLRDGEQSPGAT+T+KEKLD+A QLA L VDIIEAGFPA
Sbjct  68    RRPDYIPNRISDPNYIRIFDTTLRDGEQSPGATLTSKEKLDIASQLANLEVDIIEAGFPA  127

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  128   ASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  187

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+K+KL  S+++V+E A +MVA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  188   TSDIHLKYKLKKSKDEVIEIARNMVAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  247

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA++
Sbjct  248   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHS  307

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG
Sbjct  308   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTG  367

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEIMSPE+IGL R+N++GIVLGKLSGRH
Sbjct  368   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNEAGIVLGKLSGRH  427

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL D+
Sbjct  428   ALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDM  487

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLST+TVKL D+D +EHVACSVGTGPVDAAYKAVDL+VK P TLLEYS+ AVT
Sbjct  488   QITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVT  547

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGDN+++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML 
Sbjct  548   EGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLG  607

Query  1922  FTTLVSRYNK  1951
             F    S   K
Sbjct  608   FKEYSSTLRK  617



>gb|KFK44007.1| hypothetical protein AALP_AA1G202700 [Arabis alpina]
Length=627

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/556 (77%), Positives = 504/556 (91%), Gaps = 2/556 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  70    RRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  129

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  130   ASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  189

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IH+++KL  ++E+V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIK
Sbjct  190   TSNIHLEYKLKKTKEEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYEILGEVIK  249

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA++
Sbjct  250   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHS  309

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTG++T+HI+M SKMVEEYTG
Sbjct  310   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGLDTRHIVMTSKMVEEYTG  369

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRH
Sbjct  370   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRH  429

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGY++D ++   +FWRFKSVAE+KKK+TD D+IAL+SDEVFQP+ VWKL D+
Sbjct  430   ALKDRLTELGYELDDEQLSTIFWRFKSVAEQKKKVTDADIIALVSDEVFQPEAVWKLLDI  489

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLSTATVKL +AD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  490   QITCGTLGLSTATVKLAEADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  549

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRG+N++T+T+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML 
Sbjct  550   EGIDAIATTRVLIRGNNNYTATNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLD  609

Query  1922  FTTLVSRYNKTEDNVV  1969
             F     +   +++N V
Sbjct  610   FKVKSPKKIPSQNNRV  625



>ref|XP_011021916.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Populus 
euphratica]
Length=621

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/541 (80%), Positives = 490/541 (91%), Gaps = 4/541 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP Y+PN+I DPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAA
Sbjct  64    RPVYVPNKIPDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA  123

Query  491   SEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             S+ DFEAV++IA EVGN    EG +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  124   SKDDFEAVKMIANEVGNQVDSEG-YVPVICGLSRCNEKDIRAAWEAVKNAKRPRIHTFIA  182

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM++KL  S+E+VVE A+SMV +ARSLGC DVEFSPEDAGRS+REFLY ILGEVIK
Sbjct  183   TSGIHMEYKLRKSKEEVVEIASSMVRFARSLGCDDVEFSPEDAGRSEREFLYHILGEVIK  242

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG   P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA A
Sbjct  243   AGATTLNIPDTVGINTPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGACA  302

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVM +KCRGE VLGGLYTGINT+HI MASKMVEEYTG
Sbjct  303   GARQVEVTINGIGERAGNASLEEVVMVIKCRGEHVLGGLYTGINTRHITMASKMVEEYTG  362

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N +GIVLGKLSGRH
Sbjct  363   LHVQPHKAIVGANAFAHESGIHQDGMLKHKSTYEIISPEDIGLERSNDAGIVLGKLSGRH  422

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGY++D  +  ++FWRFK+VAE KK++TD DLIAL+SDEVFQP+ VWKL DL
Sbjct  423   ALKDRLNELGYELDDAQLGNIFWRFKAVAETKKRVTDADLIALVSDEVFQPENVWKLHDL  482

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+ AD EEHVACS+GTGPVD+AYKAVDL+VK PVTLLEYS+ AVT
Sbjct  483   QVTCGTLGLSTATVKLLSADGEEHVACSLGTGPVDSAYKAVDLIVKEPVTLLEYSMNAVT  542

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRV+IRG+N H  THALT     RTFSG+GAGMDIV+SSV+AY+GALNKML+
Sbjct  543   EGIDAIATTRVVIRGENQHAPTHALTDEPFQRTFSGSGAGMDIVVSSVKAYIGALNKMLA  602

Query  1922  F  1924
             F
Sbjct  603   F  603



>ref|XP_006390475.1| hypothetical protein EUTSA_v10018267mg [Eutrema salsugineum]
 gb|ESQ27761.1| hypothetical protein EUTSA_v10018267mg [Eutrema salsugineum]
Length=631

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/541 (79%), Positives = 498/541 (92%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y PNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  71    RRPEYTPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  130

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  131   ASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  190

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+K+KL  S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  191   TSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCQDVEFSPEDAGRSEREYLYEILGEVIK  250

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIKANTPG +NVIISTHCQNDLGLSTANTLAGA++
Sbjct  251   AGATTLNIPDTVGITLPSEFGQLIADIKANTPGNQNVIISTHCQNDLGLSTANTLAGAHS  310

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVEEYTG
Sbjct  311   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEEYTG  370

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEIM PE+IGL R+N++GIVLGKLSGRH
Sbjct  371   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMCPEEIGLERSNEAGIVLGKLSGRH  430

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             AL+ ++ ELGY+++ ++  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL D+
Sbjct  431   ALRDRLNELGYELNDEQLSNLFWRFKTVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDM  490

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLST+TVKL D+D +EHVACS+GTGPVDAAYKAVDL+VK P TLLEYS+ AVT
Sbjct  491   QITCGTLGLSTSTVKLADSDGKEHVACSIGTGPVDAAYKAVDLIVKEPATLLEYSMNAVT  550

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGDN+++ST+A+TG  V RTFSG GAGMDIV+SSV+AYVGALNKML 
Sbjct  551   EGIDAIATTRVLIRGDNNYSSTNAVTGESVQRTFSGAGAGMDIVVSSVKAYVGALNKMLG  610

Query  1922  F  1924
             F
Sbjct  611   F  611



>gb|KHG02682.1| 2-isopropylmalate synthase 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=627

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/537 (80%), Positives = 492/537 (92%), Gaps = 2/537 (0%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             YIPN I DPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+ 
Sbjct  74    YIPNHIPDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKD  133

Query  500   DFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV  IA+EVGN E E  +VPVICGLSRCN+ DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  134   DFEAVTAIAKEVGNAEDENGYVPVICGLSRCNENDIKAAWEAVKYAKRPRIHTFIATSGI  193

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             H+++KL  S+E+V++ A SMV +ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  194   HLEYKLRKSKEEVLDIARSMVRFARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGAT  253

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA AGARQ
Sbjct  254   TLNIPDTVGITMPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  313

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             VEVTINGIGERAGNASLEEVVMA+KCRGE VLGGLYTGINTQHI+M+SKMVE+YTGL +Q
Sbjct  314   VEVTINGIGERAGNASLEEVVMAIKCRGEHVLGGLYTGINTQHIVMSSKMVEDYTGLHIQ  373

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N++GIVLGKLSGRHALK 
Sbjct  374   PHKAIVGANAFAHESGIHQDGMLKHKSTYEIISPEDIGLERSNEAGIVLGKLSGRHALKD  433

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             +++ELGY++D ++  ++FWRFK+VAE+KK++ D DLIAL+SDEVFQP++VWKL DLQVTC
Sbjct  434   RLKELGYELDDEQLGNIFWRFKAVAEQKKRVIDADLIALVSDEVFQPEVVWKLHDLQVTC  493

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+LGLSTATVKLI AD EEHVACSVGTGPVD+AYKA+DL+ K PVTLLEYS+ AVTEGID
Sbjct  494   GTLGLSTATVKLIGADGEEHVACSVGTGPVDSAYKAIDLITKEPVTLLEYSMNAVTEGID  553

Query  1754  AIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             AIA+TRVLIR + S  ST+ LTG +V RTFSG GAGMDIV+SSV+AY+GALNKML F
Sbjct  554   AIATTRVLIRAEKSRISTNILTGEIVQRTFSGNGAGMDIVVSSVKAYIGALNKMLGF  610



>gb|ABA26446.1| 2-isopropylmalate synthase 1 [Brassica insularis]
Length=623

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/570 (76%), Positives = 509/570 (89%), Gaps = 15/570 (3%)
 Frame = +2

Query  284   VRCGLGAP------RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQL  445
             + C L  P      RRP+YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQL
Sbjct  52    LSCSLSDPSPPLCRRRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQL  111

Query  446   AKLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWE  616
             AKLGVD+IEAGFPAAS+ DFEAV+ IA  VGN   G+G +VPVICGLSRCN+RDI+ AWE
Sbjct  112   AKLGVDVIEAGFPAASKDDFEAVKTIAGTVGNAVDGDG-YVPVICGLSRCNKRDIETAWE  170

Query  617   AVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  796
             AVK+AK+PR+HTFIATS+IH+++KL  S+++V+E A +MV +ARSLGC DVEFSPEDAGR
Sbjct  171   AVKYAKRPRIHTFIATSDIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGR  230

Query  797   SDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQN  976
             S+REFLYQILGEVIKAGATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQN
Sbjct  231   SEREFLYQILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQN  290

Query  977   DLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1156
             DLGLSTANTL+GA++GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T
Sbjct  291   DLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDT  350

Query  1157  QHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHR  1336
             +HI+M SKMVE+YTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R
Sbjct  351   RHIVMTSKMVEDYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLER  410

Query  1337  ANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS  1516
             +N +GIVLGKLSGRHALK ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+S
Sbjct  411   SNDAGIVLGKLSGRHALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVS  470

Query  1517  DEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLV  1696
             DEVFQP+ +WKL D+Q+TCG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+V
Sbjct  471   DEVFQPEALWKLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIV  530

Query  1697  KVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVI  1876
             K P TLLEYS+ AVTEGIDAIA+TRVLIRG+N++++T+A+TG  V RTFSGTGAGMDIV+
Sbjct  531   KEPATLLEYSMNAVTEGIDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVV  590

Query  1877  SSVRAYVGALNKMLSF-----TTLVSRYNK  1951
             SSV+AYVGALNKML F     T + S+ NK
Sbjct  591   SSVKAYVGALNKMLDFKENSTTKIPSQNNK  620



>gb|KGN57885.1| hypothetical protein Csa_3G363180 [Cucumis sativus]
Length=633

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/541 (79%), Positives = 494/541 (91%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP YIPNRI DP+YVRVFDTTLRDGEQSPGA++T KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  78    RRPPYIPNRIPDPSYVRVFDTTLRDGEQSPGASLTVKEKLDIARQLAKLGVDIIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV++IA+E+GN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  138   ASKEDFEAVKMIAKEIGNAVDEDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  197

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHM+ KL  ++E+V+E A +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIK
Sbjct  198   TSEIHMEHKLRKTKEEVIEIARNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIK  257

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYT+P EFG+LIADIK+NTPGIENVIIS+HCQNDLGL+TANT+AGA A
Sbjct  258   AGATTLNIPDTVGYTMPFEFGKLIADIKSNTPGIENVIISSHCQNDLGLATANTVAGACA  317

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMAL+CRGE VLGGL+TGIN++HI + SKMVEE+TG
Sbjct  318   GARQVEVTINGIGERAGNASLEEVVMALQCRGEHVLGGLHTGINSRHIFLTSKMVEEFTG  377

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAH SGIHQDGMLKHK TYEIM+PEDIG  R+N +GIVLGKLSGRH
Sbjct  378   LNVQPHKAIVGANAFAHASGIHQDGMLKHKGTYEIMAPEDIGYERSNDAGIVLGKLSGRH  437

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK+ + ELGY++DG+  D++FWRFK+VAE+KK++TD DL AL+SDEVFQP ++WKL D+
Sbjct  438   ALKSLLLELGYELDGENLDNVFWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDM  497

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+DAD +EH+ACSVGTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  498   QVTCGTLGLSTATVKLLDADGKEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  557

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGD S+TST+ALTG  V RTFSG GAGMDIV+SSV+AY+GALNKML 
Sbjct  558   EGIDAIATTRVLIRGDKSYTSTNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLG  617

Query  1922  F  1924
             F
Sbjct  618   F  618



>gb|AAW81741.1| Putative 2-isopropylmalate synthase [Brassica oleracea]
Length=623

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/570 (76%), Positives = 509/570 (89%), Gaps = 15/570 (3%)
 Frame = +2

Query  284   VRCGLGAPR------RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQL  445
             + C L  P       RP+YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQL
Sbjct  52    LSCSLSDPSPPLRRCRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQL  111

Query  446   AKLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWE  616
             AKLGVD+IEAGFPAAS+ DFEAV+ IA+ VGN   G+G +VPVICGLSRCN+RDI+ AWE
Sbjct  112   AKLGVDVIEAGFPAASKDDFEAVKTIAETVGNAVDGDG-YVPVICGLSRCNKRDIETAWE  170

Query  617   AVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  796
             AVK+AK+PR+HTFIATS+IH+++KL  S+++V+E A +MV +ARSLGC DVEFSPEDAGR
Sbjct  171   AVKYAKRPRIHTFIATSDIHLEYKLKKSKDEVIEFARNMVKFARSLGCEDVEFSPEDAGR  230

Query  797   SDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQN  976
             S+REFLYQILGEVIKAGATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQN
Sbjct  231   SEREFLYQILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQN  290

Query  977   DLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1156
             DLGLSTANTL+GA++GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T
Sbjct  291   DLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDT  350

Query  1157  QHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHR  1336
             +HI+M SKMVE+YTG+  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R
Sbjct  351   RHIVMTSKMVEDYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLER  410

Query  1337  ANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS  1516
             +N +GIVLGKLSGRHALK ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+S
Sbjct  411   SNDAGIVLGKLSGRHALKDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVS  470

Query  1517  DEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLV  1696
             DEVFQP+ +WKL D+Q+TCG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+V
Sbjct  471   DEVFQPEALWKLLDIQITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIV  530

Query  1697  KVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVI  1876
             K P TLLEYS+ AVTEGIDAIA+TRVLIRG+N++++T+A+TG  V RTFSGTGAGMDIV+
Sbjct  531   KEPATLLEYSMNAVTEGIDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVV  590

Query  1877  SSVRAYVGALNKMLSF-----TTLVSRYNK  1951
             SSV+AYVGALNKML F     T + S+ NK
Sbjct  591   SSVKAYVGALNKMLDFKENTTTKIPSQNNK  620



>ref|XP_004165080.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis 
sativus]
Length=639

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/541 (79%), Positives = 494/541 (91%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP YIPNRI DP+YVRVFDTTLRDGEQSPGA++T KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  78    RRPPYIPNRIPDPSYVRVFDTTLRDGEQSPGASLTVKEKLDIARQLAKLGVDIIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV++IA+E+GN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  138   ASKEDFEAVKMIAKEIGNAVDEDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  197

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHM+ KL  ++E+V+E A +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIK
Sbjct  198   TSEIHMEHKLRKTKEEVIEIARNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIK  257

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYT+P EFG+LIADIK+NTPGIENVIIS+HCQNDLGL+TANT+AGA A
Sbjct  258   AGATTLNIPDTVGYTMPFEFGKLIADIKSNTPGIENVIISSHCQNDLGLATANTVAGACA  317

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMAL+CRGE VLGGL+TGIN++HI + SKMVEE+TG
Sbjct  318   GARQVEVTINGIGERAGNASLEEVVMALQCRGEHVLGGLHTGINSRHIFLTSKMVEEFTG  377

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAH SGIHQDGMLKHK TYEIM+PEDIG  R+N +GIVLGKLSGRH
Sbjct  378   LNVQPHKAIVGANAFAHASGIHQDGMLKHKGTYEIMAPEDIGYERSNDAGIVLGKLSGRH  437

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK+ + ELGY++DG+  D++FWRFK+VAE+KK++TD DL AL+SDEVFQP ++WKL D+
Sbjct  438   ALKSLLLELGYELDGENLDNVFWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDM  497

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+DAD +EH+ACSVGTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  498   QVTCGTLGLSTATVKLLDADGKEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  557

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGD S+TST+ALTG  V RTFSG GAGMDIV+SSV+AY+GALNKML 
Sbjct  558   EGIDAIATTRVLIRGDKSYTSTNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLG  617

Query  1922  F  1924
             F
Sbjct  618   F  618



>gb|KDP42866.1| hypothetical protein JCGZ_23808 [Jatropha curcas]
Length=634

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/556 (79%), Positives = 495/556 (89%), Gaps = 6/556 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPN I DP YVRVFDTTLRDGEQSPGAT+T+KEKLD+AR L+KLGVDIIEAGFPA
Sbjct  76    RRPEYIPNHIPDPFYVRVFDTTLRDGEQSPGATLTSKEKLDIARHLSKLGVDIIEAGFPA  135

Query  488   ASEADFEAVRLIAQEVGNG---EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS  DFEAV+ IA+EVGN    EG +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFI
Sbjct  136   ASNDDFEAVKTIAKEVGNAVDDEG-YVPVICGLSRCNEKDIKTAWEAVKYAKRPRIHTFI  194

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             ATSEIHM++KL  S+E+VVE AT+MV +ARSLGC DVEFSPEDAGRSDREFLY ILGEVI
Sbjct  195   ATSEIHMQYKLRKSKEEVVEIATNMVKFARSLGCDDVEFSPEDAGRSDREFLYHILGEVI  254

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTLNIPDTVG TLP+EFGQLIADI+ANTPGIENVIISTHCQNDLGLSTANTLAG Y
Sbjct  255   KAGATTLNIPDTVGITLPSEFGQLIADIRANTPGIENVIISTHCQNDLGLSTANTLAGTY  314

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVT+NGIGERAGNASLEEVVMA+KCRGE VLGGLYTGIN++HI MASKMVEEYT
Sbjct  315   AGARQVEVTVNGIGERAGNASLEEVVMAIKCRGEHVLGGLYTGINSKHITMASKMVEEYT  374

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEIMSPEDIGL RAN +GIVLGKLSGR
Sbjct  375   GLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEDIGLERANDAGIVLGKLSGR  434

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGD  1558
             HALK +++ELGY++  ++  ++FWRFKSVAE KK++TD DL+AL+SDEVFQP++VW+LGD
Sbjct  435   HALKDRLKELGYELSDEQLGNIFWRFKSVAENKKRVTDADLLALVSDEVFQPEIVWQLGD  494

Query  1559  LQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAV  1738
             LQ+TCG+LGLSTATVKLIDA+ E+H+ACSVGTGPVDAAYKAVDL+VK PV LLEYS+TAV
Sbjct  495   LQITCGTLGLSTATVKLIDANGEQHIACSVGTGPVDAAYKAVDLIVKEPVELLEYSMTAV  554

Query  1739  TEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             T GIDAIA+TRVLI GDN      A+TG    RTFSG+GAGMDIV+SSV+AY+GALNKML
Sbjct  555   TGGIDAIATTRVLICGDNHKID--AITGEPSRRTFSGSGAGMDIVVSSVKAYIGALNKML  612

Query  1919  SFTTLVSRYNKTEDNV  1966
             +  +      KT   V
Sbjct  613   AVNSQQLSTTKTVSTV  628



>ref|XP_008457079.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis 
melo]
Length=641

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/558 (77%), Positives = 500/558 (90%), Gaps = 2/558 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP YIPNRI DP+YVR+FDTTLRDGEQSPGA++TTKEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  80    RRPPYIPNRIPDPSYVRIFDTTLRDGEQSPGASLTTKEKLDIARQLAKLGVDIIEAGFPA  139

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV++IA+E+G+   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  140   ASKEDFEAVKMIAKEIGSAVDEDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  199

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHM+ KL  +REQV+E A +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIK
Sbjct  200   TSEIHMEHKLRKTREQVIEIARNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIK  259

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYT+P EFG+LIADIK+NTPGIENVIISTHCQNDLGL+TANT+AGA A
Sbjct  260   AGATTLNIPDTVGYTMPFEFGKLIADIKSNTPGIENVIISTHCQNDLGLATANTVAGACA  319

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMAL+CRGE VLGGL+TGIN +HI + SKMVEE+TG
Sbjct  320   GARQVEVTINGIGERAGNASLEEVVMALQCRGEHVLGGLHTGINPRHIFLTSKMVEEFTG  379

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAH SGIHQDGMLKHK TYEIM+PEDIG  R+N +GIVLGKLSGRH
Sbjct  380   LNVQPHKAIVGANAFAHASGIHQDGMLKHKGTYEIMAPEDIGYERSNDAGIVLGKLSGRH  439

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK+++ ELGY++D +   ++FWRFK+VAE+KK++TD DL AL+SDEVFQP ++WKL DL
Sbjct  440   ALKSRLLELGYELDSENLHNVFWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDL  499

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+DAD +EH+ACSVGTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  500   QVTCGTLGLSTATVKLLDADGKEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  559

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGD S+TST+ALTG  V RTFSG GAGMDIV+SSV+AY+GALNKML 
Sbjct  560   EGIDAIATTRVLIRGDKSYTSTNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLG  619

Query  1922  FTTLVSRYNKTEDNVVAK  1975
             F  +  +  K +  ++ K
Sbjct  620   FQGIDIKETKEKHYLLKK  637



>ref|XP_008232677.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform 
X2 [Prunus mume]
 ref|XP_008232686.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform 
X2 [Prunus mume]
Length=632

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/543 (79%), Positives = 491/543 (90%), Gaps = 2/543 (0%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             A RRPDYIPNRISDPNYVR+FDTTLRDGEQSPGA++T+KEKLD+ARQLAKLGVDIIEAGF
Sbjct  73    AARRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARQLAKLGVDIIEAGF  132

Query  482   PAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS  DFEAV++IA+EVGN   +  +VPVICGLSRCN++DI RAW+AV+ AK+PR+HTF
Sbjct  133   PAASNDDFEAVKMIAKEVGNSVDKDGYVPVICGLSRCNKKDIKRAWDAVECAKRPRIHTF  192

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATS IHM+ KL  ++EQVVE A  MV+YARSLGC DVEFSPEDAGRSDREFLYQILGEV
Sbjct  193   IATSAIHMEHKLRKTKEQVVEIARDMVSYARSLGCDDVEFSPEDAGRSDREFLYQILGEV  252

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVGY +P+E+ QLI+DIK+NT GIENVIISTHCQNDLGLSTANT+AGA
Sbjct  253   IKAGATTLNIPDTVGYNVPSEYSQLISDIKSNTTGIENVIISTHCQNDLGLSTANTIAGA  312

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQ+EVTINGIGERAGNASLEEVVM L CRG+ VLGGLYTGIN +HI + SKMVEEY
Sbjct  313   SAGARQLEVTINGIGERAGNASLEEVVMTLDCRGDHVLGGLYTGINARHIYITSKMVEEY  372

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             TGL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSG
Sbjct  373   TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSG  432

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHALK +++ELGY++   + + +FWRFK+VA++KK++TD DL AL+SDEVFQP++VWKL 
Sbjct  433   RHALKKRLEELGYELADDQLETIFWRFKAVADQKKRVTDADLRALVSDEVFQPEVVWKLH  492

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
             DLQVTCG+LGLSTATVKLIDAD  EHVAC++GTGPVD+AYKAVDL+VK PVTLLEYS+ A
Sbjct  493   DLQVTCGTLGLSTATVKLIDADGREHVACAIGTGPVDSAYKAVDLIVKEPVTLLEYSMNA  552

Query  1736  VTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             VTEGIDAIA+TRVLIRG+NS+ +THA TG  V RTFSG GAGMDIV+SSV+AYVGALNKM
Sbjct  553   VTEGIDAIATTRVLIRGENSNITTHAFTGETVQRTFSGIGAGMDIVVSSVKAYVGALNKM  612

Query  1916  LSF  1924
             L F
Sbjct  613   LGF  615



>ref|XP_006416598.1| hypothetical protein EUTSA_v10007073mg [Eutrema salsugineum]
 gb|ESQ34951.1| hypothetical protein EUTSA_v10007073mg [Eutrema salsugineum]
Length=625

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/538 (79%), Positives = 496/538 (92%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIP+RISDP+YVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  71    EYIPSRISDPSYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  130

Query  497   ADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIATS+
Sbjct  131   DDFEAVKTIAKTVGNDVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIATSD  190

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLYQILGEVIKAGA
Sbjct  191   IHLEYKLKKSKEEVIEIARNMVMFARSLGCEDVEFSPEDAGRSEREFLYQILGEVIKAGA  250

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLIAD+KANTPGIENVIISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  251   TTLNIPDTVGITLPSEFGQLIADLKANTPGIENVIISTHCQNDLGLSTANTLSGAHAGAR  310

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVEEYTG+  
Sbjct  311   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEEYTGMHT  370

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  371   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  430

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY++D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ VWKL D+Q+T
Sbjct  431   GRLTELGYELDDEQLSTIFWRFKSVAERKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  490

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  491   CGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  550

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVLIRG+N+++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  551   DAIATTRVLIRGNNNYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  608



>emb|CDY19217.1| BnaC05g14180D [Brassica napus]
Length=623

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/553 (77%), Positives = 503/553 (91%), Gaps = 9/553 (2%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVD+IEAGFPAAS+
Sbjct  69    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFPAASK  128

Query  497   ADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATS  667
              DFEAV+ IA+ VGN   G+G +VPVICGLSRCN+RDI+ AWEAVK+AK+PR+HTFIATS
Sbjct  129   DDFEAVKTIAETVGNAVDGDG-YVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFIATS  187

Query  668   EIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  847
             +IH+++KL  S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLYQILGEVIKAG
Sbjct  188   DIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYQILGEVIKAG  247

Query  848   ATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGA  1027
             ATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA++GA
Sbjct  248   ATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHSGA  307

Query  1028  RQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLL  1207
             RQ+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVE+YTG+ 
Sbjct  308   RQLEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQ  367

Query  1208  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHAL  1387
              QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHAL
Sbjct  368   TQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHAL  427

Query  1388  KTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQV  1567
             K ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ +WKL D+Q+
Sbjct  428   KDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWKLLDIQI  487

Query  1568  TCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEG  1747
             TCG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEG
Sbjct  488   TCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLVVKEPATLLEYSMNAVTEG  547

Query  1748  IDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF-  1924
             IDAIA+TRVLIRG+N++++T+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F 
Sbjct  548   IDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLDFK  607

Query  1925  ----TTLVSRYNK  1951
                 T + S+ NK
Sbjct  608   ENSTTKIPSQNNK  620



>ref|XP_008232670.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform 
X1 [Prunus mume]
Length=633

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/544 (79%), Positives = 491/544 (90%), Gaps = 3/544 (1%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             A RRPDYIPNRISDPNYVR+FDTTLRDGEQSPGA++T+KEKLD+ARQLAKLGVDIIEAGF
Sbjct  73    AARRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARQLAKLGVDIIEAGF  132

Query  482   PAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS  DFEAV++IA+EVGN   +  +VPVICGLSRCN++DI RAW+AV+ AK+PR+HTF
Sbjct  133   PAASNDDFEAVKMIAKEVGNSVDKDGYVPVICGLSRCNKKDIKRAWDAVECAKRPRIHTF  192

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATS IHM+ KL  ++EQVVE A  MV+YARSLGC DVEFSPEDAGRSDREFLYQILGEV
Sbjct  193   IATSAIHMEHKLRKTKEQVVEIARDMVSYARSLGCDDVEFSPEDAGRSDREFLYQILGEV  252

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVGY +P+E+ QLI+DIK+NT GIENVIISTHCQNDLGLSTANT+AGA
Sbjct  253   IKAGATTLNIPDTVGYNVPSEYSQLISDIKSNTTGIENVIISTHCQNDLGLSTANTIAGA  312

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQ+EVTINGIGERAGNASLEEVVM L CRG+ VLGGLYTGIN +HI + SKMVEEY
Sbjct  313   SAGARQLEVTINGIGERAGNASLEEVVMTLDCRGDHVLGGLYTGINARHIYITSKMVEEY  372

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             TGL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSG
Sbjct  373   TGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSG  432

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHALK +++ELGY++   + + +FWRFK+VA++KK++TD DL AL+SDEVFQP++VWKL 
Sbjct  433   RHALKKRLEELGYELADDQLETIFWRFKAVADQKKRVTDADLRALVSDEVFQPEVVWKLH  492

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKV-PVTLLEYSLT  1732
             DLQVTCG+LGLSTATVKLIDAD  EHVAC++GTGPVD+AYKAVDL+VK  PVTLLEYS+ 
Sbjct  493   DLQVTCGTLGLSTATVKLIDADGREHVACAIGTGPVDSAYKAVDLIVKQEPVTLLEYSMN  552

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             AVTEGIDAIA+TRVLIRG+NS+ +THA TG  V RTFSG GAGMDIV+SSV+AYVGALNK
Sbjct  553   AVTEGIDAIATTRVLIRGENSNITTHAFTGETVQRTFSGIGAGMDIVVSSVKAYVGALNK  612

Query  1913  MLSF  1924
             ML F
Sbjct  613   MLGF  616



>emb|CDY21704.1| BnaA09g44550D [Brassica napus]
Length=627

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/538 (79%), Positives = 493/538 (92%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             DYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  73    DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  132

Query  497   ADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ I++ VGN   E  +VPVICGLSRCN+RDI  AWEAV++AK+PR+HTFIATS+
Sbjct  133   DDFEAVKTISETVGNAVNENGYVPVICGLSRCNERDIQTAWEAVRYAKRPRIHTFIATSD  192

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  S+++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  193   IHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  252

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLIADIKANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  253   TTLNIPDTVGITLPSEFGQLIADIKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  312

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVE+YTG+  
Sbjct  313   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQT  372

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  373   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  432

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ VWKL D+Q+T
Sbjct  433   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  492

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL DAD +EH ACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  493   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  552

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVL+RG+N++TST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  553   DAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  610



>ref|XP_007034041.1| 2-isopropylmalate synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY04967.1| 2-isopropylmalate synthase 1 isoform 1 [Theobroma cacao]
Length=657

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/586 (75%), Positives = 497/586 (85%), Gaps = 35/586 (6%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             +IPN I DPNYVRVFDTTLRDGEQSPGATMT+KEKLD+ARQLAKLGVDIIEAGFPAAS+ 
Sbjct  71    FIPNHIPDPNYVRVFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKD  130

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV+ IA+EVGN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  131   DFEAVKTIAKEVGNAVDEDGYVPVICGLSRCNEKDIKAAWEAVKYAKRPRIHTFIATSGI  190

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL  S+ +VV+ A SMV +ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  191   HMEYKLRKSKAEVVDIARSMVRFARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGAT  250

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG  LP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA AGARQ
Sbjct  251   TLNIPDTVGINLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  310

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             VEVTINGIGERAGNASLEEVVMALKCRGE VLGGLYTGINT+HI+MASKMVEEYTGL VQ
Sbjct  311   VEVTINGIGERAGNASLEEVVMALKCRGEHVLGGLYTGINTRHIVMASKMVEEYTGLHVQ  370

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N++GIVLGKLSGRHAL  
Sbjct  371   PHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNEAGIVLGKLSGRHALSD  430

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ---  1564
             +++ELGY++D ++  ++FWRFK+VAE+KK++TD DLIAL+SDEVFQP++VWKL DLQ   
Sbjct  431   RLKELGYELDQEQLGNIFWRFKAVAEQKKRVTDADLIALVSDEVFQPEVVWKLHDLQVAF  490

Query  1565  ------------------------------VTCGSLGLSTATVKLIDADDEEHVACSVGT  1654
                                           VTCG+LGLSTATVKLI AD EEHVACSVGT
Sbjct  491   LKRSRMQKNHDLGYMKWIAFLGGSSDPGNYVTCGTLGLSTATVKLISADGEEHVACSVGT  550

Query  1655  GPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVN  1834
             GPVD+AYKAVDL+ K  VTLLEYSL AVTEGIDAIA+TRVLIR + SH STHALTG + +
Sbjct  551   GPVDSAYKAVDLITKEAVTLLEYSLIAVTEGIDAIATTRVLIRTEKSHMSTHALTGEITH  610

Query  1835  RTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNKTEDNVVA  1972
             RTFSGTGAGMDIV+SSV+AY+GA+NKML F   +      E   ++
Sbjct  611   RTFSGTGAGMDIVVSSVKAYIGAINKMLGFKEQIPTKGSAERTTIS  656



>ref|XP_009117611.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Brassica 
rapa]
Length=627

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/538 (79%), Positives = 492/538 (91%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             DYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  73    DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  132

Query  497   ADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ I++ VGN   E  +VPVICGLSRCN+RDI  AWEAV++AK+PR+HTFIATS+
Sbjct  133   DDFEAVKTISETVGNAVDENGYVPVICGLSRCNERDIQTAWEAVRYAKRPRIHTFIATSD  192

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  S+++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  193   IHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  252

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLIADIKANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  253   TTLNIPDTVGITLPSEFGQLIADIKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  312

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVE+YTG+  
Sbjct  313   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQT  372

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  373   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  432

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ VWKL D+Q+T
Sbjct  433   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  492

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL DAD +EH ACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  493   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPTTLLEYSMNAVTEGI  552

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVL+RG N++TST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  553   DAIATTRVLVRGSNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  610



>ref|XP_004149446.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis 
sativus]
Length=633

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/541 (79%), Positives = 491/541 (91%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP YIPNRI DP+YVRVFDTTLRDGEQSPGA++T KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  78    RRPPYIPNRIPDPSYVRVFDTTLRDGEQSPGASLTVKEKLDIARQLAKLGVDIIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV++IA+E+GN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  138   ASKEDFEAVKMIAKEIGNAVDEDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  197

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHM+ KL  ++E+V+E A +MV +ARSLGC DVEFSPEDAGRSDREFLYQILGEVIK
Sbjct  198   TSEIHMEHKLRKTKEEVIEIARNMVRFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIK  257

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYT+P EFG+LIADIK+NTPGIENVIIS+HCQNDLGL+TANT+AGA A
Sbjct  258   AGATTLNIPDTVGYTMPFEFGKLIADIKSNTPGIENVIISSHCQNDLGLATANTVAGACA  317

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMAL+CRGE VLGGL+TGIN++HI + SKMVEE+TG
Sbjct  318   GARQVEVTINGIGERAGNASLEEVVMALQCRGEHVLGGLHTGINSRHIFLTSKMVEEFTG  377

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAH SGIHQDGMLKHK TYEIM+PEDIG  R+N +GIV  + SGRH
Sbjct  378   LNVQPHKAIVGANAFAHASGIHQDGMLKHKGTYEIMAPEDIGYERSNDAGIVFFEYSGRH  437

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK+ + ELGY++DG+  D++FWRFK+VAE+KK++TD DL AL+SDEVFQP ++WKL D+
Sbjct  438   ALKSLLLELGYELDGENLDNVFWRFKAVAEQKKRVTDADLRALVSDEVFQPTVLWKLLDM  497

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+DAD +EH+ACSVGTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  498   QVTCGTLGLSTATVKLLDADGKEHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  557

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRGD S+TST+ALTG  V RTFSG GAGMDIV+SSV+AY+GALNKML 
Sbjct  558   EGIDAIATTRVLIRGDKSYTSTNALTGEAVQRTFSGIGAGMDIVVSSVKAYIGALNKMLG  617

Query  1922  F  1924
             F
Sbjct  618   F  618



>ref|XP_010064504.1| PREDICTED: 2-isopropylmalate synthase A-like, partial [Eucalyptus 
grandis]
Length=654

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/552 (78%), Positives = 497/552 (90%), Gaps = 3/552 (1%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRI DPNYVR+FDTTLRDGEQSPGATMT+KEKLD+ARQLAKLGVDIIEAGFPAAS 
Sbjct  101   EYIPNRIPDPNYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASP  160

Query  497   ADFEAVRLIAQEVGNGEGEH--VPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DF AV+ IA EVGN    H  VPVICGLSRCN++DI  AW+AV+ A++PR+HTFIATS 
Sbjct  161   DDFGAVKAIALEVGNAVDPHGYVPVICGLSRCNEKDIQAAWDAVRFARRPRIHTFIATSA  220

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IHM++KL  S+++V++ A  MVA+AR LGC+DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  221   IHMQYKLKKSKQEVIDIARRMVAFARRLGCNDVEFSPEDAGRSEREFLYEILGEVIKAGA  280

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG T+P EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+AGA AGAR
Sbjct  281   TTLNIPDTVGITMPQEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIAGACAGAR  340

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMALKC+G  +LGGLYTGINT+HI+M SKMVEEY+GL V
Sbjct  341   QVEVTINGIGERAGNASLEEVVMALKCKGGSILGGLYTGINTRHIVMTSKMVEEYSGLHV  400

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SP+DIGL R N++GIVLGKLSGRHALK
Sbjct  401   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPDDIGLERTNEAGIVLGKLSGRHALK  460

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              K+ ELGYDIDG++ D++FWRFK+VAE+KK++TD D+ AL+SDEVFQP +VWKL DLQVT
Sbjct  461   MKLVELGYDIDGEQLDNIFWRFKAVAEQKKRVTDADIRALVSDEVFQPTVVWKLHDLQVT  520

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKLI A+ +EH+AC+VGTGPVD+AYKAVDL+VKVP TLLEYS+TAVTEGI
Sbjct  521   CGTLGLSTATVKLISAEGKEHIACAVGTGPVDSAYKAVDLIVKVPATLLEYSMTAVTEGI  580

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTT  1930
             DAIA+TRVLIRG+N+HTST ALTG  ++RTFSG G+ MDI +SSVRAY+GALNKML F  
Sbjct  581   DAIATTRVLIRGENNHTSTLALTGETIHRTFSGIGSSMDITVSSVRAYIGALNKMLGFME  640

Query  1931  LVSRYNKTEDNV  1966
             L +  ++ +DN+
Sbjct  641   L-TPLHQCDDNM  651



>ref|XP_010477031.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Camelina 
sativa]
Length=626

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/541 (78%), Positives = 494/541 (91%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  68    RRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  127

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIA
Sbjct  128   ASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIA  187

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH++ KL  ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  188   TSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  247

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA+A
Sbjct  248   AGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHA  307

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTG++T+HI+M SKMVEEYTG
Sbjct  308   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGLDTRHIVMTSKMVEEYTG  367

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRH
Sbjct  368   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRH  427

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGYD+D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+
Sbjct  428   ALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDI  487

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  488   QITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  547

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRG N ++ST+A+TG  V RTFSGTG+ +DIV+SSV+AYVGALNKM+ 
Sbjct  548   EGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKAYVGALNKMMD  607

Query  1922  F  1924
             F
Sbjct  608   F  608



>ref|XP_009149293.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic [Brassica 
rapa]
Length=626

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/539 (78%), Positives = 497/539 (92%), Gaps = 4/539 (1%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVD+IEAGFPAAS+
Sbjct  72    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFPAASK  131

Query  497   ADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATS  667
              DFEAV+ IA+ VGN   G+G +VPVICGLSRCN+RDI+ AWEAVK+AK+PR+HTFIATS
Sbjct  132   DDFEAVKTIAETVGNAVDGDG-YVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFIATS  190

Query  668   EIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  847
             +IH+++KL  S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAG
Sbjct  191   DIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYEILGEVIKAG  250

Query  848   ATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGA  1027
             ATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA++GA
Sbjct  251   ATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHSGA  310

Query  1028  RQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLL  1207
             RQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVE+YTG+ 
Sbjct  311   RQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQ  370

Query  1208  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHAL  1387
              QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHAL
Sbjct  371   TQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHAL  430

Query  1388  KTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQV  1567
             K ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ +W+L D+Q+
Sbjct  431   KDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWRLLDIQI  490

Query  1568  TCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEG  1747
             TCG+LGLSTATVKL+DAD +EHVACS+G GPVD+AYKA+DL+VK P TLLEYS+ AVTEG
Sbjct  491   TCGTLGLSTATVKLVDADGKEHVACSMGAGPVDSAYKAIDLIVKEPATLLEYSMNAVTEG  550

Query  1748  IDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             IDAIA+TRVLIRG+N++++T+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  551   IDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  609



>ref|XP_010274930.1| PREDICTED: 2-isopropylmalate synthase A-like [Nelumbo nucifera]
Length=613

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/546 (79%), Positives = 487/546 (89%), Gaps = 2/546 (0%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             A  RP+YIPNRI DP YVR+FDTTLRDGEQSPGATMT+KEKLD+ARQLAKLGVDIIEAGF
Sbjct  58    ASARPEYIPNRIPDPLYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGF  117

Query  482   PAASEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS+ D EAV+ IA EVGN   E  +VPVICGL+RCN+ DID AWEAVKHAK+PR+HTF
Sbjct  118   PAASKDDLEAVKTIAMEVGNDVDETGYVPVICGLARCNRADIDAAWEAVKHAKRPRIHTF  177

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATSEIHMK KL  SRE+V++ A  MV+YARSLGC DVEFSPEDAGRS++EFLYQIL EV
Sbjct  178   IATSEIHMKHKLRKSREEVIQIARDMVSYARSLGCQDVEFSPEDAGRSEKEFLYQILEEV  237

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVG  L  EF QLIADIKANTPGIENVIISTHCQNDLG ++ NT+AGA
Sbjct  238   IKAGATTLNIPDTVGCLLEDEFAQLIADIKANTPGIENVIISTHCQNDLGQASGNTIAGA  297

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQ+EVTINGIGERAGNASLEEVVMA+K RG+ ++GGLYTGINT+HI M SKMV EY
Sbjct  298   RAGARQLEVTINGIGERAGNASLEEVVMAIKTRGKAIMGGLYTGINTKHIFMTSKMVTEY  357

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             +GL VQPHKAIVGANAF+HESGIHQDGMLK K TYEIMSPEDIGL+R+N SGIVLGKLSG
Sbjct  358   SGLPVQPHKAIVGANAFSHESGIHQDGMLKFKGTYEIMSPEDIGLYRSNDSGIVLGKLSG  417

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHAL++++ ELGY++D KEFDDLFWRFK+VAEKKK I+D D+ ALI DE+FQPQ+VW LG
Sbjct  418   RHALRSRLLELGYELDSKEFDDLFWRFKTVAEKKKHISDGDIEALILDEIFQPQVVWSLG  477

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
             DLQVTCG+LGLSTATVKLI AD  EHVACSVGTGPVDAAYKAVD +VK+PVTL+EYS+ A
Sbjct  478   DLQVTCGTLGLSTATVKLIAADGVEHVACSVGTGPVDAAYKAVDQIVKIPVTLVEYSMNA  537

Query  1736  VTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             VTEGIDAIASTRV+IRG+++HT  HAL+G +  RTFSGTGAGMDIV+SSVRAYVGALNK+
Sbjct  538   VTEGIDAIASTRVVIRGEDAHTVKHALSGQITQRTFSGTGAGMDIVVSSVRAYVGALNKV  597

Query  1916  LSFTTL  1933
             L F ++
Sbjct  598   LGFQSV  603



>emb|CDY26154.1| BnaA06g12630D [Brassica napus]
Length=626

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/539 (78%), Positives = 497/539 (92%), Gaps = 4/539 (1%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVD+IEAGFPAAS+
Sbjct  72    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDVIEAGFPAASK  131

Query  497   ADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATS  667
              DFEAV+ IA+ VGN   G+G +VPVICGLSRCN+RDI+ AWEAVK+AK+PR+HTFIATS
Sbjct  132   DDFEAVKTIAETVGNAVDGDG-YVPVICGLSRCNKRDIETAWEAVKYAKRPRIHTFIATS  190

Query  668   EIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  847
             +IH+++KL  S+++V+E A +MV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAG
Sbjct  191   DIHLEYKLKKSKDEVIEIARNMVKFARSLGCEDVEFSPEDAGRSEREFLYEILGEVIKAG  250

Query  848   ATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGA  1027
             ATTLNIPDTVG TLP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA++GA
Sbjct  251   ATTLNIPDTVGITLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHSGA  310

Query  1028  RQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLL  1207
             RQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTGI+T+HI+M SKMVE+YTG+ 
Sbjct  311   RQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGIDTRHIVMTSKMVEDYTGMQ  370

Query  1208  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHAL  1387
              QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHAL
Sbjct  371   TQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHAL  430

Query  1388  KTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQV  1567
             K ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ +W+L D+Q+
Sbjct  431   KDRLTELGYVLDDEQLSSIFWRFKSVAERKKRVTDADIIALVSDEVFQPEALWRLLDIQI  490

Query  1568  TCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEG  1747
             TCG+LGLSTATVKL+DAD +EHVACS+G GPVD+AYKA+DL+VK P TLLEYS+ AVTEG
Sbjct  491   TCGTLGLSTATVKLVDADGKEHVACSMGAGPVDSAYKAIDLIVKEPATLLEYSMNAVTEG  550

Query  1748  IDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             IDAIA+TRVLIRG+N++++T+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  551   IDAIATTRVLIRGNNNYSTTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  609



>ref|XP_010459471.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Camelina 
sativa]
Length=625

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/541 (78%), Positives = 493/541 (91%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  67    RRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  126

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIA
Sbjct  127   ASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIA  186

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH++ KL  ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  187   TSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  246

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA+A
Sbjct  247   AGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHA  306

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGLYTG++T+HI+M SKMVEEYTG
Sbjct  307   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLYTGLDTRHIVMTSKMVEEYTG  366

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRH
Sbjct  367   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRH  426

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGYD D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+
Sbjct  427   ALKDRLTELGYDFDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDI  486

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  487   QITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  546

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRG N ++ST+A+TG  V RTFSGTG+ +DIV+SSV+AYVGALNKM+ 
Sbjct  547   EGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKAYVGALNKMMD  606

Query  1922  F  1924
             F
Sbjct  607   F  607



>ref|NP_173285.2| 2-isopropylmalate synthase [Arabidopsis thaliana]
 sp|Q9LPR4.2|LEU11_ARATH RecName: Full=2-isopropylmalate synthase 1, chloroplastic; AltName: 
Full=Methylthioalkylmalate synthase-like 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE29723.1| 2-isopropylmalate synthase [Arabidopsis thaliana]
Length=631

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/538 (78%), Positives = 492/538 (91%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  77    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  136

Query  497   ADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIATS+
Sbjct  137   DDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSD  196

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  ++ +V+E A SMV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA
Sbjct  197   IHLEYKLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGA  256

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLI D+KANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  257   TTLNIPDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  316

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG+  
Sbjct  317   QMEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQT  376

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  377   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  436

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY +D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+Q+T
Sbjct  437   DRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  496

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  497   CGTLGLSTATVKLADADGKEHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  556

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVLIRG N ++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKM+ F
Sbjct  557   DAIATTRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDF  614



>gb|ACB59195.1| 2-isopropylmalate synthase [Brassica oleracea]
Length=672

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/538 (78%), Positives = 493/538 (92%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             DYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  118   DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  177

Query  497   ADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ I++ VGN   E  +VPVICGLSRCN++DI  AWEAV++AK+PR+HTFIATS+
Sbjct  178   DDFEAVKTISETVGNAVDENGYVPVICGLSRCNKKDIQTAWEAVRYAKRPRIHTFIATSD  237

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  S+++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  238   IHLEYKLKKSKQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  297

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLIAD+KANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  298   TTLNIPDTVGITLPSEFGQLIADLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  357

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVE+YTG+  
Sbjct  358   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEDYTGMQT  417

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  418   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  477

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ VWK+ D+Q+T
Sbjct  478   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEAVWKVLDIQIT  537

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL DAD +EH ACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  538   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  597

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVL+RG+N++TST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  598   DAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  655



>ref|XP_010672456.1| PREDICTED: 2-isopropylmalate synthase A-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=631

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/552 (78%), Positives = 492/552 (89%), Gaps = 6/552 (1%)
 Frame = +2

Query  281   VVRCGLGAP--RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKL  454
             ++RC   +P  RRPDYIPN+I DPNYVR+FDTTLRDGEQSPGA+MT K+KL++AR LA+L
Sbjct  53    IIRCSTTSPLQRRPDYIPNKIPDPNYVRIFDTTLRDGEQSPGASMTPKQKLEIARHLARL  112

Query  455   GVDIIEAGFPAASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKH  628
             GVDIIEAGFPA+S AD EAV+ IA EVGN   E  +VPVICGLSRCN+ DID AWEAVK+
Sbjct  113   GVDIIEAGFPASSNADLEAVKTIAIEVGNFVDEFGYVPVICGLSRCNKADIDAAWEAVKY  172

Query  629   AKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  808
             AK+PR+HTFIATSEIHM+ KLN +RE+V+E A SMV+YARSLGC DVEFSPEDAGRSDRE
Sbjct  173   AKRPRIHTFIATSEIHMQHKLNKTREEVIEIAKSMVSYARSLGCDDVEFSPEDAGRSDRE  232

Query  809   FLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGL  988
             FLYQILGEVI+AGATTLNIPDTVGYT+P EFGQLIADIKANTPGIENVIISTHCQNDLGL
Sbjct  233   FLYQILGEVIRAGATTLNIPDTVGYTVPKEFGQLIADIKANTPGIENVIISTHCQNDLGL  292

Query  989   STANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHII  1168
             STANT++GA AGARQ+EVTINGIGERAGNASLEEVVM +KCRG Q LGGL+TGI T+HI+
Sbjct  293   STANTVSGACAGARQLEVTINGIGERAGNASLEEVVMTIKCRG-QSLGGLHTGIQTEHIV  351

Query  1169  MASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS  1348
              ASKMV EYTGLLVQPHKAIVGANAF HESGIHQ GMLKHK TYEIMSPEDIGL RA++S
Sbjct  352   KASKMVAEYTGLLVQPHKAIVGANAFKHESGIHQHGMLKHKGTYEIMSPEDIGLQRADES  411

Query  1349  GIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVF  1528
             G+VLGKLSGRHAL+ ++++LGY  +GKE DD+FWRFKSVAEKKK + D+D+ AL+ DE+F
Sbjct  412   GLVLGKLSGRHALQKRLEQLGYFFEGKELDDVFWRFKSVAEKKKHVLDEDIEALVVDELF  471

Query  1529  QPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPV  1708
             QP  VW LGDLQVTCG+LGLSTATVKLI AD +EHVAC+VGTGPVD+AYKAVD +VK+PV
Sbjct  472   QPDSVWSLGDLQVTCGTLGLSTATVKLICADGKEHVACAVGTGPVDSAYKAVDSIVKMPV  531

Query  1709  TLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
             TLLEYSL+AVTEGIDA+A+TRVLIRG+N  TST A  G  + R+FSG+G+ MDIV+SSVR
Sbjct  532   TLLEYSLSAVTEGIDALATTRVLIRGENGFTSTQA-NGEQIRRSFSGSGSEMDIVVSSVR  590

Query  1889  AYVGALNKMLSF  1924
             AYV ALNKML+F
Sbjct  591   AYVSALNKMLAF  602



>ref|XP_010498246.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic isoform 
X2 [Camelina sativa]
Length=625

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/541 (78%), Positives = 494/541 (91%), Gaps = 2/541 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDP+YVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  67    RRPEYIPNRISDPSYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  126

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIA
Sbjct  127   ASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIA  186

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH++ KL  ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  187   TSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  246

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA+A
Sbjct  247   AGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHA  306

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TG++T+HI+M SKMVEEYTG
Sbjct  307   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGLDTRHIVMTSKMVEEYTG  366

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRH
Sbjct  367   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRH  426

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGYD+D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+
Sbjct  427   ALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDI  486

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q+TCG+LGLSTATVKL DAD +EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVT
Sbjct  487   QITCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT  546

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRVLIRG N ++ST+A+TG  V RTFSGTG+ +DIV+SSV+AYVGALNKM+ 
Sbjct  547   EGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKAYVGALNKMMD  606

Query  1922  F  1924
             F
Sbjct  607   F  607



>emb|CDX81876.1| BnaC08g37250D [Brassica napus]
Length=629

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/538 (78%), Positives = 493/538 (92%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             DYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  75    DYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  134

Query  497   ADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ I++ VGN   E  +VPVICGLSRCN++DI  AWEAV++AK+PR+HTFIATS+
Sbjct  135   DDFEAVKTISETVGNAVDENGYVPVICGLSRCNKKDIQTAWEAVRYAKRPRIHTFIATSD  194

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  SR++V+E A SMV +ARSLGC DVEFSPEDAGRS+REFLY+ILGEVIKAGA
Sbjct  195   IHLEYKLKKSRQEVIEIARSMVRFARSLGCDDVEFSPEDAGRSEREFLYEILGEVIKAGA  254

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLIAD+KANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  255   TTLNIPDTVGITLPSEFGQLIADLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  314

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVE+YTG+  
Sbjct  315   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEDYTGMQT  374

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  375   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  434

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY +D ++   +FWRFKSVAE+KK++TD D+IAL+SDEVFQP+ +WKL D+Q+T
Sbjct  435   DRLTELGYVLDDEQLSTIFWRFKSVAEQKKRVTDADIIALVSDEVFQPEALWKLLDIQIT  494

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL DAD +EH ACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  495   CGTLGLSTATVKLADADGKEHCACSMGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  554

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVL+RG+N++TST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F
Sbjct  555   DAIATTRVLVRGNNTYTSTNAITGEEVLRTFSGTGAGMDIVVSSVKAYVGALNKMLDF  612



>gb|KHF98529.1| 2-isopropylmalate synthase 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=648

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/567 (77%), Positives = 495/567 (87%), Gaps = 29/567 (5%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P YIPN I DPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  65    RCPPYIPNHIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  124

Query  488   ASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS+ DFEAV+ IA+EVGN   G G +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFI
Sbjct  125   ASKDDFEAVKTIAKEVGNAVDGNG-YVPVICGLSRCNEKDIKTAWEAVKYAKRPRIHTFI  183

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             ATS IH+++KL  S+E+V++ A +MV +ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVI
Sbjct  184   ATSAIHLEYKLRKSKEEVLDIARNMVRFARSLGCNDVEFSPEDAGRSDREFLYEILGEVI  243

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTLNIPDTVG T+P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT+AGA 
Sbjct  244   KAGATTLNIPDTVGITMPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTIAGAC  303

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGERAGNAS+EEVVMALKCRGE VLGGL+TGINT+HI+MASKMVEEYT
Sbjct  304   AGARQVEVTINGIGERAGNASMEEVVMALKCRGEHVLGGLHTGINTRHIVMASKMVEEYT  363

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKL---  1369
             GL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N++GIVLGKL   
Sbjct  364   GLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNEAGIVLGKLRFL  423

Query  1370  ----------------------SGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKK  1483
                                    GRHAL  +++ELGY++D  +  ++FWRFK VAE+KK+
Sbjct  424   TFTNSMVLCYLELDMNVGVGPMGGRHALSDRLKELGYELDDVQLGNIFWRFKEVAEQKKR  483

Query  1484  ITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPV  1663
             +TD DL+AL+SDEVFQP +VWKL DLQVTCG+LGLSTATVKLIDAD  EHVACSVGTGPV
Sbjct  484   VTDADLVALVSDEVFQPDVVWKLLDLQVTCGTLGLSTATVKLIDADGREHVACSVGTGPV  543

Query  1664  DAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTF  1843
             D+AYKAVDL++K  V+LLEYS+ AVTEGIDAIA+TRVLIR + SH STHALTG +V+RTF
Sbjct  544   DSAYKAVDLIIKESVSLLEYSMNAVTEGIDAIATTRVLIRVEKSHLSTHALTGELVHRTF  603

Query  1844  SGTGAGMDIVISSVRAYVGALNKMLSF  1924
             SGTGAGMDIV+SSV+AYV ALNKML F
Sbjct  604   SGTGAGMDIVVSSVKAYVSALNKMLGF  630



>ref|XP_002890281.1| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66540.1| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. 
lyrata]
Length=630

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/538 (78%), Positives = 488/538 (91%), Gaps = 2/538 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  76    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  135

Query  497   ADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIATS+
Sbjct  136   DDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSD  195

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH++ KL  ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA
Sbjct  196   IHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGA  255

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP EFGQLI D+KANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  256   TTLNIPDTVGITLPNEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  315

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG+  
Sbjct  316   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQT  375

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  376   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  435

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGY +D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+Q+T
Sbjct  436   DRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQIT  495

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+LGLSTATVKL D D  EHVACS+GTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGI
Sbjct  496   CGTLGLSTATVKLADTDGREHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGI  555

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAIA+TRVLIRG N ++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKM+ F
Sbjct  556   DAIATTRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDF  613



>ref|XP_010672455.1| PREDICTED: 2-isopropylmalate synthase A-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=638

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/546 (79%), Positives = 488/546 (89%), Gaps = 4/546 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIP RISDPNYVR+FDTTLRDGEQSPGA+MT +EKL++ARQLA LGVDIIEAGFPAA
Sbjct  72    RPEYIPQRISDPNYVRIFDTTLRDGEQSPGASMTPREKLEIARQLALLGVDIIEAGFPAA  131

Query  491   SEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S++D EAV+ IA EVGN   E  +VPVICGLSRCN+ DID AWEAVK+AK+PR+HTFIAT
Sbjct  132   SKSDLEAVKAIAMEVGNDVDEEGYVPVICGLSRCNKEDIDAAWEAVKYAKRPRIHTFIAT  191

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             SEIHMK+KLN +RE+VV+ A SMV YARSLGC DVEFSPEDAGRSDREFLYQILGEVI+A
Sbjct  192   SEIHMKYKLNKTREEVVDIARSMVGYARSLGCLDVEFSPEDAGRSDREFLYQILGEVIRA  251

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDTVGYT+P EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANT++GA AG
Sbjct  252   GATTLNIPDTVGYTVPKEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTVSGACAG  311

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVM +KCRG Q LGGL+TGI T+HI+ ASKMV EYTGL
Sbjct  312   ARQLEVTINGIGERAGNASLEEVVMTIKCRG-QSLGGLHTGIQTEHIVKASKMVAEYTGL  370

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
             LVQPHKAIVGANAF HESGIHQ GMLKHK TYEIMSPEDIGL RA++SG+VLGKLSGRHA
Sbjct  371   LVQPHKAIVGANAFKHESGIHQHGMLKHKGTYEIMSPEDIGLQRADESGLVLGKLSGRHA  430

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ  1564
             L+ ++++LGY  +GKE DD+FWRFKSVAEKKK + D+D+ AL+ DE+FQP  VW LGDLQ
Sbjct  431   LQKRLEQLGYFFEGKELDDVFWRFKSVAEKKKHVLDEDIEALVVDELFQPDSVWSLGDLQ  490

Query  1565  VTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTE  1744
             VTCG+LGLSTATVKLI AD +EHVAC+VGTGPVD+AYKAVD +VK+PVTLLEYSL+AVTE
Sbjct  491   VTCGTLGLSTATVKLICADGKEHVACAVGTGPVDSAYKAVDSIVKMPVTLLEYSLSAVTE  550

Query  1745  GIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             GIDA+A+TRVLIRG+N  TST A  G  + R+FSG+G+ MDIV+SSVRAYV ALNKML+F
Sbjct  551   GIDALATTRVLIRGENGFTSTQA-NGEQIRRSFSGSGSEMDIVVSSVRAYVSALNKMLAF  609

Query  1925  TTLVSR  1942
                 S+
Sbjct  610   NNKSSQ  615



>ref|XP_010097501.1| 2-isopropylmalate synthase 2 [Morus notabilis]
 gb|EXB68692.1| 2-isopropylmalate synthase 2 [Morus notabilis]
Length=637

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/544 (78%), Positives = 494/544 (91%), Gaps = 2/544 (0%)
 Frame = +2

Query  299   GAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAG  478
             G  RR +Y+PNRISDP YVR+FDTTLRDGEQSPGA++T+KEKLD+ARQLAKLGVDIIEAG
Sbjct  77    GRRRRSEYVPNRISDPYYVRIFDTTLRDGEQSPGASLTSKEKLDIARQLAKLGVDIIEAG  136

Query  479   FPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             FPAAS+ DFEAV+ IA+EVGN   +  +VPVICGLSRCN+ DI  AWEAVK+AK+PR+HT
Sbjct  137   FPAASKDDFEAVKTIAKEVGNAVDKDGYVPVICGLSRCNENDIRTAWEAVKYAKRPRIHT  196

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATS IHM++KL  S+EQV+E A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGE
Sbjct  197   FIATSPIHMEYKLRKSKEQVIEIARNMVKFARSLGCEDVEFSPEDAGRSDREFLYRILGE  256

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTLNIPDTVGYT+P EFG+LIADIKANT GIENVIISTHCQNDLGLSTANT+AG
Sbjct  257   VIKAGATTLNIPDTVGYTVPEEFGKLIADIKANTFGIENVIISTHCQNDLGLSTANTIAG  316

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A AGARQ+EVTINGIGERAGNASLEEVVM LKCRGE+ LGGL+T INT+HI+M SKMVE+
Sbjct  317   ACAGARQLEVTINGIGERAGNASLEEVVMTLKCRGERELGGLHTRINTKHIMMTSKMVED  376

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             YTGL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI++PEDIGL R N++GIVLGKLS
Sbjct  377   YTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIIAPEDIGLERINEAGIVLGKLS  436

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHALK +++ELGY++D ++   +FWRFK+VA++KK++TD DL AL++DEVFQP++VWKL
Sbjct  437   GRHALKRRLEELGYELDDEQLGSIFWRFKAVADQKKRVTDADLRALVTDEVFQPEVVWKL  496

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              DLQVTCG+LGLSTATVKL+DAD +++VACSVGTGPVD+AYKAVDL+VK PVTLLEYS+ 
Sbjct  497   VDLQVTCGTLGLSTATVKLVDADGKDYVACSVGTGPVDSAYKAVDLIVKEPVTLLEYSMI  556

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             AVTEGIDAIA+TRVLIRG+N+ + THA TG  V+RTFSG GAGMDIV+SSV+AY+GALNK
Sbjct  557   AVTEGIDAIATTRVLIRGENACSPTHASTGESVSRTFSGNGAGMDIVVSSVKAYIGALNK  616

Query  1913  MLSF  1924
             ML F
Sbjct  617   MLGF  620



>ref|XP_009411766.1| PREDICTED: 2-isopropylmalate synthase A-like [Musa acuminata 
subsp. malaccensis]
Length=629

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/568 (75%), Positives = 494/568 (87%), Gaps = 8/568 (1%)
 Frame = +2

Query  278   GVVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLG  457
             G ++C L  P RP+YIPN I DPNYVR+FDTTLRDGEQSPGATMT+ EKL VAR L++LG
Sbjct  63    GALKCSL--PSRPEYIPNHIPDPNYVRIFDTTLRDGEQSPGATMTSNEKLVVARHLSRLG  120

Query  458   VDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKH  628
             VDIIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGL+RCN++DID AWEAV+H
Sbjct  121   VDIIEAGFPASSPDDLDAVRSIAIEVGNQPVGEDGHVPVICGLARCNKKDIDAAWEAVRH  180

Query  629   AKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  808
             AKKPRVHTFIATSEIH++ KL  +RE+VV  A  MVAYARSLGC D+EFSPEDAGRSDRE
Sbjct  181   AKKPRVHTFIATSEIHLQHKLRKTREEVVNIAREMVAYARSLGCQDIEFSPEDAGRSDRE  240

Query  809   FLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGL  988
             FLY +L EVIKAGATTLNIPDTVGYTLP+EFG+LIADIKANTPGIEN IISTHCQNDLGL
Sbjct  241   FLYHVLEEVIKAGATTLNIPDTVGYTLPSEFGKLIADIKANTPGIENAIISTHCQNDLGL  300

Query  989   STANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHII  1168
             +TANTLAGAYAGARQ+EVT+NGIGERAGNASLEEVV+A+KCR +++LGGLYTGINT+HI 
Sbjct  301   ATANTLAGAYAGARQLEVTVNGIGERAGNASLEEVVVAMKCR-QELLGGLYTGINTKHIF  359

Query  1169  MASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS  1348
             MASKMV E+TGL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N+S
Sbjct  360   MASKMVAEHTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLSRSNES  419

Query  1349  GIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVF  1528
             GIVLGKLSGRHAL++++ E GYDI GKE DD+F RFK VAEKKK+I+D+DL ALISDE+F
Sbjct  420   GIVLGKLSGRHALRSRLLEFGYDISGKELDDVFKRFKEVAEKKKRISDEDLEALISDEIF  479

Query  1529  QPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPV  1708
             QP ++W L +LQ TCG+LGLSTATVKL+ +D EE +ACS+GTGPVDAAYKA+D +V+V  
Sbjct  480   QPPVIWSLSELQATCGTLGLSTATVKLVSSDGEEKIACSIGTGPVDAAYKAIDSIVQVHA  539

Query  1709  TLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
              L EY++ AVTEGIDAIA+TRV+I GD+S+TS HALTG  + RTFSG+GA MD+V+SSVR
Sbjct  540   VLKEYAMNAVTEGIDAIATTRVVISGDDSYTSMHALTGETMRRTFSGSGASMDVVVSSVR  599

Query  1889  AYVGALNKMLSFTTLV--SRYNKTEDNV  1966
             AY+ ALNKML F + +  S+ N  + N+
Sbjct  600   AYISALNKMLGFVSAMRASKENTEKQNI  627



>ref|XP_010931990.1| PREDICTED: 2-isopropylmalate synthase A-like [Elaeis guineensis]
Length=631

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/556 (77%), Positives = 493/556 (89%), Gaps = 6/556 (1%)
 Frame = +2

Query  278   GVVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLG  457
             G +RC L +  RP+YIPN I DP YVRVFDTTLRDGEQSPGATMT+KEKL VARQL+ LG
Sbjct  63    GALRCSLRS--RPEYIPNHIPDPCYVRVFDTTLRDGEQSPGATMTSKEKLVVARQLSLLG  120

Query  458   VDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKH  628
             VDIIEAGFPA+S  D +AVR IA EVGN    E  H+PVICGL+RCN++DID AWEAV+H
Sbjct  121   VDIIEAGFPASSPDDLDAVRSIAMEVGNQPVSEDGHIPVICGLARCNKKDIDAAWEAVRH  180

Query  629   AKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  808
             AKKPRVHTFIATSEIHM+ KL  +RE+VV  A  MVAYARSLGC D+EFSPEDAGRSDR+
Sbjct  181   AKKPRVHTFIATSEIHMQHKLRKTREEVVRIACEMVAYARSLGCQDIEFSPEDAGRSDRD  240

Query  809   FLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGL  988
             FLY +L EVIKAGATT+NIPDTVGYTLP+EF +LIADIKANT GIE+VIISTHCQNDLGL
Sbjct  241   FLYHVLEEVIKAGATTVNIPDTVGYTLPSEFEKLIADIKANTRGIEDVIISTHCQNDLGL  300

Query  989   STANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHII  1168
             +TANTLAGAYAGARQVEVT+NGIGERAGNASLEEVV+ALKCR ++++GGLYTGINT+HI+
Sbjct  301   ATANTLAGAYAGARQVEVTVNGIGERAGNASLEEVVIALKCR-QELMGGLYTGINTKHIV  359

Query  1169  MASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS  1348
             MASKMV EYTGL VQPHKAIVGANAFAHESGIHQDGMLKHK+TYEI+SPEDIGL R+N+S
Sbjct  360   MASKMVAEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKNTYEIISPEDIGLSRSNES  419

Query  1349  GIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVF  1528
             GIVLGKLSGRHAL++K+ E GYDI+GKE +D+F RFK VAEKKK+I+D+D+ ALISDE+F
Sbjct  420   GIVLGKLSGRHALRSKLLEFGYDINGKELEDVFKRFKEVAEKKKRISDEDIEALISDEIF  479

Query  1529  QPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPV  1708
             QP ++W LG+LQ TCG+LGLSTATVKL+ +D EE +ACSVGTGPVDAAYKA+D +V+VP 
Sbjct  480   QPAVIWSLGELQATCGTLGLSTATVKLVASDGEEKIACSVGTGPVDAAYKAIDSIVEVPA  539

Query  1709  TLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
             TL EY++T+VTEGIDAIA+TRV+I GD SH STHALTG  V+RTFSG+GA MDIV+SSVR
Sbjct  540   TLREYAMTSVTEGIDAIATTRVVIGGDGSHMSTHALTGEPVHRTFSGSGAAMDIVVSSVR  599

Query  1889  AYVGALNKMLSFTTLV  1936
             AY+ ALNKML F + V
Sbjct  600   AYISALNKMLGFMSAV  615



>ref|XP_003592827.1| 2-isopropylmalate synthase [Medicago truncatula]
 gb|AES63078.1| 2-isopropylmalate synthase [Medicago truncatula]
Length=598

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/543 (77%), Positives = 483/543 (89%), Gaps = 4/543 (1%)
 Frame = +2

Query  305   PR-RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             PR RP YIPN I DP+YVR+FDTTLRDGEQSPGA+MT+KEKLD+ARQLAKLGVDIIEAGF
Sbjct  56    PRHRPPYIPNHIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDIARQLAKLGVDIIEAGF  115

Query  482   PAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS  DFEAV++IA EVGN   +  +VPVICGLSRCN+ DI  AW AVKHAK+PR+HTF
Sbjct  116   PAASTDDFEAVKMIANEVGNAVDDNGYVPVICGLSRCNENDIQTAWNAVKHAKRPRIHTF  175

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATS IHM+FKL MS++QV++KA +MVA+ARSLGC DVEFSPEDAGRSDREFLYQILGEV
Sbjct  176   IATSAIHMEFKLRMSKQQVIDKARTMVAFARSLGCQDVEFSPEDAGRSDREFLYQILGEV  235

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVG T+P+EFG+LIADIKANTPG+ENVIISTHCQNDLGLSTANT+ GA
Sbjct  236   IKAGATTLNIPDTVGITMPSEFGKLIADIKANTPGVENVIISTHCQNDLGLSTANTIEGA  295

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQ+EVTINGIGERAGNASLEEVVMALKC G  +   L+TGINT+HI + S+MVEEY
Sbjct  296   RAGARQLEVTINGIGERAGNASLEEVVMALKC-GGHIFNNLFTGINTRHIYLTSRMVEEY  354

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             +GL +QPHKA+VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N++GIVLGKLSG
Sbjct  355   SGLQLQPHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNEAGIVLGKLSG  414

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHA++ +++ELGY++   + + LFWRFK+VAE+KK+ITD DL AL+SDEVFQ + +WKL 
Sbjct  415   RHAMRKRLEELGYELKDDQVESLFWRFKAVAEQKKRITDADLRALVSDEVFQAEPIWKLD  474

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
             DLQVTCG+LGLSTATVKL+  D   H+ACSVGTGPVD+AYKAVDL+VK P TLLEYS+ A
Sbjct  475   DLQVTCGTLGLSTATVKLVGDDGSTHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMIA  534

Query  1736  VTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             VTEGIDAIA+TRV+IRGD   TSTHALTG  V RTFSGTGAGMD+V+SSV+AY+ A+NKM
Sbjct  535   VTEGIDAIATTRVVIRGDTDQTSTHALTGESVQRTFSGTGAGMDVVVSSVKAYIAAINKM  594

Query  1916  LSF  1924
             LSF
Sbjct  595   LSF  597



>ref|XP_010498244.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic isoform 
X1 [Camelina sativa]
Length=650

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/566 (74%), Positives = 494/566 (87%), Gaps = 27/566 (5%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDP+YVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  67    RRPEYIPNRISDPSYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  126

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIA
Sbjct  127   ASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIA  186

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH++ KL  ++ +V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  187   TSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIK  246

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA+A
Sbjct  247   AGATTLNIPDTVGITLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAHA  306

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TG++T+HI+M SKMVEEYTG
Sbjct  307   GARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGLDTRHIVMTSKMVEEYTG  366

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +  QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRH
Sbjct  367   MQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRH  426

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK ++ ELGYD+D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+
Sbjct  427   ALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDI  486

Query  1562  QV-------------------------TCGSLGLSTATVKLIDADDEEHVACSVGTGPVD  1666
             QV                         TCG+LGLSTATVKL DAD +EHVACS+GTGPVD
Sbjct  487   QVKLRSSCFLFHFLLAYSHLLQSGMQITCGTLGLSTATVKLADADGKEHVACSMGTGPVD  546

Query  1667  AAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFS  1846
             +AYKAVDL+VK P TLLEYS+ AVTEGIDAIA+TRVLIRG N ++ST+A+TG  V RTFS
Sbjct  547   SAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFS  606

Query  1847  GTGAGMDIVISSVRAYVGALNKMLSF  1924
             GTG+ +DIV+SSV+AYVGALNKM+ F
Sbjct  607   GTGSEIDIVVSSVKAYVGALNKMMDF  632



>gb|KHG05648.1| 2-isopropylmalate synthase 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=674

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/593 (73%), Positives = 495/593 (83%), Gaps = 55/593 (9%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P YIPN I DPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  65    RCPPYIPNHIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  124

Query  488   ASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS+ DFEAV+ IA+EVGN   G G +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFI
Sbjct  125   ASKDDFEAVKTIAKEVGNAVDGNG-YVPVICGLSRCNEKDIKTAWEAVKYAKRPRIHTFI  183

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR--------------  796
             ATS IH+++KL  S+E+V++ A +MV +ARSLGC+DVEFSPEDAGR              
Sbjct  184   ATSAIHLEYKLRKSKEEVLDIARNMVRFARSLGCNDVEFSPEDAGRCMLVFAWGGLIISG  243

Query  797   ------------SDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPG  940
                         SDREFLY+ILGEVIKAGATTLNIPDTVG T+P+EFGQLIADIKANTPG
Sbjct  244   ALNDSYFAVAVVSDREFLYEILGEVIKAGATTLNIPDTVGITMPSEFGQLIADIKANTPG  303

Query  941   IENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGE  1120
             IENVIISTHCQNDLGLSTANT+AGA AGARQVEVTINGIGERAGNAS+EEVVMALKCRGE
Sbjct  304   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASMEEVVMALKCRGE  363

Query  1121  QVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1300
              VLGGL+TGINT+HI+MASKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  364   HVLGGLHTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  423

Query  1301  EIMSPEDIGLHRANQSGIVLGKL-------------------------SGRHALKTKMQE  1405
             EI+SPEDIGL R+N++GIVLGKL                          GRHAL  +++E
Sbjct  424   EIISPEDIGLERSNEAGIVLGKLRFLTFTNSMVLCYLELDMNVGVGPMGGRHALSDRLKE  483

Query  1406  LGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLG  1585
             LGY++D  +  ++FWRFK VAE+KK++TD DL+AL+SDEVFQP +VWKL DLQVTCG+LG
Sbjct  484   LGYELDDVQLGNIFWRFKEVAEQKKRVTDADLVALVSDEVFQPDVVWKLLDLQVTCGTLG  543

Query  1586  LSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIAS  1765
             LSTATVKLIDAD  EHVACSVGTGPVD+AYKAVDL++K  V+LLEYS+ AVTEGIDAIA+
Sbjct  544   LSTATVKLIDADGREHVACSVGTGPVDSAYKAVDLIIKESVSLLEYSMNAVTEGIDAIAT  603

Query  1766  TRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             TRVLIR + SH STHALTG +V+RTFSGTGAGMDIV+SSV+AYV ALNKML F
Sbjct  604   TRVLIRVEKSHLSTHALTGELVHRTFSGTGAGMDIVVSSVKAYVSALNKMLGF  656



>ref|XP_008786904.1| PREDICTED: 2-isopropylmalate synthase A-like [Phoenix dactylifera]
Length=631

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/556 (75%), Positives = 487/556 (88%), Gaps = 6/556 (1%)
 Frame = +2

Query  278   GVVRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLG  457
             G  RC L +  RP+YIPN I DP YVRVFDTTLRDGEQSPGATMT+KEKL VARQL++LG
Sbjct  63    GATRCSLRS--RPEYIPNDIPDPRYVRVFDTTLRDGEQSPGATMTSKEKLVVARQLSRLG  120

Query  458   VDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKH  628
             VDIIEAGFPA+S  D +AVR IA EVG     E  H+PVICGL+RCN++DID AWEAV+H
Sbjct  121   VDIIEAGFPASSPDDLDAVRSIAMEVGKQPVSEDGHIPVICGLARCNKKDIDAAWEAVRH  180

Query  629   AKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  808
             AKKPRVHTFIATSEIHM+ KL  +RE+VV  A  MVAYARSLGC D+EFSPEDAGRSDR+
Sbjct  181   AKKPRVHTFIATSEIHMQHKLRKTREEVVRIAREMVAYARSLGCQDIEFSPEDAGRSDRD  240

Query  809   FLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGL  988
             FLY +L EVIKAGATT+NIPDTVGYTLP+EF +LIADIKANT GIENVIISTHCQNDLGL
Sbjct  241   FLYHVLEEVIKAGATTVNIPDTVGYTLPSEFEKLIADIKANTHGIENVIISTHCQNDLGL  300

Query  989   STANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHII  1168
             +TANTLAGAYAGARQ+EVT+NGIGERAGNASLEEVV+A+KCR ++++GGLYTGINT+HI+
Sbjct  301   ATANTLAGAYAGARQLEVTVNGIGERAGNASLEEVVIAMKCR-QELMGGLYTGINTKHIV  359

Query  1169  MASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS  1348
             MASKMV EYTGL VQPHKAIVGANAFAHESGIHQDGMLKHK+TYEI+SPEDIGL R+N+S
Sbjct  360   MASKMVAEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKNTYEIISPEDIGLSRSNES  419

Query  1349  GIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVF  1528
             GIVLGKLSGRHAL++K+ E GYDI+G E +D+F RFK VAEKKK+++D+D+ ALI+DE+F
Sbjct  420   GIVLGKLSGRHALRSKLLEFGYDINGNELEDVFKRFKEVAEKKKRVSDEDIEALITDEIF  479

Query  1529  QPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPV  1708
             QP ++W LG+LQ TCG+LGLSTATVKLI +D EE +ACSVGTGPVDAAYKA+D +V+VP 
Sbjct  480   QPAVIWSLGELQATCGTLGLSTATVKLIASDGEEKIACSVGTGPVDAAYKAIDSIVQVPA  539

Query  1709  TLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
              L EY++ +VTEGIDAIA+TRV+I GDN+  + HALTG  V RTFSG+GA MDIV+SSVR
Sbjct  540   VLREYAMNSVTEGIDAIATTRVVIGGDNNSMAMHALTGESVRRTFSGSGAAMDIVVSSVR  599

Query  1889  AYVGALNKMLSFTTLV  1936
             AYV ALNKML F + V
Sbjct  600   AYVSALNKMLGFMSAV  615



>ref|XP_003556565.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Glycine 
max]
Length=624

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/539 (78%), Positives = 485/539 (90%), Gaps = 5/539 (1%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             YIPNRI DP+YVR+FDTTLRDGEQSPGA+MT+KEKLDVARQLAKLGVDIIEAGFPAAS+ 
Sbjct  70    YIPNRIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLAKLGVDIIEAGFPAASKD  129

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV++IAQEVGN   +  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  130   DFEAVKMIAQEVGNAVDDDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSAI  189

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  190   HMEYKLRMSKDKVVDIARNMVKFARSLGCEDVEFSPEDAGRSDREFLYEILGEVIKAGAT  249

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQ
Sbjct  250   TLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIEGARAGARQ  309

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             +EVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+HI + S+MVEEYTGL +Q
Sbjct  310   LEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGINTKHIFLTSRMVEEYTGLQLQ  368

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKA+VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R N++GIVLGKLSGRHAL+ 
Sbjct  369   PHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKLSGRHALRK  428

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             +++ELGY++   +   LFWRFK+VAE+KK++TD DL AL+SDEVFQ + VWKLGDLQVTC
Sbjct  429   RLEELGYELSDDQVQTLFWRFKAVAEQKKRVTDADLRALVSDEVFQAEPVWKLGDLQVTC  488

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+LGLSTATVKL+ +D   HVACSVGTGPVD+AYKAVDL+VK PVTLLEYS+ AVTEGID
Sbjct  489   GTLGLSTATVKLLSSDGSTHVACSVGTGPVDSAYKAVDLIVKEPVTLLEYSMNAVTEGID  548

Query  1754  AIASTRVLIRGDN--SHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             AIA+TRV+IRG++  S ++THALTG  V RTFSGTGAGMD+V+SSV+AY+ ALNKML F
Sbjct  549   AIATTRVVIRGESETSTSTTHALTGEAVLRTFSGTGAGMDVVVSSVKAYIAALNKMLGF  607



>gb|AAF26002.1|AC013354_21 F15H18.3 [Arabidopsis thaliana]
Length=675

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/582 (72%), Positives = 493/582 (85%), Gaps = 46/582 (8%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  77    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  136

Query  497   ADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIATS+
Sbjct  137   DDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSD  196

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH+++KL  ++ +V+E A SMV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA
Sbjct  197   IHLEYKLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGA  256

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLI D+KANTPGIENV+ISTHCQNDLGLSTANTL+GA+AGAR
Sbjct  257   TTLNIPDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGAR  316

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             Q+EVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG+  
Sbjct  317   QMEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQT  376

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  377   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  436

Query  1391  TKMQE-----------------------------LGYDIDGKEFDDLFWRFKSVAEKKKK  1483
              ++ E                             LGY +D ++   +FWRFK+VAE+KK+
Sbjct  437   DRLTEVHSNLTHTNTCIAIFVGDTNVLLSFVHFQLGYQLDDEQLSTIFWRFKTVAEQKKR  496

Query  1484  ITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPV  1663
             +TD D+IAL+SDEVFQP+ VWKL D+Q+TCG+LGLSTATVKL DAD +EHVACS+GTGPV
Sbjct  497   VTDADIIALVSDEVFQPEAVWKLLDIQITCGTLGLSTATVKLADADGKEHVACSIGTGPV  556

Query  1664  DAAYKAVDLLVKV---------------PVTLLEYSLTAVTEGIDAIASTRVLIRGDNSH  1798
             D+AYKAVDL+VKV               P TLLEYS+ AVTEGIDAIA+TRVLIRG N +
Sbjct  557   DSAYKAVDLIVKVLFIPLRLSSTNNSPEPATLLEYSMNAVTEGIDAIATTRVLIRGSNKY  616

Query  1799  TSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             +ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKM+ F
Sbjct  617   SSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDF  658



>ref|XP_004289267.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=628

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/542 (77%), Positives = 482/542 (89%), Gaps = 8/542 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDY+PNRISDPNYVR+FDTTLRDGEQSPGA++T+KEKL +ARQLAKLGVDIIEAGFPA
Sbjct  72    RRPDYVPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLGIARQLAKLGVDIIEAGFPA  131

Query  488   ASEADFEAVRLIAQEVGNG---EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS+ DFEAV+ IA+EVGN    +G +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFI
Sbjct  132   ASKDDFEAVKTIAKEVGNFVDIDG-YVPVICGLSRCNEKDIKTAWEAVKYAKRPRIHTFI  190

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             ATS IHM+ KL  ++EQV+E A SMV+YARSLGC DVEFSPEDAGRS++EFLYQILGEVI
Sbjct  191   ATSPIHMEHKLRKTKEQVIEIARSMVSYARSLGCEDVEFSPEDAGRSEKEFLYQILGEVI  250

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTLNIPDTVG T+P EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTLAGA 
Sbjct  251   KAGATTLNIPDTVGITVPNEFGQLIADIKANTPGIDNVIISTHCQNDLGLSTANTLAGAS  310

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
              GARQVEVTINGIGERAGNASLEEVVM L CRGEQV GGLYTGIN +HI + SKMV EYT
Sbjct  311   RGARQVEVTINGIGERAGNASLEEVVMTLNCRGEQVFGGLYTGINPKHIYITSKMVSEYT  370

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             G+ VQPHKAIVG+NAFAHESGIHQDGMLK K TYEI+SPEDIG  R+N++GIVLGKLSGR
Sbjct  371   GMHVQPHKAIVGSNAFAHESGIHQDGMLKDKRTYEIISPEDIGYDRSNEAGIVLGKLSGR  430

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGD  1558
             HA+K ++++LGY++D  + + +FWRFK VAE+KK++TD DL AL+SDEVFQP++VWKL D
Sbjct  431   HAVKKQLEQLGYELDDVQLETVFWRFKGVAEQKKRVTDADLRALVSDEVFQPEVVWKLHD  490

Query  1559  LQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAV  1738
             LQVTCG+LGLSTATVKLIDAD  EH+ACSVGTGPVD+AYKAVDL+VK PVTL+EYS+  V
Sbjct  491   LQVTCGTLGLSTATVKLIDADGREHIACSVGTGPVDSAYKAVDLIVKEPVTLVEYSMNGV  550

Query  1739  TEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             TEGIDAIA+TRV+IR +NS      + G +  RTFSG GAGMDIV+SSV+AY+GALNKML
Sbjct  551   TEGIDAIATTRVVIRVENSDM----VAGEISQRTFSGIGAGMDIVVSSVKAYIGALNKML  606

Query  1919  SF  1924
              F
Sbjct  607   GF  608



>gb|KCW87847.1| hypothetical protein EUGRSUZ_A00248 [Eucalyptus grandis]
Length=638

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/554 (75%), Positives = 484/554 (87%), Gaps = 5/554 (1%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             AP  P YIPNRI DPNY+R+FDTTLRDGEQSPGATMT++EKL++ARQLAKLGVDIIEAGF
Sbjct  82    APPCPKYIPNRIPDPNYIRIFDTTLRDGEQSPGATMTSQEKLNIARQLAKLGVDIIEAGF  141

Query  482   PAASEADFEAVRLIAQEVGNGEGEH--VPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS  DF AV+ IA EVGN    H  +P+IC LSRCN++DI  AW+AV+ A++PR+HTF
Sbjct  142   PAASPDDFNAVKAIALEVGNAVDPHGYIPIICSLSRCNEKDIQAAWDAVRFARRPRIHTF  201

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATS IHM++KL  S+++V+  A +MVA+ARSLGC+DVEFSPEDAGRS+REFLY+ILGEV
Sbjct  202   IATSAIHMQYKLKKSKQEVINIARTMVAFARSLGCNDVEFSPEDAGRSEREFLYEILGEV  261

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVG T+P EFG+LIAD+KANTPGIENVIIS HC NDLGLSTANT+AGA
Sbjct  262   IKAGATTLNIPDTVGITMPEEFGKLIADVKANTPGIENVIISAHCHNDLGLSTANTIAGA  321

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQVEVTINGIGERAGNASLEEVVMALKC+GE +LGGLYTGINT+HI+M SKMVEEY
Sbjct  322   CAGARQVEVTINGIGERAGNASLEEVVMALKCKGESILGGLYTGINTRHIVMTSKMVEEY  381

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             +GL VQPHKAIVGANAFAHESGIHQD MLKHK TYEI+SP+DIGL R N+  IVLGKLSG
Sbjct  382   SGLHVQPHKAIVGANAFAHESGIHQDRMLKHKGTYEIISPDDIGLERTNEVDIVLGKLSG  441

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHALK K+ ELGYDIDG++ D++FW+FK+VAE+KK++TD ++IAL+SDEVFQP +VWKL 
Sbjct  442   RHALKMKLVELGYDIDGEQLDNIFWQFKAVAEQKKRVTDAEIIALVSDEVFQPAVVWKLH  501

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
             DLQV+CG+LGLSTATVKLI  D +EH+AC+VGTG VD+AYKAVDL+VKVP TLL+YS+T 
Sbjct  502   DLQVSCGTLGLSTATVKLISGDGKEHIACAVGTGRVDSAYKAVDLIVKVPTTLLKYSMTT  561

Query  1736  VTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             VTEGIDAIA+T+VLI G+N  TS HALT   ++RTFSGTG+ MDI +SSVRAY+ ALNKM
Sbjct  562   VTEGIDAIATTQVLIHGENDRTSRHALT---IHRTFSGTGSSMDIAVSSVRAYIVALNKM  618

Query  1916  LSFTTLVSRYNKTE  1957
             L F  L      TE
Sbjct  619   LGFMELTPAEVPTE  632



>ref|XP_004497478.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=617

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/550 (76%), Positives = 483/550 (88%), Gaps = 6/550 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP YIPN I DP+YVR+FDTTLRDGEQSPGA+MT+KEKLD+ARQL KLGVDIIEAGFPA
Sbjct  64    RRPPYIPNHIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDIARQLTKLGVDIIEAGFPA  123

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV++IA EVGN   +  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIA
Sbjct  124   ASKDDFEAVKVIATEVGNDVDDNGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA  183

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM++KL MS+E+V+EKA SMVA+ARSLGC DVEFSPEDAGRSDREFLYQILGEVIK
Sbjct  184   TSAIHMEYKLRMSKEKVIEKARSMVAFARSLGCDDVEFSPEDAGRSDREFLYQILGEVIK  243

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG T+P+EFG+LIADIKANTPG+ENVIISTHCQNDLGLSTANT+ GA A
Sbjct  244   AGATTLNIPDTVGITMPSEFGKLIADIKANTPGVENVIISTHCQNDLGLSTANTIEGARA  303

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+EVTINGIGERAGNASLEEVVMALKC G  V   L+TGINT+HI M S+MVEEY+G
Sbjct  304   GARQLEVTINGIGERAGNASLEEVVMALKC-GGHVFDNLFTGINTRHIYMTSRMVEEYSG  362

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L +QPHKA+VGANAFAHESGIHQDGMLKHK+TYEI+SPEDIGL R+N++GIVLGKLSGRH
Sbjct  363   LQLQPHKALVGANAFAHESGIHQDGMLKHKNTYEIISPEDIGLERSNEAGIVLGKLSGRH  422

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             AL+ +++ELGY++   + + LFWRFK+VAE+KK+ITD DL AL+SDEVFQ + +WKLGDL
Sbjct  423   ALRKRLEELGYELKDDQVESLFWRFKAVAEQKKRITDADLRALVSDEVFQAEPIWKLGDL  482

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG+LGLSTATVKL+  D    VACSVGTGPVD+AYKA+DL+VK PVTLLEYS+ AVT
Sbjct  483   QVTCGTLGLSTATVKLVGDDGSTCVACSVGTGPVDSAYKAIDLIVKEPVTLLEYSMNAVT  542

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRV+IRGD  H STHALTG  V RTF     GMD+V+SSV+AY+ A+NKMLS
Sbjct  543   EGIDAIATTRVVIRGDQKHKSTHALTGERVQRTFR---YGMDVVVSSVKAYIAAINKMLS  599

Query  1922  FTTLVSRYNK  1951
             F    S   K
Sbjct  600   FKETSSSTEK  609



>ref|NP_001066116.1| Os12g0138900 [Oryza sativa Japonica Group]
 gb|ABA95781.2| 2-isopropylmalate synthase B, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29135.1| Os12g0138900 [Oryza sativa Japonica Group]
 gb|EEC68833.1| hypothetical protein OsI_37410 [Oryza sativa Indica Group]
 gb|EEE52743.1| hypothetical protein OsJ_35174 [Oryza sativa Japonica Group]
Length=635

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/550 (76%), Positives = 482/550 (88%), Gaps = 5/550 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VR  +  PRRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  68    VRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  127

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  128   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  187

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  188   RPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFL  247

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+T
Sbjct  248   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLAT  307

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+
Sbjct  308   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMS  366

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GI
Sbjct  367   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGI  426

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  427   VLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  486

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             ++ W L D+Q TCG+LGLSTATVKLI  D +E +AC+VGTGPVDAAYKAVD ++++P  L
Sbjct  487   KVFWSLADVQATCGTLGLSTATVKLIGPDGDEKIACAVGTGPVDAAYKAVDDIIQIPTVL  546

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV++ GD S  S HALTG+  NR FSG+GA +DIV+SSVRAY
Sbjct  547   REYSMTSVTEGIDAIATTRVVVTGDVS-DSKHALTGHSFNRAFSGSGAALDIVVSSVRAY  605

Query  1895  VGALNKMLSF  1924
             + ALNKM SF
Sbjct  606   LSALNKMSSF  615



>gb|ABA91408.1| 2-isopropylmalate synthase B, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEE51633.1| hypothetical protein OsJ_32925 [Oryza sativa Japonica Group]
Length=635

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/550 (76%), Positives = 482/550 (88%), Gaps = 5/550 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VR  +  PRRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  68    VRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  127

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  128   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  187

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  188   RPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFL  247

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+T
Sbjct  248   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLAT  307

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+
Sbjct  308   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMS  366

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GI
Sbjct  367   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGI  426

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  427   VLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  486

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             ++ W L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P  L
Sbjct  487   KVFWSLADVQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDAAYKAVDDIIQIPTVL  546

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV++ GD S  S HALTG+  +R FSG+GA +DIV+SSVRAY
Sbjct  547   REYSMTSVTEGIDAIATTRVVVTGDVS-DSKHALTGHSFSRAFSGSGAALDIVVSSVRAY  605

Query  1895  VGALNKMLSF  1924
             + ALNKM SF
Sbjct  606   LSALNKMSSF  615



>ref|XP_006858638.1| hypothetical protein AMTR_s00066p00043610 [Amborella trichopoda]
 gb|ERN20105.1| hypothetical protein AMTR_s00066p00043610 [Amborella trichopoda]
Length=629

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/563 (74%), Positives = 491/563 (87%), Gaps = 6/563 (1%)
 Frame = +2

Query  287   RC---GLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLG  457
             RC   G G  +RP+Y+PNRI D  YVR+FDTTLRDGEQSPGA+MT+KEKLDVARQLA+LG
Sbjct  66    RCHALGGGGQQRPEYLPNRIDDLQYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLARLG  125

Query  458   VDIIEAGFPAASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHA  631
             VDIIEAGFP AS  D EA+++IA +VG+   +  +VPVICGL+RCN+ DID AWEAV+ A
Sbjct  126   VDIIEAGFPIASREDLEAIKMIAADVGSFIDDSGYVPVICGLARCNKADIDAAWEAVQRA  185

Query  632   KKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREF  811
              +PR+H FIATSEIH++ KL  +R++V+E A SMVAYARSLGC DVEFSPEDAGRSDREF
Sbjct  186   VRPRIHIFIATSEIHLEHKLKKTRDEVLEIARSMVAYARSLGCPDVEFSPEDAGRSDREF  245

Query  812   LYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLS  991
             LY +LGE IKAGATTLNIPDTVGYTLP+E+G+LI+DI+ANTPGIENVIISTHCQNDLGL+
Sbjct  246   LYLVLGEAIKAGATTLNIPDTVGYTLPSEYGKLISDIRANTPGIENVIISTHCQNDLGLA  305

Query  992   TANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIM  1171
             ++NTLAGAYAGARQ+EVT+NGIGERAGNASLEEVVMAL  RG+++LGGLYTGINT+ I M
Sbjct  306   SSNTLAGAYAGARQLEVTVNGIGERAGNASLEEVVMALHLRGKELLGGLYTGINTKQIAM  365

Query  1172  ASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSG  1351
             ASKMV EYTG+ VQPHKAIVGANAFAHESGIHQDGMLK + TYEI+SP DIGL+R+ +SG
Sbjct  366   ASKMVTEYTGMPVQPHKAIVGANAFAHESGIHQDGMLKFQGTYEILSPSDIGLNRSTESG  425

Query  1352  IVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQ  1531
             IVLGKLSGRHALK+++ +LGY++  K+ DD+FWRFK+VAEKKK ++D D+ AL+SDEVFQ
Sbjct  426   IVLGKLSGRHALKSRLVQLGYNLGEKKLDDVFWRFKAVAEKKKHLSDGDIEALVSDEVFQ  485

Query  1532  PQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVT  1711
             PQ++W LGDLQVTCG+ GLST TVKLI AD  EH+AC+VGTGPVDAAYKA+D +VKV VT
Sbjct  486   PQVIWSLGDLQVTCGTSGLSTGTVKLIGADGTEHIACAVGTGPVDAAYKAIDSIVKVSVT  545

Query  1712  LLEYSLTAVTEGIDAIASTRVLIRGDNS-HTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
             LLEYS+ AVTEGIDAIA TRV+IR ++  HTSTHALTG  ++RTFSGTGAGMDIV SSVR
Sbjct  546   LLEYSMNAVTEGIDAIAHTRVIIRPEHGHHTSTHALTGETLHRTFSGTGAGMDIVASSVR  605

Query  1889  AYVGALNKMLSFTTLVSRYNKTE  1957
             AYV ALNKMLSF T+ +R    E
Sbjct  606   AYVSALNKMLSFRTISTRKETVE  628



>emb|CBX25286.1| hypothetical_protein [Oryza brachyantha]
Length=564

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/546 (77%), Positives = 480/546 (88%), Gaps = 5/546 (1%)
 Frame = +2

Query  296   LGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEA  475
             + APRRP+Y+PNRI DP+YVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEA
Sbjct  1     MAAPRRPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEA  60

Query  476   GFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRV  646
             GFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA++PR+
Sbjct  61    GFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRI  120

Query  647   HTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  826
             HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL
Sbjct  121   HTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHIL  180

Query  827   GEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  1006
              EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTL
Sbjct  181   EEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTL  240

Query  1007  AGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMV  1186
             AGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+SKMV
Sbjct  241   AGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMV  299

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGK  1366
             +E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGK
Sbjct  300   QEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGK  359

Query  1367  LSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVW  1546
             LSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP++ W
Sbjct  360   LSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFW  419

Query  1547  KLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYS  1726
              L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P  L EYS
Sbjct  420   SLVDVQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAYKAVDEIIQIPTVLREYS  479

Query  1727  LTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGAL  1906
             +T+VTEGIDAIA+TRV++ GD S  S HALTG   NR FSG+GA MDIV+SSVRAY+ AL
Sbjct  480   MTSVTEGIDAIATTRVVVTGDVSD-SKHALTGQSFNRAFSGSGAAMDIVVSSVRAYLSAL  538

Query  1907  NKMLSF  1924
             NKM SF
Sbjct  539   NKMSSF  544



>gb|EMT05050.1| 2-isopropylmalate synthase A [Aegilops tauschii]
Length=627

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/564 (74%), Positives = 486/564 (86%), Gaps = 6/564 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VR  L APRRP+Y+P+RI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  61    VRACLAAPRRPEYVPDRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  120

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  121   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  180

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSEIHM+ KL  + +QVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  181   KPRIHTFIATSEIHMQHKLRKTPDQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFL  240

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL++
Sbjct  241   YHILEEVIKAGATTLNIPDTVGYTLPHEFGKLIADIKANTPGIENAIISTHCQNDLGLAS  300

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGAYAGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGL+TGIN+QHI M 
Sbjct  301   ANTLAGAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLHTGINSQHITMT  359

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK K TYEI+SP+DIGL RAN+ GI
Sbjct  360   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIISPDDIGLTRANEFGI  419

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA++TK+ ELGY+I+ KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  420   VLGKLSGRHAVRTKLVELGYEINDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  479

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             +++W LGD+Q TCG+LGLSTATVKLI  D EE + CSVGTGPVDAAYKAVD ++++P  L
Sbjct  480   KVIWSLGDVQATCGTLGLSTATVKLITIDGEEKIGCSVGTGPVDAAYKAVDQIIQIPTVL  539

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV+I GD S     ALT N  NR+FSG+GA MD+V+SSVRAY
Sbjct  540   REYSMTSVTEGIDAIATTRVVIAGDVS-ADKPALTSN-SNRSFSGSGAAMDVVVSSVRAY  597

Query  1895  VGALNKMLSFTTLVSRYNKTEDNV  1966
             + ALNKM S+   V   ++  + +
Sbjct  598   LSALNKMSSYVGAVKASSEAPETI  621



>dbj|BAJ93533.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=627

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/550 (76%), Positives = 482/550 (88%), Gaps = 6/550 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             V   L APRRP+Y+P+RI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  61    VHACLAAPRRPEYVPDRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  120

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  121   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  180

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             KPR+HTFIATSEIHM+ KL  + +QVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  181   KPRIHTFIATSEIHMQHKLRKTPDQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFL  240

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL++
Sbjct  241   YHILEEVIKAGATTLNIPDTVGYTLPHEFGKLIADIKANTPGIENAIISTHCQNDLGLAS  300

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGAYAGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGIN+QHI M 
Sbjct  301   ANTLAGAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLDGLYTGINSQHITMT  359

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK K TYEI+SP+DIGL RAN+ GI
Sbjct  360   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIISPDDIGLTRANEFGI  419

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA++TK+ ELGY+I+ +EF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  420   VLGKLSGRHAVRTKLVELGYEINDREFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  479

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             +++W LGD+Q TCG+LGLSTATVKLI  D EE + CSVGTGPVDAAYKAVD ++++P  L
Sbjct  480   KVIWSLGDVQATCGTLGLSTATVKLITLDGEEKIGCSVGTGPVDAAYKAVDQIIQIPTIL  539

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV+I GD S  + +ALTG+  NR+FSG+GA MD+V+SSVRAY
Sbjct  540   REYSMTSVTEGIDAIATTRVVITGDVS-ANKYALTGH-SNRSFSGSGAAMDVVVSSVRAY  597

Query  1895  VGALNKMLSF  1924
             + ALNKM SF
Sbjct  598   LSALNKMSSF  607



>gb|AFW64772.1| 2-isopropylmalate synthase B [Zea mays]
Length=641

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/555 (74%), Positives = 483/555 (87%), Gaps = 7/555 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD+IEAGFPA
Sbjct  78    RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDVIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGNGE-----GEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             +S  D +AVR IA EVGN       G HVPVICGLSRCN+RDID AWEAV+HA++PR+HT
Sbjct  138   SSPDDLDAVRSIAIEVGNPPPGDDGGAHVPVICGLSRCNRRDIDAAWEAVRHARRPRIHT  197

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATSEIHM+ KL  + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY IL E
Sbjct  198   FIATSEIHMQHKLRKTPDQVVAVAREMVAYARSLGCADVEFSPEDAGRSNREFLYHILEE  257

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTLNIPDTVGYTLP EFG+LI+DIK NTPGIEN IISTHCQNDLGL+TANTLAG
Sbjct  258   VIKAGATTLNIPDTVGYTLPYEFGKLISDIKENTPGIENAIISTHCQNDLGLATANTLAG  317

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A+AGARQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E
Sbjct  318   AHAGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQE  376

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             ++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLS
Sbjct  377   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLARANEFGIVLGKLS  436

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L
Sbjct  437   GRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSL  496

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              D+Q TCG+LGLSTATVKLI  D EE +ACSVGTGPVDAAYKAVD ++++P  L EY +T
Sbjct  497   ADVQATCGTLGLSTATVKLIGPDGEERIACSVGTGPVDAAYKAVDQIIQIPTVLREYGMT  556

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             +VTEGIDAIA+TRV++ GD ++ S HALTG+  NR+FSG+GA MDIV+SSVRAY+ ALNK
Sbjct  557   SVTEGIDAIATTRVVVTGDVANNSKHALTGHSFNRSFSGSGAAMDIVVSSVRAYLSALNK  616

Query  1913  MLSFTTLVSRYNKTE  1957
             M SF    +R + TE
Sbjct  617   MCSFAG-AARASSTE  630



>ref|XP_003536802.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Glycine 
max]
Length=620

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/539 (77%), Positives = 478/539 (89%), Gaps = 5/539 (1%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             YIPN I DP+YVR+FDTTLRDGEQSPGA+MT+KEKLDVARQLAKLGVDIIEAGFPAAS+ 
Sbjct  66    YIPNLIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLAKLGVDIIEAGFPAASKD  125

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV++IAQ VGN      +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  126   DFEAVKMIAQAVGNAVENDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSPI  185

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIK GAT
Sbjct  186   HMEYKLRMSKDKVVDIARNMVKFARSLGCDDVEFSPEDAGRSDREFLYEILGEVIKVGAT  245

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQ
Sbjct  246   TLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIEGARAGARQ  305

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             +EVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+HI + SKMVEEYTGL +Q
Sbjct  306   LEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGINTKHIFLTSKMVEEYTGLQIQ  364

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKA+VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R N++GIVLGKLSGRHAL+ 
Sbjct  365   PHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKLSGRHALRK  424

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             +++ELGY+++  +   LFW FK+VAE+KK++TD DL AL+SDEVFQ + VWKLGDLQVTC
Sbjct  425   RLEELGYELNDDQVQTLFWCFKAVAEQKKRVTDADLRALVSDEVFQAEPVWKLGDLQVTC  484

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+LGLSTATVKL+ +D   HVACS+GTGPVD+AYKAVDL+VK  VTLLEYS+ AVTEGID
Sbjct  485   GTLGLSTATVKLLSSDGSTHVACSIGTGPVDSAYKAVDLIVKEQVTLLEYSMNAVTEGID  544

Query  1754  AIASTRVLIRGDN--SHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             AIA+TRV+IRG++  S  +THALTG  V RTFSGTGAGMD+V+SSV+AY+ ALNKM  F
Sbjct  545   AIATTRVVIRGESETSTITTHALTGETVIRTFSGTGAGMDVVVSSVKAYIAALNKMSGF  603



>ref|XP_002887519.1| hypothetical protein ARALYDRAFT_476544 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63778.1| hypothetical protein ARALYDRAFT_476544 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/563 (74%), Positives = 486/563 (86%), Gaps = 28/563 (5%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDYIPNRISDPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPA
Sbjct  68    RRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPA  127

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS+ DFEAV+ IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIA
Sbjct  128   ASKDDFEAVKTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIA  187

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IH+K+KL  S+E+V+E A +MV +ARSL C DVEFSPEDAGRS+RE+LY+ILGEVIK
Sbjct  188   TSDIHLKYKLKKSKEEVIEIARNMVRFARSLRCEDVEFSPEDAGRSEREYLYEILGEVIK  247

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVG TLP+EFGQLIADIK NT GI+NVI STHCQNDLGLSTANTL+GA++
Sbjct  248   AGATTLNIPDTVGITLPSEFGQLIADIKTNTRGIQNVISSTHCQNDLGLSTANTLSGAHS  307

Query  1022  GARQVEVTINGIGERAGNASLEEV------------VMALKCRGEQVLGGLYTGINTQHI  1165
             GARQVEVTINGIGERAGNASLEEV            VMA+KCRG+ VLGGL+TGI+T+HI
Sbjct  308   GARQVEVTINGIGERAGNASLEEVRSENLLKCYEFFVMAIKCRGDHVLGGLFTGIDTRHI  367

Query  1166  IMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQ  1345
             +M SKMVEEYTG+  QPHKAI              DGMLKHK TYEIMSPE+IGL R+N+
Sbjct  368   VMTSKMVEEYTGMQTQPHKAI--------------DGMLKHKGTYEIMSPEEIGLQRSNE  413

Query  1346  SGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEV  1525
             +GIVLGKLSGRHAL+ ++ ELGY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEV
Sbjct  414   AGIVLGKLSGRHALRDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEV  473

Query  1526  FQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVP  1705
             FQP+ VWKL D+Q+TCG+LGLST+TVKL D+D +EHVACSVGTGPVDAAYKAVDL+VK P
Sbjct  474   FQPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEP  533

Query  1706  VTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSV  1885
              TLLEYS+ AVTEGIDAIA+TRVLIRGDN+++ST+A+TG  V RTFSGTGAGMDIV+SSV
Sbjct  534   ATLLEYSMNAVTEGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSV  593

Query  1886  RAYVGALNKMLSFTTLVSRYNKT  1954
             +AYVGALNKML F    S  +KT
Sbjct  594   KAYVGALNKMLGFKEHSSTLSKT  616



>ref|XP_006664321.1| PREDICTED: 2-isopropylmalate synthase A-like [Oryza brachyantha]
Length=605

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/550 (76%), Positives = 479/550 (87%), Gaps = 6/550 (1%)
 Frame = +2

Query  287   RCGLG-APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             RC  G A  RP+Y+PNRI DP+YVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  38    RCSHGLAAARPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  97

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  98    IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  157

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  158   RPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFL  217

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+T
Sbjct  218   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLAT  277

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+
Sbjct  278   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMS  336

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GI
Sbjct  337   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGI  396

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  397   VLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  456

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             ++ W L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P  L
Sbjct  457   KVFWSLADVQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAYKAVDEIIQIPTVL  516

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV++ GD    S HALTG   NR FSG+GA MDIV+SSVRAY
Sbjct  517   REYSMTSVTEGIDAIATTRVVVTGDVID-SKHALTGQSFNRAFSGSGAAMDIVVSSVRAY  575

Query  1895  VGALNKMLSF  1924
             + ALNKM SF
Sbjct  576   LSALNKMSSF  585



>ref|XP_003578949.1| PREDICTED: 2-isopropylmalate synthase A-like [Brachypodium distachyon]
Length=633

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/559 (75%), Positives = 486/559 (87%), Gaps = 8/559 (1%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             APRRP+Y+P+RI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEAGF
Sbjct  72    APRRPEYVPDRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGF  131

Query  482   PAASEADFEAVRLIAQEVGN----GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVH  649
             PA+S  D +AVR IA EVGN    G+G HVPVICGLSRCN+RDID AWEAV+HA+KPR+H
Sbjct  132   PASSPDDLDAVRSIAIEVGNTPLGGDG-HVPVICGLSRCNKRDIDAAWEAVRHARKPRIH  190

Query  650   TFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  829
             TFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL 
Sbjct  191   TFIATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYHILE  250

Query  830   EVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  1009
             EVIKAGATTLNIPDTVGY LP EFG+LIADIKANTPGIEN IISTHCQNDLGL++ANTLA
Sbjct  251   EVIKAGATTLNIPDTVGYNLPHEFGKLIADIKANTPGIENAIISTHCQNDLGLASANTLA  310

Query  1010  GAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVE  1189
             GAYAGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGI+TQHI M+SKMV+
Sbjct  311   GAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGISTQHITMSSKMVQ  369

Query  1190  EYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKL  1369
             E++GL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R N+ GIVLGKL
Sbjct  370   EHSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLVRVNEFGIVLGKL  429

Query  1370  SGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWK  1549
             SGRHA+KTK+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W 
Sbjct  430   SGRHAVKTKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWS  489

Query  1550  LGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSL  1729
             LGD+Q TCG+LGLSTATVKLI  D EE + CSVGTGPVDAAYKAVD ++++P  L EYS+
Sbjct  490   LGDVQATCGTLGLSTATVKLIAIDGEEKIGCSVGTGPVDAAYKAVDQIIQIPTVLREYSM  549

Query  1730  TAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALN  1909
             T+VTEGIDAIA+TRV+I GD S+ S +AL G   NR+FSG+GA +D+V+SSVRAY+ ALN
Sbjct  550   TSVTEGIDAIATTRVVITGDVSN-SKNALIGQ-NNRSFSGSGAALDVVVSSVRAYLSALN  607

Query  1910  KMLSFTTLVSRYNKTEDNV  1966
             KM S+   V   ++  +++
Sbjct  608   KMSSYVGAVKASSEAPESI  626



>ref|NP_001146593.1| uncharacterized protein LOC100280189 [Zea mays]
 gb|ACL54348.1| unknown [Zea mays]
Length=641

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/555 (74%), Positives = 483/555 (87%), Gaps = 7/555 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD+IEAGFPA
Sbjct  78    RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDVIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGNGE-----GEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             +S  D +AVR IA EVGN       G HVPVICGLSRCN+RDID AWEAV+HA++PR+HT
Sbjct  138   SSPDDLDAVRSIAIEVGNPPPGDDGGAHVPVICGLSRCNRRDIDAAWEAVRHARRPRIHT  197

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATSEIHM+ KL  + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY IL E
Sbjct  198   FIATSEIHMQHKLRKTPDQVVAVAREMVAYARSLGCADVEFSPEDAGRSNREFLYHILEE  257

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTLNIPDTVGYTLP EFG+LI+DIK NTPGIEN IISTHCQNDLGL+TANTLAG
Sbjct  258   VIKAGATTLNIPDTVGYTLPYEFGKLISDIKENTPGIENAIISTHCQNDLGLATANTLAG  317

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A+AGARQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E
Sbjct  318   AHAGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQE  376

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             ++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLS
Sbjct  377   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLARANEFGIVLGKLS  436

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L
Sbjct  437   GRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSL  496

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              D+Q TCG+LGLSTATVKLI  D EE +ACSVGTGPVDAA+KAVD ++++P  L EY +T
Sbjct  497   ADVQATCGTLGLSTATVKLIGPDGEERIACSVGTGPVDAAHKAVDQIIQIPTVLREYGMT  556

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             +VTEGIDAIA+TRV++ GD ++ S HALTG+  NR+FSG+GA MDIV+SSVRAY+ ALNK
Sbjct  557   SVTEGIDAIATTRVVVTGDVANNSKHALTGHSFNRSFSGSGAAMDIVVSSVRAYLSALNK  616

Query  1913  MLSFTTLVSRYNKTE  1957
             M SF    +R + TE
Sbjct  617   MCSFAG-AARASSTE  630



>ref|XP_006663190.1| PREDICTED: 2-isopropylmalate synthase A-like [Oryza brachyantha]
Length=605

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/550 (76%), Positives = 479/550 (87%), Gaps = 6/550 (1%)
 Frame = +2

Query  287   RCGLG-APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             RC  G A  RP+Y+PNRI DP+YVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  38    RCSHGLAAARPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  97

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  98    IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  157

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  158   RPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFL  217

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+T
Sbjct  218   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLAT  277

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+
Sbjct  278   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMS  336

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GI
Sbjct  337   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGI  396

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  397   VLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  456

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             ++ W L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P  L
Sbjct  457   KVFWSLVDVQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAYKAVDEIIQIPTVL  516

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV++ GD    S HALTG   NR FSG+GA MDIV+SSVRAY
Sbjct  517   REYSMTSVTEGIDAIATTRVVVTGDVID-SKHALTGQSFNRAFSGSGAAMDIVVSSVRAY  575

Query  1895  VGALNKMLSF  1924
             + ALNKM SF
Sbjct  576   LSALNKMSSF  585



>ref|XP_002448963.1| hypothetical protein SORBIDRAFT_05g002540 [Sorghum bicolor]
 gb|EES07951.1| hypothetical protein SORBIDRAFT_05g002540 [Sorghum bicolor]
Length=620

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/539 (76%), Positives = 474/539 (88%), Gaps = 3/539 (1%)
 Frame = +2

Query  314   PDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAAS  493
             P+Y+P+RI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEAGFPA+S
Sbjct  63    PEYVPHRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPASS  122

Query  494   EADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATS  667
               D +AVR IA EVGN   EG HVPVICGLSRCN+RDID AWEAV++A++PR+HTFIATS
Sbjct  123   PDDLDAVRSIAIEVGNPVEEGAHVPVICGLSRCNKRDIDAAWEAVRNARRPRIHTFIATS  182

Query  668   EIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  847
             EIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVIKAG
Sbjct  183   EIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVIKAG  242

Query  848   ATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGA  1027
             ATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA AGA
Sbjct  243   ATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLAGARAGA  302

Query  1028  RQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLL  1207
             RQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E++GL 
Sbjct  303   RQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQEHSGLH  361

Query  1208  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHAL  1387
             VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLSGRHA+
Sbjct  362   VQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGRHAV  421

Query  1388  KTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQV  1567
             ++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L D+Q 
Sbjct  422   RSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSLADVQA  481

Query  1568  TCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEG  1747
             TCG+LGLSTATVKLI  D EE + CSVGTGPVDAAYKAVD ++++P  L EY +T+VTEG
Sbjct  482   TCGTLGLSTATVKLIAPDGEEKIGCSVGTGPVDAAYKAVDQIIQIPTVLREYGMTSVTEG  541

Query  1748  IDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             IDAIA+TRV++ GD ++ S HALTG   NR+FSG+GA MDIV+SSVRAY+ ALNKM SF
Sbjct  542   IDAIATTRVVVTGDVTNNSKHALTGQSFNRSFSGSGAAMDIVVSSVRAYLSALNKMCSF  600



>gb|ACR35826.1| unknown [Zea mays]
 tpg|DAA39219.1| TPA: 2-isopropylmalate synthase B [Zea mays]
Length=640

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/544 (75%), Positives = 476/544 (88%), Gaps = 6/544 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEAGFPA
Sbjct  78    RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGN----GEGE-HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             +S  D +AVR IA EVGN    G G  HVPVICGLSRCN++DID AWEAV+HA++PR+HT
Sbjct  138   SSPDDLDAVRSIAIEVGNPPTAGAGTAHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHT  197

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL E
Sbjct  198   FIATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEE  257

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTLNIPDTVGYTLP EFG+LIADIKANT GIEN IISTHCQNDLGL+TANTLAG
Sbjct  258   VIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTSGIENAIISTHCQNDLGLATANTLAG  317

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A +GARQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E
Sbjct  318   ARSGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQE  376

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             ++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLS
Sbjct  377   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLS  436

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L
Sbjct  437   GRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSL  496

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              D+Q TCG+LGLSTATVKLI  D EE +ACSVGTGPVDAAYKA+D ++++P  L EY +T
Sbjct  497   ADVQATCGTLGLSTATVKLIAPDGEERIACSVGTGPVDAAYKAIDQIIQIPTVLREYGMT  556

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             +VTEGIDAIA+TRV++ GD ++ S HALTG   NR+FSG+GA MDIV+SSVRAY+ ALNK
Sbjct  557   SVTEGIDAIATTRVVVTGDVTNNSKHALTGRAFNRSFSGSGAAMDIVVSSVRAYLSALNK  616

Query  1913  MLSF  1924
             M SF
Sbjct  617   MCSF  620



>ref|NP_001147962.1| LOC100281571 [Zea mays]
 gb|ACG29253.1| 2-isopropylmalate synthase B [Zea mays]
Length=640

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/544 (75%), Positives = 474/544 (87%), Gaps = 6/544 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEAGFPA
Sbjct  78    RRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPA  137

Query  488   ASEADFEAVRLIAQEVGNGEGE-----HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             +S  D +AVR IA EVGN         HVPVICGLSRCN++DID AWEAV+HA++PR+HT
Sbjct  138   SSPDDLDAVRSIAIEVGNPPTASAGTVHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHT  197

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REF+Y IL E
Sbjct  198   FIATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFMYHILEE  257

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTLNIPDTVGYTLP EFG+LIADIKANT GIEN IISTHCQNDLGL+TANTLAG
Sbjct  258   VIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTSGIENAIISTHCQNDLGLATANTLAG  317

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A +GARQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E
Sbjct  318   ARSGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQE  376

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             ++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLS
Sbjct  377   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLS  436

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L
Sbjct  437   GRHAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSL  496

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              D+Q TCG+LGLSTATVKLI  D EE +ACSVGTGPVDAAYKA+D ++++P  L EY +T
Sbjct  497   ADVQATCGTLGLSTATVKLIAPDGEERIACSVGTGPVDAAYKAIDQIIQIPTVLREYGMT  556

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             +VTEGIDAIA+TRV++ GD ++ S HALTG   NR+FSG+GA MDIV+SSVRAY+ ALNK
Sbjct  557   SVTEGIDAIATTRVVVTGDVTNNSKHALTGRAFNRSFSGSGAAMDIVVSSVRAYLSALNK  616

Query  1913  MLSF  1924
             M SF
Sbjct  617   MCSF  620



>ref|XP_004977502.1| PREDICTED: 2-isopropylmalate synthase A-like [Setaria italica]
Length=631

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/543 (75%), Positives = 474/543 (87%), Gaps = 4/543 (1%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +Y+P RI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEAGFPA+S 
Sbjct  78    EYVPGRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPASSP  137

Query  497   ADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATS  667
              D +AVR IA EVGN   GE  HVPVICGLSRCN++DID AWEAV+HA++PR+HTFIATS
Sbjct  138   DDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHTFIATS  197

Query  668   EIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAG  847
             EIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVIKAG
Sbjct  198   EIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVIKAG  257

Query  848   ATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGA  1027
             ATTLNIPDTVGYTLP EFG LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA AGA
Sbjct  258   ATTLNIPDTVGYTLPYEFGNLIADIKANTPGIENAIISTHCQNDLGLATANTLAGARAGA  317

Query  1028  RQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLL  1207
             RQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E++GL 
Sbjct  318   RQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLNGLYTGINSQHITLTSKMVQEHSGLH  376

Query  1208  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHAL  1387
             VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLSGRHA+
Sbjct  377   VQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGRHAV  436

Query  1388  KTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQV  1567
             ++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SD++FQP+++W L D+Q 
Sbjct  437   RSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDQIFQPKVIWSLADVQA  496

Query  1568  TCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEG  1747
             TCG+LGLSTATVKLI  D EE +AC VGTGPVDAAYKAVD ++++P  L EY +T+VTEG
Sbjct  497   TCGTLGLSTATVKLIAPDGEEKIACCVGTGPVDAAYKAVDEIIQIPTVLREYGMTSVTEG  556

Query  1748  IDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFT  1927
             IDAIA+TRV+I GD S+ S HALTG+  NR+FSG+GA MD+V+SSVRAY+ ALNKM SF 
Sbjct  557   IDAIATTRVIITGDLSNNSKHALTGHSFNRSFSGSGASMDVVVSSVRAYLSALNKMCSFA  616

Query  1928  TLV  1936
              +V
Sbjct  617   GVV  619



>ref|XP_004978642.1| PREDICTED: 2-isopropylmalate synthase A-like [Setaria italica]
Length=635

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/546 (75%), Positives = 474/546 (87%), Gaps = 6/546 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y+P+RI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEAGFPA
Sbjct  81    RRPEYVPSRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEAGFPA  140

Query  488   ASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +S  D +AVR IA EVGN   GE  HVPVICGLSRCN++DID AWEAV+HA++PR+HTFI
Sbjct  141   SSPDDLDAVRSIAIEVGNTPVGEEGHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHTFI  200

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             ATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL EVI
Sbjct  201   ATSEIHMQHKLRKTPEQVVAIAREMVAYARSLGCPDVEFSPEDAGRSNREFLYHILEEVI  260

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTLNIPDTVGYTLP EFG LIADIKANTPGIEN IISTHCQNDLGL+TANTLAGA 
Sbjct  261   KAGATTLNIPDTVGYTLPYEFGNLIADIKANTPGIENAIISTHCQNDLGLATANTLAGAR  320

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQ+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E++
Sbjct  321   AGARQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQEHS  379

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLSGR
Sbjct  380   GLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGR  439

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGD  1558
             HA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L  
Sbjct  440   HAVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSLAA  499

Query  1559  LQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAV  1738
             +Q TCG+LGLSTATVKLI  D EE +AC VGTGPVDAAYKAVD ++++P  L EY +T+V
Sbjct  500   VQATCGTLGLSTATVKLIAPDGEEKIACCVGTGPVDAAYKAVDEIIQIPTVLREYGMTSV  559

Query  1739  TEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             TEGIDAIA+TRV+I GD S  S HALT   +NR+FSG+GA MD+V+SSVRAY+ ALNKM 
Sbjct  560   TEGIDAIATTRVVITGDVSSNSKHALTS--LNRSFSGSGASMDVVVSSVRAYLSALNKMC  617

Query  1919  SFTTLV  1936
             SF   V
Sbjct  618   SFAGAV  623



>ref|XP_009336349.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase 1, 
chloroplastic-like [Pyrus x bretschneideri]
Length=659

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/570 (73%), Positives = 478/570 (84%), Gaps = 32/570 (6%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RPDYIPNRISDPNYVR+FDTTLRDGEQSPGA++T+KEKLD+AR+LAKLGVDIIEAGFPA+
Sbjct  73    RPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARKLAKLGVDIIEAGFPAS  132

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S+ D EAV++IA+EVGN   +  +VPVICGLSRCN+ DI  AW+AVK+AK+PR+HTFIAT
Sbjct  133   SKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNRNDIQTAWDAVKYAKRPRIHTFIAT  192

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IH+++KL  S+EQV+E A +MV +AR LGC DVEFSPEDAGRS+REFLYQILGEVIK 
Sbjct  193   SPIHLEYKLRKSKEQVIEIARNMVKFARELGCDDVEFSPEDAGRSEREFLYQILGEVIKV  252

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDTVGY +P E+ QLIADIK+NTPGI+NVIISTHCQNDLGLSTANTLAGA AG
Sbjct  253   GATTLNIPDTVGYNVPDEYSQLIADIKSNTPGIDNVIISTHCQNDLGLSTANTLAGACAG  312

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVM L CRGE VLGGLYTGINT+HI + SKMVEEYTGL
Sbjct  313   ARQLEVTINGIGERAGNASLEEVVMTLNCRGEHVLGGLYTGINTKHIYVTSKMVEEYTGL  372

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSGRHA
Sbjct  373   HVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHA  432

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL-  1561
             L+ ++ ELGY+++  +   +F  FK+VAE+KK ITD DL AL+ DEVFQP++VWKL DL 
Sbjct  433   LRNRLAELGYELEDDQLATVFEHFKAVAEQKKIITDADLGALVRDEVFQPEVVWKLHDLQ  492

Query  1562  -----------------------------QVTCGSLGLSTATVKLIDADDEEHVACSVGT  1654
                                          QVTCG+LGLSTATVKLIDAD  EHVACSVGT
Sbjct  493   VFRDSVLPCSLSARXVLRVDHLXFIGLDAQVTCGTLGLSTATVKLIDADGREHVACSVGT  552

Query  1655  GPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVN  1834
             GPVD+AYKAVDL+VK PVTL+EYS+ A+TEG DAIA+TRV+IR +N    THA TG  V 
Sbjct  553   GPVDSAYKAVDLIVKEPVTLIEYSMNAITEGNDAIATTRVVIRPENRRMITHAHTGESVQ  612

Query  1835  RTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             RTFSG GAGMDIV+SSV+AY+GALNKM+ F
Sbjct  613   RTFSGIGAGMDIVVSSVKAYIGALNKMIGF  642



>gb|ACG29264.1| 2-isopropylmalate synthase B [Zea mays]
Length=642

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/552 (74%), Positives = 478/552 (87%), Gaps = 7/552 (1%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD+IEAGFPA+S 
Sbjct  82    EYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDVIEAGFPASSP  141

Query  497   ADFEAVRLIAQEVGNGE-----GEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
              D +AVR IA EVGN       G HVPVICGLSRCN+RDID AWEAV+HA++PR+HTFIA
Sbjct  142   DDLDAVRSIAIEVGNPPPGDDGGAHVPVICGLSRCNRRDIDAAWEAVRHARRPRIHTFIA  201

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHM+ KL  + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY IL EVIK
Sbjct  202   TSEIHMQHKLRKTPDQVVAVAREMVAYARSLGCADVEFSPEDAGRSNREFLYHILEEVIK  261

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
              GATTLNIPDTVGYTLP EFG+LI+DIK NTPGIEN IISTHCQNDLGL+TANTLAGA A
Sbjct  262   VGATTLNIPDTVGYTLPYEFGKLISDIKENTPGIENAIISTHCQNDLGLATANTLAGARA  321

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GA+Q+EVTINGIGERAGNASLEEVVMA+KCRGE +L GLYTGIN+QHI + SKMV+E++G
Sbjct  322   GAQQLEVTINGIGERAGNASLEEVVMAIKCRGE-LLDGLYTGINSQHITLTSKMVQEHSG  380

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLSGRH
Sbjct  381   LHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLARANEFGIVLGKLSGRH  440

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             A+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP+++W L D+
Sbjct  441   AVRSKLVELGYEISDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVIWSLADV  500

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             Q TCG+LGLSTATVKLI  D EE +ACSVGTGPVDAAYKAVD ++++P  L EY +T+VT
Sbjct  501   QATCGTLGLSTATVKLIGPDGEERIACSVGTGPVDAAYKAVDQIIQIPTVLREYGMTSVT  560

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRV++ GD ++ S HALTG+  NR+FSG+GA MDIV+SSVRAY+ ALNKM S
Sbjct  561   EGIDAIATTRVVVTGDVANNSKHALTGHSFNRSFSGSGAAMDIVVSSVRAYLSALNKMCS  620

Query  1922  FTTLVSRYNKTE  1957
             F    +R + TE
Sbjct  621   FAG-AARASSTE  631



>ref|XP_002442681.1| hypothetical protein SORBIDRAFT_08g001160 [Sorghum bicolor]
 gb|EES16519.1| hypothetical protein SORBIDRAFT_08g001160 [Sorghum bicolor]
Length=633

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/549 (74%), Positives = 473/549 (86%), Gaps = 10/549 (2%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ +KL VARQLA+LGVDIIEAGFPA+S 
Sbjct  70    EYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAQKLVVARQLARLGVDIIEAGFPASSP  129

Query  497   ADFEAVRLIAQEVGN---------GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVH  649
              D +AVR IA EVGN          +  HVPVICGLSRCN++DID AWEAV+HA++PR+H
Sbjct  130   DDLDAVRSIAIEVGNPAPAGDDGGADATHVPVICGLSRCNRKDIDAAWEAVRHARRPRIH  189

Query  650   TFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILG  829
             TFIATS+IHM+ KL  + EQV   A  MVAYARSLGC+DVEFSPEDAGRS+REFLY ILG
Sbjct  190   TFIATSDIHMQHKLRKTPEQVAAIARDMVAYARSLGCTDVEFSPEDAGRSNREFLYHILG  249

Query  830   EVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA  1009
             EVIKAGATTLNIPDTVGY LP EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTLA
Sbjct  250   EVIKAGATTLNIPDTVGYNLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTLA  309

Query  1010  GAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVE  1189
             GA AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGI+++HI + SKMV+
Sbjct  310   GARAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLNGLYTGIDSRHITLTSKMVQ  368

Query  1190  EYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKL  1369
             E++GL+VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKL
Sbjct  369   EHSGLIVQPHKAIVGANAFAHESGIHQDGMLKNKGTYEIISPDDIGLTRANEFGIVLGKL  428

Query  1370  SGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWK  1549
             SGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+DL AL+SDE+FQP+L+W 
Sbjct  429   SGRHAVRSKLVELGYEIGDKEFEDFFKRYKEVAEKKKRVTDEDLEALLSDEIFQPKLIWS  488

Query  1550  LGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSL  1729
             L D+Q TCG+L LSTATVKLI  D EE +ACSVGTGPVDAAYKAVD ++++P  L EYS+
Sbjct  489   LADVQATCGTLSLSTATVKLIGPDGEERIACSVGTGPVDAAYKAVDQIIQIPTVLREYSM  548

Query  1730  TAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALN  1909
             T+VTEGIDAIA+TRV++ GD S  + HALTG   NR+FSG+GA MDIV+SSVRAY+ ALN
Sbjct  549   TSVTEGIDAIATTRVVVTGDVSINAKHALTGRSFNRSFSGSGASMDIVVSSVRAYLSALN  608

Query  1910  KMLSFTTLV  1936
             K+ SF   V
Sbjct  609   KICSFAGAV  617



>ref|XP_001775199.1| predicted protein [Physcomitrella patens]
 gb|EDQ59935.1| predicted protein [Physcomitrella patens]
Length=583

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/551 (74%), Positives = 474/551 (86%), Gaps = 3/551 (1%)
 Frame = +2

Query  281   VVRCGLGAPR-RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLG  457
             +++C   A R RP Y+PNRI DP YVR+FDTTLRDGEQSPGATMT+KEKLD+ARQLA+LG
Sbjct  11    LIQCNGSALRKRPQYVPNRIDDPAYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLARLG  70

Query  458   VDIIEAGFPAASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHA  631
             VDIIEAGFP AS  D EAVRLIA+EVGN   E  +VPVICGLSRCN++DID AWEAVK+A
Sbjct  71    VDIIEAGFPIASPDDLEAVRLIAKEVGNQVDEDGYVPVICGLSRCNKKDIDAAWEAVKYA  130

Query  632   KKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREF  811
              +PR+HTFIATSEIHM  KL  + +QVV+ A  MVAYARSLGC D+EFSPEDAGRSD EF
Sbjct  131   VRPRIHTFIATSEIHMVHKLKKTPDQVVQIARDMVAYARSLGCEDIEFSPEDAGRSDPEF  190

Query  812   LYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLS  991
             LY+IL EVIKAGATTLNIPDTVGYTLP+EFG LI  +KANTPG E VI STHCQNDLGL+
Sbjct  191   LYRILAEVIKAGATTLNIPDTVGYTLPSEFGSLIGKLKANTPGAEKVIFSTHCQNDLGLA  250

Query  992   TANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIM  1171
             TANTLAGA+AGARQVEVTINGIGERAGNASLEEVVMAL+CRG++ LGGL+TG+NT+HI +
Sbjct  251   TANTLAGAHAGARQVEVTINGIGERAGNASLEEVVMALRCRGQEQLGGLFTGLNTKHIAV  310

Query  1172  ASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSG  1351
             AS+MV +YTG++VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI++PEDIGL RA+ SG
Sbjct  311   ASRMVADYTGMVVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEILAPEDIGLVRADASG  370

Query  1352  IVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQ  1531
             IVLGKLSGRHALK ++ +LGY+IDG++ DD+F RFK+VAEKKK ++DDDL  L+SDEVFQ
Sbjct  371   IVLGKLSGRHALKQRLNQLGYEIDGQDLDDVFKRFKAVAEKKKNVSDDDLEILLSDEVFQ  430

Query  1532  PQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVT  1711
             P+ +W +G +QV CG+ GLSTATVKL+  D  EH+  SVGTGPVDAAYKAVD +VK PVT
Sbjct  431   PETLWSVGLIQVVCGTSGLSTATVKLVGPDGVEHIGMSVGTGPVDAAYKAVDTIVKAPVT  490

Query  1712  LLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRA  1891
             LLEYS+ AVTEGIDAIA TRV IR  +  T T+  TG+ V R++SGTGA  D+V+SSVRA
Sbjct  491   LLEYSMHAVTEGIDAIAHTRVQIRALDPLTVTNPQTGSQVPRSYSGTGAAEDVVVSSVRA  550

Query  1892  YVGALNKMLSF  1924
             Y+ ALNKML+F
Sbjct  551   YISALNKMLTF  561



>ref|XP_010035134.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase 2, 
chloroplastic-like [Eucalyptus grandis]
Length=515

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/511 (78%), Positives = 460/511 (90%), Gaps = 2/511 (0%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGNGEGEH--VPVICGLS  580
             MT+KEKLD+ARQLAKLGVDIIEAGFPAAS  DF AV+ IA EVGN    H  VPVICGLS
Sbjct  1     MTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVICGLS  60

Query  581   RCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGC  760
             RCN++DI  AW+AV+ A++PR+HTFIATS IHM++KL  S+++V++ A  MVA+ARSLGC
Sbjct  61    RCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARSLGC  120

Query  761   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPG  940
             +DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKANTPG
Sbjct  121   NDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKANTPG  180

Query  941   IENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGE  1120
             IENVIISTHCQNDLGLSTANT+AGA AGARQVEVTINGIGERAGNASLEEVVMALKC+G 
Sbjct  181   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGG  240

Query  1121  QVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1300
              +LGGLYTGINT+HI+M SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  241   SILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  300

Query  1301  EIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK  1480
             EI+SP+DIGL R N++GIVLGKLSGRHALK K+ ELGYDIDG++ D++FWRFK+VAE+KK
Sbjct  301   EIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAEQKK  360

Query  1481  KITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGP  1660
             ++TD D+ AL+SDEVFQP +VWKL DLQVTCG+LGLST TVKLI AD +EH+AC+VGTGP
Sbjct  361   RVTDADIRALVSDEVFQPTVVWKLHDLQVTCGTLGLSTXTVKLISADGKEHIACAVGTGP  420

Query  1661  VDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRT  1840
             VD+AYKAVDL+VKVP TLLEYS+TAVTEGIDAIA+TRVLIRG+N+H ST ALTG  ++RT
Sbjct  421   VDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHISTLALTGETIHRT  480

Query  1841  FSGTGAGMDIVISSVRAYVGALNKMLSFTTL  1933
             FSG G+ MDI +SSVRAY+GALNKML F  L
Sbjct  481   FSGIGSSMDITVSSVRAYIGALNKMLGFMEL  511



>gb|KCW87848.1| hypothetical protein EUGRSUZ_A00249 [Eucalyptus grandis]
Length=524

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/522 (77%), Positives = 468/522 (90%), Gaps = 3/522 (1%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGNGEGEH--VPVICGLS  580
             MT+KEKLD+ARQLAKLGVDIIEAGFPAAS  DF AV+ IA EVGN    H  VPVICGLS
Sbjct  1     MTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVICGLS  60

Query  581   RCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGC  760
             RCN++DI  AW+AV+ A++PR+HTFIATS IHM++KL  S+++V++ A  MVA+AR LGC
Sbjct  61    RCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARRLGC  120

Query  761   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPG  940
             +DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKANTPG
Sbjct  121   NDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKANTPG  180

Query  941   IENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGE  1120
             IENVIISTHCQNDLGLSTANT+AGA AGARQVEVTINGIGERAGNASLEEVVMALKC+G 
Sbjct  181   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGG  240

Query  1121  QVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1300
              +LGGLYTGINT+HI+M SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  241   SILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  300

Query  1301  EIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK  1480
             EI+SP+DIGL R N++GIVLGKLSGRHALK K+ ELGYDIDG++ D++FWRFK+VAE+KK
Sbjct  301   EIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAEQKK  360

Query  1481  KITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGP  1660
             ++TD D+ AL+SDEVFQP +VWKL DLQVTCG+LGLSTATVKLI A+ +EH+AC+VGTGP
Sbjct  361   RVTDADIRALVSDEVFQPTVVWKLHDLQVTCGTLGLSTATVKLISAEGKEHIACAVGTGP  420

Query  1661  VDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRT  1840
             VD+AYKAVDL+VKVP TLLEYS+TAVTEGIDAIA+TRVLIRG+N+HTST ALTG  ++RT
Sbjct  421   VDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHTSTLALTGETIHRT  480

Query  1841  FSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNKTEDNV  1966
             FSG G+ MDI +SSVRAY+GALNKML F  L +  ++ +DN+
Sbjct  481   FSGIGSSMDITVSSVRAYIGALNKMLGFMEL-TPLHQCDDNM  521



>ref|NP_001146891.1| 2-isopropylmalate synthase B [Zea mays]
 gb|ACG24230.1| 2-isopropylmalate synthase B [Zea mays]
Length=624

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/546 (74%), Positives = 474/546 (87%), Gaps = 7/546 (1%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ +KL VARQLA+LGVDIIEAGFPA+S 
Sbjct  64    EYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAQKLVVARQLARLGVDIIEAGFPASSP  123

Query  497   ADFEAVRLIAQEVGN----GEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
              D +AVR IA EVGN    GE    HVPVICGLSRCN+RDID AWEAV+HA++PR+HTFI
Sbjct  124   DDLDAVRSIAIEVGNPAPAGEDAAVHVPVICGLSRCNRRDIDAAWEAVRHARRPRIHTFI  183

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             ATS+IHM+ KL  + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY ILGEVI
Sbjct  184   ATSDIHMQHKLRKTPDQVVAIAREMVAYARSLGCTDVEFSPEDAGRSNREFLYHILGEVI  243

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTLNIPDTVGY LP EFG+LIADIKANTPGIE  IISTHCQNDLGL+TANTLAGA 
Sbjct  244   KAGATTLNIPDTVGYNLPYEFGKLIADIKANTPGIEKAIISTHCQNDLGLATANTLAGAR  303

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGI+++HI + SKMV+E++
Sbjct  304   AGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLDGLYTGIDSRHITLTSKMVQEHS  362

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLSGR
Sbjct  363   GLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLSGR  422

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGD  1558
             HA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+DL AL+SDE+FQP+++W L D
Sbjct  423   HAVRSKLVELGYEIGDKEFEDFFKRYKEVAEKKKRVTDEDLEALLSDEIFQPKVIWSLAD  482

Query  1559  LQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAV  1738
             +Q TCG+L LSTATVKLI  D EE +ACSVGTGPVDAAYKAVD ++++P  L EYS+T+V
Sbjct  483   VQATCGTLALSTATVKLIAPDGEEKIACSVGTGPVDAAYKAVDKIIQIPTVLREYSMTSV  542

Query  1739  TEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             TEGIDAIA+TRV++ GD S+ + HALTG   NR+FSG+GA MDIV+SSVRAY+ ALNK+ 
Sbjct  543   TEGIDAIATTRVVVTGDVSNNAKHALTGQSFNRSFSGSGASMDIVVSSVRAYLSALNKIC  602

Query  1919  SFTTLV  1936
             SF   V
Sbjct  603   SFAGAV  608



>emb|CBX25373.1| hypothetical_protein [Oryza brachyantha]
Length=553

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/546 (75%), Positives = 468/546 (86%), Gaps = 16/546 (3%)
 Frame = +2

Query  296   LGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEA  475
             + APRRP+Y+PNRI DP+YVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVDIIEA
Sbjct  1     MAAPRRPEYVPNRIDDPSYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVDIIEA  60

Query  476   GFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRV  646
             GFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA++PR+
Sbjct  61    GFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHARRPRI  120

Query  647   HTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  826
             HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFLY IL
Sbjct  121   HTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFLYHIL  180

Query  827   GEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  1006
              EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+TANTL
Sbjct  181   EEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLATANTL  240

Query  1007  AGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMV  1186
             AGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+SKMV
Sbjct  241   AGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMSSKMV  299

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGK  1366
             +E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGK
Sbjct  300   QEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGK  359

Query  1367  LSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVW  1546
             L            LGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP++ W
Sbjct  360   L-----------RLGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQPKVFW  408

Query  1547  KLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYS  1726
              L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P  L EYS
Sbjct  409   SLADVQATCGTLGLSTATVKLIAPDGEEKIACAVGTGPVDAAYKAVDEIIQIPTVLREYS  468

Query  1727  LTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGAL  1906
             +T+VTEGIDAIA+TRV++ GD    S HALTG   NR FSG+GA MDIV+SSVRAY+ AL
Sbjct  469   MTSVTEGIDAIATTRVVVTGDVID-SKHALTGQSFNRAFSGSGAAMDIVVSSVRAYLSAL  527

Query  1907  NKMLSF  1924
             NKM SF
Sbjct  528   NKMSSF  533



>gb|ACN29300.1| unknown [Zea mays]
 gb|AFW55822.1| 2-isopropylmalate synthase B [Zea mays]
Length=626

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/548 (74%), Positives = 475/548 (87%), Gaps = 9/548 (2%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             DY+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ +KL VARQLA+LGVDIIEAGFPA+S 
Sbjct  64    DYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAQKLVVARQLARLGVDIIEAGFPASSP  123

Query  497   ADFEAVRLIAQEVGN------GEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
              D +AVR IA EVGN      GE +  HVPVICGLSRCN++DID AWEAV+HA++PR+HT
Sbjct  124   DDLDAVRSIAIEVGNPAPGPAGEEDAVHVPVICGLSRCNRKDIDAAWEAVRHARRPRIHT  183

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATS+IHM+ KL  + +QVV  A  MVAYARSLGC+DVEFSPEDAGRS+REFLY ILGE
Sbjct  184   FIATSDIHMQHKLRKTPDQVVAIAREMVAYARSLGCTDVEFSPEDAGRSNREFLYHILGE  243

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTLNIPDTVGY LP EFG+LIADIKANTPGIE  IISTHCQNDLGL+TANTLAG
Sbjct  244   VIKAGATTLNIPDTVGYNLPYEFGKLIADIKANTPGIEKAIISTHCQNDLGLATANTLAG  303

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +L GLYTGI+++HI + SKMV+E
Sbjct  304   ARAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLDGLYTGIDSRHITLTSKMVQE  362

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             ++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GIVLGKLS
Sbjct  363   HSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGIVLGKLS  422

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+DL AL+SDE+FQP+++W L
Sbjct  423   GRHAVRSKLVELGYEIGDKEFEDFFKRYKEVAEKKKRVTDEDLEALLSDEIFQPKVIWSL  482

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              D+Q TCG+L LSTATVKL+  D EE +ACSVGTGPVDAAYKAVD ++++P  L EYS+T
Sbjct  483   ADVQATCGTLALSTATVKLVAPDGEEKIACSVGTGPVDAAYKAVDKIIQIPTVLREYSMT  542

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
             +VTEGIDAIA+TRV++ GD S+ + HALTG   NR+FSG+GA MDIV+SSVRAY+ ALNK
Sbjct  543   SVTEGIDAIATTRVVVTGDVSNNAKHALTGQSFNRSFSGSGASMDIVVSSVRAYLSALNK  602

Query  1913  MLSFTTLV  1936
             + SF   V
Sbjct  603   ICSFAGAV  610



>ref|XP_001761198.1| predicted protein [Physcomitrella patens]
 gb|EDQ73920.1| predicted protein [Physcomitrella patens]
Length=616

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/550 (74%), Positives = 473/550 (86%), Gaps = 3/550 (1%)
 Frame = +2

Query  284   VRC-GLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGV  460
             ++C G    +RP YIPNRI DP+YVR+FDTTLRDGEQSPGATMT+KEKLD+ARQLA+LGV
Sbjct  45    IQCQGAQHKKRPQYIPNRIDDPSYVRIFDTTLRDGEQSPGATMTSKEKLDIARQLARLGV  104

Query  461   DIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             DIIEAGFP AS  D EAVRLIA+EVGN   +  +VPVICGLSRCN++DID AWEAVK+A 
Sbjct  105   DIIEAGFPIASPDDLEAVRLIAKEVGNNVDDDGYVPVICGLSRCNKKDIDAAWEAVKYAV  164

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PR+HTFIATSEIHM  KL  S E+VV+ A  MVAYARSLGC D+EFSPEDAGRSD EFL
Sbjct  165   RPRIHTFIATSEIHMVHKLKKSPEEVVQIARDMVAYARSLGCEDIEFSPEDAGRSDPEFL  224

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y+IL EVIKAGATTLNIPDTVGYTLP+EFG LIA +KANTPG + VI STHCQNDLGL+T
Sbjct  225   YRILEEVIKAGATTLNIPDTVGYTLPSEFGGLIAKLKANTPGADKVIFSTHCQNDLGLAT  284

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQVEVTINGIGERAGNASLEEVVMAL+CRG++ LGGLYTG+NT+HI +A
Sbjct  285   ANTLAGAHAGARQVEVTINGIGERAGNASLEEVVMALRCRGQERLGGLYTGLNTKHIAVA  344

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             S+MV +YTG++VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SP+DIGL RA+ SGI
Sbjct  345   SRMVADYTGMVVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEILSPDDIGLVRADASGI  404

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHALK ++ +LGY++DG+E DD+F RFK+VAEKKK ++++DL  L+ DEVFQP
Sbjct  405   VLGKLSGRHALKQRLNQLGYEVDGQELDDVFKRFKAVAEKKKNVSNEDLETLLFDEVFQP  464

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             + +W LG +QV CG+ G+STATVKL   D  +H+  SVGTGPVDAAYKAVD +VK PVTL
Sbjct  465   ETLWSLGLIQVVCGNAGISTATVKLEGPDGAQHIGMSVGTGPVDAAYKAVDTIVKAPVTL  524

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
             LEYSL +VTEGIDA+A TRV IR  +S T THA T + V RT+SGTGA  D+V+SS RAY
Sbjct  525   LEYSLNSVTEGIDALAHTRVQIRALDSLTVTHAQTDSQVPRTYSGTGASEDVVVSSCRAY  584

Query  1895  VGALNKMLSF  1924
             + ALNKML+F
Sbjct  585   ISALNKMLTF  594



>emb|CBX24424.1| hypothetical_protein [Oryza glaberrima]
Length=622

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/553 (74%), Positives = 470/553 (85%), Gaps = 20/553 (4%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VR  +  PRRP+Y+PNRI DPNYVRVFDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  64    VRASMAQPRRPEYVPNRIDDPNYVRVFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  123

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  124   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  183

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR-SDREF  811
             +PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGR S+REF
Sbjct  184   RPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRRSNREF  243

Query  812   LYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLS  991
             LY IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+
Sbjct  244   LYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLA  303

Query  992   TANTLAGAYAGARQVEVTINGIGERAGNASLEE-VVMALKCRGEQVLGGLYTGINTQHII  1168
             TANTLAGA+AGARQ+EVTINGIGERAGNASLEE VVMA+KCR E +LGGLYTGINTQHI 
Sbjct  304   TANTLAGAHAGARQLEVTINGIGERAGNASLEEEVVMAIKCRRE-LLGGLYTGINTQHIT  362

Query  1169  MASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS  1348
             M+SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ 
Sbjct  363   MSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEF  422

Query  1349  GIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVF  1528
             GIVLGKL            +GY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+F
Sbjct  423   GIVLGKL------------IGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIF  470

Query  1529  QPQLVWKLGDL-QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVP  1705
             QP++ W L D+ Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P
Sbjct  471   QPKVFWSLADVQQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDAAYKAVDDIIQIP  530

Query  1706  VTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSV  1885
               L EYS+T+VTEGIDAIA+TRV++ GD S  S HALTG   +R FSG+GA +DIV+SSV
Sbjct  531   TVLREYSMTSVTEGIDAIATTRVVVTGDVSD-SKHALTGRSFSRAFSGSGASLDIVVSSV  589

Query  1886  RAYVGALNKMLSF  1924
             RAY+ ALNKM SF
Sbjct  590   RAYLSALNKMSSF  602



>gb|ABG21878.1| 2-isopropylmalate synthase B, putative, expressed [Oryza sativa 
Japonica Group]
Length=589

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/523 (76%), Positives = 458/523 (88%), Gaps = 5/523 (1%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VR  +  PRRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  68    VRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  127

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEAV+HA+
Sbjct  128   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAVRHAR  187

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
             +PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  188   RPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFL  247

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+T
Sbjct  248   YHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLAT  307

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+
Sbjct  308   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMS  366

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GI
Sbjct  367   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGI  426

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  427   VLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  486

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             ++ W L D+Q TCG+LGLSTATVKLI  D +E +AC+VGTGPVDAAYKAVD ++++P  L
Sbjct  487   KVFWSLADVQATCGTLGLSTATVKLIGPDGDEKIACAVGTGPVDAAYKAVDDIIQIPTVL  546

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTF  1843
              EYS+T+VTEGIDAIA+TRV++ GD S  S HALTG+  NR F
Sbjct  547   REYSMTSVTEGIDAIATTRVVVTGDVS-DSKHALTGHSFNRAF  588



>gb|EEC67654.1| hypothetical protein OsI_35067 [Oryza sativa Indica Group]
Length=609

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/550 (73%), Positives = 461/550 (84%), Gaps = 26/550 (5%)
 Frame = +2

Query  284   VRCGLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVD  463
             VR  +  PRRP+Y+PNRI DPNYVR+FDTTLRDGEQSPGATMT+ EKL VARQLA+LGVD
Sbjct  63    VRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQLARLGVD  122

Query  464   IIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAK  634
             IIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGLSRCN+RDID AWEA K  K
Sbjct  123   IIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAWEAHKLRK  182

Query  635   KPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFL  814
              P                     EQVV  A  MVAYARSLGC DVEFSPEDAGRS+REFL
Sbjct  183   TP---------------------EQVVAIAKEMVAYARSLGCPDVEFSPEDAGRSNREFL  221

Query  815   YQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLST  994
             Y IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTPGIEN IISTHCQNDLGL+T
Sbjct  222   YHILKEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQNDLGLAT  281

Query  995   ANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMA  1174
             ANTLAGA+AGARQ+EVTINGIGERAGNASLEEVVMA+KCR E +LGGLYTGINTQHI M+
Sbjct  282   ANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRE-LLGGLYTGINTQHITMS  340

Query  1175  SKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGI  1354
             SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SP+DIGL RAN+ GI
Sbjct  341   SKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTRANEFGI  400

Query  1355  VLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQP  1534
             VLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKKK++TD+D+ AL+SDE+FQP
Sbjct  401   VLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLSDEIFQP  460

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
             ++ W L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTGPVDAAYKAVD ++++P  L
Sbjct  461   KVFWSLADVQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDAAYKAVDDIIQIPTVL  520

Query  1715  LEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAY  1894
              EYS+T+VTEGIDAIA+TRV++ GD S  S HALTG+  +R FSG+GA +DIV+SSVRAY
Sbjct  521   REYSMTSVTEGIDAIATTRVVVTGDVSD-SKHALTGHSFSRAFSGSGAALDIVVSSVRAY  579

Query  1895  VGALNKMLSF  1924
             + ALNKM SF
Sbjct  580   LSALNKMSSF  589



>ref|XP_009368425.1| PREDICTED: LOW QUALITY PROTEIN: 2-isopropylmalate synthase 2, 
chloroplastic-like [Pyrus x bretschneideri]
Length=632

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/560 (72%), Positives = 462/560 (83%), Gaps = 32/560 (6%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RPDYIPNRISDPNYVR+FDTTLRDGEQSPGA++T+KEKLD+AR+LAKLGVDIIEAGFPA+
Sbjct  73    RPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARKLAKLGVDIIEAGFPAS  132

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S+ D EAV++IA+EVGN   +  +VPVICGLSRCN+ DI  AW+AVK+AK+PR+HTFIAT
Sbjct  133   SKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNRNDIQTAWDAVKYAKRPRIHTFIAT  192

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IH+++KL  S+EQV+E A +MV +AR LGC DVEFSPEDAGRS+REFLYQILGEVIK 
Sbjct  193   SPIHLEYKLRKSKEQVIEIARNMVKFARELGCDDVEFSPEDAGRSEREFLYQILGEVIKV  252

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDTVGY +P E+ QLIADIK+NTPGI+NVIISTHCQNDLGLSTANTLAGA AG
Sbjct  253   GATTLNIPDTVGYNVPDEYSQLIADIKSNTPGIDNVIISTHCQNDLGLSTANTLAGACAG  312

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVM L CRGE VLGGLYTGINT+HI + SKMVEEYTGL
Sbjct  313   ARQLEVTINGIGERAGNASLEEVVMTLNCRGEHVLGGLYTGINTKHIYVTSKMVEEYTGL  372

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSGRHA
Sbjct  373   HVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHA  432

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL-  1561
             L+ ++ ELGY+++  +   +F  FK+VAE+KK ITD DL AL+ DEVFQP++VWKL DL 
Sbjct  433   LRNRLAELGYELEDDQLATVFEHFKAVAEQKKIITDADLGALVRDEVFQPEVVWKLHDLQ  492

Query  1562  -----------------------------QVTCGSLGLSTATVKLIDADDEEHVACSVGT  1654
                                          QVTCG+LGLSTATVKLIDAD  EHVACSVGT
Sbjct  493   VFRDSVLPCSLSARXVLRVDHLXFIGLDAQVTCGTLGLSTATVKLIDADGREHVACSVGT  552

Query  1655  GPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVN  1834
             GPVD+AYKAVDL+VK PVTL+EYS+ AVTEG D+IA+TRV+IR +N    THA TG  V 
Sbjct  553   GPVDSAYKAVDLIVKEPVTLVEYSMNAVTEGNDSIATTRVVIRPENKRMITHAHTGESVQ  612

Query  1835  RTFSGTGAGMDIVISSVRAY  1894
             RTFSG  AGM +V     A+
Sbjct  613   RTFSGVAAGMSLVSRHTSAH  632



>gb|KCW87662.1| hypothetical protein EUGRSUZ_A00052 [Eucalyptus grandis]
Length=519

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/515 (76%), Positives = 454/515 (88%), Gaps = 6/515 (1%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGNGEGEH--VPVICGLS  580
             MT+KEKLD+ARQLAKLGVDIIEAGFPAAS  DF AV+ IA EVGN    H  VPVICGLS
Sbjct  1     MTSKEKLDIARQLAKLGVDIIEAGFPAASPDDFGAVKAIALEVGNAVDPHGYVPVICGLS  60

Query  581   RCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGC  760
             RCN++DI  AW+AV+ A++PR+HTFIATS IHM++KL  S+++V++ A  MVA+ARSLGC
Sbjct  61    RCNEKDIQAAWDAVRFARRPRIHTFIATSAIHMQYKLKKSKQEVIDIARRMVAFARSLGC  120

Query  761   SDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPG  940
             +DVEFSPEDAGRS+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIKANTPG
Sbjct  121   NDVEFSPEDAGRSEREFLYEILGEVIKAGATTLNIPDTVGITMPQEFGKLIADIKANTPG  180

Query  941   IENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGE  1120
             IENVIISTHCQNDLGLSTANT+AGA AGARQVEVTINGIGERAGNASLEEVVMALKC+G 
Sbjct  181   IENVIISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGG  240

Query  1121  QVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTY  1300
              +LGGLYTGINT+HI+M SKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLKHK TY
Sbjct  241   SILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTY  300

Query  1301  EIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK  1480
             EI+SP+DIGL R N++GIVLGKLSGRHALK K+ ELGYDIDG++ D++FWRFK+VAE+KK
Sbjct  301   EIISPDDIGLERTNEAGIVLGKLSGRHALKMKLVELGYDIDGEQLDNIFWRFKAVAEQKK  360

Query  1481  KITDDDLIALISDEVFQPQLVWKLGDL-QVTCG---SLGLSTATVKLIDADDEEHVACSV  1648
             ++TD D+ AL+SDEVFQP +VWKL DL Q+ C     L +   TVKLI AD +EH+AC+V
Sbjct  361   RVTDADIRALVSDEVFQPTVVWKLHDLQQMPCMLHVELLVCRRTVKLISADGKEHIACAV  420

Query  1649  GTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNV  1828
             GTGPVD+AYKAVDL+VKVP TLLEYS+TAVTEGIDAIA+TRVLIRG+N+H ST ALTG  
Sbjct  421   GTGPVDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRGENNHISTLALTGET  480

Query  1829  VNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTL  1933
             ++RTFSG G+ MDI +SSVRAY+GALNKML F  L
Sbjct  481   IHRTFSGIGSSMDITVSSVRAYIGALNKMLGFMEL  515



>ref|XP_002980035.1| hypothetical protein SELMODRAFT_111991 [Selaginella moellendorffii]
 gb|EFJ18905.1| hypothetical protein SELMODRAFT_111991 [Selaginella moellendorffii]
Length=610

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/545 (72%), Positives = 465/545 (85%), Gaps = 2/545 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             +RP Y+P+RI DP+YVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFP 
Sbjct  48    KRPIYVPSRIDDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPI  107

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS  D  AV+ IA +VGN   +  +VPVICGLSRCN+ DI  AWEAV HA +PR+HTFIA
Sbjct  108   ASPDDLLAVKGIALDVGNRVDDDGYVPVICGLSRCNKADIAAAWEAVSHALRPRIHTFIA  167

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHMK KL  S ++VV+ AT MV YA+SLGC D+EFSPEDAGRSD EFLY+IL EVIK
Sbjct  168   TSEIHMKHKLRKSPDEVVQIATDMVGYAKSLGCQDIEFSPEDAGRSDPEFLYRILAEVIK  227

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYTLP+EFG+LIA IK NTPG +NV+ISTHCQNDLGL+TANTLAGAYA
Sbjct  228   AGATTLNIPDTVGYTLPSEFGRLIAMIKENTPGSQNVVISTHCQNDLGLATANTLAGAYA  287

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+EVTINGIGERAGNASLEEVVMA++CRG++ L GL+TGI  +HI + S+MV +YTG
Sbjct  288   GARQLEVTINGIGERAGNASLEEVVMAIRCRGDEQLNGLHTGIKPKHIAVTSRMVSDYTG  347

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             + VQPHKAIVGANAFAHESGIHQDGMLK K TYEIM PEDIGL RA+++GIVLGK SGRH
Sbjct  348   MTVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIMCPEDIGLVRADEAGIVLGKHSGRH  407

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALKT++ +LGY+++ K+ DD+F RFK+VA+KKK ++D DL AL+SDEVFQP++VW L DL
Sbjct  408   ALKTRLSQLGYELESKKLDDVFKRFKAVADKKKSLSDVDLEALLSDEVFQPEVVWALLDL  467

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QV CG+LGLSTATVKL   D+ + V  S+GTGPVDAAYKAVD +V++PVTLLEYS+ AVT
Sbjct  468   QVVCGTLGLSTATVKLSGPDNIQRVGTSIGTGPVDAAYKAVDSIVQIPVTLLEYSMNAVT  527

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRV+IR +NS   THA +   V R+FSG+GA  D+ +SSVRAYV ALNK++ 
Sbjct  528   EGIDAIANTRVVIRAENSTPVTHAQSTEPVQRSFSGSGASEDVTVSSVRAYVSALNKVIG  587

Query  1922  FTTLV  1936
             F+  V
Sbjct  588   FSKAV  592



>ref|XP_002992921.1| hypothetical protein SELMODRAFT_187069 [Selaginella moellendorffii]
 gb|EFJ06010.1| hypothetical protein SELMODRAFT_187069 [Selaginella moellendorffii]
Length=610

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/545 (72%), Positives = 465/545 (85%), Gaps = 2/545 (0%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             +RP Y+P+RI DP+YVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFP 
Sbjct  48    KRPIYVPSRIDDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPI  107

Query  488   ASEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS  D  AV+ IA +VGN   +  +VPVICGLSRCN+ DI  AWEAV HA +PR+HTFIA
Sbjct  108   ASPDDLLAVKGIALDVGNRVDDDGYVPVICGLSRCNKADIAAAWEAVSHALRPRIHTFIA  167

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TSEIHMK KL  S ++VV+ AT MV YA+SLGC D+EFSPEDAGRSD EFLY+IL EVIK
Sbjct  168   TSEIHMKHKLRKSPDEVVQIATDMVGYAKSLGCQDIEFSPEDAGRSDPEFLYRILAEVIK  227

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGYTLP+EFG+LIA IK NTPG ++V+ISTHCQNDLGL+TANTLAGAYA
Sbjct  228   AGATTLNIPDTVGYTLPSEFGRLIAMIKENTPGSQSVVISTHCQNDLGLATANTLAGAYA  287

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+EVTINGIGERAGNASLEEVVMA++CRG++ L GL+TGI  +HI + S+MV +YTG
Sbjct  288   GARQLEVTINGIGERAGNASLEEVVMAIRCRGDEQLNGLHTGIKPKHIAVTSRMVSDYTG  347

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             + VQPHKAIVGANAFAHESGIHQDGMLK K TYEIM PEDIGL RA+++GIVLGK SGRH
Sbjct  348   MTVQPHKAIVGANAFAHESGIHQDGMLKFKGTYEIMCPEDIGLVRADEAGIVLGKHSGRH  407

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALKT++ +LGY+++ K+ DD+F RFK+VA+KKK ++D DL AL+SDEVFQP++VW L DL
Sbjct  408   ALKTRLSQLGYELESKQLDDVFKRFKAVADKKKSLSDVDLEALLSDEVFQPEVVWALLDL  467

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QV CG+LGLSTATVKL   D+ + V  S+GTGPVDAAYKAVD +V++PVTLLEYS+ AVT
Sbjct  468   QVVCGTLGLSTATVKLSGPDNIQRVGTSIGTGPVDAAYKAVDSIVQIPVTLLEYSMNAVT  527

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EGIDAIA+TRV+IR +NS   THA +   V R+FSG+GA  D+ +SSVRAYV ALNK++ 
Sbjct  528   EGIDAIANTRVVIRAENSTPVTHAQSTEPVQRSFSGSGASEDVTVSSVRAYVSALNKVIG  587

Query  1922  FTTLV  1936
             F+  V
Sbjct  588   FSKAV  592



>gb|KHN27115.1| 2-isopropylmalate synthase 2, chloroplastic [Glycine soja]
Length=594

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/539 (73%), Positives = 455/539 (84%), Gaps = 35/539 (6%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             YIPNRI DP+Y                              LAKLGVDIIEAGFPAAS+ 
Sbjct  70    YIPNRIPDPSY------------------------------LAKLGVDIIEAGFPAASKD  99

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV++IAQEVGN   +  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  100   DFEAVKMIAQEVGNAVDDDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSAI  159

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  160   HMEYKLRMSKDKVVDIARNMVKFARSLGCEDVEFSPEDAGRSDREFLYEILGEVIKAGAT  219

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQ
Sbjct  220   TLNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIEGARAGARQ  279

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             +EVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+HI + S+MVEEYTGL +Q
Sbjct  280   LEVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGINTKHIFLTSRMVEEYTGLQLQ  338

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKA+VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R N++GIVLGKLSGRHAL+ 
Sbjct  339   PHKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKLSGRHALRK  398

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             +++ELGY++   +   LFWRFK+VAE+KK++TD DL AL+SDEVFQ + VWKLGDLQVTC
Sbjct  399   RLEELGYELSDDQVQTLFWRFKAVAEQKKRVTDADLRALVSDEVFQAEPVWKLGDLQVTC  458

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+LGLSTATVKL+ +D   HVACSVGTGPVD+AYKAVDL+VK PVTLLEYS+ AVTEGID
Sbjct  459   GTLGLSTATVKLLSSDGSTHVACSVGTGPVDSAYKAVDLIVKEPVTLLEYSMNAVTEGID  518

Query  1754  AIASTRVLIRGDN--SHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             AIA+TRV+IRG++  S ++THALTG  V RTFSGTGAGMD+V+SSV+AY+ ALNKML F
Sbjct  519   AIATTRVVIRGESETSTSTTHALTGEAVLRTFSGTGAGMDVVVSSVKAYIAALNKMLGF  577



>emb|CBX25469.1| hypothetical_protein [Oryza glaberrima]
Length=527

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/509 (76%), Positives = 445/509 (87%), Gaps = 5/509 (1%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGL  577
             MT+ EKL VARQLA+LGVDIIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGL
Sbjct  1     MTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGL  60

Query  578   SRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLG  757
             SRCN+RDID AWEAV+HA++PR+HTFIATSEIHM+ KL  + EQVV  A  MVAYARSLG
Sbjct  61    SRCNKRDIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLG  120

Query  758   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTP  937
             C DVEFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTP
Sbjct  121   CPDVEFSPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTP  180

Query  938   GIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRG  1117
             GIEN IISTHCQNDLGL+TANTLAG +AGARQ+EVTINGIGERAGNASLEEVVMA+KCR 
Sbjct  181   GIENAIISTHCQNDLGLATANTLAGTHAGARQLEVTINGIGERAGNASLEEVVMAIKCRR  240

Query  1118  EQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1297
             E +LGGLYTGINTQHI M+SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK+K T
Sbjct  241   E-LLGGLYTGINTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGT  299

Query  1298  YEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK  1477
             YEI+SP+DIGL RAN+ GIVLGKLSGRHA+++K+ ELGY+I  KEF+D F R+K VAEKK
Sbjct  300   YEIISPDDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKK  359

Query  1478  KKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTG  1657
             K++TD+D+ AL+SDE+FQP++ W L D+Q TCG+LGLSTATVKLI  D EE +AC+VGTG
Sbjct  360   KRVTDEDIEALLSDEIFQPKVFWSLADVQATCGTLGLSTATVKLIGPDGEEKIACAVGTG  419

Query  1658  PVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNR  1837
             PVDAAYKAVD ++++P  L EYS+T+VTEGIDAIA+TRV++ GD S  S HALTG+  +R
Sbjct  420   PVDAAYKAVDDIIQIPTVLREYSMTSVTEGIDAIATTRVVVTGDVS-DSKHALTGHSFSR  478

Query  1838  TFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
              FSG+GA +DIV+SSVRAY+ ALNKM SF
Sbjct  479   AFSGSGAALDIVVSSVRAYLSALNKMSSF  507



>dbj|BAH20374.1| AT1G74040 [Arabidopsis thaliana]
Length=491

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/482 (77%), Positives = 435/482 (90%), Gaps = 2/482 (0%)
 Frame = +2

Query  515   RLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFK  688
             + IA+ VGN   E  +VPVICGLSRCN++DI+ AWEAVK+AK+PR+HTFIATS+IH+K+K
Sbjct  1     KTIAETVGNTVDENGYVPVICGLSRCNKKDIETAWEAVKYAKRPRIHTFIATSDIHLKYK  60

Query  689   LNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIP  868
             L  S+E+V+E A +MV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGATTLNIP
Sbjct  61    LKKSKEEVIEIARNMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNIP  120

Query  869   DTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTI  1048
             DTVG TLP+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA++GARQVEVTI
Sbjct  121   DTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLSTANTLSGAHSGARQVEVTI  180

Query  1049  NGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAI  1228
             NGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG+  QPHKAI
Sbjct  181   NGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAI  240

Query  1229  VGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQEL  1408
             VGANAFAHESGIHQDGMLKHK TYEIMSPE+IGL R+N +GIVLGKLSGRHALK ++ EL
Sbjct  241   VGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNDAGIVLGKLSGRHALKDRLNEL  300

Query  1409  GYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGL  1588
             GY +D  +  +LFWRFK+VAE+KK++TD DLIAL+SDEVFQP+ VWKL D+Q+TCG+LGL
Sbjct  301   GYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQPEAVWKLLDMQITCGTLGL  360

Query  1589  STATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIAST  1768
             ST+TVKL D+D +EHVACSVGTGPVDAAYKAVDL+VK P TLLEYS+ AVTEGIDAIA+T
Sbjct  361   STSTVKLADSDGKEHVACSVGTGPVDAAYKAVDLIVKEPATLLEYSMNAVTEGIDAIATT  420

Query  1769  RVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYN  1948
             RVLIRGDN+++ST+A+TG  V RTFSGTGAGMDIV+SSV+AYVGALNKML F    S  +
Sbjct  421   RVLIRGDNNYSSTNAVTGESVERTFSGTGAGMDIVVSSVKAYVGALNKMLGFKEHTSTLS  480

Query  1949  KT  1954
             KT
Sbjct  481   KT  482



>gb|EMS63121.1| 2-isopropylmalate synthase A [Triticum urartu]
Length=526

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/523 (74%), Positives = 448/523 (86%), Gaps = 6/523 (1%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGL  577
             MT+ EKL VARQLA+LGVDIIEAGFPA+S  D +AVR IA EVGN   GE  HVPVICGL
Sbjct  1     MTSAEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGL  60

Query  578   SRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLG  757
             SRCN+RDID AWEAV+HA+KPR+HTFIATSEIHM+ KL  + +QVV  A  MVAYAR LG
Sbjct  61    SRCNKRDIDAAWEAVRHARKPRIHTFIATSEIHMQHKLRKTPDQVVAIAREMVAYARGLG  120

Query  758   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTP  937
             C DVEFSPEDAGRS+REFLY IL EVIKAGATTLNIPDTVGYTLP EFG+LIADIKANTP
Sbjct  121   CPDVEFSPEDAGRSNREFLYHILDEVIKAGATTLNIPDTVGYTLPHEFGKLIADIKANTP  180

Query  938   GIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRG  1117
             GIEN IISTHCQNDLGL++ANTLAGAYAGARQ+EVTINGIGERAGNASLEEVVMA+KCR 
Sbjct  181   GIENAIISTHCQNDLGLASANTLAGAYAGARQLEVTINGIGERAGNASLEEVVMAIKCRR  240

Query  1118  EQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1297
             E +LGGLYTGIN+QHI M SKMV+E++GL VQPHKAIVGANAFAHESGIHQDGMLK K T
Sbjct  241   E-LLGGLYTGINSQHITMTSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKFKGT  299

Query  1298  YEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK  1477
             YEI+SP+DIGL RAN+ GIVLGKLSGRHA++TK+ ELGY+I+ KEF+D F R+K VAEKK
Sbjct  300   YEIISPDDIGLTRANEFGIVLGKLSGRHAVRTKLVELGYEINDKEFEDFFKRYKEVAEKK  359

Query  1478  KKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTG  1657
             K++TD+D+ AL+SDE+FQP+++W LGD+Q TCG+LGLSTATVKLI  D EE + CSVGTG
Sbjct  360   KRVTDEDIEALLSDEIFQPKVIWSLGDVQATCGTLGLSTATVKLITIDGEEKIGCSVGTG  419

Query  1658  PVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNR  1837
             PVDAAYKAVD ++++P  L EYS+T+VTEGIDAIA+TRV+I GD S     ALT N  NR
Sbjct  420   PVDAAYKAVDQIIQIPTVLREYSMTSVTEGIDAIATTRVVIAGDVS-ADKPALTSN-SNR  477

Query  1838  TFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNKTEDNV  1966
             +FSG+GA MD+V+SSVRAY+ ALNKM S+   V   ++  + +
Sbjct  478   SFSGSGAAMDVVVSSVRAYLSALNKMSSYVGAVKASSEAPETI  520



>ref|XP_002307122.2| hypothetical protein POPTR_0005s08480g [Populus trichocarpa]
 gb|EEE94118.2| hypothetical protein POPTR_0005s08480g [Populus trichocarpa]
Length=489

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/472 (80%), Positives = 425/472 (90%), Gaps = 4/472 (1%)
 Frame = +2

Query  518   LIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFK  688
             +IA EVGN    EG +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS IHM++K
Sbjct  1     MIANEVGNQVDSEG-YVPVICGLSRCNEKDIRAAWEAVKNAKRPRIHTFIATSGIHMEYK  59

Query  689   LNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIP  868
             L  S+E+VVE A+SMV +ARSLGC DVEFSPEDAGRS+REFLY ILGEVIKAGATTLNIP
Sbjct  60    LRKSKEEVVEIASSMVRFARSLGCDDVEFSPEDAGRSEREFLYHILGEVIKAGATTLNIP  119

Query  869   DTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTI  1048
             DTVG T P+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GA AGARQVEVTI
Sbjct  120   DTVGITTPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGACAGARQVEVTI  179

Query  1049  NGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAI  1228
             NGIGERAGNASLEEVVM +KCRGE VLGGLYTGINT+HI MASKMVEEYTGL VQPHKAI
Sbjct  180   NGIGERAGNASLEEVVMVIKCRGEHVLGGLYTGINTRHITMASKMVEEYTGLHVQPHKAI  239

Query  1229  VGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQEL  1408
             VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R+N +GIVLGKLSGRHALK ++ EL
Sbjct  240   VGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNDAGIVLGKLSGRHALKDRLNEL  299

Query  1409  GYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGL  1588
             GY++D  +  ++FWRFK+VAE KK++TD DLIAL+SDEVFQP+ VWKL DLQVTCG+LGL
Sbjct  300   GYELDDAQLGNIFWRFKAVAETKKRVTDADLIALVSDEVFQPENVWKLHDLQVTCGTLGL  359

Query  1589  STATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIAST  1768
             STATVKL+ AD EEHVACS+GTGPVD+AYKAV+L+VK PVTLLEYS+ AVTEGIDAIA+T
Sbjct  360   STATVKLLSADGEEHVACSLGTGPVDSAYKAVNLIVKEPVTLLEYSMIAVTEGIDAIATT  419

Query  1769  RVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             RV+IRG+N H  THALT     RTFSG+GAGMDIV+SSV+AYVGALNKML+F
Sbjct  420   RVVIRGENQHAPTHALTDEPFQRTFSGSGAGMDIVVSSVKAYVGALNKMLAF  471



>gb|KHN37280.1| 2-isopropylmalate synthase 2, chloroplastic [Glycine soja]
Length=586

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/538 (71%), Positives = 447/538 (83%), Gaps = 37/538 (7%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             YIPN I DP+YVR+FDTTLRDGEQSPGA+MT+KEKLD                       
Sbjct  66    YIPNLIPDPSYVRIFDTTLRDGEQSPGASMTSKEKLD-----------------------  102

Query  500   DFEAVRLIAQEVGNG-EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIH  676
                        VGN  +  +VP ICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS IH
Sbjct  103   ----------RVGNAVDDGYVPAICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIATSPIH  152

Query  677   MKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATT  856
             M++KL MS+++VV+ A +MV +ARSLGC DVEFSPEDAGRSDREFLY+ILGEVIKAGATT
Sbjct  153   MEYKLRMSKDKVVDIARNMVKFARSLGCDDVEFSPEDAGRSDREFLYEILGEVIKAGATT  212

Query  857   LNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQV  1036
             LNIPDTVG T+P+EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQ+
Sbjct  213   LNIPDTVGITMPSEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIEGARAGARQL  272

Query  1037  EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQP  1216
             EVTINGIGERAGNASLEEVVMAL+C G  V G LYTGI+T+HI + SKMVEEYTGL VQP
Sbjct  273   EVTINGIGERAGNASLEEVVMALRC-GAHVNGNLYTGIDTKHIFLTSKMVEEYTGLQVQP  331

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             HKA+VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R N++GIVLGKLSGRHAL+ +
Sbjct  332   HKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERTNEAGIVLGKLSGRHALRKR  391

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             ++ELGY+++  +   LFW FK+VAE+KK++TD DL AL+SDEVFQ + VWKLGDLQVTCG
Sbjct  392   LEELGYELNDDQVQTLFWCFKAVAEQKKRVTDADLRALVSDEVFQAEPVWKLGDLQVTCG  451

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
             +LGLSTATVKL+ +D   HVACS+GTGPVD+AYKAVDL+VK  VTLLEYS+ AVTEGIDA
Sbjct  452   TLGLSTATVKLLSSDGSTHVACSIGTGPVDSAYKAVDLIVKEQVTLLEYSMNAVTEGIDA  511

Query  1757  IASTRVLIRGDN--SHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             IA+TRV+IRG++  S  +THALTG  V RTFSGTGAGMD+V+SSV+AY+ ALNKM  F
Sbjct  512   IATTRVVIRGESETSTITTHALTGETVIRTFSGTGAGMDVVVSSVKAYIAALNKMSGF  569



>ref|XP_007207420.1| hypothetical protein PRUPE_ppa004868mg [Prunus persica]
 gb|EMJ08619.1| hypothetical protein PRUPE_ppa004868mg [Prunus persica]
Length=488

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/471 (78%), Positives = 422/471 (90%), Gaps = 2/471 (0%)
 Frame = +2

Query  518   LIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKL  691
             +IA+EVGN   +  +VPVICGLSRCN++DI RAW+AV+ AK+PR+HTFIATS IHM+ KL
Sbjct  1     MIAKEVGNSVDKDGYVPVICGLSRCNKKDIKRAWDAVECAKRPRIHTFIATSAIHMEHKL  60

Query  692   NMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  871
               ++EQVVE A  MV+YARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD
Sbjct  61    RKTKEQVVEIARDMVSYARSLGCDDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  120

Query  872   TVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTIN  1051
             TVGY +P+E+ QLI+DIK+NTPGIENVIISTHCQNDLGLSTANT+AGA AGARQ+EVTIN
Sbjct  121   TVGYNVPSEYSQLISDIKSNTPGIENVIISTHCQNDLGLSTANTIAGASAGARQLEVTIN  180

Query  1052  GIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             GIGERAGNASLEEVVM L CRG+ VLGGLYTGIN +HI + SKMVEEYTGL VQPHKAIV
Sbjct  181   GIGERAGNASLEEVVMTLDCRGDHVLGGLYTGINARHIYITSKMVEEYTGLHVQPHKAIV  240

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSGRHALK +++ELG
Sbjct  241   GANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHALKKRLEELG  300

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             Y++   + + +FWRFK+VA++KK++TD DL AL+SDEVFQP++VWKL DLQVTCG+LGLS
Sbjct  301   YELADDQLETIFWRFKAVADQKKRVTDADLRALVSDEVFQPEVVWKLHDLQVTCGTLGLS  360

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATVKLIDAD  EHVAC+VGTGPVD+AYKAVDL+VK PV LLEYS+ AVTEGIDAIA+TR
Sbjct  361   TATVKLIDADGREHVACAVGTGPVDSAYKAVDLIVKEPVILLEYSMNAVTEGIDAIATTR  420

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             VLIRG+NS+ +THA TG  V RTFSG GAGMDIV+SSV+AYVGALNKML F
Sbjct  421   VLIRGENSNITTHAFTGETVQRTFSGIGAGMDIVVSSVKAYVGALNKMLGF  471



>ref|XP_010064495.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Eucalyptus 
grandis]
Length=550

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/469 (77%), Positives = 420/469 (90%), Gaps = 2/469 (0%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             AP  P YIPNRI DPNY+R+FDTTLRDGEQSPGATMT++EKL++ARQLAKLGVDIIEAGF
Sbjct  82    APPCPKYIPNRIPDPNYIRIFDTTLRDGEQSPGATMTSQEKLNIARQLAKLGVDIIEAGF  141

Query  482   PAASEADFEAVRLIAQEVGNGEGEH--VPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PAAS  DF AV+ IA EVGN    H  +P+IC LSRCN++DI  AW+AV+ A++PR+HTF
Sbjct  142   PAASPDDFNAVKAIALEVGNAVDPHGYIPIICSLSRCNEKDIQAAWDAVRFARRPRIHTF  201

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             IATS IHM++KL  S+++V+  A +MVA+ARSLGC+DVEFSPEDAGRS+REFLY+ILGEV
Sbjct  202   IATSAIHMQYKLKKSKQEVINIARTMVAFARSLGCNDVEFSPEDAGRSEREFLYEILGEV  261

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTLNIPDTVG T+P EFG+LIAD+KANTPGIENVIIS HC NDLGLSTANT+AGA
Sbjct  262   IKAGATTLNIPDTVGITMPEEFGKLIADVKANTPGIENVIISAHCHNDLGLSTANTIAGA  321

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQVEVTINGIGERAGNASLEEVVMALKC+GE +LGGLYTGINT+HI+M SKMVEEY
Sbjct  322   CAGARQVEVTINGIGERAGNASLEEVVMALKCKGESILGGLYTGINTRHIVMTSKMVEEY  381

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             +GL VQPHKAIVGANAFAHESGIHQD MLKHK TYEI+SP+DIGL R N+  IVLGKLSG
Sbjct  382   SGLHVQPHKAIVGANAFAHESGIHQDRMLKHKGTYEIISPDDIGLERTNEVDIVLGKLSG  441

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHALK K+ ELGYDIDG++ D++FW+FK+VAE+KK++TD ++IAL+SDEVFQP +VWKL 
Sbjct  442   RHALKMKLVELGYDIDGEQLDNIFWQFKAVAEQKKRVTDAEIIALVSDEVFQPAVVWKLH  501

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKV  1702
             DLQV+CG+LGLSTATVKLI  D +EH+AC+VGTG VD+AYKAVDL+VKV
Sbjct  502   DLQVSCGTLGLSTATVKLISGDGKEHIACAVGTGRVDSAYKAVDLIVKV  550



>dbj|BAI49592.1| homocitrate synthase [Lotus japonicus]
Length=540

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/542 (67%), Positives = 438/542 (81%), Gaps = 17/542 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPN I +P YVR+ DTTLRDGEQSPGA MT  +KL+ ARQLAKLGVDIIEAGFP A
Sbjct  11    RPEYIPNHIPNPTYVRILDTTLRDGEQSPGAAMTCVQKLETARQLAKLGVDIIEAGFPCA  70

Query  491   SEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             S+ DF AV++IA+EVGN   G G +VPVI G+SRCN++DI  AWEA+KHAK+PR+ TFIA
Sbjct  71    SKQDFMAVKMIAEEVGNCVDGNG-YVPVITGVSRCNEKDIATAWEALKHAKRPRLRTFIA  129

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM++KL  S++QV+E A +MV +ARSLGC+D++F  EDA RSD+EFLYQI GEVIK
Sbjct  130   TSPIHMEYKLRKSKDQVLETARNMVKFARSLGCTDIQFGAEDAARSDKEFLYQIFGEVIK  189

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTL IPDTVG  +P E+G+LIADIKANTPGIEN I++THC NDLGL+TANT+ GA  
Sbjct  190   AGATTLTIPDTVGIAMPFEYGKLIADIKANTPGIENAIMATHCHNDLGLATANTIEGARY  249

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+EVTINGIGERAGNAS EEVVMAL CRG  +LGGL+TGINT+HI+  SKMVE+Y+G
Sbjct  250   GARQLEVTINGIGERAGNASFEEVVMALTCRGIDILGGLHTGINTRHILKTSKMVEKYSG  309

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L +QPHKA+VGANAF HESGIHQDGMLKH+ TYEI+SPEDIGL R+    IVLGKLSGR 
Sbjct  310   LHLQPHKALVGANAFLHESGIHQDGMLKHRGTYEIISPEDIGLVRSVGDTIVLGKLSGRQ  369

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             AL+ +++ELGY +   E + +FW+FK+VAEKKK+ITD DL AL+S+E F  Q +WKLGDL
Sbjct  370   ALRNRLEELGYKLKDTEVEGVFWQFKAVAEKKKRITDTDLRALVSNEAFNEQPIWKLGDL  429

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG++G STATVKL   D   HVACS+GTGPVD+AYKA++ +VK P  L++Y+L A+T
Sbjct  430   QVTCGTVGFSTATVKLFSIDGSMHVACSIGTGPVDSAYKAINHIVKEPAKLVKYTLGAIT  489

Query  1742  EGIDAIASTRVLI-RGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             EGIDA A+T V I RGD +H              FSGTG G D+V+SSV AY+ ALN ML
Sbjct  490   EGIDATATTSVEISRGDTNHP------------VFSGTGGGTDVVVSSVDAYLSALNNML  537

Query  1919  SF  1924
              F
Sbjct  538   RF  539



>ref|XP_002945733.1| 2-isopropylmalate synthase [Volvox carteri f. nagariensis]
 gb|EFJ52728.1| 2-isopropylmalate synthase [Volvox carteri f. nagariensis]
Length=635

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/552 (66%), Positives = 448/552 (81%), Gaps = 8/552 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDYIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+AR LA+LGVDIIEAGFP 
Sbjct  41    RRPDYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARGLARLGVDIIEAGFPV  100

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS  DFEAVR IA EVGN      +VPVICGLSR    D++RAW+AV+HAK+PRVHTFIA
Sbjct  101   ASPDDFEAVRTIAMEVGNDVQPDGYVPVICGLSRTKFADLERAWDAVRHAKRPRVHTFIA  160

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS+IHMK+KL M+ ++VVE A + V + RSLGC+D+EFSPEDAGRSD +FLY+ILGEVIK
Sbjct  161   TSDIHMKYKLRMTPDEVVENAVAAVRHLRSLGCNDIEFSPEDAGRSDPQFLYRILGEVIK  220

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDT G+ LP EFG LIA I+ NTPG ENVIISTHCQNDLGLSTAN+LAGA A
Sbjct  221   AGATTLNIPDTTGWNLPHEFGGLIAAIRKNTPGAENVIISTHCQNDLGLSTANSLAGAMA  280

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+E TINGIGERAGNASLEEVVMA+  RG+  + GLYTGI   HI   SKMV +Y+G
Sbjct  281   GARQIECTINGIGERAGNASLEEVVMAISLRGKDQMNGLYTGIRPVHIYPMSKMVSDYSG  340

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS-GIVLGKLSGR  1378
             ++VQPHKAIVGANAFAHESGIHQDGMLK+++TYEIM+PE IGL R  Q  GIVLGK SGR
Sbjct  341   MIVQPHKAIVGANAFAHESGIHQDGMLKNRETYEIMTPESIGLPRQEQDRGIVLGKHSGR  400

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGD  1558
             +AL ++++ LGY++   E DD+F RFK++A+KKK ITD+D++AL+SDE+ QP+++W+L D
Sbjct  401   NALSSRLRSLGYELSTSELDDVFKRFKALADKKKGITDEDILALMSDELHQPKVIWELLD  460

Query  1559  LQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAV  1738
             LQV CG++G+ TATV++   D    +   VGTGPVDAAYKA+D LV+V   L++YS+++V
Sbjct  461   LQVVCGTMGMPTATVQMQGPDGIARIGVGVGTGPVDAAYKAIDSLVRVEAELVDYSVSSV  520

Query  1739  TEGIDAIASTRVLIRGDNSHT----STHALTGNVVNRTFSGTGAGMDIVISSVRAYVGAL  1906
             T+GI+A+A TRV+IR     +    S HA  G  V R FSG+GA  DIV++S RAY+ AL
Sbjct  521   TQGIEALAHTRVMIRPAGKMSDQGYSEHAALGT-VQRQFSGSGANEDIVVASARAYISAL  579

Query  1907  NKMLSFTTLVSR  1942
             NKM+ + ++  +
Sbjct  580   NKMIGWMSVAQK  591



>ref|XP_005648878.1| 2-isopropylmalate synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24334.1| 2-isopropylmalate synthase [Coccomyxa subellipsoidea C-169]
Length=599

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/545 (67%), Positives = 439/545 (81%), Gaps = 7/545 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRI DPNYVR+FDTTLRDGEQSPGAT+T+KEKLD+ARQLAKL VDIIEAGFP 
Sbjct  30    RRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLRVDIIEAGFPV  89

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             AS  DF+AVR IA +VGN   E  +VPVICGLSR   RD++ AWEAVK AK+PRVHTF+A
Sbjct  90    ASPDDFDAVRSIAMDVGNNVDEDGYVPVICGLSRTIIRDLEVAWEAVKLAKRPRVHTFLA  149

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM+ KL M+ +QVVE A   V + RSLGC+D+EFSPEDAGRSD +FLY++L  VI+
Sbjct  150   TSAIHMEHKLKMTPDQVVENAVKAVRHLRSLGCTDIEFSPEDAGRSDPKFLYRVLAAVIE  209

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDT G+ LP EFG LIAD+ ANTPG + V+ STHCQNDLGLSTAN+LAGA A
Sbjct  210   AGATTLNIPDTTGWNLPHEFGGLIADLIANTPGADKVVFSTHCQNDLGLSTANSLAGAMA  269

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+E TINGIGERAGNASLEEVVMA+  RG Q +GGL TGI   HII  SKMV +Y+G
Sbjct  270   GARQIECTINGIGERAGNASLEEVVMAINKRGAQQMGGLRTGIRPVHIISTSKMVSDYSG  329

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             ++VQPHKAIVGANAFAHESGIHQDGMLK KDTYEI+ PE+IGL R + +GIV+GK SGR+
Sbjct  330   MMVQPHKAIVGANAFAHESGIHQDGMLKSKDTYEIIRPEEIGLTRQDDAGIVMGKHSGRN  389

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             AL+TK+Q LG+D+   + DD+F RFKS+A+KKK +TD+D++AL+SDEV QP+ +W L  L
Sbjct  390   ALRTKLQALGFDLAQDQLDDVFKRFKSLADKKKNVTDEDVLALVSDEVHQPEKLWDLLGL  449

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QV CG++GL TATV+++  D     A  +GTGPVDAAYKA+D LV+V V L EY++T+VT
Sbjct  450   QVVCGTMGLPTATVRMLGPDGIARTATGMGTGPVDAAYKAIDALVRVQVQLSEYTMTSVT  509

Query  1742  EGIDAIASTRVLIRGDNSHTST----HALTGNVVNRTFSGTGAGMDIVISSVRAYVGALN  1909
             EGI+A+ASTRV IR    H       HA  G    R+FSG+GA  DIV++S RAYV ALN
Sbjct  510   EGIEALASTRVSIRPVGGHADQGFVIHA-QGGSTQRSFSGSGANEDIVVASARAYVSALN  568

Query  1910  KMLSF  1924
             K+++F
Sbjct  569   KLIAF  573



>gb|KHN34615.1| Putative 2-isopropylmalate synthase [Glycine soja]
Length=583

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/544 (66%), Positives = 440/544 (81%), Gaps = 5/544 (1%)
 Frame = +2

Query  305   PR-RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             PR RP+YIPN I DP+YVR+ DTTLRDGEQSPGA MT+ +KL +ARQL KLGVDII+AGF
Sbjct  39    PRSRPEYIPNHIPDPSYVRILDTTLRDGEQSPGAAMTSDQKLGIARQLVKLGVDIIDAGF  98

Query  482   PAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             P+AS+ DF AV++IAQEVGN    +G +VPVI  L RCN++DI  AWEAV++AKKPR+  
Sbjct  99    PSASQEDFNAVKMIAQEVGNDCDADG-YVPVIAALCRCNEKDITTAWEAVRYAKKPRLIP  157

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATS IHM++KLN ++E+V++ A  MV + RSLGC D+EF  EDA RSD EFLY+IL E
Sbjct  158   FIATSSIHMEYKLNKTKEEVLQIAIDMVKFTRSLGCDDIEFGVEDAARSDTEFLYKILEE  217

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTL I DTVG T+P EFG++IA IKAN PG+ENVIIS HC NDLG +TANT+  
Sbjct  218   VIKAGATTLCIADTVGITMPLEFGEMIAGIKANVPGVENVIISVHCHNDLGHATANTIQA  277

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A  GARQ+EVTINGIGERAGNA+ EEVVMALKCRG+  LGGLYTGINT+HI+  S+MVEE
Sbjct  278   ACVGARQLEVTINGIGERAGNAAFEEVVMALKCRGDHALGGLYTGINTRHILKTSRMVEE  337

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
              +G+ +QPHKA+VG N+F HESGIHQ G+LKH+ TYEI+SPEDIG  R+N + +VLGKLS
Sbjct  338   CSGMYLQPHKALVGDNSFLHESGIHQAGLLKHRGTYEIISPEDIGHERSNGANMVLGKLS  397

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHALK ++QELGY++   E + +F  FK++A KKK++TD DL AL+SD+V   + +WKL
Sbjct  398   GRHALKNRLQELGYELRDDELESVFRNFKAMAGKKKRVTDVDLKALVSDQVCHVEPIWKL  457

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              DLQVTCG++G STA+VKL+      HVACSVG GPVDAAYKA+DL+VK  V +LEY+L 
Sbjct  458   DDLQVTCGTMGSSTASVKLVTVHGSTHVACSVGVGPVDAAYKAIDLIVKETVKVLEYTLN  517

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
              VTEG DAIA+TR++IR +N+ T THAL GN V  TFSGTG G+D+V+SSV AY+ ALNK
Sbjct  518   PVTEGTDAIATTRIVIRRENNKTLTHALNGNFVYPTFSGTGEGVDVVVSSVEAYLTALNK  577

Query  1913  MLSF  1924
             ML F
Sbjct  578   MLDF  581



>ref|XP_010546219.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=642

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/548 (66%), Positives = 449/548 (82%), Gaps = 13/548 (2%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDPNYVRVFDTTLRDGEQSPGA M T++KL +AR+LA+LGVD+IEAGFPA
Sbjct  71    RRPEYIPNRISDPNYVRVFDTTLRDGEQSPGAAMQTEQKLLIARKLAELGVDVIEAGFPA  130

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS ADFEAV+ IAQ VGN   E   +VPVICGLSRC + D++ AWEAVKHAK+PR+H FI
Sbjct  131   ASAADFEAVKAIAQTVGNDVDEETGYVPVICGLSRCRKDDVEAAWEAVKHAKRPRIHVFI  190

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHM+ KL  +RE+V++ A+SM+ +ARSLGC+DVEF  EDAGRS++ F+Y+IL EVI
Sbjct  191   STSDIHMEHKLRKTREEVIQMASSMIRFARSLGCADVEFGAEDAGRSEKGFMYKILEEVI  250

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGA+T+NI DTVG   P EFG+LI+DIKANTPGI++VIISTHCQNDLGL+TANTL+G  
Sbjct  251   KAGASTVNIADTVGINTPDEFGELISDIKANTPGIDDVIISTHCQNDLGLATANTLSGTS  310

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER GNASLEEVVM LKC+GE    GLYTGI+T+HI+ ASK+VEE+T
Sbjct  311   AGARQVEVTINGIGERGGNASLEEVVMTLKCKGEHAFCGLYTGIDTRHIVPASKLVEEHT  370

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHKAIVGANAF HESGIHQDGMLK+K TYEIM PED+GL R+ + GIVLGKLSGR
Sbjct  371   GLHVQPHKAIVGANAFVHESGIHQDGMLKNKSTYEIMLPEDVGLERSQELGIVLGKLSGR  430

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEVFQPQLVWKL  1552
             HAL+ ++++LGY++D  + + +F +FK+VAE KK++TD DL+AL+S  D     +  WKL
Sbjct  431   HALQERLKQLGYEMDDTKLNHVFLKFKAVAELKKRVTDADLVALVSDVDTCRSDEPTWKL  490

Query  1553  GDLQVTCGS--LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYS  1726
              ++QV CGS  L  STA V L+D   +EHVACSVGTGP+D+AY+AVDL+VK  VTLLEYS
Sbjct  491   LEVQVVCGSGTLSRSTAIVTLVDRKGQEHVACSVGTGPIDSAYRAVDLIVKEAVTLLEYS  550

Query  1727  LTAVTEGIDAIASTRVLIRGD-NSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGA  1903
             +  ++EGID+I++ RV IR + +S  STH        +TF G G G DIV+SSV+AY+GA
Sbjct  551   MDGISEGIDSISTIRVSIRKNCHSIASTHEPL-----QTFEGMGVGTDIVVSSVKAYIGA  605

Query  1904  LNKMLSFT  1927
             LN ++  +
Sbjct  606   LNNVIRIS  613



>ref|XP_006604280.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=583

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/544 (66%), Positives = 439/544 (81%), Gaps = 5/544 (1%)
 Frame = +2

Query  305   PR-RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             PR RP+YIPN I DP+YVR+ DTTLRDGEQSPGA MT+ +KL +ARQL KLGVDII+AGF
Sbjct  39    PRSRPEYIPNHIPDPSYVRILDTTLRDGEQSPGAAMTSDQKLGIARQLVKLGVDIIDAGF  98

Query  482   PAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHT  652
             P+AS+ DF AV++IAQEVGN    +G +VPVI  L RCN++DI  AWEAV++AKKPR+  
Sbjct  99    PSASQEDFNAVKMIAQEVGNDCDADG-YVPVIAALCRCNEKDITTAWEAVRYAKKPRLIP  157

Query  653   FIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGE  832
             FIATS IHM++KLN ++E+V++ A  MV + RSLGC D+EF  EDA RSD EFLY+IL E
Sbjct  158   FIATSSIHMEYKLNKTKEEVLQIAIDMVKFTRSLGCDDIEFGVEDAARSDTEFLYKILEE  217

Query  833   VIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAG  1012
             VIKAGATTL I DTVG T+P EFG++IA IKAN PG+EN IIS HC NDLG +TANT+  
Sbjct  218   VIKAGATTLCIADTVGITMPLEFGEMIAGIKANVPGVENAIISVHCHNDLGHATANTIQA  277

Query  1013  AYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEE  1192
             A  GARQ+EVTINGIGERAGNA+ EEVVMALKCRG+  LGGLYTGINT+HI+  S+MVEE
Sbjct  278   ACVGARQLEVTINGIGERAGNAAFEEVVMALKCRGDHALGGLYTGINTRHILKTSRMVEE  337

Query  1193  YTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
              +G+ +QPHKA+VG N+F HESGIHQ G+LKH+ TYEI+SPEDIG  R+N + +VLGKLS
Sbjct  338   CSGMYLQPHKALVGDNSFLHESGIHQAGLLKHRGTYEIISPEDIGHERSNGANMVLGKLS  397

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL  1552
             GRHALK ++QELGY++   E + +F  FK++A KKK++TD DL AL+SD+V   + +WKL
Sbjct  398   GRHALKNRLQELGYELRDDELESVFRNFKAMAGKKKRVTDVDLKALVSDQVCHVEPIWKL  457

Query  1553  GDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLT  1732
              DLQVTCG++G STA+VKL+      HVACSVG GPVDAAYKA+DL+VK  V +LEY+L 
Sbjct  458   DDLQVTCGTMGSSTASVKLVTVHGSTHVACSVGVGPVDAAYKAIDLIVKETVKVLEYTLN  517

Query  1733  AVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNK  1912
              VTEG DAIA+TR++IR +N+ T THAL GN V  TFSGTG G+D+V+SSV AY+ ALNK
Sbjct  518   PVTEGTDAIATTRIVIRRENNKTLTHALNGNFVYPTFSGTGEGVDVVVSSVEAYLTALNK  577

Query  1913  MLSF  1924
             ML F
Sbjct  578   MLDF  581



>ref|XP_003521867.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=555

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/538 (65%), Positives = 439/538 (82%), Gaps = 4/538 (1%)
 Frame = +2

Query  314   PDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAAS  493
             P+YIPNRI DP+YVR+ DTTLRDGEQ+PGA MT+ +KL +ARQLAKLGVD+IE GFP+AS
Sbjct  15    PEYIPNRIPDPHYVRILDTTLRDGEQAPGAAMTSDQKLQIARQLAKLGVDVIEGGFPSAS  74

Query  494   EADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             + DF AV++IAQEVGN    +G +VPVI  L RCN+RDI RAWEA+K+AK+PR+  FIA 
Sbjct  75    QEDFNAVKMIAQEVGNNCDADG-YVPVIAALCRCNERDITRAWEALKYAKRPRLMPFIAV  133

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IHM++KLN ++E+V++ AT M+ +AR LGC+D++F  EDA RSDREFLYQIL EVIKA
Sbjct  134   SPIHMEYKLNKTKEEVLQIATDMIKFARGLGCTDIQFCSEDAARSDREFLYQILEEVIKA  193

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTL I DTVG T+P E  +L+A IKAN PG ENVIIS HC NDLG +TANT+  A AG
Sbjct  194   GATTLGIGDTVGITMPFEIRELVAGIKANVPGAENVIISIHCHNDLGHATANTIEAARAG  253

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             A Q+EVTINGIGERAGNASLEEVVMALKCRG+ VLGGLYTGINT+H++  SKMVEE++G+
Sbjct  254   AMQLEVTINGIGERAGNASLEEVVMALKCRGDHVLGGLYTGINTRHLLKTSKMVEEFSGM  313

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              +QPHKA+VG NAF HESG+HQ G+LKH+ TYEI+SPEDIG  ++N   +VLGKLSGR A
Sbjct  314   YLQPHKAVVGDNAFLHESGVHQAGLLKHRGTYEILSPEDIGHEKSNGVNMVLGKLSGRQA  373

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ  1564
             LK++++ELGY++  +E + +F  FK++AEKKK++TD DL AL+SD+    + +WKLG LQ
Sbjct  374   LKSRLKELGYELRDEEVESVFRNFKAIAEKKKRVTDVDLKALVSDQASHAEPIWKLGGLQ  433

Query  1565  VTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTE  1744
             VTCG++G STAT+KL+ +D   HVACSVG GPVD+AYKA++L+VK  V +LEYS + VT 
Sbjct  434   VTCGTMGSSTATIKLVTSDGSTHVACSVGVGPVDSAYKAINLIVKETVKVLEYSPSTVTG  493

Query  1745  GIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             G DAIA+TRV+IR +N  + T AL GNV+  TFSGTG G+DIV SSV AY+ ALNKML
Sbjct  494   GTDAIATTRVVIRRENKQSPTPALNGNVIYPTFSGTGEGVDIVTSSVEAYITALNKML  551



>ref|XP_003554069.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=555

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/541 (65%), Positives = 441/541 (82%), Gaps = 6/541 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPNRI DP+YVR+ DTTLRDGEQ+PGA+M + +KL  ARQLAKLGVD+IE GFP+A
Sbjct  16    RPEYIPNRIPDPHYVRILDTTLRDGEQAPGASMVSSQKL--ARQLAKLGVDVIEGGFPSA  73

Query  491   SEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             S+ DF AV++IAQEVGN    +G +VPVI  L RCN++DI  AWEA+K+AK+PR+  FIA
Sbjct  74    SQEDFNAVKMIAQEVGNNCDADG-YVPVIAALCRCNEKDIATAWEALKYAKRPRLMPFIA  132

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
              S IHM++KLN ++E+V++ A  M+ +ARSLGCSD++F  EDA RSDREFLYQIL EVIK
Sbjct  133   VSPIHMEYKLNKTKEEVLQIAKDMIKFARSLGCSDIQFCSEDAARSDREFLYQILEEVIK  192

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTL I DTVG T+P E  QLIADIKAN PG ENVIIS HC NDLG +TAN +  A A
Sbjct  193   AGATTLGIGDTVGITMPFEIRQLIADIKANVPGAENVIISMHCHNDLGHATANAIEAAQA  252

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GA Q+EVTINGIGERAGNASLEEVVMALKCRG+QVLGGLYTGINT+H++  SKMVEE++G
Sbjct  253   GAMQLEVTINGIGERAGNASLEEVVMALKCRGDQVLGGLYTGINTRHLLKTSKMVEEFSG  312

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             + +QPHKA+VG NAF HESG+HQ G+LKH+ TYEIMSPEDIG  +++   +VLGKLSGR 
Sbjct  313   MYLQPHKAVVGDNAFLHESGVHQAGLLKHRATYEIMSPEDIGHEKSSGVNMVLGKLSGRQ  372

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             ALK++++ELGY++  +E + +F  FK++AEKKK++TD DL AL+S++V   + +WKL  L
Sbjct  373   ALKSRLKELGYELRDEEVESVFRNFKAIAEKKKRVTDVDLKALVSNQVSHDEPIWKLDGL  432

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QVTCG++G STAT+KL+ +D   HVACSVG GPVD+AYKA++L+VK  V +LEYSL+ VT
Sbjct  433   QVTCGTMGSSTATIKLVTSDGITHVACSVGVGPVDSAYKAINLIVKETVKVLEYSLSTVT  492

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             EG DAIA+TRV+IR +N  + T AL GNV+  TFSGTG G+D+V SSV AY+ ALNKML 
Sbjct  493   EGTDAIATTRVVIRRENKQSPTPALNGNVIYPTFSGTGEGVDVVTSSVEAYLTALNKMLD  552

Query  1922  F  1924
              
Sbjct  553   L  553



>ref|XP_010546232.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Tarenaya 
hassleriana]
Length=606

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/545 (65%), Positives = 447/545 (82%), Gaps = 16/545 (3%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+Y+ NRISD NYVR+FDTTLRDGEQSPGA +T+ +KL +ARQLAKLGVD+I+AGFPA
Sbjct  58    RRPEYVANRISDQNYVRIFDTTLRDGEQSPGAALTSTQKLAIARQLAKLGVDVIDAGFPA  117

Query  488   ASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS  DFEAV+ IA+ VGN    + ++VPVICGL+RCN +D+  AWEAVKHA++PR+H FI
Sbjct  118   ASADDFEAVKTIAKTVGNEWDKKTDYVPVICGLARCNMKDVTDAWEAVKHARRPRIHVFI  177

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS++H+K KL  +RE+VVE A++ V +AR+LGC DV+FSPEDA RS++EFLY ILGEVI
Sbjct  178   STSDLHIKHKLRTTREKVVEMASNTVTFARNLGCDDVQFSPEDACRSEKEFLYSILGEVI  237

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLA-GA  1015
              AGATTLNI DTVG+++P EFGQLI+DIKANT GI +VIIS HC +DLGLSTANTLA  A
Sbjct  238   AAGATTLNIADTVGFSIPNEFGQLISDIKANTRGINDVIISVHCHDDLGLSTANTLAVSA  297

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQ+EVT+NGIGER GNASLEEVVMA+KCRG  VLGGLY+GINT+ II +SK++EE 
Sbjct  298   CAGARQIEVTVNGIGERGGNASLEEVVMAMKCRGPHVLGGLYSGINTRQIIPSSKLLEEC  357

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQ-DGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLS  1372
             TGL VQP+KAIVGANAF HESGIHQ DG+LKHK+TYEI++PED+GL RAN SGIVLGKLS
Sbjct  358   TGLHVQPNKAIVGANAFVHESGIHQLDGVLKHKNTYEIIAPEDVGLLRANNSGIVLGKLS  417

Query  1373  GRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISD-EVFQPQLVWK  1549
             GRHAL+++++ELGY++D ++ + +FWRFK++A++KK+++D D+IAL+SD E  + ++ WK
Sbjct  418   GRHALQSRLKELGYELDNEKLNVVFWRFKAIADQKKRVSDADIIALVSDGETTRYEVTWK  477

Query  1550  LGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSL  1729
             L D+QV CG+ G S ATVKL+D   EEH ACSVG GPVD+AYKAVDL+VK PV LLEYS 
Sbjct  478   LLDVQVVCGTAGQSMATVKLVDPKGEEHKACSVGNGPVDSAYKAVDLIVKEPVRLLEYST  537

Query  1730  TAVTEGIDAI--ASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGA  1903
               V  G+D+    +TRV I+ +    S         ++TFSG G GMD ++SSV AY+GA
Sbjct  538   NDVLGGVDSTTKTTTRVSIQTNPDFVSE--------DQTFSGVGEGMDFIVSSVEAYIGA  589

Query  1904  LNKML  1918
             LN ML
Sbjct  590   LNNML  594



>ref|NP_001237749.1| probable 2-isopropylmalate synthase [Glycine max]
 sp|Q39891.1|LEU1_SOYBN RecName: Full=Probable 2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate 
synthase; AltName: Full=Late nodulin-56; Short=N-56 [Glycine 
max]
 dbj|BAA07212.1| late nodulin [Glycine max]
Length=565

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/540 (64%), Positives = 429/540 (79%), Gaps = 2/540 (0%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP YIPN I D +YVR+ DTTLRDGEQSPGATMT KEKLD+ARQL KLGVDII+ GFP+A
Sbjct  19    RPQYIPNHIPDSSYVRILDTTLRDGEQSPGATMTAKEKLDIARQLVKLGVDIIQPGFPSA  78

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S +DF AV++IAQEVGN   +  +VPVI G  RC ++DI  AWEAVK+AK+PR+ T IAT
Sbjct  79    SNSDFMAVKMIAQEVGNAVDDDGYVPVIAGFCRCVEKDISTAWEAVKYAKRPRLCTSIAT  138

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IHM+ KL  S++QV++ A  MV +ARSLGC+D++F  EDA RSDREFLY+ILG VI+A
Sbjct  139   SPIHMEHKLRKSKDQVIQIARDMVKFARSLGCNDIQFGAEDATRSDREFLYEILGVVIEA  198

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATT+NI DTVG  +P E G+LI DIK NTPGI NVIISTHC NDLGL+TANT+ GA  G
Sbjct  199   GATTVNIADTVGIVMPLELGKLIVDIKDNTPGIANVIISTHCHNDLGLATANTIEGARTG  258

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVMAL  +G+  L GLYT INT+HI+  SKMVEEY+G+
Sbjct  259   ARQLEVTINGIGERAGNASLEEVVMALASKGDHALNGLYTRINTRHILETSKMVEEYSGM  318

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              +QPHK +VGANAF H SGIHQDGMLKHK TYE +SPE+IG  R  + GIVLGKLSG  A
Sbjct  319   HLQPHKPLVGANAFVHASGIHQDGMLKHKGTYETISPEEIGHKRTTRIGIVLGKLSGSQA  378

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ  1564
             L+ +++ELGYD+   E D +FW+FK++AEKKK +TD DL AL+S + F  + +WKLGDLQ
Sbjct  379   LRKRLEELGYDLKEDEVDSVFWQFKAMAEKKKVVTDVDLKALVSYKAFHAESIWKLGDLQ  438

Query  1565  VTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTE  1744
             VTCG++GLSTATVKL++ D   HVACS+G G VD+ YKA++L+VK P  LL+YSL +VTE
Sbjct  439   VTCGTIGLSTATVKLVNIDGSTHVACSIGIGAVDSTYKAINLIVKEPTKLLDYSLNSVTE  498

Query  1745  GIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             GI    + RV+I  +N+HTST+A T +    TFSG  A MD+V+S+V+AY+ ALNK+L +
Sbjct  499   GIGVNVTARVVICRENNHTSTYAFTEDANYPTFSGIAAEMDVVVSTVKAYLVALNKLLRW  558



>ref|XP_006307272.1| hypothetical protein CARUB_v10008887mg [Capsella rubella]
 gb|EOA40170.1| hypothetical protein CARUB_v10008887mg [Capsella rubella]
Length=511

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/423 (78%), Positives = 386/423 (91%), Gaps = 2/423 (0%)
 Frame = +2

Query  317   DYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASE  496
             +YIPNRISDPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAAS+
Sbjct  74    EYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  133

Query  497   ADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSE  670
              DFEAV+ IA+ +GN   E  +VPVICGLSRCN++DI+RAW+AVK+AK+PR+HTFIATS 
Sbjct  134   DDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSN  193

Query  671   IHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGA  850
             IH++ KL  ++ QV+E A SMV +ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA
Sbjct  194   IHLEHKLKKTKAQVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGA  253

Query  851   TTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGAR  1030
             TTLNIPDTVG TLP+EFGQLIADIKANTPGI+NVIISTHCQNDLGLSTANTL+GA++GAR
Sbjct  254   TTLNIPDTVGITLPSEFGQLIADIKANTPGIKNVIISTHCQNDLGLSTANTLSGAHSGAR  313

Query  1031  QVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLV  1210
             QVEVTINGIGERAGNASLEEVVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG+  
Sbjct  314   QVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQT  373

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QPHKAIVGANAFAHESGIHQDGMLKHK TYEI+ PE+IGL R+N +GIVLGKLSGRHALK
Sbjct  374   QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALK  433

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++ ELGYD+D ++   +FWRFK+VAE+KK++TD D+IAL+SDEVFQP+ VWKL D+QV 
Sbjct  434   DRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQVK  493

Query  1571  CGS  1579
              G+
Sbjct  494   LGT  496



>ref|XP_003538074.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=565

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/540 (64%), Positives = 424/540 (79%), Gaps = 2/540 (0%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP YIPN I D +YVR+ DTTLRDGEQSPGATMT KEKLD+ARQL KLGVDII+ GFP+A
Sbjct  19    RPQYIPNHIPDSSYVRILDTTLRDGEQSPGATMTAKEKLDIARQLVKLGVDIIQPGFPSA  78

Query  491   SEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S +DF AV++IAQEVGN  G+  +VPVI    RC ++DI  AWEAVK+AK+PR+ T IAT
Sbjct  79    SNSDFMAVKMIAQEVGNAVGDDGYVPVIASFCRCVEKDIATAWEAVKYAKRPRLCTSIAT  138

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IHM+ KL  S++QV++ A  MV +ARSLGC+D++F  EDA RSDREFLY+ILG VI+A
Sbjct  139   SPIHMEHKLRKSKDQVIQIARDMVKFARSLGCNDIQFGAEDATRSDREFLYEILGVVIEA  198

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATT+NI DTVG  +P E G+LI DIK NTPGI NVIISTHC NDLGL+TANT+ GA  G
Sbjct  199   GATTVNIADTVGIVMPLELGKLIVDIKDNTPGIANVIISTHCHNDLGLATANTIEGARTG  258

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVM L  +G+  L GLYT INT+HI+  SKMVEEY+G+
Sbjct  259   ARQLEVTINGIGERAGNASLEEVVMVLASKGDHALNGLYTRINTRHILETSKMVEEYSGM  318

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              +QPHK +VGANAF H SGIHQDGMLKHK TYE +SPE+IG  R  + GIVLGKLSG  A
Sbjct  319   HLQPHKPLVGANAFVHASGIHQDGMLKHKGTYETISPEEIGHKRTTRIGIVLGKLSGSQA  378

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ  1564
             L+ +++ELGYD+   E D +F +FK++AEKKK +TD DL AL+S +    + +WKLG LQ
Sbjct  379   LRKRLEELGYDLKEDEVDSVFRQFKAMAEKKKVVTDVDLKALVSHKACHAESIWKLGGLQ  438

Query  1565  VTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTE  1744
             VTCG++GLSTATVKL++ D   HVACS+G G VD+ YKA++L+VK P  LL+YSL +VTE
Sbjct  439   VTCGTIGLSTATVKLVNIDGSTHVACSIGIGAVDSTYKAINLVVKEPTKLLDYSLNSVTE  498

Query  1745  GIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             GI    + RV+I  +N+HTST+A T +    TFSG  A MD+V+S+ +AY+ ALNK+L +
Sbjct  499   GIGVNVTARVVICRENNHTSTYAFTEDANYPTFSGIAAEMDVVVSTAKAYLVALNKLLRW  558



>ref|XP_006443113.1| hypothetical protein CICLE_v10020218mg [Citrus clementina]
 gb|ESR56353.1| hypothetical protein CICLE_v10020218mg [Citrus clementina]
Length=433

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/416 (80%), Positives = 379/416 (91%), Gaps = 0/416 (0%)
 Frame = +2

Query  677   MKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATT  856
             M+ KL  +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILGEVIK GATT
Sbjct  1     MEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATT  60

Query  857   LNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQV  1036
             LNIPDTVG T+PTEFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+AGA AGARQV
Sbjct  61    LNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQV  120

Query  1037  EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQP  1216
             EVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+HI+MASKMVEEYTGL VQP
Sbjct  121   EVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQP  180

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             HKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R++++GIVLGKLSGRHALK +
Sbjct  181   HKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDR  240

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             ++ELGY+++ ++   +FW FK+VAE+KK++TD DLIAL+SDEVFQP++VWKL D+QVTCG
Sbjct  241   LKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEVFQPEVVWKLLDMQVTCG  300

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
             +LGLSTATVKL+DA+ EEHVACS GTGPVD+AYKAVDL+VK P TLLEYS+ AVT GIDA
Sbjct  301   TLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDA  360

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             IA+TRVLIRG+ S  STHA TG  V RTFSGTGAGMDIV+SSV+AY+GALNKML F
Sbjct  361   IATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGF  416



>ref|XP_002508720.1| 2-isopropylmalate synthase [Micromonas sp. RCC299]
 gb|ACO69978.1| 2-isopropylmalate synthase [Micromonas sp. RCC299]
Length=639

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/570 (62%), Positives = 430/570 (75%), Gaps = 24/570 (4%)
 Frame = +2

Query  278   GVVRCGLGAPR--------RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDV  433
             GV+R   GAP+        RP+YIPN+I D NYVRVFDTTLRDGEQSPGAT+T+KEKLD+
Sbjct  45    GVIRA-TGAPKDEDVVRAPRPEYIPNKIDDLNYVRVFDTTLRDGEQSPGATLTSKEKLDI  103

Query  434   ARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDR  607
             AR LAKLGVDIIEAGFP AS  D EAVR IA+ VGN      +VPVICGLSR N++DID 
Sbjct  104   ARNLAKLGVDIIEAGFPIASPDDLEAVRNIAKNVGNEVYPDGYVPVICGLSRANKKDIDA  163

Query  608   AWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPED  787
             AWE V+HAK+PR+HTFIATS+IHM+ KL  + ++VV+ A   V YARSLGC DVEFSPED
Sbjct  164   AWEGVRHAKRPRIHTFIATSKIHMESKLRKTPDEVVQIAVDGVTYARSLGCEDVEFSPED  223

Query  788   AGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTH  967
             AGRSD EFLY+IL  V++AGATTLNIPDTVG  LP EFG LIA IKAN PG    IISTH
Sbjct  224   AGRSDPEFLYRILAAVVEAGATTLNIPDTVGICLPEEFGALIAGIKANVPG--QYIISTH  281

Query  968   CQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTG  1147
             CQNDLGLSTAN+LAG   GARQVE TINGIGERAGNASLEEV M++  RG++ + G  TG
Sbjct  282   CQNDLGLSTANSLAGVANGARQVECTINGIGERAGNASLEEVAMSIWMRGQEKIFGARTG  341

Query  1148  INTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIG  1327
             IN  +I   SKMV EY+G+ VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI++PE IG
Sbjct  342   INPVYIYPCSKMVREYSGMAVQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPETIG  401

Query  1328  LHRAN-QSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK-KITDDDL  1501
               R     G+V+GK SGRHALK+K+++LG+ ++G E +++F RFK VAE+K   + DD++
Sbjct  402   YFRGEGDVGVVMGKHSGRHALKSKLKQLGFPLEGDELNEMFDRFKLVAEQKTGGVGDDEI  461

Query  1502  IALISDEVFQ---PQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAA  1672
             IAL++    Q     + WKL ++QV CG++GL TATVK+   D    +  +VGTGPVDAA
Sbjct  462   IALVTSGAGQGDDTAVTWKLDEVQVVCGTMGLPTATVKMTGPDAVTRINSAVGTGPVDAA  521

Query  1673  YKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHAL------TGNVVN  1834
             YKA+D L +V V L+EY++ AV EGI+++A TRV IR  +  T   A+      TGNV  
Sbjct  522   YKAIDGLCRVKVDLVEYTVNAVVEGIESLAQTRVSIRAKSDQTMPGAMMKANVQTGNVEA  581

Query  1835  RTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             RTF  TGA  DIV+SS RAYV ALN+M+SF
Sbjct  582   RTFMATGADSDIVVSSARAYVAALNRMISF  611



>gb|KHN42168.1| Putative 2-isopropylmalate synthase [Glycine soja]
Length=510

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/507 (64%), Positives = 411/507 (81%), Gaps = 4/507 (1%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGL  577
             MT+ +KL +ARQLAKLGVD+IE GFP+AS+ DF AV++IAQEVGN    +G +VPVI  L
Sbjct  1     MTSDQKLQIARQLAKLGVDVIEGGFPSASQEDFNAVKMIAQEVGNNCDADG-YVPVIAAL  59

Query  578   SRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLG  757
              RCN+RDI RAWEA+K+AK+PR+  FIA S IHM++KLN ++E+V++ AT M+ +AR LG
Sbjct  60    CRCNERDITRAWEALKYAKRPRLMPFIAVSPIHMEYKLNKTKEEVLQIATDMIKFARGLG  119

Query  758   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTP  937
             C+D++F  EDA RSDREFLYQIL EVIKAGATTL I DTVG T+P E  +L+A IKAN P
Sbjct  120   CTDIQFCSEDAARSDREFLYQILEEVIKAGATTLGIGDTVGITMPFEIRELVAGIKANVP  179

Query  938   GIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRG  1117
             G ENVIIS HC NDLG +TANT+  A AGA Q+EVTINGIGERAGNASLEEVVMALKCRG
Sbjct  180   GAENVIISIHCHNDLGHATANTIEAARAGAMQLEVTINGIGERAGNASLEEVVMALKCRG  239

Query  1118  EQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1297
             + VLGGLYTGINT+H++  SKMVEE++G+ +QPHKA+VG NAF HESG+HQ G+LKH+ T
Sbjct  240   DHVLGGLYTGINTRHLLKTSKMVEEFSGMYLQPHKAVVGDNAFLHESGVHQAGLLKHRGT  299

Query  1298  YEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK  1477
             YEI+SPEDIG  ++N   +VLGKLSGR ALK++++ELGY++  +E + +F  FK++AEKK
Sbjct  300   YEILSPEDIGHEKSNGVNMVLGKLSGRQALKSRLKELGYELRDEEVESVFRNFKAIAEKK  359

Query  1478  KKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTG  1657
             K++TD DL AL+SD+    + +WKLG LQVTCG++G STAT+KL+ +D   HVACSVG G
Sbjct  360   KRVTDVDLKALVSDQASHAEPIWKLGGLQVTCGTMGSSTATIKLVTSDGSTHVACSVGVG  419

Query  1658  PVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNR  1837
             PVD+AYKA++L+VK  V +LEYS + VT G DAIA+TRV+IR +N  + T AL GNV+  
Sbjct  420   PVDSAYKAINLIVKETVKVLEYSPSTVTGGTDAIATTRVVIRRENKQSPTPALNGNVIYP  479

Query  1838  TFSGTGAGMDIVISSVRAYVGALNKML  1918
             TFSGTG G+DIV SSV AY+ ALNKML
Sbjct  480   TFSGTGEGVDIVTSSVEAYITALNKML  506



>gb|KFM22835.1| 2-isopropylmalate synthase A [Auxenochlorella protothecoides]
Length=534

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/510 (66%), Positives = 403/510 (79%), Gaps = 12/510 (2%)
 Frame = +2

Query  281   VVRCGLGAPR----RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLA  448
             V R   G+ R    RP+YIPNRI DPNYVRVFDTTLRDGEQSPGAT+T+KEK+++A+QL 
Sbjct  24    VTRASAGSARPQRKRPEYIPNRIDDPNYVRVFDTTLRDGEQSPGATLTSKEKMEIAKQLQ  83

Query  449   KLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEA  619
             KLGVD+IEAGFP AS  DFEAVR IA EVGN    +G +VP ICGLSR  + D++RAW+A
Sbjct  84    KLGVDVIEAGFPIASPDDFEAVRSIAMEVGNNVDADG-YVPAICGLSRSREADLERAWDA  142

Query  620   VKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRS  799
             V+HA+ PRVH F+ATS IHM+ KL M+ +QV+ +A   V + RSLGC D+EFSPEDA RS
Sbjct  143   VRHARHPRVHVFLATSPIHMEHKLRMTPDQVIRQAVESVKHLRSLGCKDIEFSPEDATRS  202

Query  800   DREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFG---QLIADIKANTPGIENVIISTHC  970
                FLY++L EVIKAGATTLNIPDT G++LP EF     LI D++AN  G  +VI STHC
Sbjct  203   HPTFLYEVLAEVIKAGATTLNIPDTTGWSLPHEFQVLRGLITDLRANVHGANDVIFSTHC  262

Query  971   QNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGI  1150
             QNDLGLSTAN+LAGA  GARQVE TINGIGERAGNASLEE+VMA+  RGE+ LGGL+TGI
Sbjct  263   QNDLGLSTANSLAGAMGGARQVECTINGIGERAGNASLEEIVMAIALRGERQLGGLWTGI  322

Query  1151  NTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGL  1330
             N  HI + SKMV +Y+G+ VQPHKAIVGANAFAHESGIHQDGMLK +DTYEIM+PE IGL
Sbjct  323   NPVHIAVTSKMVCDYSGMPVQPHKAIVGANAFAHESGIHQDGMLKSRDTYEIMTPESIGL  382

Query  1331  HRANQSGIVLGKLSGRHALKTKMQELGY-DIDGKEFDDLFWRFKSVAEKKKKITDDDLIA  1507
              RA+  G+VLGK SGRHAL T++ ELGY D+  +   +LF RFK +A+KKK I D+DL+A
Sbjct  383   ARASGVGLVLGKHSGRHALSTRLAELGYGDLPAERVAELFRRFKDLADKKKDIADEDLLA  442

Query  1508  LISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVD  1687
             L+ D V QP+ VW LGDLQV CGS+GL TATVKLI  D    VA  +GTGPVDAAYKA+D
Sbjct  443   LVQDGVHQPEAVWALGDLQVVCGSMGLPTATVKLIGPDGLPRVAAGMGTGPVDAAYKAID  502

Query  1688  LLVKVPVTLLEYSLTAVTEGIDAIASTRVL  1777
              LV+VP  L++YS+  VTEGI+A+A TRV+
Sbjct  503   SLVRVPARLVDYSMNGVTEGIEALAVTRVI  532



>gb|ACJ85684.1| unknown [Medicago truncatula]
Length=416

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/416 (77%), Positives = 372/416 (89%), Gaps = 1/416 (0%)
 Frame = +2

Query  677   MKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATT  856
             M+FKL MS++QV++KA +MVA+ARSLGC DVEFSPEDAGRSDREFLYQILGEVIKAGATT
Sbjct  1     MEFKLRMSKQQVIDKARTMVAFARSLGCQDVEFSPEDAGRSDREFLYQILGEVIKAGATT  60

Query  857   LNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQV  1036
             LNIPDTVG T+P+EFG+LIADIKANTPG+ENVIISTHCQNDLGLSTANT+ GA AGARQ+
Sbjct  61    LNIPDTVGITMPSEFGKLIADIKANTPGVENVIISTHCQNDLGLSTANTIEGARAGARQL  120

Query  1037  EVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQP  1216
             EVTINGIGERAGNASLEEVVMALKC G  +   L+TGINT+HI + S+MVEEY+GL +QP
Sbjct  121   EVTINGIGERAGNASLEEVVMALKCGG-HIFNNLFTGINTRHIYLTSRMVEEYSGLQLQP  179

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             HKA+VGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL  +N++GIVLGKLSGRHA++ +
Sbjct  180   HKALVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLEGSNEAGIVLGKLSGRHAMRKR  239

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             ++ELGY++   + + LFWRFK+VAE+KK+ITD DL AL+SDEVFQ + +WKL DLQVTCG
Sbjct  240   LEELGYELKDDQVESLFWRFKAVAEQKKRITDADLRALVSDEVFQAEPIWKLDDLQVTCG  299

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
             +LGLSTATVKL+  D   H+ACSVGTGPVD+AYKAVDL+VK P TLLEYS+ AVTEGIDA
Sbjct  300   TLGLSTATVKLVGDDGSAHIACSVGTGPVDSAYKAVDLIVKEPATLLEYSMIAVTEGIDA  359

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             IA+TRV+IRGD   TSTHALTG  V RTFSGTGAGMD+V+SSV+AY+ A+NKMLSF
Sbjct  360   IATTRVVIRGDTDQTSTHALTGESVQRTFSGTGAGMDVVVSSVKAYIAAINKMLSF  415



>ref|WP_013558760.1| 2-isopropylmalate synthase [Anaerolinea thermophila]
 ref|YP_004172963.1| 2-isopropylmalate synthase [Anaerolinea thermophila UNI-1]
 dbj|BAJ62363.1| 2-isopropylmalate synthase [Anaerolinea thermophila UNI-1]
Length=541

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/525 (64%), Positives = 410/525 (78%), Gaps = 7/525 (1%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             +YVR+FDTTLRDGEQSPGAT+T+ EKL+VAR LA+LGVD+IEAGFPAAS  D EAVR IA
Sbjct  4     DYVRIFDTTLRDGEQSPGATLTSAEKLEVARGLARLGVDVIEAGFPAASPDDLEAVRRIA  63

Query  527   QEVGN-GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
              EVGN  +G H P+ICGL+R  + DID+AWEAV+ A+ PR+HTF+ATSEIHM++KL M+R
Sbjct  64    VEVGNPADGGHAPIICGLARATRSDIDKAWEAVRPARHPRIHTFLATSEIHMQYKLRMTR  123

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             +QV+E+   MV+YARSL C DVEFSPEDAGRSD  FLY++LG  I+AGATTLNIPDTVGY
Sbjct  124   QQVLERVEEMVSYARSL-CEDVEFSPEDAGRSDPAFLYEVLGVAIRAGATTLNIPDTVGY  182

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
             T P EFG LIA I  +TPGIE+ I+S HC NDLGL+TANTLAG  AGARQ EVTINGIGE
Sbjct  183   TTPDEFGALIAGILRHTPGIEHCIVSVHCHNDLGLATANTLAGLRAGARQAEVTINGIGE  242

Query  1064  RAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANA  1243
             RAGN +LEEVVMAL  R    L GL TGI+T  I   SK+V  YTG+ VQP+KAIVGANA
Sbjct  243   RAGNTALEEVVMALHTRPN--LYGLRTGIDTTQITRLSKLVSNYTGMPVQPNKAIVGANA  300

Query  1244  FAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDID  1423
             FAHE+GIHQDGMLKH  TYEIM PE +G   A QS +VLGK SGRHALKT++  LGY + 
Sbjct  301   FAHEAGIHQDGMLKHTLTYEIMRPETVG---ATQSKLVLGKHSGRHALKTRLASLGYALG  357

Query  1424  GKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATV  1603
               E D +F RFK++A++KK ITD DL AL+SDE++QP+ ++ L  LQV CG++G+ TATV
Sbjct  358   EDEMDQVFERFKNLADRKKVITDADLEALVSDELYQPRELYALDGLQVACGTMGMPTATV  417

Query  1604  KLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIR  1783
             +L   D + HV  +VGTGPVDA YKA+D +V VP+TLLE+ + AVTEGIDA+    V I+
Sbjct  418   RLRGPDGQLHVHAAVGTGPVDATYKAIDAIVGVPITLLEFVVHAVTEGIDALGEVTVRIQ  477

Query  1784  GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             G++  +S  A   + + RTF G GA  DIV++S +AY+ ALNK+L
Sbjct  478   GEDGLSSVSAQREDDLPRTFGGYGADTDIVVASAKAYLAALNKLL  522



>gb|KCW87846.1| hypothetical protein EUGRSUZ_A00246 [Eucalyptus grandis]
Length=514

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/494 (69%), Positives = 388/494 (79%), Gaps = 42/494 (9%)
 Frame = +2

Query  443   LAKLGVDIIEAGFPAASEADFEAVRLIAQEVGNGEGEH--VPVICGLSRCNQRDIDRAWE  616
             LAKL VDIIEAGFP AS  DF AV+ IA EVGN    H  +PVICGLSRCN++DI  AW+
Sbjct  57    LAKLSVDIIEAGFPTASSYDFVAVKAIALEVGNAIDPHSYIPVICGLSRCNEKDILTAWD  116

Query  617   AVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGR  796
             AV+ A++PR+HTFIATS IHM++KL  S+++V++ A  MVA+A SLGC DVEFSPEDAGR
Sbjct  117   AVRFARRPRIHTFIATSGIHMQYKLKKSKQEVIDIARRMVAFAWSLGCDDVEFSPEDAGR  176

Query  797   SDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQN  976
             S+REFLY+ILGEVIKAGATTLNIPDTVG T+P EFG+LIADIK NTPGIENVIISTHC N
Sbjct  177   SEREFLYEILGEVIKAGATTLNIPDTVGITMPEEFGKLIADIKVNTPGIENVIISTHCHN  236

Query  977   DLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1156
             DLGLSTANT+AGA AGARQVEVTINGIGERAGNASLEEVVMALKC+G  +LGGLYTGINT
Sbjct  237   DLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMALKCKGGSILGGLYTGINT  296

Query  1157  QHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHR  1336
             +HIIM SKMVE Y+ L VQPHKAIVGANAFAHESGIHQDGMLKH  TYEI+SP+DIG  R
Sbjct  297   RHIIMTSKMVEGYSDLYVQPHKAIVGANAFAHESGIHQDGMLKHTGTYEIISPDDIGHER  356

Query  1337  ANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS  1516
              N+ GIVLGKL  RH                        F  VAE    IT+ D+ AL+S
Sbjct  357   TNEVGIVLGKL--RH------------------------FIIVAEHMFSITNADIRALVS  390

Query  1517  DEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLV  1696
             DE              V+CG+LGLSTATVKLI AD +E +AC+VGTGPVD+AYKAVDL+V
Sbjct  391   DE--------------VSCGTLGLSTATVKLISADGKELIACAVGTGPVDSAYKAVDLIV  436

Query  1697  KVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVI  1876
             KVP  LLEYS+ A TE IDAIA+T+VLIR  N+H ST ALTG  +++TFSGTG+ MDI +
Sbjct  437   KVPAMLLEYSMAAFTEDIDAIATTQVLIRDKNNHMSTLALTGETIHQTFSGTGSSMDIAV  496

Query  1877  SSVRAYVGALNKML  1918
             SSVRAY+GALNKM 
Sbjct  497   SSVRAYIGALNKMF  510



>gb|EPS60107.1| hypothetical protein M569_14697, partial [Genlisea aurea]
Length=385

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/381 (85%), Positives = 352/381 (92%), Gaps = 2/381 (1%)
 Frame = +2

Query  794   RSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQ  973
             RSDR FLY+IL EVI AGATTLNIPDTVGYTLP+EFGQLIADIKANTPGIENVIISTHCQ
Sbjct  1     RSDRTFLYKILAEVIAAGATTLNIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTHCQ  60

Query  974   NDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIN  1153
             NDLGLSTANT+AGA+AGARQ+EVTINGIGERAGNASLEEVVMALKCRGEQ L GLYTGIN
Sbjct  61    NDLGLSTANTIAGAHAGARQLEVTINGIGERAGNASLEEVVMALKCRGEQALDGLYTGIN  120

Query  1154  TQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLH  1333
             T+HI+MASKMVEEY+GL VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI+SPED+GL 
Sbjct  121   TKHIVMASKMVEEYSGLRVQPHKAIVGANAFAHESGIHQDGMLKNKSTYEIISPEDVGLT  180

Query  1334  RANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI  1513
             R+N+SGIVLGKLSGRHALK KM ELGYDIDGKE DDLF RFK VA  KK ITDDDL+AL+
Sbjct  181   RSNESGIVLGKLSGRHALKAKMLELGYDIDGKELDDLFTRFKDVAGNKKIITDDDLVALV  240

Query  1514  SDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLL  1693
             SDEVFQP +VWKL  +QVTCG+LGLSTATVKL+DA+ +EHV+CSVGTGPVDAAYKAVDL+
Sbjct  241   SDEVFQPTVVWKLEAVQVTCGTLGLSTATVKLVDANGKEHVSCSVGTGPVDAAYKAVDLV  300

Query  1694  VKVPVTLLEYSLTAVTEGIDAIASTRVLIRGD-NSHT-STHALTGNVVNRTFSGTGAGMD  1867
             VKVPVTLLEY++ +VT+GIDAIASTRVLIRGD NS T +THALTG  VNR FSGTGA MD
Sbjct  301   VKVPVTLLEYTMNSVTQGIDAIASTRVLIRGDGNSVTETTHALTGEPVNRAFSGTGAAMD  360

Query  1868  IVISSVRAYVGALNKMLSFTT  1930
             IVISSVRAYVGALNK++ FTT
Sbjct  361   IVISSVRAYVGALNKLIGFTT  381



>ref|XP_001415634.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93926.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=624

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/558 (61%), Positives = 411/558 (74%), Gaps = 12/558 (2%)
 Frame = +2

Query  293   GLGAPRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIE  472
             G+    RP Y+P  ISDP YVRVFDTTLRDGEQSPGAT+T+KEKLD+A  LA+LGVDIIE
Sbjct  56    GVARAPRPAYVPGVISDPKYVRVFDTTLRDGEQSPGATLTSKEKLDIATSLARLGVDIIE  115

Query  473   AGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRV  646
             AGFP AS  D EAVR IA++VGN   E  +VPVICGLSR N++DID AWE V+HA +PR+
Sbjct  116   AGFPIASPDDLEAVRGIAKKVGNEVYEDGYVPVICGLSRANKKDIDAAWEGVRHALRPRI  175

Query  647   HTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQIL  826
             HTFIATS IHM+ KL  + ++VV  A   V YARSLGC DVEFSPEDAGRSD EFLY+IL
Sbjct  176   HTFIATSPIHMESKLRKTPDEVVAIAVEAVKYARSLGCDDVEFSPEDAGRSDPEFLYRIL  235

Query  827   GEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL  1006
               V++AGATTLNIPDTVG  LP EFGQLIA IKAN  GIE  +ISTHCQNDLGLSTAN+L
Sbjct  236   SAVVEAGATTLNIPDTVGICLPDEFGQLIAGIKANVKGIEGAVISTHCQNDLGLSTANSL  295

Query  1007  AGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMV  1186
             AG   GARQVE TINGIGERAGNASLEEV M++  RG+  L G YTGIN  +I   S+MV
Sbjct  296   AGVANGARQVECTINGIGERAGNASLEEVAMSIFMRGQSRLAGAYTGINPVYIYPTSQMV  355

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRA-NQSGIVLG  1363
             + Y+G+ +QPHKAIVGANAFAHESGIHQDGMLK+K TYEI++PE IG  R  N  G+V+G
Sbjct  356   KNYSGMAIQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPEQIGYFRGENDVGVVMG  415

Query  1364  KLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK-KKITDDDLIALISDEVFQPQL  1540
             K SGRHAL +K+++LG  ++G   D++F RFK VAE K   + DD+L+A++ D       
Sbjct  416   KHSGRHALSSKLKQLGVPMEGDALDEVFNRFKLVAETKLGGVNDDELLAIVRDGESVQDP  475

Query  1541  VWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLE  1720
              W L  +QV CG+ GL TATVK++  D   H++  VGTGPVDAA+KA+D LV + V L E
Sbjct  476   AWSLETVQVVCGTTGLPTATVKMLAKDGTVHISAVVGTGPVDAAFKAIDALVGLDVVLTE  535

Query  1721  YSLTAVTEGIDAIASTRVLIRGDNSHTS--------THALTGNVVNRTFSGTGAGMDIVI  1876
             Y +TAVT+GI+++A T + ++               T+  TG    R+F+ TGA  DIV+
Sbjct  536   YRVTAVTKGINSLAETTITVKPREGAEQKLGADVFKTNLQTGETAVRSFTATGADTDIVV  595

Query  1877  SSVRAYVGALNKMLSFTT  1930
             SS RAYV ALN+M  + T
Sbjct  596   SSARAYVIALNRMTEYVT  613



>ref|XP_002286323.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95964.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=658

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/554 (61%), Positives = 413/554 (75%), Gaps = 16/554 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIP +ISDP+YVR+FDTTLRDGEQSPGAT+T+ EKL++AR LAKLGVDIIEAGFP A
Sbjct  72    RPEYIPGKISDPDYVRIFDTTLRDGEQSPGATLTSSEKLEIARNLAKLGVDIIEAGFPIA  131

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  DF  V+ IA  VGN   E  +VPVI GLSR N++DI RAW+AVK A +PR+HTFIAT
Sbjct  132   SPDDFNGVKQIADVVGNEVFEDGYVPVIAGLSRANEKDIARAWDAVKGAMRPRIHTFIAT  191

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             SEIHMK KLN + ++VVE A + V +A+ LGC D+EFSPEDAGRSD EFLY+ILG VI+A
Sbjct  192   SEIHMKSKLNKTPDEVVEIAVNAVTFAKGLGCDDIEFSPEDAGRSDPEFLYRILGRVIEA  251

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDT G+ +P EFG+LI  ++ N PG ENV+ STHCQNDLGL+TAN+L+GA  G
Sbjct  252   GATTLNIPDTTGWNMPWEFGELIKKLRENVPGAENVVFSTHCQNDLGLATANSLSGALNG  311

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRG-EQVLGG-----LYTGINTQHIIMASKMV  1186
             ARQ+E TINGIGERAGNASLEEVVM+L  +G EQ  GG     LYT IN  +I   SKMV
Sbjct  312   ARQLECTINGIGERAGNASLEEVVMSLALKGDEQFKGGPGTGKLYTAINPVYITPTSKMV  371

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQ---SGIV  1357
              EYTG+  QPHKAIVGANAF HESGIHQDGM+K K TYEIM+PE IGL R      +GIV
Sbjct  372   SEYTGMKCQPHKAIVGANAFQHESGIHQDGMIKDKSTYEIMTPESIGLMRGESQSGAGIV  431

Query  1358  LGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK-KITDDDLIALISDEVFQP  1534
             LGK SGR+A+ T+++E+GYD+D  + + +F RFK VAEKKK  + DDDL +L+ D+    
Sbjct  432   LGKHSGRNAVGTRLREMGYDLDMDKLNAVFARFKEVAEKKKGGLDDDDLESLVMDQSQST  491

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
               +WK+  LQ T G  G+ T+TVK++  D  E    + GTGPVDA YKA+D ++ V V L
Sbjct  492   NELWKVTGLQTTTGISGIPTSTVKMMGPDGVERFVSATGTGPVDAVYKAIDQIMGVSVEL  551

Query  1715  LEYSLTAVTEGIDAIASTRVLI----RGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISS  1882
               YS+ +V EGI+A+ASTRV+I     G N      A T  +  R FSG+G+  DI+ SS
Sbjct  552   ESYSMNSVNEGIEALASTRVVIVPNANGPNDSVVMDAQTSQLRERKFSGSGSDTDIITSS  611

Query  1883  VRAYVGALNKMLSF  1924
              RAYV ALNK+L++
Sbjct  612   ARAYVSALNKLLTW  625



>ref|XP_005851963.1| hypothetical protein CHLNCDRAFT_133663 [Chlorella variabilis]
 gb|EFN59861.1| hypothetical protein CHLNCDRAFT_133663 [Chlorella variabilis]
Length=564

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/547 (60%), Positives = 409/547 (75%), Gaps = 57/547 (10%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+Y+PNRI DP+YVR+FDTTLRDGEQSPGAT+T+KEKL++A++L++LGVDIIEAGFP A
Sbjct  42    RPEYVPNRIDDPDYVRIFDTTLRDGEQSPGATLTSKEKLEIAKKLSQLGVDIIEAGFPIA  101

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  DFEAVR IA +VGN   +  +VPVICGLSR  ++D++ AWEAV+HAK PRVHTFIAT
Sbjct  102   SPDDFEAVRAIAMDVGNAVHDDGYVPVICGLSRTREKDLETAWEAVRHAKLPRVHTFIAT  161

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             SEIHMK+KL MS +QV+E A + V + RSLGCSD+EFSPEDAGRS+  FLY+IL EVIKA
Sbjct  162   SEIHMKYKLRMSPDQVIENAVNAVKHLRSLGCSDIEFSPEDAGRSEPAFLYEILAEVIKA  221

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDT G+TLP EF  LI+ IKANTPG E VIISTHCQNDLGLSTAN+LAGA  G
Sbjct  222   GATTLNIPDTTGWTLPHEFQSLISKIKANTPGAEGVIISTHCQNDLGLSTANSLAGAMGG  281

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+E TINGIGERAGNASLEEVVMA+  RG+  +GGL+TG                   
Sbjct  282   ARQIECTINGIGERAGNASLEEVVMAIALRGKDQMGGLWTGA------------------  323

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
                   AIVGANAFAHESGIHQDGMLK++DTYEIMSPE IGL R + +GIVLGK SGR+A
Sbjct  324   ----RPAIVGANAFAHESGIHQDGMLKNRDTYEIMSPETIGLQRVDAAGIVLGKHSGRNA  379

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQ  1564
             L T++ +LG+ +   + +D+F RFK++A++KK I+D+D++AL++DEV QP +VW L  LQ
Sbjct  380   LNTRLGQLGFQLPEDQLNDVFRRFKNLADRKKNISDEDVLALVNDEVHQPTVVWVLEGLQ  439

Query  1565  VTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTE  1744
             V CGS+GL TAT                          A+D LV+V   L++YS+ +VTE
Sbjct  440   VVCGSMGLPTAT--------------------------AIDSLVRVQAELVDYSVNSVTE  473

Query  1745  GIDAIASTRVLIR-----GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALN  1909
             GI+A+A+TRV+IR      D  + +++   G    R+FSG+GA  DIV+SS RAYV ALN
Sbjct  474   GIEALANTRVVIRPAGKQADEGYVASY--KGGRTQRSFSGSGADEDIVVSSARAYVSALN  531

Query  1910  KMLSFTT  1930
             KM+ F +
Sbjct  532   KMIGFIS  538



>ref|XP_002178632.1| 2-isopropylmalate synthase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50297.1| 2-isopropylmalate synthase [Phaeodactylum tricornutum CCAP 1055/1]
Length=663

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/555 (61%), Positives = 416/555 (75%), Gaps = 18/555 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP YIP +I DP+YVR+FDTTLRDGEQSPGAT+T+ EKL++A+ LAKLGVD+IEAGFP A
Sbjct  76    RPAYIPGKIDDPDYVRIFDTTLRDGEQSPGATLTSAEKLEIAQMLAKLGVDVIEAGFPIA  135

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  DF AV+ IA  VGN   E  +VPVICGLSR NQ+DI  AW+AVK AK PRVHTFIAT
Sbjct  136   SPDDFNAVKQIADIVGNDVFEDGYVPVICGLSRANQKDIQTAWDAVKGAKLPRVHTFIAT  195

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHM+ KLN + +QVVE A   V +A+SLGC+D+EFSPEDAGRSD  FLY+IL EVI A
Sbjct  196   SQIHMETKLNKTPDQVVEIAVEAVKFAKSLGCNDIEFSPEDAGRSDPVFLYRILSEVIVA  255

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDT G+ +P EFG LI  ++ N  G ENV+ STHCQNDLGL+TAN+L+GA  G
Sbjct  256   GATTLNIPDTTGWNMPWEFGDLIKQLRENVKGAENVVFSTHCQNDLGLATANSLSGALNG  315

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGG------LYTGINTQHIIMASKMV  1186
             ARQ+E TINGIGERAGNASLEE+VM+L  +G     G      L+T +N  +I   SKMV
Sbjct  316   ARQLECTINGIGERAGNASLEEIVMSLALKGATKFSGGPGTGKLFTAVNPVYITPTSKMV  375

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQ---SGIV  1357
              EYTG+  QPHKAIVGANAF HESGIHQDGM+K+K TYEIM+PE IGL R      +GIV
Sbjct  376   SEYTGMACQPHKAIVGANAFQHESGIHQDGMIKNKSTYEIMTPESIGLMRGESQSGAGIV  435

Query  1358  LGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK-KITDDDLIALISDEVFQP  1534
             LGK SGR+A+ T+++ELGYD+D ++ + +F RFK VAE+KK  + D+DL AL+SD+    
Sbjct  436   LGKHSGRNAVGTRLRELGYDLDTEKLNAVFVRFKQVAERKKGGLEDEDLEALVSDQAGLS  495

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADD-EEHVACSVGTGPVDAAYKAVDLLVKVPVT  1711
              L+W++  LQV  G  G+ TATVK++  D  E +VAC+ GTGPVDA YKA+D ++ V V 
Sbjct  496   NLLWEVTGLQVATGLSGIPTATVKMLGPDGLERYVACT-GTGPVDAVYKAIDQIMGVSVR  554

Query  1712  LLEYSLTAVTEGIDAIASTRVLIR----GDNSHTSTHALTGNVVNRTFSGTGAGMDIVIS  1879
             L  Y L +VTEGI+A+A+TRV+I     G N   S H+ TG   NR FSG+G+  DI+ S
Sbjct  555   LEAYQLNSVTEGIEAMATTRVVIAPLEGGPNDSISIHSQTGVSRNRKFSGSGSDTDIITS  614

Query  1880  SVRAYVGALNKMLSF  1924
             S RAYV ALNK+L +
Sbjct  615   SARAYVSALNKLLKW  629



>ref|XP_008392601.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Malus 
domestica]
Length=474

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/393 (78%), Positives = 353/393 (90%), Gaps = 2/393 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRPDYIPNRISDPNYVR+FDTTLRDGEQSPGA++T+ EKLD+ARQLAKLGVDIIEAGFPA
Sbjct  77    RRPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSXEKLDIARQLAKLGVDIIEAGFPA  136

Query  488   ASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             +S+ D EAV++IA+EVGN   +  +VPVICGLSRCN+ DI  AW+AVK+AK+PR+HTFIA
Sbjct  137   SSKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNKNDIQTAWDAVKYAKRPRIHTFIA  196

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IH+++KL  S+EQV+E A +MV +AR LGC DVEFSPEDAGRS+REFLYQILGEVIK
Sbjct  197   TSPIHLEYKLRKSKEQVIEIARNMVKFARELGCDDVEFSPEDAGRSEREFLYQILGEVIK  256

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
             AGATTLNIPDTVGY +P E+ QLIADIK+NTPGI+NVIISTHCQNDLGLSTANTLAGA A
Sbjct  257   AGATTLNIPDTVGYNVPEEYRQLIADIKSNTPGIDNVIISTHCQNDLGLSTANTLAGACA  316

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQ+EVTINGIGERAGNASLEEVV+ L CRGE VLGGLYTGINT+HI + SKMVEEYTG
Sbjct  317   GARQLEVTINGIGERAGNASLEEVVLTLNCRGEXVLGGLYTGINTKHIYVTSKMVEEYTG  376

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             L VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSGRH
Sbjct  377   LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRH  436

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK  1480
             AL+ ++ ELGY+++  +   +F RFK+VAE+KK
Sbjct  437   ALRNRLAELGYELENDQLATIFERFKAVAEQKK  469



>ref|XP_003074581.1| Putative 2-isopropylmalate synthase (ISS) [Ostreococcus tauri]
Length=586

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/552 (60%), Positives = 414/552 (75%), Gaps = 15/552 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP Y+P  ISDP YVRVFDTTLRDGEQSPGAT+T++EKLD+A  LAKLGVD+IEAGFP A
Sbjct  23    RPAYVPGVISDPKYVRVFDTTLRDGEQSPGATLTSREKLDIATSLAKLGVDVIEAGFPIA  82

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  D EAVR IA++VGN   E  +VPVICGLSR N++DID AWE V+HA +PR+HTFIAT
Sbjct  83    SPDDLEAVRGIAKKVGNEVYEDGYVPVICGLSRANKKDIDAAWEGVRHALRPRIHTFIAT  142

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHM +KL  + ++VV+ A   V YARSLGC DVEFSPEDAGRSD +FLY+IL  V++A
Sbjct  143   SQIHMDYKLRKTPDEVVQIAVDAVKYARSLGCEDVEFSPEDAGRSDPQFLYRILNAVVEA  202

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGI-ENVIISTHCQNDLGLSTANTLAGAYA  1021
             GATTLNIPDTVG  LP EFG LI  IK N  G  E V+ISTHCQNDLGLSTAN+LAG   
Sbjct  203   GATTLNIPDTVGICLPDEFGTLIKGIKENVKGAGETVVISTHCQNDLGLSTANSLAGVAN  262

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVE TINGIGERAGNASLEEV MA+  RG++ L G YTGIN  +I  +S+MV+ ++G
Sbjct  263   GARQVECTINGIGERAGNASLEEVTMAIFMRGQERLMGAYTGINPVYIYPSSQMVKNFSG  322

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRA-NQSGIVLGKLSGR  1378
             + +QPHKAIVGANAFAHESGIHQDGMLK+K TYEI++PE IG  R  ++ G+V+GK SGR
Sbjct  323   MAIQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPEQIGYFRGEDECGVVMGKHSGR  382

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK-KKITDDDLIALISDEVFQPQLVWKLG  1555
             HAL +K+++LG  ++G   D++F RFK VAE K   + DD+L+A++ D        W L 
Sbjct  383   HALSSKLKQLGVPMEGAALDEVFNRFKLVAETKLGGVNDDELLAIVRDGESVQDPAWSLE  442

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
              +QV CG+ GL TATV++ + D  +H++  VGTGPVDAA+KA+D LV + V L EY +TA
Sbjct  443   TVQVVCGTTGLPTATVRMNNRDGTQHISAVVGTGPVDAAFKAIDALVGLDVVLTEYRVTA  502

Query  1736  VTEGIDAIASTRVLIR---------GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
             VT+GI+++A T + I+         G + +  T+  TG    R F+ TGA  DIV+SS R
Sbjct  503   VTKGINSMAETTITIKPKEGVEQKLGTDVY-KTNVQTGEKTMRAFTATGADTDIVVSSAR  561

Query  1889  AYVGALNKMLSF  1924
             AYV ALN+M+ +
Sbjct  562   AYVIALNRMVEY  573



>ref|XP_003063010.1| 2-isopropylmalate synthase [Micromonas pusilla CCMP1545]
 gb|EEH52949.1| 2-isopropylmalate synthase [Micromonas pusilla CCMP1545]
Length=649

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/551 (61%), Positives = 413/551 (75%), Gaps = 15/551 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+Y+P+RI DPNYVRVFDTTLRDGEQSPGAT+T+ EKLD+AR LAKLGVDIIEAGFP A
Sbjct  73    RPEYVPSRIDDPNYVRVFDTTLRDGEQSPGATLTSSEKLDIARNLAKLGVDIIEAGFPIA  132

Query  491   SEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  D EAVR IA+ VGN   E  +VPVICGLSR N++DID +WE V+HA +PR+HTFIAT
Sbjct  133   SPDDLEAVRNIAKIVGNERFEDGYVPVICGLSRANKKDIDASWEGVRHAIRPRIHTFIAT  192

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHM+ KL  + ++VV+ A   V YARSLGC DVEFSPEDAGRSD +FL++IL  V+ A
Sbjct  193   SKIHMESKLRKTPDEVVQIAVDAVKYARSLGCDDVEFSPEDAGRSDPKFLHRILTAVVDA  252

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDTVG  LP EFG LIA IK N PG    +ISTHCQNDLGLSTAN+LAG   G
Sbjct  253   GATTLNIPDTVGVCLPEEFGTLIAGIKENVPG--EYVISTHCQNDLGLSTANSLAGVANG  310

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQ--VLGGLYTGINTQHIIMASKMVEEYT  1198
             ARQVE TINGIGERAGNASLEEV MA+  RG+    + G +TGIN  +I   SKMV++++
Sbjct  311   ARQVECTINGIGERAGNASLEEVAMAIWLRGQDKTAIYGAFTGINPVYIYPCSKMVKDFS  370

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS-GIVLGKLSG  1375
             G+ VQPHKAIVGANAFAHESGIHQDGMLK+K TYEI++PE IG  R   S G+V+GK SG
Sbjct  371   GMSVQPHKAIVGANAFAHESGIHQDGMLKNKKTYEIIAPETIGYFRGEDSVGVVMGKHSG  430

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK-KITDDDLIALISDEVFQ------P  1534
             RHAL +K+++LGY ++G   D++F RFK VAE+K   + DD++IAL++ E  Q       
Sbjct  431   RHALSSKLKQLGYPLEGDALDEMFNRFKLVAEQKTGGVDDDEIIALVTCEGSQFAGDVDK  490

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKV-PVT  1711
                WKL D+QV CG++GL TATVK+   D    V   VG+GPVDA YKA+D +V    V 
Sbjct  491   SASWKLEDVQVVCGTMGLPTATVKMCGPDGMSRVRSEVGSGPVDATYKAIDGIVAAGKVE  550

Query  1712  LLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRA  1891
             L+EYS+ AV EGI+++A TRV +R  +S       +G +  RTF+ +GA  DIV++S RA
Sbjct  551   LVEYSVNAVVEGIESLAETRVRVRPMDSVAMKAKSSGEMEARTFTASGADTDIVVASARA  610

Query  1892  YVGALNKMLSF  1924
             YV A N+M+ F
Sbjct  611   YVAATNRMIGF  621



>emb|CEF96841.1| 2-isopropylmalate synthase, bacterial-type [Ostreococcus tauri]
Length=642

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/552 (60%), Positives = 414/552 (75%), Gaps = 15/552 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP Y+P  ISDP YVRVFDTTLRDGEQSPGAT+T++EKLD+A  LAKLGVD+IEAGFP A
Sbjct  79    RPAYVPGVISDPKYVRVFDTTLRDGEQSPGATLTSREKLDIATSLAKLGVDVIEAGFPIA  138

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  D EAVR IA++VGN   E  +VPVICGLSR N++DID AWE V+HA +PR+HTFIAT
Sbjct  139   SPDDLEAVRGIAKKVGNEVYEDGYVPVICGLSRANKKDIDAAWEGVRHALRPRIHTFIAT  198

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHM +KL  + ++VV+ A   V YARSLGC DVEFSPEDAGRSD +FLY+IL  V++A
Sbjct  199   SQIHMDYKLRKTPDEVVQIAVDAVKYARSLGCEDVEFSPEDAGRSDPQFLYRILNAVVEA  258

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGI-ENVIISTHCQNDLGLSTANTLAGAYA  1021
             GATTLNIPDTVG  LP EFG LI  IK N  G  E V+ISTHCQNDLGLSTAN+LAG   
Sbjct  259   GATTLNIPDTVGICLPDEFGTLIKGIKENVKGAGETVVISTHCQNDLGLSTANSLAGVAN  318

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVE TINGIGERAGNASLEEV MA+  RG++ L G YTGIN  +I  +S+MV+ ++G
Sbjct  319   GARQVECTINGIGERAGNASLEEVTMAIFMRGQERLMGAYTGINPVYIYPSSQMVKNFSG  378

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRA-NQSGIVLGKLSGR  1378
             + +QPHKAIVGANAFAHESGIHQDGMLK+K TYEI++PE IG  R  ++ G+V+GK SGR
Sbjct  379   MAIQPHKAIVGANAFAHESGIHQDGMLKNKLTYEIIAPEQIGYFRGEDECGVVMGKHSGR  438

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK-KKITDDDLIALISDEVFQPQLVWKLG  1555
             HAL +K+++LG  ++G   D++F RFK VAE K   + DD+L+A++ D        W L 
Sbjct  439   HALSSKLKQLGVPMEGAALDEVFNRFKLVAETKLGGVNDDELLAIVRDGESVQDPAWSLE  498

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
              +QV CG+ GL TATV++ + D  +H++  VGTGPVDAA+KA+D LV + V L EY +TA
Sbjct  499   TVQVVCGTTGLPTATVRMNNRDGTQHISAVVGTGPVDAAFKAIDALVGLDVVLTEYRVTA  558

Query  1736  VTEGIDAIASTRVLIR---------GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVR  1888
             VT+GI+++A T + I+         G + +  T+  TG    R F+ TGA  DIV+SS R
Sbjct  559   VTKGINSMAETTITIKPKEGVEQKLGTDVY-KTNVQTGEKTMRAFTATGADTDIVVSSAR  617

Query  1889  AYVGALNKMLSF  1924
             AYV ALN+M+ +
Sbjct  618   AYVIALNRMVEY  629



>gb|KDO41316.1| hypothetical protein CISIN_1g0069691mg, partial [Citrus sinensis]
Length=393

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/376 (81%), Positives = 346/376 (92%), Gaps = 0/376 (0%)
 Frame = +2

Query  797   SDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQN  976
             SDR+FLY+ILGEVIK GATTLNIPDTVG T+PTEFG+LIADIKANTPGIENV+ISTHCQN
Sbjct  1     SDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQN  60

Query  977   DLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINT  1156
             DLGLSTANT+AGA AGARQVEVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT
Sbjct  61    DLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINT  120

Query  1157  QHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHR  1336
             +HI+MASKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R
Sbjct  121   RHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLER  180

Query  1337  ANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS  1516
             ++++GIVLGKLSGRHALK +++ELGY+++ ++   +FW FK+VAE+KK++TD DLIAL+S
Sbjct  181   SSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVS  240

Query  1517  DEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLV  1696
             DE+FQP++VWKL D+QVTCG+LGLSTATVKL+DA+ EEHVACS GTGPVD+AYKAVDL+V
Sbjct  241   DEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIV  300

Query  1697  KVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVI  1876
             K P TLLEYS+ AVT GIDAIA+TRVLIRG+ S  STHA TG  V RTFSGTGAGMDIV+
Sbjct  301   KEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVV  360

Query  1877  SSVRAYVGALNKMLSF  1924
             SSV+AY+GALNKML F
Sbjct  361   SSVKAYIGALNKMLGF  376



>ref|XP_008342849.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Malus 
domestica]
Length=469

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/392 (77%), Positives = 351/392 (90%), Gaps = 2/392 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RPDYIPNRISDPNYVR+FDTTLRDGEQSPGA++T+KEKLD+AR+LAKLGVDIIEAGFPA+
Sbjct  73    RPDYIPNRISDPNYVRIFDTTLRDGEQSPGASLTSKEKLDIARKLAKLGVDIIEAGFPAS  132

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S+ D EAV++IA+EVGN   +  +VPVICGLSRCN+ DI  AW+AVK+AK+PR+HTFIAT
Sbjct  133   SKDDAEAVKMIAKEVGNAVDKDGYVPVICGLSRCNRXDIQTAWDAVKYAKRPRIHTFIAT  192

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IH+++KL  ++EQV+E A +MV +AR LGC DVEFSPEDAGRS+REFLYQILGEVIKA
Sbjct  193   SPIHLEYKLRKTKEQVIEIARNMVKFARELGCDDVEFSPEDAGRSEREFLYQILGEVIKA  252

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDTVGY +P E+ QLIADIK+NTPGI+N IISTHCQNDLGLSTANTLAGA AG
Sbjct  253   GATTLNIPDTVGYNVPDEYSQLIADIKSNTPGIDNXIISTHCQNDLGLSTANTLAGACAG  312

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVM L CRGE VLGGLYTGINT+HI + SKMVEEYTGL
Sbjct  313   ARQLEVTINGIGERAGNASLEEVVMTLNCRGEHVLGGLYTGINTKHIYVTSKMVEEYTGL  372

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  R+N++GIVLGKLSGRHA
Sbjct  373   HVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHA  432

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK  1480
             L+ ++ ELGY+++  +   +F  FK+VAE+KK
Sbjct  433   LRNRLAELGYELEDDQLATVFEHFKAVAEQKK  464



>ref|XP_009768817.1| PREDICTED: 2-isopropylmalate synthase A-like [Nicotiana sylvestris]
Length=862

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/432 (72%), Positives = 371/432 (86%), Gaps = 1/432 (0%)
 Frame = +2

Query  545   EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKA  724
             E  +VP+ICGL+R +++DI+RAWEA+K+AKKP +H FIATS+IHMK+KL MSRE+ +E A
Sbjct  408   EEGYVPMICGLARSSKKDIERAWEALKYAKKPMLHMFIATSDIHMKYKLKMSREETLETA  467

Query  725   TSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFG  904
              SMVAYA++L   DV FS EDA RSDREFLY I GEVIKAGAT + +PDTVG  LP+E+ 
Sbjct  468   RSMVAYAKTL-FEDVRFSTEDASRSDREFLYHINGEVIKAGATVIGLPDTVGCNLPSEYA  526

Query  905   QLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASL  1084
             QLI+DIKANTPGI++V ISTHC NDLGL++ANTLAG  AGAR V+VTINGIGERAGNASL
Sbjct  527   QLISDIKANTPGIQDVNISTHCHNDLGLASANTLAGICAGARLVDVTINGIGERAGNASL  586

Query  1085  EEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGI  1264
             EE+VMALK RGEQVLGG+YTGINT+HI M SKMVEEY+GL +QPHKAIVGANAF+HESGI
Sbjct  587   EEIVMALKYRGEQVLGGIYTGINTKHIFMTSKMVEEYSGLKLQPHKAIVGANAFSHESGI  646

Query  1265  HQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDL  1444
             HQDG+LK++DTYE +S ED+G  RAN+ GI LGKLSGRHALK KM E GYD DGKE DDL
Sbjct  647   HQDGVLKNRDTYEFVSLEDVGYRRANEYGISLGKLSGRHALKAKMVEFGYDFDGKELDDL  706

Query  1445  FWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADD  1624
             F RFKS+AE+KKKITDDDL AL+SDEVFQPQ+ W+LGD+Q+TCGS+G STA VKLID+D 
Sbjct  707   FHRFKSLAERKKKITDDDLRALVSDEVFQPQVSWQLGDVQITCGSVGRSTANVKLIDSDG  766

Query  1625  EEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTS  1804
             +EH A SVGTGPVDAAYKAVDL+VKVPVTL+EYS+ A+TE I++ ASTRVL+RGD+ + S
Sbjct  767   QEHTASSVGTGPVDAAYKAVDLIVKVPVTLVEYSVNAITERINSTASTRVLVRGDDDYAS  826

Query  1805  THALTGNVVNRT  1840
              +   G  VNRT
Sbjct  827   FNTSNGQTVNRT  838



>gb|KHN34617.1| Putative 2-isopropylmalate synthase [Glycine soja]
Length=482

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/509 (62%), Positives = 392/509 (77%), Gaps = 32/509 (6%)
 Frame = +2

Query  407   MTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVGN---GEGEHVPVICGL  577
             M + +KL +ARQLAKLGVD+IE GFP+AS+ DF AV++IAQEVGN    +G +VPVI  L
Sbjct  1     MVSSQKLRIARQLAKLGVDVIEGGFPSASQEDFNAVKMIAQEVGNNCDADG-YVPVIAAL  59

Query  578   SRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLG  757
              RCN++DI  AWEA+K+AK+PR+  FIA S IHM++KLN ++E+V++ A  M+ +ARSLG
Sbjct  60    CRCNEKDIATAWEALKYAKRPRLMPFIAVSPIHMEYKLNKTKEEVLQIAKDMIKFARSLG  119

Query  758   CSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTP  937
             CSD++F  EDA RSDREFLYQIL EVIKAGATTL I DTVG T+P E  QLIADIKAN P
Sbjct  120   CSDIQFCSEDAARSDREFLYQILEEVIKAGATTLGIGDTVGITMPFEIRQLIADIKANVP  179

Query  938   GIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRG  1117
             G ENVIIS HC NDLG +TAN +  A AGA Q+EVTINGIGERAGNASLEEVVMALKCRG
Sbjct  180   GAENVIISMHCHNDLGHATANAIEAAQAGAMQLEVTINGIGERAGNASLEEVVMALKCRG  239

Query  1118  EQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDT  1297
             +QVLGGLYTGINT+H++  SKMVEE++G+ +QPHKA+VG NAF HESG+HQ G+LKH+ T
Sbjct  240   DQVLGGLYTGINTRHLLKTSKMVEEFSGMYLQPHKAVVGDNAFLHESGVHQAGLLKHRAT  299

Query  1298  YEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKK  1477
             YEIMSPEDIG  +++   +VLGKLSGR ALK++++ELGY++  +E + +F  FK++AEKK
Sbjct  300   YEIMSPEDIGHEKSSGVNMVLGKLSGRQALKSRLKELGYELRDEEVESVFRNFKAIAEKK  359

Query  1478  KKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTG  1657
             K                            VTCG++G STAT+KL+ +D   HVACSVG G
Sbjct  360   K----------------------------VTCGTMGSSTATIKLVTSDGITHVACSVGVG  391

Query  1658  PVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNR  1837
             PVD+AYKA++L+VK  V +LEYSL+ VTEG DAIA+TRV+IR +N  + T AL GNV+  
Sbjct  392   PVDSAYKAINLIVKETVKVLEYSLSTVTEGTDAIATTRVVIRRENKQSPTPALNGNVIYP  451

Query  1838  TFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             TFSGTG G+D+V SSV AY+ ALNKML  
Sbjct  452   TFSGTGEGVDVVTSSVEAYLTALNKMLDL  480



>ref|XP_007508841.1| 2-isopropylmalate synthase [Bathycoccus prasinos]
 emb|CCO19927.1| 2-isopropylmalate synthase [Bathycoccus prasinos]
Length=731

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/549 (60%), Positives = 410/549 (75%), Gaps = 14/549 (3%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIP +I DP YVRVFDTTLRDGEQSPGAT+T+ EK+ +A  LAKLGVDIIEAGFP A
Sbjct  160   RPEYIPGKIQDPRYVRVFDTTLRDGEQSPGATLTSTEKVQIATNLAKLGVDIIEAGFPIA  219

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  D EAVR IA+ VGN   E  +VPVICGLSR N++DI  AWE V+HA +PR+HTFIAT
Sbjct  220   SPDDLEAVRNIAKVVGNKVYEDGYVPVICGLSRANEKDIACAWEGVRHAVRPRIHTFIAT  279

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IHM++KL  + ++VV  A   V +A+SLGC D+EFSPEDAGRS+ EFLY+IL  V+ A
Sbjct  280   SPIHMEYKLKKTPDEVVNIAVKAVKFAKSLGCEDIEFSPEDAGRSEPEFLYRILKAVVDA  339

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGI--ENVIISTHCQNDLGLSTANTLAGAY  1018
             GATT+NIPDTVG+ LP EFG+LI  IK N   +   + IISTHCQNDLGLSTAN+LAG  
Sbjct  340   GATTINIPDTVGFCLPDEFGRLIKGIKENVIDVSANDAIISTHCQNDLGLSTANSLAGIA  399

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
              GARQVE TINGIGERAGNASLEE+ M++  RG+  L G Y G+N  +I   S+MV EY+
Sbjct  400   NGARQVECTINGIGERAGNASLEEIAMSVIMRGQNQLNGAYMGVNPVYIYQTSRMVSEYS  459

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHR-ANQSGIVLGKLSG  1375
             G+LVQPHKAIVGANAFAHESGIHQDGMLK+K TYEI++PE IG+ R  +  G+V+GK SG
Sbjct  460   GMLVQPHKAIVGANAFAHESGIHQDGMLKNKSTYEIIAPETIGVFRDEDDCGVVMGKHSG  519

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK-KITDDDLIALISD--EVFQPQLVW  1546
             RHALK+K+ ++G  +   + +  F RFK VAE K   ++D +L+AL+ D  EV + +  +
Sbjct  520   RHALKSKLGQMGVTLADDQLNAFFDRFKLVAETKTGGVSDVELMALLRDEMEVEEGKEFY  579

Query  1547  KLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYS  1726
              L D+QV CG++GL TATVK+ID   E   AC VGTGPVDA YKA+D +V   V L EY+
Sbjct  580   TLVDVQVVCGTMGLPTATVKIIDQGTERISAC-VGTGPVDAVYKAIDAVVGKSVELTEYN  638

Query  1727  LTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVV----NRTFSGTGAGMDIVISSVRAY  1894
             + AVT+GI+++A+TRV I+  +  T+   +T N       RTF+ TGA  DIV+SS RAY
Sbjct  639   VKAVTQGIESLATTRVTIKPTDESTA-ETITNNQTEARGTRTFTATGADTDIVVSSARAY  697

Query  1895  VGALNKMLS  1921
             + ALN+MLS
Sbjct  698   LSALNRMLS  706



>gb|KDO41315.1| hypothetical protein CISIN_1g0069691mg [Citrus sinensis]
Length=447

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/356 (84%), Positives = 329/356 (92%), Gaps = 3/356 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIPNRI DPNYVRVFDTTLRDGEQSPGAT+T+KEKLD+ARQLAKLGVDIIEAGFPAA
Sbjct  63    RPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA  122

Query  491   SEADFEAVRLIAQEVGNG---EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIA  661
             S+ DFEAVR IA+EVGN    E  +VPVICGLSRCN+RDI  AWEAVK+AK+PR+HTFIA
Sbjct  123   SKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIA  182

Query  662   TSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIK  841
             TS IHM+ KL  +++QVVE A SMV +ARSLGC DVEFSPEDAGRSDR+FLY+ILGEVIK
Sbjct  183   TSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIK  242

Query  842   AGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYA  1021
              GATTLNIPDTVG T+PTEFG+LIADIKANTPGIENV+ISTHCQNDLGLSTANT+AGA A
Sbjct  243   VGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACA  302

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTG  1201
             GARQVEVTINGIGERAGNASLEEVVMA KCRGE +LGGLYTGINT+HI+MASKMVEEYTG
Sbjct  303   GARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTG  362

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKL  1369
             L VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIGL R++++GIVLGKL
Sbjct  363   LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKL  418



>ref|XP_009351137.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=422

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/377 (80%), Positives = 339/377 (90%), Gaps = 0/377 (0%)
 Frame = +2

Query  794   RSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQ  973
             RS+REFLYQILGEVIKAGATTLNIPDTVGY +P E+ QLIADIK+NTPGI+NVIISTHCQ
Sbjct  29    RSEREFLYQILGEVIKAGATTLNIPDTVGYNVPEEYSQLIADIKSNTPGIDNVIISTHCQ  88

Query  974   NDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIN  1153
             NDLGLSTANTLAGA AGARQ+EVTINGIGERAGNASLEEVV+ L CRGE VLGGLYTGIN
Sbjct  89    NDLGLSTANTLAGACAGARQLEVTINGIGERAGNASLEEVVLTLNCRGEHVLGGLYTGIN  148

Query  1154  TQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLH  1333
             T+HI + SKMVEEYTGL VQPHKAIVGANAFAHESGIHQDGMLKHK TYEI+SPEDIG  
Sbjct  149   TKHIYVTSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGYE  208

Query  1334  RANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI  1513
             R+N++GIVLGKLSGRHAL+ ++ ELGY+++  +   +F RFK+VAE+KK ITD DL AL+
Sbjct  209   RSNEAGIVLGKLSGRHALRNRLAELGYELENDQLATIFERFKAVAEQKKSITDADLGALV  268

Query  1514  SDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLL  1693
              DEVFQP++VWKL DLQVTCG+LGLSTAT+KLIDAD  EHVACSVGTGPVD+AYKAVDL+
Sbjct  269   RDEVFQPEVVWKLHDLQVTCGTLGLSTATIKLIDADGREHVACSVGTGPVDSAYKAVDLI  328

Query  1694  VKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIV  1873
             VK PVTL+EYS+ AVTEGIDAIA+TRV+IR +NSHT THA TG  V RTFSG GAGMDIV
Sbjct  329   VKEPVTLIEYSMNAVTEGIDAIATTRVVIRLENSHTVTHAQTGESVQRTFSGIGAGMDIV  388

Query  1874  ISSVRAYVGALNKMLSF  1924
             +SSV+AY+GALNKM+ F
Sbjct  389   VSSVKAYIGALNKMIGF  405



>gb|KFK41842.1| hypothetical protein AALP_AA2G178400 [Arabis alpina]
Length=552

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/398 (76%), Positives = 350/398 (88%), Gaps = 17/398 (4%)
 Frame = +2

Query  731   MVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQL  910
             MVA+ARSLGC DVEFSPEDAGRS+RE+LY+ILGEVIKAGA TLNIPDTVG TLP+EFGQL
Sbjct  1     MVAFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGAITLNIPDTVGITLPSEFGQL  60

Query  911   IADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEE  1090
             IADIKANT GI+NVIISTHCQNDLGLSTANTL+GA++GARQVEVTINGIGERAGNASLEE
Sbjct  61    IADIKANTHGIQNVIISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEE  120

Query  1091  VVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQ  1270
             VVMA+KCRG+ VLGGL+TGI+T+HI+M SKMVEEYTG+  QPHKAIVGANAFAHESGIHQ
Sbjct  121   VVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQ  180

Query  1271  DGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFW  1450
             DGMLKHK TYEIM PE+IGL R+N++GI                 LGY++D  +  +LFW
Sbjct  181   DGMLKHKGTYEIMCPEEIGLERSNEAGI-----------------LGYELDDVQLSNLFW  223

Query  1451  RFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEE  1630
             RFKSVA++KK++TD DLIAL+SDEVFQP+ VW L D+Q+TCG+LGLST+TVKL + D +E
Sbjct  224   RFKSVADQKKRVTDADLIALVSDEVFQPEAVWTLLDMQITCGTLGLSTSTVKLANFDGKE  283

Query  1631  HVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTH  1810
             HVACS+GTGPVDAAYKAVDL+VK P TLLEYS+  VTEGIDAI +TRVLIRGDN+++ST+
Sbjct  284   HVACSIGTGPVDAAYKAVDLIVKEPTTLLEYSMNGVTEGIDAITTTRVLIRGDNNYSSTN  343

Query  1811  ALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             A+TG  V RTFSGTGAGMD+V+SSV+AYVGALNKML F
Sbjct  344   AVTGESVQRTFSGTGAGMDVVVSSVKAYVGALNKMLGF  381



>gb|EJK57969.1| hypothetical protein THAOC_21945 [Thalassiosira oceanica]
Length=590

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 381/493 (77%), Gaps = 12/493 (2%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP+YIP RI DP+YVR+FDTTLRDGEQSPGAT+T+ EKLD+AR LAKLGVDIIEAGFP A
Sbjct  68    RPEYIPGRIDDPDYVRIFDTTLRDGEQSPGATLTSSEKLDIARNLAKLGVDIIEAGFPIA  127

Query  491   SEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  DF AV+ IA  VGN   +  +VPVI GLSR N++DI RAW+AVK A +PR+HTFIAT
Sbjct  128   SPDDFNAVKQIADVVGNEVYDDGYVPVIAGLSRANEKDIGRAWDAVKGAVRPRIHTFIAT  187

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHMK KLN + ++V+E A + V +A+SLGC D+EFSPEDAGRSD EFLY++LG+VI+A
Sbjct  188   SDIHMKSKLNKTPDEVIEIAVNAVTFAKSLGCDDIEFSPEDAGRSDPEFLYRVLGKVIEA  247

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATTLNIPDT G+ +P EFG+LI  ++ N PG ENV+ STHCQNDLGL+TAN+L+GA  G
Sbjct  248   GATTLNIPDTTGWNMPWEFGELIKKLRENVPGAENVVFSTHCQNDLGLATANSLSGALNG  307

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRG-EQVLGG-----LYTGINTQHIIMASKMV  1186
             ARQ+E TINGIGERAGNASLEE+VM+L  +G EQ  GG     LYT +N  +I   SKMV
Sbjct  308   ARQLECTINGIGERAGNASLEEIVMSLALKGDEQFEGGPGSGKLYTAVNPVYITPTSKMV  367

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQ---SGIV  1357
              EYTG+  QPHKAIVGANAF HESGIHQDGM+K+K TYEIM+PE IGL R +    +GIV
Sbjct  368   AEYTGMKCQPHKAIVGANAFQHESGIHQDGMIKNKSTYEIMTPESIGLMRGDSQSGAGIV  427

Query  1358  LGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK-KITDDDLIALISDEVFQP  1534
             LGK SGR+A+ T+++ELGYD+D ++ + +F RFK VAEKKK  + DDDL +L+SD+    
Sbjct  428   LGKHSGRNAVGTRLRELGYDMDPEKLNAVFARFKEVAEKKKGGLDDDDLESLVSDQAGSV  487

Query  1535  QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTL  1714
               +W++  LQ T G  G+ TATVK++  D  E    + GTGPVDA YKA+D ++ V V L
Sbjct  488   NELWRVSGLQATTGLSGIPTATVKMVGPDGVERFVSATGTGPVDAVYKAIDQIMGVQVVL  547

Query  1715  LEYSLTAVTEGID  1753
               YS+ AV EGI+
Sbjct  548   ESYSMNAVNEGIE  560



>ref|XP_009039595.1| hypothetical protein AURANDRAFT_54528 [Aureococcus anophagefferens]
 gb|EGB05756.1| hypothetical protein AURANDRAFT_54528 [Aureococcus anophagefferens]
Length=609

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/566 (58%), Positives = 409/566 (72%), Gaps = 22/566 (4%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP YIP +I DP YVR+FDTTLRDGEQSPGAT+T+ EKL++A+ L+KLGVD+IEAGFP A
Sbjct  31    RPPYIPGKIVDPGYVRIFDTTLRDGEQSPGATLTSSEKLEIAKHLSKLGVDVIEAGFPIA  90

Query  491   SEADFEAVRLIAQEVGN--GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  DFEAVR IAQ VGN   +  +VPVICGLSR N RDI+RAW+AVK AK PR+HTFIAT
Sbjct  91    SPDDFEAVRQIAQIVGNEVDDSGYVPVICGLSRANARDIERAWDAVKSAKLPRLHTFIAT  150

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IHM+ KL  + ++VV+ A   V +ARSLGC D+EFSPEDAGRSD +FL +IL  V+ A
Sbjct  151   SNIHMETKLCKTPDEVVQIAVDAVKFARSLGCDDIEFSPEDAGRSDVDFLVRILEAVVDA  210

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPG-IENVIISTHCQNDLGLSTANTLAGAYA  1021
             GATTLNIPDT G+  P EFG+LIA ++      +E++I STHCQNDLGL++AN+LAGAY 
Sbjct  211   GATTLNIPDTTGWNTPWEFGELIATLRRRLGARLEDIIFSTHCQNDLGLASANSLAGAYN  270

Query  1022  GARQVEVTINGIGERAGNASLEEVVMALKCRG--EQVLGG---LYTGINTQHIIMASKMV  1186
             GARQ+E TINGIGERAGNA+LEE+ MAL  RG  E    G   L+TG++T  I   S+MV
Sbjct  271   GARQIECTINGIGERAGNAALEEIAMALCLRGTSEHAFAGGPRLWTGLDTTFITPCSRMV  330

Query  1187  EEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQ---SGIV  1357
              EYTG+ +QPHKAIVGANAF HESGIHQDGM+K+K TYEIM+PE +GL R      +GIV
Sbjct  331   AEYTGMAIQPHKAIVGANAFRHESGIHQDGMIKNKATYEIMTPESVGLPRGQAESGAGIV  390

Query  1358  LGKLSGRHALKTKMQELGY-DI--DGKEFDDLFWRFKSVAEKKK-KITDDDLIALISDEV  1525
             LGK SGR+A+ T++ ELGY DI  D  + D +F RFK VAE+KK  + DD+L AL+SDE 
Sbjct  391   LGKHSGRNAVSTRLVELGYGDIADDKLKLDAIFTRFKHVAERKKGGLDDDELEALVSDEA  450

Query  1526  FQPQL-VWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKV  1702
             +Q    +W L   QVT GS  + T TV +   D     A   G+GPVDA YKA+D L  V
Sbjct  451   YQNTCALWTLVGAQVTTGSGVIPTGTVTMQGPDGVIRHAALTGSGPVDAVYKAIDALTGV  510

Query  1703  PVTLLEYSLTAVTEGIDAIASTRVLIR----GDNSHTSTHALTGNVVNRTFSGTGAGMDI  1870
              V L  Y L +V  GIDA+A+T+VLI+          + H+ +G   N+ FSG+G+  DI
Sbjct  511   KVDLESYGLESVNSGIDAMATTKVLIKPRIGTQLESAAVHSQSGATTNKRFSGSGSDTDI  570

Query  1871  VISSVRAYVGALNKMLSFTTLVSRYN  1948
             V+SS RAY+ A+NK+L++   + RY+
Sbjct  571   VVSSARAYIAAVNKLLNWN--MHRYS  594



>ref|XP_007142640.1| hypothetical protein PHAVU_007G004600g [Phaseolus vulgaris]
 gb|ESW14634.1| hypothetical protein PHAVU_007G004600g [Phaseolus vulgaris]
Length=435

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 334/380 (88%), Gaps = 8/380 (2%)
 Frame = +2

Query  284   VRCGLGAP---RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKL  454
             V C    P   RRP Y+PNRI+DP+YVR+FDTTLRDGEQSPGA+MT+KEKLDVARQLAKL
Sbjct  51    VSCCASEPSLRRRPPYVPNRIADPSYVRIFDTTLRDGEQSPGASMTSKEKLDVARQLAKL  110

Query  455   GVDIIEAGFPAASEADFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKH  628
             GVDIIEAGFPAAS+ DFEAV+ IA EVGN   +  +VPVICGLSRCN+ DI RAWEAVK+
Sbjct  111   GVDIIEAGFPAASKDDFEAVKAIASEVGNAVDDDGYVPVICGLSRCNENDIRRAWEAVKY  170

Query  629   AKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDRE  808
             AK+PR+HTFIATS IHM++KL MS+E+V++ A SMV +ARSLGC DVEFSPEDAGRSDRE
Sbjct  171   AKRPRIHTFIATSAIHMEYKLRMSKEKVIDTARSMVKFARSLGCEDVEFSPEDAGRSDRE  230

Query  809   FLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGL  988
             FLY+ILGEVIKAGATTLNIPDTVG  LP+EFG+LIADIKANTPGIENV+ISTHCQNDLGL
Sbjct  231   FLYEILGEVIKAGATTLNIPDTVGINLPSEFGRLIADIKANTPGIENVVISTHCQNDLGL  290

Query  989   STANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHII  1168
             STANT+ GA AGARQ+EVTINGIGERAGNASLEEVVMAL+C G  V G LYTGINT+HI 
Sbjct  291   STANTIEGARAGARQLEVTINGIGERAGNASLEEVVMALRC-GAHVTGNLYTGINTKHIF  349

Query  1169  MASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQS  1348
             + SKMVEEYTGL +QPHKA+VGANAFAHESGIHQDGMLKHK TYEI++PEDIGL R N++
Sbjct  350   LTSKMVEEYTGLQLQPHKALVGANAFAHESGIHQDGMLKHKGTYEIIAPEDIGLERTNEA  409

Query  1349  GIVLGKLSGRHALKTKMQEL  1408
             GIVLGKL  R+A+   ++ +
Sbjct  410   GIVLGKL--RYAIFVSLEHI  427



>ref|WP_020736424.1| 2-isopropylmalate synthase [Sorangium cellulosum]
 ref|YP_008150901.1| 2-isopropylmalate synthase [Sorangium cellulosum So0157-2]
 gb|AGP37014.1| 2-isopropylmalate synthase [Sorangium cellulosum So0157-2]
Length=558

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/530 (58%), Positives = 388/530 (73%), Gaps = 12/530 (2%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             +YVR+FDTTLRDGEQSPGATMT+ EKL++A  LAKLGVD+IE GFPAAS  D  AV+ IA
Sbjct  5     DYVRIFDTTLRDGEQSPGATMTSSEKLEIALALAKLGVDVIETGFPAASPDDLLAVQTIA  64

Query  527   QEVGNG-----EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKL  691
             + VG            P+IC L+R  + DID+AWE V  A  PR+HTF+ATS+IH+K KL
Sbjct  65    ERVGAAAVPGRPAATPPIICALARATKVDIDKAWEGVARAAHPRIHTFLATSDIHLKHKL  124

Query  692   NMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  871
              M+R +V+++  +MVAYAR L C+DVEFSPEDAGRS+ EFLYQ+L   I AGATTLNIPD
Sbjct  125   RMTRPEVLDRVRAMVAYARDL-CADVEFSPEDAGRSEPEFLYQVLEAAIAAGATTLNIPD  183

Query  872   TVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTIN  1051
             TVGYT+P+EFG LIA I+ N PGI+  IIS HC NDLGL+TAN L G  AGARQ EVTIN
Sbjct  184   TVGYTMPSEFGALIAGIRKNVPGIDRAIISVHCHNDLGLATANALEGIRAGARQAEVTIN  243

Query  1052  GIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             GIGERAGN +LEEVVMAL  R  + + GL TGI+T  I   S++V   TG  VQP+KAIV
Sbjct  244   GIGERAGNTALEEVVMALATR--RAVFGLRTGIDTTQIATVSRLVSAATGFNVQPNKAIV  301

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHESGIHQDGMLKH+DTYEIM PE +G+    Q+ +VLGK SGRHAL+ +++ELG
Sbjct  302   GANAFAHESGIHQDGMLKHQDTYEIMRPEMVGV---TQTRLVLGKHSGRHALRNRLEELG  358

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             Y +D  +    F  FK++A+KKK +TD D+ A++S    Q   ++ L  LQV CG+ G+ 
Sbjct  359   YHLDEAQLAAAFASFKALADKKKHVTDPDIEAIVSTTRAQGDELYTLDALQVACGTTGMP  418

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV+L   D   HV  ++GTGPVDAAY+A+D +V+VP +LLE+S+ AVTEGIDA+    
Sbjct  419   TATVRLRGPDGALHVRAAIGTGPVDAAYRAIDEIVRVPSSLLEFSVHAVTEGIDALGEVS  478

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             V +R D + +  H    +  +R F G GA  DI+++S +AY+ ALN++L+
Sbjct  479   VRVRADATSSKRHP-QHDASHRVFHGHGADTDILVASAKAYLTALNRLLA  527



>ref|XP_009040112.1| hypothetical protein AURANDRAFT_38625 [Aureococcus anophagefferens]
 gb|EGB05211.1| hypothetical protein AURANDRAFT_38625 [Aureococcus anophagefferens]
Length=616

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/559 (58%), Positives = 401/559 (72%), Gaps = 22/559 (4%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP Y+P  I+DP YVR+FDTTLRDGEQSPGAT+T+ EKLD+A+QLA L VD+IEAGFP A
Sbjct  34    RPSYVPGEIADPGYVRIFDTTLRDGEQSPGATLTSSEKLDIAKQLANLQVDVIEAGFPIA  93

Query  491   SEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S  DF AV+ IA+ VGN   E  +VPVICGLSR N RDI+ AW+AVK A+ PRVHTFIAT
Sbjct  94    SPDDFNAVQQIARIVGNNVDEFGYVPVICGLSRANLRDIECAWDAVKSARLPRVHTFIAT  153

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHM+ KL  + ++V+  A   V +ARSLGC D+EFSPEDAGRSD  FL ++L  V+ A
Sbjct  154   SKIHMETKLCKTPDEVLRIAVDAVTFARSLGCDDIEFSPEDAGRSDVNFLVRVLEAVVDA  213

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGI--ENVIISTHCQNDLGLSTANTLAGAY  1018
             GATTLNIPDT G+  P EFG+LIA ++A   GI  E V+ STHCQNDLGL++AN+LAGAY
Sbjct  214   GATTLNIPDTTGWNTPWEFGELIATLRARL-GIRAERVVFSTHCQNDLGLASANSLAGAY  272

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLG-----GLYTGINTQHIIMASKM  1183
              GARQ+E TINGIGERAGNA+LEEVVMAL  RG  V        L TGIN   I   S+M
Sbjct  273   RGARQIECTINGIGERAGNAALEEVVMALHLRGTSVAAFADGPHLRTGINPTFITPCSRM  332

Query  1184  VEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQ---SGI  1354
             V EYTG+ +QPHKAIVGANAF HESGIHQDGM+K+K TYEIM+PE IGL R      +GI
Sbjct  333   VSEYTGMAIQPHKAIVGANAFRHESGIHQDGMIKNKATYEIMTPESIGLARGQAESGAGI  392

Query  1355  VLGKLSGRHALKTKMQELGYD---IDGKEFDDLFWRFKSVAEKKK-KITDDDLIALISDE  1522
             VLGK SGR+A+ T++ ELGY+    D  + + +F RFK VAE+KK  + DD+L ALISDE
Sbjct  393   VLGKHSGRNAVSTRLIELGYENIVKDQSKLEAIFTRFKHVAERKKGGLDDDELEALISDE  452

Query  1523  VFQP-QLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVK  1699
              +Q  + +W L   QVT GS  + +ATV +   D     +   G+GPVDA YKA+D L  
Sbjct  453   AYQNLRALWTLIGAQVTTGSGVIPSATVSMQGPDGVTRHSAVTGSGPVDAVYKAIDTLTD  512

Query  1700  VPVTLLEYSLTAVTEGIDAIASTRVLIR----GDNSHTSTHALTGNVVNRTFSGTGAGMD  1867
             V V L  YSL +V  GIDA+A+T+V+I+          + H+ +G   NR FSG+G   D
Sbjct  513   VKVNLETYSLESVNAGIDAMATTKVIIKPLTGTQLESAAVHSQSGATTNRRFSGSGTDTD  572

Query  1868  IVISSVRAYVGALNKMLSF  1924
             IVISS RAYV A+NK+L++
Sbjct  573   IVISSARAYVAAVNKLLNW  591



>ref|WP_012236363.1| 2-isopropylmalate synthase [Sorangium cellulosum]
 ref|YP_001614373.1| 2-isopropylmalate synthase [Sorangium cellulosum So ce56]
 emb|CAN93893.1| 2-isopropylmalate synthase [Sorangium cellulosum So ce56]
Length=564

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/542 (56%), Positives = 392/542 (72%), Gaps = 13/542 (2%)
 Frame = +2

Query  314   PDYIPNRISDP-NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             P+ I N+   P +YVR+FDTTLRDGEQSPGATMT+ EKL++A  LAKLGVD+IE GFPAA
Sbjct  2     PEMIANQAMPPSDYVRIFDTTLRDGEQSPGATMTSSEKLEIALALAKLGVDVIETGFPAA  61

Query  491   SEADFEAVRLIAQEVGNG-----EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             S  D  AV+ IA+ VG            P+IC L+R  + DID+AWE V  A  PR+HTF
Sbjct  62    SPDDLLAVQTIAERVGAAAVPGRPAPTPPIICALARATKVDIDKAWEGVARAAHPRIHTF  121

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             +ATS+IH+K KL M+R +V+++  +MVAYAR L C+DVEFSPEDAGRS+ EFLYQ+L   
Sbjct  122   LATSDIHLKHKLRMTRAEVLDRVRAMVAYARDL-CADVEFSPEDAGRSEPEFLYQVLEAA  180

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             I AGATTLNIPDTVGYT+P+EFG LIA I+ N  GI+  I+S HC NDLGL+TAN L G 
Sbjct  181   IAAGATTLNIPDTVGYTIPSEFGALIAGIRKNVAGIDRAIVSVHCHNDLGLATANALEGI  240

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
              AGARQ EVTINGIGERAGN +LEE+VMAL  R  + + GL TGI+T  I   S++V   
Sbjct  241   RAGARQAEVTINGIGERAGNTALEEIVMALATR--RAVFGLRTGIDTTQIATVSRLVSAA  298

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             TG  VQP+KAIVGANAFAHESGIHQDGMLKH++TYEIM PE +G+    Q+ +VLGK SG
Sbjct  299   TGFNVQPNKAIVGANAFAHESGIHQDGMLKHQETYEIMRPEMVGV---TQTRLVLGKHSG  355

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLG  1555
             RHAL+ +++ELGY +D  +    F  FK++A+KKK +TD D+ A++S    Q   ++ L 
Sbjct  356   RHALRNRLEELGYHLDEAQLAAAFASFKALADKKKHVTDPDIEAIVSTTRAQADDLYTLD  415

Query  1556  DLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTA  1735
              LQV CG+ G+ TATV+L   D   HV  ++GTGPVDAAY+A+D +V+VP +LLE+S+ A
Sbjct  416   ALQVACGTTGMPTATVRLRGPDGALHVRAAIGTGPVDAAYRAIDEIVRVPSSLLEFSVHA  475

Query  1736  VTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             VTEGIDA+    V +R D + +  H    +   R F G GA  DI+++S +AY+ ALN++
Sbjct  476   VTEGIDALGEVSVRVRADATSSKRHP-QHDAAARVFHGHGADTDILVASAKAYLTALNRL  534

Query  1916  LS  1921
             L+
Sbjct  535   LA  536



>gb|KCW44560.1| hypothetical protein EUGRSUZ_L01927 [Eucalyptus grandis]
Length=351

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/349 (80%), Positives = 319/349 (91%), Gaps = 0/349 (0%)
 Frame = +2

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
             +P EFG+LIADIKANTPGIENVIISTHCQNDLGLSTANT+ GA AGARQVEVTINGIGER
Sbjct  1     MPEEFGKLIADIKANTPGIENVIISTHCQNDLGLSTANTIVGACAGARQVEVTINGIGER  60

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNASLEEVVMALKC+G  +LGGLYTGINT+HI+M SKMVEEY+GL VQPHKAIVGANAF
Sbjct  61    AGNASLEEVVMALKCKGMSILGGLYTGINTRHIVMTSKMVEEYSGLHVQPHKAIVGANAF  120

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
              HESGIHQDGMLKHK TYEI+SP+DIGL R N++GIVLGKLSGRHALK K+ ELGYDID 
Sbjct  121   VHESGIHQDGMLKHKGTYEIISPDDIGLERTNETGIVLGKLSGRHALKMKLVELGYDIDV  180

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
             ++ +D+FWRFK+VAE+KK++TD D+ AL+ DEVFQP +VWKL DLQVTCG+LGLSTATVK
Sbjct  181   EQLNDIFWRFKAVAEQKKRVTDADIRALVFDEVFQPTVVWKLHDLQVTCGTLGLSTATVK  240

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             LI AD +EH+AC+VGTGPVD+AYKAVDL+VKVP TLLEYS+TAVTEGIDAIA+TRVLIRG
Sbjct  241   LISADGKEHIACAVGTGPVDSAYKAVDLIVKVPATLLEYSMTAVTEGIDAIATTRVLIRG  300

Query  1787  DNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTL  1933
             +N+HTSTHALTG  ++RTFSGTG+ MDI +SSVRAY+GALNK+L F  L
Sbjct  301   ENNHTSTHALTGETIHRTFSGTGSSMDIAVSSVRAYIGALNKLLGFMEL  349



>ref|WP_026370668.1| 2-isopropylmalate synthase [bacterium JKG1]
Length=558

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/531 (57%), Positives = 382/531 (72%), Gaps = 16/531 (3%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             +YV++FDTTLRDGEQSPGATMTT EKL+VARQLA+LGVDIIEAGFPAAS  D+EAV LIA
Sbjct  3     DYVKIFDTTLRDGEQSPGATMTTPEKLEVARQLARLGVDIIEAGFPAASLGDWEAVHLIA  62

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             +EVG  +G   PVICGL+R N+ DI+R W A+K A KPR+HTFIATS+IH+++KL MSRE
Sbjct  63    REVGTPDG---PVICGLARANRNDIERCWTAIKPAAKPRIHTFIATSDIHLQYKLRMSRE  119

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             QV +    MV YARSL C+DVEFSPEDAGRSD +FLY++L   I+AGATTLNIPDTVGY 
Sbjct  120   QVKQIVREMVGYARSL-CADVEFSPEDAGRSDPQFLYEVLAIAIEAGATTLNIPDTVGYL  178

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
              P E+G LI  I+   PG+E V ISTHC +DLGL+ AN+LAG   GARQVE TINGIGER
Sbjct  179   TPDEYGALIRGIREAVPGVERVTISTHCHDDLGLAVANSLAGVRNGARQVECTINGIGER  238

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNA+LEE+VMAL  R  Q    L TGI+T  I   S+MV   TGL VQP+KAIVGANAF
Sbjct  239   AGNAALEEIVMALHTR--QQFYHLRTGIDTTQIARTSRMVSAITGLPVQPNKAIVGANAF  296

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
             +HESGIHQDGMLKH  TYEIM PE IG      S +VLGK SGRHA +  ++ LGY +  
Sbjct  297   SHESGIHQDGMLKHHLTYEIMRPETIG----KDSVLVLGKHSGRHAFRKHLEHLGYQLSD  352

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
              E +  F RFK +A+KKK + D D++ALI D++ QP  +W+L  +QV+CG++ + TATV+
Sbjct  353   SELETAFQRFKDLADKKKVVDDRDIVALIDDQLHQPAPIWELEQVQVSCGNVAIPTATVR  412

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             L   D E     + GTGPVDA YKA++ ++  P  L E+S+ A+TEGIDA+    + I+ 
Sbjct  413   LRGPDGEVRTDSAQGTGPVDAVYKAINRVIGQPNVLTEFSIKAITEGIDAVGDVTIRIQE  472

Query  1787  DNSHTSTHALTGNVVN------RTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
                        G          RT++G G   DI++++  AY+GALNK+++
Sbjct  473   PEPANGNGHGNGGAREQPEARARTYTGHGVHTDIIVAAAMAYMGALNKLIA  523



>ref|WP_014434671.1| 2-isopropylmalate synthase [Caldilinea aerophila]
 ref|YP_005443342.1| 2-isopropylmalate synthase [Caldilinea aerophila DSM 14535 = 
NBRC 104270]
 dbj|BAM01445.1| 2-isopropylmalate synthase [Caldilinea aerophila DSM 14535 = 
NBRC 104270]
Length=595

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 387/536 (72%), Gaps = 14/536 (3%)
 Frame = +2

Query  335   ISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAV  514
             I++ N V +FDTTLRDGEQSPGAT+ T+EKL++A QLA+LGVDIIEAGFPAAS  D EAV
Sbjct  42    IANGNVVLIFDTTLRDGEQSPGATLNTQEKLEIAHQLARLGVDIIEAGFPAASPGDLEAV  101

Query  515   RLIAQEVG-------NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             + IA+ VG       NGE    PVI GL+R N+ DID+AWEAVK A +PR+HTF+ATS+I
Sbjct  102   KRIAETVGRKPRRGKNGEIVAPPVIAGLARANKSDIDKAWEAVKGAIRPRIHTFLATSDI  161

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL M+R++V+E    MVAYARSL C DVEFSPED GRSD EFL ++L   IKAGAT
Sbjct  162   HMQYKLRMTRDEVLETVGDMVAYARSL-CQDVEFSPEDGGRSDPEFLVKVLEVAIKAGAT  220

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVGYT P E+G LI  ++ NTPG ++VI S HC NDLGL+TANTLAG   GARQ
Sbjct  221   TLNIPDTVGYTTPEEYGALIKYLRENTPGGKDVIFSCHCHNDLGLATANTLAGVRNGARQ  280

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             +EVTINGIGERAGN SLEE VMA+  R  QV  GL T I TQ I   S MV  YTG+++Q
Sbjct  281   IEVTINGIGERAGNTSLEETVMAMYVR-PQVF-GLTTNIITQEIHRTSDMVSRYTGMVIQ  338

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             P+KAIVGANAFAHE+GIHQDGMLKHK TYEIM    IGL   N S +VLGK SG+HAL  
Sbjct  339   PNKAIVGANAFAHEAGIHQDGMLKHKRTYEIMDASTIGL---NTSKLVLGKHSGKHALAR  395

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             K++ +GY +  +E  ++F RFK +A+KKK IT+ DL AL+ DE++QP   W+L ++Q  C
Sbjct  396   KLESMGYRLTQEELKEVFNRFKELADKKKHITEADLEALVGDELYQPVEAWELVEVQAHC  455

Query  1574  GSLGLSTATVKLID-ADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             G+    TA VKL D +  E  +  + GTGPVDA YKA++ +VKVP  L+E+ + AVTEGI
Sbjct  456   GTALTPTAVVKLKDNSTGEIKMGAATGTGPVDAVYKAINEVVKVPNNLVEFLVQAVTEGI  515

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             DA     + I   +S        G    R FSG G   DI+++S +AY+ ALNKM+
Sbjct  516   DANGDVTIRIEVPDSRGYKETAQGRQRRRLFSGRGVDTDIIVASAKAYMQALNKMI  571



>ref|XP_010324707.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum lycopersicum]
Length=414

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/406 (69%), Positives = 338/406 (83%), Gaps = 2/406 (0%)
 Frame = +2

Query  329   NRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFE  508
             N+ S+PNYV +FDTTLRDGEQ+PGA MT K+K+D+ARQL KLGVD+IEAGFPA+SE +FE
Sbjct  8     NKFSNPNYVSIFDTTLRDGEQAPGAAMTAKQKMDIARQLVKLGVDVIEAGFPASSEVEFE  67

Query  509   AVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMK  682
              V+ IA E+GN   E  +VP+ICG +RC +++I+R WEA+K+AK P + TFIATS+IHMK
Sbjct  68    LVKSIAHEIGNSIDEEGYVPMICGAARCTKKEIERCWEALKYAKIPMICTFIATSDIHMK  127

Query  683   FKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLN  862
             +KLNMSREQVVEKATSMVAYAR+LGC  V F+ EDA RSD+EFL  I+GE+IKAGAT + 
Sbjct  128   YKLNMSREQVVEKATSMVAYARTLGCEHVRFAIEDATRSDKEFLCHIIGEIIKAGATCIC  187

Query  863   IPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEV  1042
             + DTVG  LP EFGQL+A +K NTPGI+NVI++ HC NDLGL+TANTLAG  AG RQV+V
Sbjct  188   LADTVGCNLPNEFGQLVAHVKVNTPGIQNVILAVHCHNDLGLATANTLAGICAGVRQVDV  247

Query  1043  TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHK  1222
             TINGIGERAGNASLEE+VMA+KCRGE+VLGG++TGINT+HI   S MVEEY+GL +QPHK
Sbjct  248   TINGIGERAGNASLEEIVMAIKCRGEEVLGGVHTGINTKHIFTTSNMVEEYSGLKLQPHK  307

Query  1223  AIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQ  1402
             AIVG NAF+HESGIHQDG+LK++ TYE +S EDIG  R+ + GI LGKLSGRHALK KM 
Sbjct  308   AIVGVNAFSHESGIHQDGILKNRSTYEFISAEDIGFIRSTEHGIKLGKLSGRHALKAKML  367

Query  1403  ELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQL  1540
              LGY+ D K  +DLFWRFKS+A  KK ITDDDL AL+S+E  Q Q+
Sbjct  368   LLGYNFDDKVLEDLFWRFKSMAGNKKNITDDDLRALVSNEDIQTQI  413



>ref|XP_006366147.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum tuberosum]
Length=418

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/406 (69%), Positives = 335/406 (83%), Gaps = 2/406 (0%)
 Frame = +2

Query  329   NRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFE  508
             N+ SDPNYV +FDTTLRDGEQ+PGA MT K+K+D+A QL KLGVD+IEAGFPA+SE +FE
Sbjct  12    NKFSDPNYVSIFDTTLRDGEQAPGAAMTAKQKMDIAHQLVKLGVDVIEAGFPASSEVEFE  71

Query  509   AVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMK  682
              V+ IA E+GN   E  +VP+ICGL+R  + DIDRAWE++K+AK P +H FI+TS+IHMK
Sbjct  72    LVKCIAHEIGNSIDEEGYVPMICGLARSTKEDIDRAWESLKYAKTPMIHMFISTSDIHMK  131

Query  683   FKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLN  862
             +KLNMSREQVVE+A SMV YARSLG   V F  EDA RSD++FL  I+GE+IKAGAT + 
Sbjct  132   YKLNMSREQVVERARSMVTYARSLGFKHVRFGLEDATRSDKKFLCDIIGEIIKAGATCIC  191

Query  863   IPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEV  1042
             + DTVG  LP EFGQL+A +KANTPGI+NVI++ HC NDLGL+TANTLAG  AG  QV+V
Sbjct  192   LADTVGCNLPNEFGQLVAHVKANTPGIQNVILAVHCHNDLGLATANTLAGICAGVSQVDV  251

Query  1043  TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHK  1222
             TINGIGERAGNASLEE+VMA+KCRGE+VLGG+YTGINT+HI   S MVEEY+GL +QPHK
Sbjct  252   TINGIGERAGNASLEEIVMAIKCRGEEVLGGVYTGINTKHIFTTSNMVEEYSGLKLQPHK  311

Query  1223  AIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQ  1402
             AIVG NAF+HESGIHQDG+LK++ TYE +SPEDIG  RA++ GI LGKLSGRHALK KM 
Sbjct  312   AIVGVNAFSHESGIHQDGILKNRSTYEFISPEDIGFIRASEHGIKLGKLSGRHALKAKML  371

Query  1403  ELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQL  1540
              LGY+ + K  +DLFWRFKS+A  KK ITDDDL ALIS+E  Q Q+
Sbjct  372   VLGYNFEEKVLEDLFWRFKSMAGSKKNITDDDLRALISNEAIQTQI  417



>gb|KEH22097.1| 2-isopropylmalate synthase [Medicago truncatula]
Length=436

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/416 (68%), Positives = 341/416 (82%), Gaps = 2/416 (0%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             Y PN+I  P YVR+ DTTLRDGEQSPGA M+ KEKLD+A  LAKL VD+IEAGFP+AS  
Sbjct  21    YTPNQIPIPTYVRILDTTLRDGEQSPGAAMSCKEKLDIAHLLAKLRVDVIEAGFPSASND  80

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DF AV++IAQEVGN      HVPVI G+ RCN++DI   WEAVKHAK+PR+ TF+ATS I
Sbjct  81    DFMAVKMIAQEVGNDVDNDGHVPVIGGMCRCNEKDIAITWEAVKHAKRPRICTFLATSPI  140

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL  +++QV++ A   V +ARSLGC D++F  EDA RS++EFLYQ+LGEVIKAGAT
Sbjct  141   HMEYKLRKTKDQVLKIARETVKFARSLGCCDIQFGVEDATRSEKEFLYQVLGEVIKAGAT  200

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             T+ IPDTVG  +P E+G LIADIK NTPGIENVII+THC NDLGL+TANT+ GA AGARQ
Sbjct  201   TVVIPDTVGIAMPFEYGNLIADIKMNTPGIENVIIATHCHNDLGLATANTIEGARAGARQ  260

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             +EVTINGIGERAGNASLEEVVMAL CRG  VLGGL+TGINT+HII  SKMVEEY+G+L+Q
Sbjct  261   LEVTINGIGERAGNASLEEVVMALTCRGNDVLGGLHTGINTRHIIRTSKMVEEYSGMLLQ  320

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKA+VGANAF HESGIHQDGMLKHK TYEI+SPEDIGL R+ ++ IVLGKLSGR AL+ 
Sbjct  321   PHKALVGANAFLHESGIHQDGMLKHKGTYEIISPEDIGLERSIEASIVLGKLSGRQALRK  380

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             +++E GY +   E + LFW+FK++A  KK++T+ DL  L+S+E +Q +LV  L DL
Sbjct  381   RLEEHGYKLKDDELETLFWKFKALAGTKKRVTNADLKILMSNEAYQDELVHNLHDL  436



>ref|WP_022848903.1| 2-isopropylmalate synthase [Chloroflexi bacterium oral taxon 
439]
Length=530

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/524 (56%), Positives = 381/524 (73%), Gaps = 7/524 (1%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQ PGA+MT++EK+++A  LA+L VD+IEAGFP AS  D  AVR IA EVG
Sbjct  7     IFDTTLRDGEQCPGASMTSEEKMEIAHALARLRVDVIEAGFPIASPDDLAAVRRIANEVG  66

Query  539   -NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVV  715
              +  G + P ICGL+RC ++DID AWEAV+ A +PR+H FIA+S IHMK+KL M   +V+
Sbjct  67    VSRNGSYAPAICGLARCARKDIDAAWEAVRGADRPRIHVFIASSPIHMKYKLRMEPAEVI  126

Query  716   EKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPT  895
              +A  MVAYA SL CSD+EFSPEDA RS+ EFLY++LG  I+AGATTLNIPDTVGY  P 
Sbjct  127   SRAREMVAYAHSL-CSDIEFSPEDASRSEPEFLYELLGAAIEAGATTLNIPDTVGYATPH  185

Query  896   EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGN  1075
             E+G+LI  I+ +T GIE  I+STHC +DLGL+ A TLAG   GARQ+EVTINGIGERAGN
Sbjct  186   EYGELIRKIREHTKGIEKCILSTHCHDDLGLAVATTLAGCENGARQIEVTINGIGERAGN  245

Query  1076  ASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHE  1255
             ASLEEVVMA++ R  +   GL T I+T+H+   S+MV  +TG  + P+KAIVG NAFAHE
Sbjct  246   ASLEEVVMAIRTR--ESYYGLRTDIDTRHLARVSQMVSNFTGFPIAPNKAIVGRNAFAHE  303

Query  1256  SGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDGKEF  1435
             SGIHQDGMLK+  TYEIM PED+G+    Q+ +VLGK SGRHAL  +M E+GY++   E 
Sbjct  304   SGIHQDGMLKNAMTYEIMKPEDVGV---RQTNLVLGKHSGRHALANRMAEIGYNLTEAEL  360

Query  1436  DDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLID  1615
             D LF +FK +A+KKK I+D DL AL+S ++ Q    ++L  LQ++CG++G+ TA+V+LI 
Sbjct  361   DVLFVKFKDLADKKKHISDWDLEALVSSDIRQLNPYYQLDGLQISCGTIGMPTASVRLIC  420

Query  1616  ADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNS  1795
              D E      +GTGP+DAAYKA+D++V+V  TL E+ + AVTEGIDA+    V I     
Sbjct  421   PDGETRTVAEIGTGPIDAAYKAIDVIVQVENTLKEFMIHAVTEGIDAVGEVTVRIENAVP  480

Query  1796  HTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFT  1927
                 H  +        SG GA  DIV+++V+AY+ ALNK++  T
Sbjct  481   SAEVHPQSDGAKTLLISGYGANNDIVVAAVKAYLSALNKLIEMT  524



>ref|XP_006366146.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum tuberosum]
Length=433

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 341/411 (83%), Gaps = 5/411 (1%)
 Frame = +2

Query  332   RISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEA  511
             ++SDPNYV +FDTTLRDGEQ+PGA+MT K+K+++A QLAKLGVD+IE GFPAAS+A+F+ 
Sbjct  21    QLSDPNYVTIFDTTLRDGEQAPGASMTAKQKMNIACQLAKLGVDVIEVGFPAASQAEFDL  80

Query  512   VRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKF  685
             V+L+AQ++GN   E  +VP+ICGL+R  + DIDRAWE++K+AK P +H FIATS+IHMK+
Sbjct  81    VKLVAQKIGNNIDEEGYVPMICGLARSTKEDIDRAWESLKYAKTPMIHMFIATSDIHMKY  140

Query  686   KLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNI  865
             KLNMSREQVV++A SMVAYARSLG   V FS EDA RSD+EF+Y I+GEVIKAGAT + +
Sbjct  141   KLNMSREQVVKRARSMVAYARSLGFEHVRFSLEDATRSDKEFVYHIIGEVIKAGATCICV  200

Query  866   PDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVT  1045
              DTVG  LP EF QLI DIKANT GI+NVI++ HC NDLGL+TANTL G  AG RQV+VT
Sbjct  201   ADTVGCNLPNEFAQLIVDIKANTLGIQNVILAVHCHNDLGLATANTLVGICAGVRQVDVT  260

Query  1046  INGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKA  1225
             INGIGERAGNASLEE+VMA+KCRG++VL GLYTGINT+HI   S MVEEY+GL +QPHKA
Sbjct  261   INGIGERAGNASLEEIVMAIKCRGKEVLSGLYTGINTKHIFTTSNMVEEYSGLKLQPHKA  320

Query  1226  IVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQE  1405
             IVG NAF+HESGIHQDG+LK++ TYE +  ED+G  RA + GI LGKLSGRHALK KM E
Sbjct  321   IVGVNAFSHESGIHQDGILKNRGTYEFIPAEDVGFIRATEHGIKLGKLSGRHALKIKMLE  380

Query  1406  LGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQL---VWK  1549
             LGY+ + K+  DLFWRFKS+AE+KK ITDDDL AL+ DE  QPQ+    W+
Sbjct  381   LGYNFEEKQLGDLFWRFKSLAERKKNITDDDLRALLLDETIQPQIGLTTWR  431



>gb|ADO16122.1| alpha isopropylmalate synthase [Ipomoea nil]
Length=274

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/274 (100%), Positives = 274/274 (100%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  274



>ref|XP_004244758.2| PREDICTED: 2-isopropylmalate synthase A-like [Solanum lycopersicum]
Length=445

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/399 (68%), Positives = 330/399 (83%), Gaps = 2/399 (1%)
 Frame = +2

Query  332   RISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEA  511
             ++SDPNYV +FDTTLRDGEQ+PGA+MT K+K+ +A QLAKLGVD+IE GFPAAS A+F+ 
Sbjct  45    KLSDPNYVTIFDTTLRDGEQAPGASMTAKQKMKIACQLAKLGVDVIEVGFPAASHAEFDL  104

Query  512   VRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKF  685
             V+L+AQ++GN   E  +VP+ICGL+R  + DIDRAWE++K+AK P +H FIATS++HMK+
Sbjct  105   VKLVAQKIGNNIDEEGYVPMICGLARSTKEDIDRAWESLKYAKTPMIHMFIATSDMHMKY  164

Query  686   KLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNI  865
             KLNMSRE+VVE+A SMVAYA SLG   V FS EDA RSD+EF+Y I+ EVIKAGAT + +
Sbjct  165   KLNMSREEVVERARSMVAYATSLGFEHVRFSLEDATRSDKEFVYHIIEEVIKAGATCICV  224

Query  866   PDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVT  1045
              DTVG  LP EF QLI DIKANT GI+NV+++ HC NDLGL+TANTLAG  AG RQV+VT
Sbjct  225   ADTVGCNLPNEFAQLIVDIKANTLGIQNVVLAVHCHNDLGLATANTLAGICAGVRQVDVT  284

Query  1046  INGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKA  1225
             INGIGERAGNASLEE+VM +K RG +VLGG+YTGINT++I   S MVEEY+GL +QP+KA
Sbjct  285   INGIGERAGNASLEEIVMTIKYRGGEVLGGVYTGINTKYIFTTSNMVEEYSGLKLQPNKA  344

Query  1226  IVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQE  1405
             IVGANAF+HESGIHQDGMLK++ TYE +S ED+G  RA + GI LGKLSGRHALK KM E
Sbjct  345   IVGANAFSHESGIHQDGMLKNRGTYEFISAEDVGFIRATKHGIKLGKLSGRHALKNKMLE  404

Query  1406  LGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDE  1522
             LGY  + K+  DLFWRFKS+AE KK ITDDDL ALI DE
Sbjct  405   LGYSFEEKQLGDLFWRFKSLAEGKKNITDDDLRALILDE  443



>ref|XP_004513503.1| PREDICTED: probable 2-isopropylmalate synthase-like [Cicer arietinum]
Length=434

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/416 (64%), Positives = 343/416 (82%), Gaps = 2/416 (0%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             YIPN+I +P Y+R+ DTTLRDGEQSPGA M+ KEKLD+ARQLAKL VD+IE+GFP+A   
Sbjct  19    YIPNQILNPTYLRILDTTLRDGEQSPGAAMSCKEKLDIARQLAKLRVDVIESGFPSAGND  78

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DF AV++IAQEVGN   +  +VPVI G+ RC+++DI   WEAVK+AK+PR+ TF+ATS I
Sbjct  79    DFMAVKMIAQEVGNNVDDDGYVPVIGGMCRCSEKDIAITWEAVKYAKRPRICTFLATSPI  138

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL  ++++V+  A  MV +ARSLGC DV+F  EDA RSD+EFLYQILGEVIKAGAT
Sbjct  139   HMEYKLRKTKDEVLVMARDMVKFARSLGCCDVQFGAEDAARSDKEFLYQILGEVIKAGAT  198

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             T+ IPDTVG  +P EFG LIAD+K NTPGIENVI++THC NDLGL+TANT+ GA AGARQ
Sbjct  199   TVVIPDTVGIAMPFEFGNLIADLKKNTPGIENVILATHCHNDLGLATANTIEGARAGARQ  258

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             +EVTINGIGERAGNASLEEVVM + CRG  +LGGL+TGINT+ I+  SKMVE+Y+GL +Q
Sbjct  259   LEVTINGIGERAGNASLEEVVMIVACRGNDILGGLHTGINTRQILNISKMVEKYSGLHLQ  318

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             PHKA+VG NAF HESGIHQDGMLKH+ TYEI+SPEDIGL R+  + +VLGKLSGR AL+ 
Sbjct  319   PHKALVGVNAFLHESGIHQDGMLKHRGTYEIISPEDIGLERSTLASLVLGKLSGRQALRK  378

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             +++ELGY +   E + +FW+FK++A KKK++T++DL  L+S++     +V+++GD+
Sbjct  379   RLEELGYVLKDDEVEAMFWKFKALAGKKKRVTNEDLKVLVSNKGQIHGIVYEIGDV  434



>gb|ADO16131.1| alpha isopropylmalate synthase [Ipomoea umbraticola]
Length=274

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/274 (99%), Positives = 272/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLPTEFGQLIADIK NTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPTEFGQLIADIKVNTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDADDEEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADDEEHVACCVGTGPVDAAYKA  274



>gb|ADO16114.1| alpha isopropylmalate synthase [Ipomoea alba]
Length=274

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/274 (99%), Positives = 272/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDADDEEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADDEEHVACCVGTGPVDAAYKA  274



>gb|ADO16128.1| alpha isopropylmalate synthase [Ipomoea purpurea]
Length=274

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/274 (99%), Positives = 272/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVACSVGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACSVGTGPVDAAYKA  274



>gb|ADO16129.1| alpha isopropylmalate synthase [Ipomoea quamoclit]
Length=274

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/274 (99%), Positives = 273/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGL+RANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLYRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDADDEEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADDEEHVACCVGTGPVDAAYKA  274



>gb|ADO16119.1| alpha isopropylmalate synthase [Ipomoea diamantinensis]
Length=274

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/274 (99%), Positives = 271/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIK NTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKTNTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDADDEEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADDEEHVACCVGTGPVDAAYKA  274



>gb|ADO16117.1| alpha isopropylmalate synthase [Ipomoea argillicola]
Length=274

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/274 (99%), Positives = 272/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHI+MASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIVMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD+EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADNEEHVACCVGTGPVDAAYKA  274



>gb|ADO16116.1| alpha isopropylmalate synthase [Ipomoea aquatica]
Length=274

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/274 (99%), Positives = 271/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLI+DIK NTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLISDIKTNTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDADDEEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADDEEHVACCVGTGPVDAAYKA  274



>gb|ADO16130.1| alpha isopropylmalate synthase [Ipomoea saintronanensis]
Length=274

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/274 (98%), Positives = 272/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGI+TQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGIDTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQL+WKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLIWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD+EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADNEEHVACCVGTGPVDAAYKA  274



>gb|ADO16115.1| alpha isopropylmalate synthase [Ipomoea amnicola]
Length=274

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/274 (98%), Positives = 271/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHR NQSGIVLGKLSGRHALK+KM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRVNQSGIVLGKLSGRHALKSKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD+EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADNEEHVACCVGTGPVDAAYKA  274



>ref|XP_007034043.1| 2-isopropylmalate synthase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY04969.1| 2-isopropylmalate synthase 1 isoform 3, partial [Theobroma cacao]
Length=434

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/319 (86%), Positives = 296/319 (93%), Gaps = 2/319 (1%)
 Frame = +2

Query  320   YIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEA  499
             +IPN I DPNYVRVFDTTLRDGEQSPGATMT+KEKLD+ARQLAKLGVDIIEAGFPAAS+ 
Sbjct  71    FIPNHIPDPNYVRVFDTTLRDGEQSPGATMTSKEKLDIARQLAKLGVDIIEAGFPAASKD  130

Query  500   DFEAVRLIAQEVGNG--EGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEI  673
             DFEAV+ IA+EVGN   E  +VPVICGLSRCN++DI  AWEAVK+AK+PR+HTFIATS I
Sbjct  131   DFEAVKTIAKEVGNAVDEDGYVPVICGLSRCNEKDIKAAWEAVKYAKRPRIHTFIATSGI  190

Query  674   HMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGAT  853
             HM++KL  S+ +VV+ A SMV +ARSLGC+DVEFSPEDAGRSDREFLY+ILGEVIKAGAT
Sbjct  191   HMEYKLRKSKAEVVDIARSMVRFARSLGCNDVEFSPEDAGRSDREFLYEILGEVIKAGAT  250

Query  854   TLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQ  1033
             TLNIPDTVG  LP+EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA AGARQ
Sbjct  251   TLNIPDTVGINLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGACAGARQ  310

Query  1034  VEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQ  1213
             VEVTINGIGERAGNASLEEVVMALKCRGE VLGGLYTGINT+HI+MASKMVEEYTGL VQ
Sbjct  311   VEVTINGIGERAGNASLEEVVMALKCRGEHVLGGLYTGINTRHIVMASKMVEEYTGLHVQ  370

Query  1214  PHKAIVGANAFAHESGIHQ  1270
             PHKAIVGANAFAHESGIHQ
Sbjct  371   PHKAIVGANAFAHESGIHQ  389



>gb|ADO16132.1| alpha isopropylmalate synthase [Ipomoea wrightii]
Length=274

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/274 (98%), Positives = 271/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVW+LGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWELGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD+EEHV C VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADNEEHVVCCVGTGPVDAAYKA  274



>gb|ADO16127.1| alpha isopropylmalate synthase [Ipomoea plebeia]
Length=274

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/274 (98%), Positives = 270/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK+KM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKSKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDD FWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDFFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACCVGTGPVDAAYKA  274



>gb|ADO16120.1| alpha isopropylmalate synthase [Ipomoea eriocarpa]
Length=274

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/274 (98%), Positives = 270/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPIEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK+KM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKSKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDD FWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDFFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACCVGTGPVDAAYKA  274



>gb|ADO16118.1| alpha isopropylmalate synthase [Ipomoea cordatotriloba]
Length=274

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/274 (98%), Positives = 271/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL DLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLEDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD++EHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADNKEHVACCVGTGPVDAAYKA  274



>gb|ADO16125.1| alpha isopropylmalate synthase [Ipomoea pes-tigridis]
Length=274

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/274 (98%), Positives = 270/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKH+DTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK+KM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHRDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKSKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDD FWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDFFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACCVGTGPVDAAYKA  274



>gb|ADO16121.1| alpha isopropylmalate synthase [Ipomoea lobata]
Length=274

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/274 (97%), Positives = 270/274 (99%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTL+GAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLSGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY+GLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYSGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKL DLQVTCGS
Sbjct  181   QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLEDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVAC VGTGPVD+AYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACCVGTGPVDSAYKA  274



>gb|ADO16126.1| alpha isopropylmalate synthase [Ipomoea plebeia]
Length=274

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/274 (97%), Positives = 269/274 (98%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPHEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKH+DTYEIMSPEDIGLHR NQSGIVLGKLSGRHALK+KM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHRDTYEIMSPEDIGLHRVNQSGIVLGKLSGRHALKSKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELGYDIDGKEFDD FWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGYDIDGKEFDDFFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVAC VGTGPVDAAYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACCVGTGPVDAAYKA  274



>dbj|BAL52895.1| 2-isopropylmalate synthase [uncultured prokaryote]
Length=528

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/528 (55%), Positives = 380/528 (72%), Gaps = 21/528 (4%)
 Frame = +2

Query  341   DPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRL  520
             +P+ VR+FDTTLRDGEQSPGAT+T +EKL++ARQL +LGVDIIEAGFP AS  DFEAVR 
Sbjct  2     EPDVVRIFDTTLRDGEQSPGATLTVEEKLEIARQLVRLGVDIIEAGFPIASPGDFEAVRR  61

Query  521   IAQEVGNGEGEHV---PVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKL  691
             IA+E+G    E     PVI GL+R N+ DID  WEAV+ A +PR+H F+ATS+IH+++KL
Sbjct  62    IAREIGPLGKERPNGPPVIAGLARANKEDIDACWEAVREAPRPRIHVFLATSDIHLQYKL  121

Query  692   NMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPD  871
              M+RE+ + +   MVAYARSL C DVEFSPEDAGR+DR+FL Q L   ++AGATTLNIPD
Sbjct  122   RMTREECLARIREMVAYARSL-CDDVEFSPEDAGRTDRDFLMQALTAAVEAGATTLNIPD  180

Query  872   TVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTIN  1051
             TVGYT P EFG L A+I+   PG+E VI+S HC NDLGL+TANTLA    GARQVEVT+N
Sbjct  181   TVGYTTPEEFGGLFAEIRRRVPGVERVILSAHCHNDLGLATANTLAAIRNGARQVEVTVN  240

Query  1052  GIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             GIGERAGN +LEEVVMAL  R +  + G+ T I+T  I   S++V   TG+ VQP+KAIV
Sbjct  241   GIGERAGNTALEEVVMALHTRRD--VFGVRTYIDTTQIYRTSRLVSALTGIPVQPNKAIV  298

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHE+GIHQDGMLK+  TYEIM PE +G+    +S +VLGK SGRHA + +++++G
Sbjct  299   GANAFAHEAGIHQDGMLKNPLTYEIMRPETVGV---PESRLVLGKHSGRHAFRVRLEQMG  355

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             Y +    F++ F RFK++ ++KK +TD DL A+++D        W+L  LQVTCG+  ++
Sbjct  356   YHLPPDAFEEAFRRFKALCDRKKYVTDFDLEAMMADFTQSSGQGWRLDMLQVTCGTPLIA  415

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV+L+  D E  V    G GPVDAAY+A++  + V   LLE+++ AVT G DA+   R
Sbjct  416   TATVRLVGPDGEVRVGTGTGNGPVDAAYRAIEAALGVQARLLEFNVHAVTPGRDAVG--R  473

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             V I+ ++  T   AL G        G GA  DIV+++ +AY+ A+ ++
Sbjct  474   VFIQVEDPQTG--ALAG--------GFGADTDIVVAAAKAYLHAVLRL  511



>ref|XP_010534037.1| PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like, 
partial [Tarenaya hassleriana]
Length=373

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/357 (74%), Positives = 311/357 (87%), Gaps = 3/357 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPNRISDPNYVRVFDTTLRDGEQSPGA M T++KL +AR+LA+LGVD+IEAGFPA
Sbjct  17    RRPEYIPNRISDPNYVRVFDTTLRDGEQSPGAAMQTEQKLLIARKLAELGVDVIEAGFPA  76

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             AS ADFEAV+ IA+ VGN   E   +VPVICGLSRC + D++ AWEAVKHAK+PR+H FI
Sbjct  77    ASAADFEAVKAIAETVGNDVDEETGYVPVICGLSRCRKDDVEAAWEAVKHAKRPRIHVFI  136

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHM+ KL  +RE+V++ A+SM+ +ARSLGC+DVEF  EDAGRS++ F+Y+IL EVI
Sbjct  137   STSDIHMEHKLRKTREEVIQMASSMIRFARSLGCADVEFGAEDAGRSEKGFMYKILEEVI  196

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGA+T+NI DTVG   P EFG+LI+DIKANTPGI++VIISTHCQNDLGL+TANTL+G  
Sbjct  197   KAGASTVNIADTVGINTPDEFGELISDIKANTPGIDDVIISTHCQNDLGLATANTLSGTS  256

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER GNASLEEVVM LKC+GE    GLYTGI+T+HI+ ASK+VEE+T
Sbjct  257   AGARQVEVTINGIGERGGNASLEEVVMTLKCKGEHAFCGLYTGIDTRHIVPASKLVEEHT  316

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKL  1369
             GL VQPHKAIVGANAF HESGIHQDGMLK+K TYEIM PED+GL R+ + GIVLGKL
Sbjct  317   GLHVQPHKAIVGANAFVHESGIHQDGMLKNKSTYEIMLPEDVGLERSQELGIVLGKL  373



>ref|XP_001696603.1| isopropylmalate synthase [Chlamydomonas reinhardtii]
 gb|EDP08580.1| isopropylmalate synthase [Chlamydomonas reinhardtii]
Length=444

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/455 (61%), Positives = 347/455 (76%), Gaps = 26/455 (6%)
 Frame = +2

Query  593   RDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVE  772
             +D++RAW+AV+HAK+PRVHTFIATSEIHMK     S    +  A + V + RSLGC+D+E
Sbjct  1     QDLERAWDAVRHAKRPRVHTFIATSEIHMKVSQQGSATSGLHNAVAAVKHLRSLGCTDIE  60

Query  773   FSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENV  952
             FS EDAGRSD +FLY+ILGEVIKAGATTLNIPDT G+ LP EFG+LIA IK NTPG +NV
Sbjct  61    FSSEDAGRSDPKFLYRILGEVIKAGATTLNIPDTTGWCLPHEFGELIAAIKKNTPGADNV  120

Query  953   IISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLG  1132
             IISTHCQNDLGLSTAN+LAGA AGARQ+E TINGIGERAGNASLEEVVMA+K RG     
Sbjct  121   IISTHCQNDLGLSTANSLAGAQAGARQIECTINGIGERAGNASLEEVVMAIKLRG-----  175

Query  1133  GLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMS  1312
                            KMV +Y+G++VQ HKAIVGANAFAHESGIHQDGMLK+++TYEIMS
Sbjct  176   ---------------KMVSDYSGMVVQAHKAIVGANAFAHESGIHQDGMLKNRETYEIMS  220

Query  1313  PEDIGLHRANQS-GIVLGKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKIT  1489
             PE IGL R  Q  GIVLGK SGR+AL ++++ LGY++   E DD+F RFK++A+KKK IT
Sbjct  221   PESIGLPRQEQDRGIVLGKHSGRNALNSRLRTLGYELSQSELDDVFKRFKALADKKKGIT  280

Query  1490  DDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDA  1669
             D+D++AL+SDE+ QP+++W+L DLQV CG++G+ TATV++   D    +   VGTGPVDA
Sbjct  281   DEDILALMSDELHQPKVIWELLDLQVVCGTMGMPTATVQMKGPDGIARIGVGVGTGPVDA  340

Query  1670  AYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRGDNSHT----STHALTGNVVNR  1837
             AYKAVD LV+V   L +YS+++VT+GI+A+A TRV+IR     +    S HA  G  V R
Sbjct  341   AYKAVDSLVRVEAELSDYSVSSVTQGIEALAHTRVMIRPSGKMSDAGYSEHAALG-TVQR  399

Query  1838  TFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSR  1942
              FSG+GA  DIV++S RAYV ALNKM+ +  +  R
Sbjct  400   QFSGSGANEDIVVASARAYVSALNKMIGWRRVGRR  434



>gb|ADO16123.1| alpha isopropylmalate synthase [Ipomoea obscura]
 gb|ADO16124.1| alpha isopropylmalate synthase [Ipomoea ochracea]
Length=274

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/274 (96%), Positives = 268/274 (98%), Gaps = 0/274 (0%)
 Frame = +2

Query  860   NIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  1039
             NIPDTVGYTLP EFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE
Sbjct  1     NIPDTVGYTLPNEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVE  60

Query  1040  VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPH  1219
             VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY+GLLVQPH
Sbjct  61    VTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYSGLLVQPH  120

Query  1220  KAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKM  1399
             KAIVGANAFAHESGIHQDGMLKH+DTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK+KM
Sbjct  121   KAIVGANAFAHESGIHQDGMLKHRDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKSKM  180

Query  1400  QELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  1579
             QELG+ IDGKEFDD FWRFKSVAEKKK ITDDDLIALISDEVFQPQLVWKLGDLQVTCGS
Sbjct  181   QELGFAIDGKEFDDFFWRFKSVAEKKKTITDDDLIALISDEVFQPQLVWKLGDLQVTCGS  240

Query  1580  LGLSTATVKLIDADDEEHVACSVGTGPVDAAYKA  1681
             LGLSTATVKLIDAD EEHVAC VGTGP+DAAYKA
Sbjct  241   LGLSTATVKLIDADGEEHVACCVGTGPIDAAYKA  274



>ref|WP_012594190.1| MULTISPECIES: 2-isopropylmalate synthase [Cyanothece]
 ref|YP_002371070.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8801]
 ref|YP_003136633.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8802]
 sp|B7JYP4.1|LEU1_CYAP8 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Cyanothece sp. PCC 8801]
 gb|ACK64914.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8801]
 gb|ACU99797.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 8802]
Length=536

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/535 (54%), Positives = 376/535 (70%), Gaps = 30/535 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ + +FDTTLRDGEQSPGA++T +EKL +AR LA+LGVDIIEAGFP AS  DFEAV+
Sbjct  3     NQPDRIIIFDTTLRDGEQSPGASLTVEEKLTIARSLARLGVDIIEAGFPYASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IAQ VG  +G   P ICGL+R  Q+DI  A EAVK A K R+HTF+ATS+IH+++KL  
Sbjct  63    KIAQTVGTEDG---PRICGLARATQKDIQTAAEAVKPAAKGRIHTFLATSDIHLQYKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+     MVAYA+SL   DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  120   TRQEVLAIVPDMVAYAKSL-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTINIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYTTPSEFGALIGGIKQNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R +     L          T INT+ I   S++V + TG++V
Sbjct  239   GERAGNAALEELVMALHVRRQYFNPFLGRPPESTEPLTNINTKEIYRTSRLVSQLTGMMV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVG NAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A +
Sbjct  299   QPNKAIVGKNAFAHESGIHQDGVLKNKLTYEIMDAESIGLTH-NQ--IVLGKLSGRNAFR  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             T+++ELG+++   E ++ F RFK VA+KKK+ITD DL A+++DE+ Q   +++L  +QV+
Sbjct  356   TRLKELGFELSDTEINNAFLRFKEVADKKKEITDWDLAAIVNDEMQQAPELFRLELVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG     TATV L   D +E    ++GTGPVDA YKA++ +V+VP  L+E+S+ +VT GI
Sbjct  416   CGDHACPTATVTLRTPDGQELTDAAIGTGPVDAVYKAINRVVQVPNELIEFSVKSVTAGI  475

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +              ++ +SG  A  DI+ +S RAY+ ALN++
Sbjct  476   DAMGEVTIRLRYE--------------DKIYSGYAANTDIITASARAYISALNRL  516



>ref|WP_013324885.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7822]
 ref|YP_003890122.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7822]
 gb|ADN16847.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7822]
Length=535

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/533 (55%), Positives = 372/533 (70%), Gaps = 30/533 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ V +FDTTLRDGEQSPGAT+   EKL VAR LA+LGVD+IEAGFP AS  DFEAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQSPGATLNVDEKLTVARALARLGVDVIEAGFPYASPGDFEAVQKI  64

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A+ VG   G   P ICGL+R  ++DI +A EA+K A KPR+HTF+ATS+IH+ +KL  +R
Sbjct  65    AKVVGVQGG---PTICGLARATRQDITKAAEALKPAAKPRIHTFLATSDIHLAYKLKKTR  121

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             ++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
               P+EFGQLI  IK N P I+N IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  181   LTPSEFGQLIRGIKENVPNIDNAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1064  RAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLVQP  1216
             RAGNA+LEE+VMAL  R       L          T INT+ I   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALHVRRSYYNPFLGRPADSTEPLTNINTKEIYKTSRLVSSLTGMAVQP  300

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             +KAIVGANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A  T+
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFGTR  357

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             ++ELG+++   E +  F RFK VA+K+K+ITD DL A+++DE+     +++L  +QV+CG
Sbjct  358   LKELGFELTETELNKAFVRFKEVADKRKEITDWDLEAIVNDEIHVAPEIFRLELVQVSCG  417

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
                  TATV L   + EE +  ++GTGPVDA YKA++ +V VP  L+E+S+ +VTEGIDA
Sbjct  418   DQARPTATVILKGPNGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVKSVTEGIDA  477

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             +    + ++ +              NRTFSG  A  DI+++S RAY+ ALN++
Sbjct  478   MGEVTIRLKYE--------------NRTFSGHAANTDIIVASARAYISALNRL  516



>ref|XP_003541255.1| PREDICTED: probable 2-isopropylmalate synthase-like [Glycine 
max]
Length=414

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/392 (67%), Positives = 315/392 (80%), Gaps = 2/392 (1%)
 Frame = +2

Query  311   RPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAA  490
             RP YIPN I D +YV + DTTLRDGEQSPGATMT KEKLD+ARQL KLGV I++ GFP+A
Sbjct  19    RPQYIPNHIPDSSYVCILDTTLRDGEQSPGATMTAKEKLDIARQLVKLGVHILQPGFPSA  78

Query  491   SEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
             S +DF AV++IAQEVGN  G+  +VPVI G  RC ++DI  AWEAVK+AK+PR+ T IAT
Sbjct  79    SNSDFMAVKMIAQEVGNAVGDDGYVPVIAGFCRCVEKDISTAWEAVKYAKRPRLCTSIAT  138

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S IHM+ KL  S++QV++ A  MV +ARSLGC+D++F  EDA RSDREFLY+ILG VI+ 
Sbjct  139   SPIHMEHKLRKSKDQVIQIARDMVEFARSLGCNDIQFGAEDATRSDREFLYEILGVVIEV  198

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATT+NI DTVG  +P E G+LI DIK NTPGI NVIISTHC NDLGL+TANT+ GA  G
Sbjct  199   GATTVNIADTVGIVMPLELGKLIVDIKDNTPGIANVIISTHCHNDLGLATANTIEGARTG  258

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGL  1204
             ARQ+EVTINGIGERAGNASLEEVVM L  +G+  L GLYT INT+HI+  SKMVEEY+G+
Sbjct  259   ARQLEVTINGIGERAGNASLEEVVMVLASKGDHALNGLYTRINTRHILETSKMVEEYSGM  318

Query  1205  LVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHA  1384
              +QPHK +VGANAF H SGIHQDGMLKHK TYE +SPE+IG  R  + GIVLGKLSG  A
Sbjct  319   HLQPHKPLVGANAFVHASGIHQDGMLKHKGTYETISPEEIGHKRTTRIGIVLGKLSGSQA  378

Query  1385  LKTKMQELGYDIDGKEFDDLFWRFKSVAEKKK  1480
             L+ +++ELGYD+   E D +FW+FK++AEKKK
Sbjct  379   LRKRLEELGYDLKEDEVDSVFWQFKAMAEKKK  410



>ref|WP_012598523.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7424]
 ref|YP_002376445.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7424]
 sp|B7KJX8.1|LEU1_CYAP7 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Cyanothece sp. PCC 7424]
 gb|ACK69577.1| 2-isopropylmalate synthase [Cyanothece sp. PCC 7424]
Length=536

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/537 (54%), Positives = 372/537 (69%), Gaps = 30/537 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + PN + +FDTTLRDGEQSPGAT+   EKL VAR LA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     NQPNRIIIFDTTLRDGEQSPGATLNGDEKLTVARALARLGVDVIEAGFPYASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA+ VG   G   P ICGL+R  + DI +A EA+K A KPR+HTF+ATS+IH+ +KL  
Sbjct  63    QIAKVVGVEGG---PSICGLARATKADIAKAAEALKPAAKPRIHTFLATSDIHLAYKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  120   TRQEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GY  P+EFGQLI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYLTPSEFGQLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R +     L          T INT+ I   S++V   TG+ V
Sbjct  239   GERAGNAALEELVMALHVRRQYYNPFLGRPVDSTEPLTNINTKEIYKTSRLVSNLTGMAV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGRHA  
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRHAFS  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             T+++ELG+++   + +  F RFK VA+KKK+ITD DL A+++DE+ Q   V++L  +QV+
Sbjct  356   TRLKELGFELSETDLNKAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPEVFRLELVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG     TATV L   + +E +  ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GI
Sbjct  416   CGDQARPTATVILRGPEGQELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVKSVTAGI  475

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             DA+    + ++ +              NR FSG  A  DI+++S RAY+ ALN++ +
Sbjct  476   DAMGEVTIRLKYE--------------NRIFSGHAANTDIIVASARAYISALNRLYA  518



>ref|WP_017296798.1| 2-isopropylmalate synthase [Nodosilinea nodulosa]
Length=539

 Score =   550 bits (1417),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 288/535 (54%), Positives = 372/535 (70%), Gaps = 30/535 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ + +FDTTLRDGEQSPGAT+  +EKL +ARQLA+LGVDIIEAGFP AS  DFEAV+ I
Sbjct  7     PDRILIFDTTLRDGEQSPGATLNVEEKLVIARQLARLGVDIIEAGFPFASPGDFEAVQKI  66

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A+EVG  +G   P ICGL+R  + DI+RA EA+K A K R+HTF+ATS+IHM++KL  SR
Sbjct  67    AREVGTADG---PTICGLARATRGDIERAGEAIKPAAKGRIHTFLATSDIHMQYKLRKSR  123

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             E+V+  A  MVAYA++    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   EEVLAIAPEMVAYAKTF-TKDVEFSPEDAGRSDPEFLYQVLEAAIAAGATTVNIPDTVGY  182

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
               PTEFG LI  I+ N P I+  +IS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  183   LTPTEFGGLIRGIRENVPNIDQAVISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  242

Query  1064  RAGNASLEEVVMALKCRG---EQVLG------GLYTGINTQHIIMASKMVEEYTGLLVQP  1216
             RAGNA+LEE+VMA+  R       LG         T I+T+ I   S++V   TG+ VQP
Sbjct  243   RAGNAALEELVMAMHVRRAFYNPFLGRPAESEAPLTNIDTRQIYKTSRLVSNLTGMFVQP  302

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             +KAIVGANAFAHESGIHQDG+LK+K TYEIM    IGL     + IVLGK SGR+A +T+
Sbjct  303   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDATSIGL---TDNQIVLGKHSGRNAFRTR  359

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             +QELGY++D +  +  F RFK +A+KKK+ITD D+ ++++DE  Q    + LG +QV+CG
Sbjct  360   LQELGYELDDQALNRAFLRFKELADKKKEITDWDIESIVNDETQQAPEHFHLGLVQVSCG  419

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
                  TATV L   D +E +  ++GTGPVDA YKA++ +V +P  L+E+S+ +VTEGIDA
Sbjct  420   DSAKPTATVTLRTPDGQELMDAAIGTGPVDAVYKAINRVVDIPNQLIEFSVQSVTEGIDA  479

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             +    + +R +              +R FSG  A  DIV++S  AY+ ALN++ +
Sbjct  480   LGEVTIRVRHE--------------DRVFSGHAANTDIVVASAHAYLHALNRLYT  520



>ref|WP_015147156.1| 2-isopropylmalate synthase [Oscillatoria acuminata]
 ref|YP_007084426.1| 2-isopropylmalate synthase [Oscillatoria acuminata PCC 6304]
 gb|AFY80506.1| 2-isopropylmalate synthase [Oscillatoria acuminata PCC 6304]
Length=535

 Score =   548 bits (1411),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 286/539 (53%), Positives = 373/539 (69%), Gaps = 32/539 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ + +FDTTLRDGEQSPGA++  +EKL +ARQLA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     TQPDRIIIFDTTLRDGEQSPGASLNGEEKLTIARQLARLGVDVIEAGFPYASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA+ VG   G   P ICGL+R  + DI+ A +A+K A K R+HTFIATS+IH+++KL  
Sbjct  63    KIAELVGVEGG---PTICGLARATRADIEAAGKALKPAAKARIHTFIATSDIHLEYKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R +VV  A  MVAYA+S    DVEFSPEDAGRSD EFLY++L + I AGATT+NIPDTV
Sbjct  120   TRPEVVAIAEEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYEVLTKAIAAGATTINIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P EFG +I  IK N P I++ IIS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYTTPGEFGAIIRGIKENVPNIDDAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R +     L          T I+T+ I   S++V   TG+ V
Sbjct  239   GERAGNAALEELVMALHVRRQYFNPFLGRPVDSQESLTNIDTRQIYKTSRLVSNLTGMFV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  + IGL     + IVLGKLSGRHA  
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKHKQTYEIMDAQSIGL---TDNQIVLGKLSGRHAFA  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             ++++ELG+D+   E ++ F +FK+VA+KKK++TD DL ++++ E+ QP  +++L  +QV+
Sbjct  356   SRLKELGFDLSDTELNNAFLKFKTVADKKKEVTDWDLESIVNAEIQQPPEIFRLELVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG     TATV L     EE    ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GI
Sbjct  416   CGDRARPTATVTLRTPTGEELTDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGI  475

Query  1751  DAIASTRVLIR-GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DA+    + +R GD               R FSG  A  DI+++S  AYV ALN++ +F
Sbjct  476   DALGEVTIRLRHGD---------------RIFSGHSANTDIIVASAHAYVNALNRLYAF  519



>ref|WP_011956698.1| 2-isopropylmalate synthase [Roseiflexus sp. RS-1]
 ref|YP_001276302.1| 2-isopropylmalate synthase [Roseiflexus sp. RS-1]
 gb|ABQ90352.1| 2-isopropylmalate synthase [Roseiflexus sp. RS-1]
Length=556

 Score =   548 bits (1411),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 283/528 (54%), Positives = 377/528 (71%), Gaps = 12/528 (2%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             ++VR+FDTTLRDGEQ+PG TMT +EKL+VARQLA+LGVDIIEAGFPAAS  D+ AV  IA
Sbjct  3     DHVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLARLGVDIIEAGFPAASPGDWAAVHEIA  62

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             + VG  +G   P+I  L+R N+ DID+AW A++ A K R+HTFI++S+IH++ +L  +RE
Sbjct  63    RTVGTPDG---PIIAALARANKDDIDKAWSAIQPAAKKRIHTFISSSDIHIEHQLRSTRE  119

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E+A  MV YARSL C DVEFSP DA RSD E++Y++L  V++ GATTLNIPDTVGY 
Sbjct  120   EVLERARMMVRYARSL-CDDVEFSPMDATRSDPEYVYRMLAAVVEEGATTLNIPDTVGYA  178

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
              P E+ +LIA I  + PG E VIISTHC +DLG++ AN+LAG  AGARQ+E TINGIGER
Sbjct  179   TPEEYAELIAGIYRHVPGAEKVIISTHCHDDLGMAVANSLAGVRAGARQIECTINGIGER  238

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNASLEEVVMALK R  +   G+ T INT+ +  +S++V    G+ V P+KAIVGANAF
Sbjct  239   AGNASLEEVVMALKTR--RSFFGVDTRINTRELARSSRLVSTIIGMPVPPNKAIVGANAF  296

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
             AHESGIHQDG+LKH+ TYEIM    IGL   + + IVLGK SGR+AL+TK+  +GY+ D 
Sbjct  297   AHESGIHQDGVLKHRMTYEIMDATTIGL---DGNAIVLGKHSGRNALRTKLAAMGYEFDS  353

Query  1427  -KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATV  1603
              +EF+ +F RFK + +KKK + D DL  L +        +++L  +QVTCG+     ATV
Sbjct  354   EEEFNQVFQRFKELCDKKKVVDDRDLEVLATGGSLHTPDLYRLDHVQVTCGTGVTPVATV  413

Query  1604  KLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIR  1783
             ++ D D   H   + GTGPVDA YKA+D +V  P  L+E+S+ AVTEGIDA+A   V IR
Sbjct  414   RITDPDGNTHTTAAHGTGPVDAIYKAIDKIVGRPNELIEFSIKAVTEGIDAVAEVSVRIR  473

Query  1784  --GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
               G+      + +  +   + +SG  A  D ++++  +Y+ ALNKM++
Sbjct  474   EPGNEVQEGEYRVGRHRGPQIYSGYSANTDTIVAAAESYMTALNKMIA  521



>ref|WP_006560911.1| 2-isopropylmalate synthase [Oscillochloris trichoides]
 gb|EFO81777.1| hypothetical protein OSCT_0354 [Oscillochloris trichoides DG-6]
Length=546

 Score =   547 bits (1409),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 281/534 (53%), Positives = 381/534 (71%), Gaps = 16/534 (3%)
 Frame = +2

Query  341   DPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRL  520
             D ++VR+FDTTLRDGEQ+PG TMT +EKL+VARQLA++ VDIIEAGFPAAS  D+ AV  
Sbjct  2     DVDHVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLARMRVDIIEAGFPAASPGDWAAVHE  61

Query  521   IAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMS  700
             IA+EVG  +G   P I  L+R N+ DID+AW A++ A   R+HTF++TS+IH++ +   S
Sbjct  62    IAREVGTPDG---PTIAALARANKDDIDKAWTAIQPAAHKRIHTFMSTSDIHLEHQFRKS  118

Query  701   REQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVG  880
             R + +E    MV+YARSL C DVEFSP DA RSD E+L+Q L   ++ GATTLNIPDTVG
Sbjct  119   RGEALELIGEMVSYARSL-CDDVEFSPMDATRSDPEYLFQALKIAVECGATTLNIPDTVG  177

Query  881   YTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIG  1060
             Y+ P E+G LIA I+ N PG + VIISTHC +DLG++ AN+LAG YAGARQ+E TINGIG
Sbjct  178   YSTPQEYGDLIAAIRQNVPGADKVIISTHCHDDLGVAVANSLAGVYAGARQIECTINGIG  237

Query  1061  ERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGAN  1240
             ERAGNASLEEVVMAL  R EQ   GL T + T+ +  AS+ V  + G+ V P+KAIVGAN
Sbjct  238   ERAGNASLEEVVMALHTR-EQFY-GLKTQVVTRELARASRTVSSFIGVPVPPNKAIVGAN  295

Query  1241  AFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDI  1420
              FAHESGIHQDG+LK++ TYEIMS E +GL   + + ++LGK SGRHA +  ++ +GYD+
Sbjct  296   TFAHESGIHQDGVLKNRMTYEIMSAETVGL---DGNALILGKHSGRHAFRKHVEAMGYDL  352

Query  1421  DGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTAT  1600
             + ++F  +F RFK + ++KK++ D D+ ALIS E+     ++KL  +Q + G+  + TAT
Sbjct  353   NDEDFQHVFARFKDLCDRKKRVDDRDIEALISGEIQHTPQIYKLAHVQYSSGTGMIPTAT  412

Query  1601  VKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLI  1780
             V+L+  D+ E +  ++GTGPVDA Y+A++ ++  P  L+E+S+ A+TEG+DA+A   V I
Sbjct  413   VRLLGPDETEQIDSALGTGPVDAIYQAINRMINRPNELIEFSIKAITEGLDAVAEVTVRI  472

Query  1781  RGDNSHTST------HALTGN-VVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             R  +    T        LTG   V + FSG G   D V+++  AY+GALNKML+
Sbjct  473   REQSEEARTVDDPTSINLTGKRAVQQIFSGYGIHTDSVLAAAEAYMGALNKMLA  526



>ref|WP_010873307.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
 ref|NP_442009.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
 ref|YP_005383877.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 ref|YP_005387046.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 ref|YP_005409753.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 ref|YP_005652069.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
 ref|YP_007451889.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
 sp|P48576.1|LEU1_SYNY3 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA10079.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
 dbj|BAK50864.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
 dbj|BAL29862.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL33031.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL36200.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM54580.1| 2-isopropylmalate synthase [Bacillus subtilis BEST7613]
 gb|AGF52375.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6803]
Length=533

 Score =   546 bits (1407),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 293/530 (55%), Positives = 374/530 (71%), Gaps = 30/530 (6%)
 Frame = +2

Query  353   VRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQE  532
             + +FDTTLRDGEQSPGAT+T +EKL +AR LA+LGVDIIEAGFP AS  DFEAV+ IAQ 
Sbjct  8     ILIFDTTLRDGEQSPGATLTVEEKLSIARALARLGVDIIEAGFPFASPGDFEAVQKIAQT  67

Query  533   VGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQV  712
             VG   G   PVICGL+R  Q+DI  A EA+K A K R+HTF+ATS+IH++ KL  +R +V
Sbjct  68    VGTENG---PVICGLARATQKDIKAAAEALKPAAKHRIHTFLATSDIHLEHKLKKTRAEV  124

Query  713   VEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLP  892
             +     MVAYA+SL  +D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGYT P
Sbjct  125   LAIVPEMVAYAKSL-VNDIEFSPEDAGRSDPEFLYQVLEAAISAGATTINIPDTVGYTTP  183

Query  893   TEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAG  1072
              E+G LI  I  N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGERAG
Sbjct  184   AEYGALIKGIADNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAG  243

Query  1073  NASLEEVVMALKCRG---EQVLG------GLYTGINTQHIIMASKMVEEYTGLLVQPHKA  1225
             NA+LEE+VMAL  R       LG         T I+T+HI   S++V E TG++VQP+KA
Sbjct  244   NAALEELVMALHVRRSYFNPFLGRPADSTAPLTNIDTKHIYATSRLVSELTGMMVQPNKA  303

Query  1226  IVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQE  1405
             IVGANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A  T+++E
Sbjct  304   IVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFGTRLKE  360

Query  1406  LGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLG  1585
             LG+D+   E ++ F RFK VA+K+K+ITD DL A+++DE+ QP  +++L  +QV+CG   
Sbjct  361   LGFDLSDTELNNAFIRFKEVADKRKEITDWDLEAIVNDEIRQPPELFRLERVQVSCGEPS  420

Query  1586  LSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIAS  1765
             + TAT+ +      E  A ++GTGPVDA YKA++ +V++P  LLEYS+T+VTEGIDA+  
Sbjct  421   VPTATLTIRTPAGPEETAVAIGTGPVDAVYKAINQIVQLPNELLEYSVTSVTEGIDALGK  480

Query  1766  TRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
               V +R +                 ++G  A  DI+++S RAY+GALN++
Sbjct  481   VSVRLRHNGV--------------IYTGYAANTDIIVASARAYLGALNRL  516



>emb|CAJ55512.1| methylthioalkylmalate synthase a [Boechera divaricarpa]
Length=504

 Score =   545 bits (1404),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 253/411 (62%), Positives = 332/411 (81%), Gaps = 5/411 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQ+PG ++T  +KL++ARQLAKL VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE + E V+ IA+ VGN   E   +VP IC ++R    DI+ AWEAVK+AK+PR+  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEETGYVPAICAIARSKHSDIEAAWEAVKYAKRPRILIFT  189

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A S V +A+SLG +D++F  ED GRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQFGCEDGGRSDKEFLCKILGESI  249

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGAT +N+ DTVG  +P E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGATVVNVADTVGINMPHEYGELVTYVKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNASLEEVVMALKCRG  VL G+YTGI+T+ I+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVLDGVYTGIDTREIMATSKMVQEYT  369

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  429

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI--SDEV  1525
             HA+K +++ELGY++D ++ +D+F RF+ + + KK+ITD DL AL+  SDE+
Sbjct  430   HAMKGRLKELGYELDDEKLNDVFSRFRDLTKHKKRITDADLKALVTSSDEI  480



>ref|WP_007306993.1| 2-isopropylmalate synthase [Crocosphaera watsonii]
 gb|EAM49269.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 8501]
 gb|EHJ11128.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 0003]
Length=537

 Score =   546 bits (1406),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 287/542 (53%), Positives = 375/542 (69%), Gaps = 30/542 (6%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQSPGA++T +EKL +AR LA+LGVDIIEAGFP AS  DF+AV+ IA+ VG
Sbjct  10    IFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFQAVQKIAETVG  69

Query  539   NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVE  718
                G   P ICGL+R + +DI  A EA+K A K R+HTFIATS+IH+K KL  +R +V++
Sbjct  70    TENG---PRICGLARASTKDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTRSEVLD  126

Query  719   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTE  898
                 MVAYA++    D+EFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  127   IVPEMVAYAKTF-TDDIEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGYTTPSE  185

Query  899   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNA  1078
             FG +I  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGIGERAGNA
Sbjct  186   FGAIIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1079  SLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             +LEE+VMAL  R +     L          T INTQ I   S++V   TG++VQP+KAIV
Sbjct  246   ALEELVMALHVRRQYFNPFLGRAVDSTEPLTNINTQEIYKTSRLVSNLTGMIVQPNKAIV  305

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A +T++ ELG
Sbjct  306   GANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFRTRLSELG  362

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             +++   + ++ F RFK VA+KKK+ITD DL A+++DE+ Q   +++L  +QV+CG   +S
Sbjct  363   FELSDNDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCGDHAVS  422

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV L + + +E    ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GIDA+    
Sbjct  423   TATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDAMGEVT  482

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNK  1951
             + +R +               RT+SG  A  DI+ +S RAY+ ALN++       S+ N 
Sbjct  483   IRLRHE--------------GRTYSGYAANTDIITASARAYISALNRLYGAIQEQSKVNS  528

Query  1952  TE  1957
             +E
Sbjct  529   SE  530



>ref|WP_021829821.1| 2-isopropylmalate synthase [Crocosphaera watsonii]
 emb|CCQ60867.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 0401]
 emb|CCQ50009.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 8502]
Length=546

 Score =   546 bits (1406),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 287/542 (53%), Positives = 375/542 (69%), Gaps = 30/542 (6%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQSPGA++T +EKL +AR LA+LGVDIIEAGFP AS  DF+AV+ IA+ VG
Sbjct  19    IFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFQAVQKIAETVG  78

Query  539   NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVE  718
                G   P ICGL+R + +DI  A EA+K A K R+HTFIATS+IH+K KL  +R +V++
Sbjct  79    TENG---PRICGLARASTKDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTRSEVLD  135

Query  719   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTE  898
                 MVAYA++    D+EFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  136   IVPEMVAYAKTF-TDDIEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGYTTPSE  194

Query  899   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNA  1078
             FG +I  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGIGERAGNA
Sbjct  195   FGAIIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  254

Query  1079  SLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             +LEE+VMAL  R +     L          T INTQ I   S++V   TG++VQP+KAIV
Sbjct  255   ALEELVMALHVRRQYFNPFLGRAVDSTEPLTNINTQEIYKTSRLVSNLTGMIVQPNKAIV  314

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A +T++ ELG
Sbjct  315   GANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFRTRLSELG  371

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             +++   + ++ F RFK VA+KKK+ITD DL A+++DE+ Q   +++L  +QV+CG   +S
Sbjct  372   FELSDNDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCGDHAVS  431

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV L + + +E    ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GIDA+    
Sbjct  432   TATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDAMGEVT  491

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNK  1951
             + +R +               RT+SG  A  DI+ +S RAY+ ALN++       S+ N 
Sbjct  492   IRLRHE--------------GRTYSGYAANTDIITASARAYISALNRLYGAIQEQSKVNS  537

Query  1952  TE  1957
             +E
Sbjct  538   SE  539



>gb|AIE73388.1| 2-isopropylmalate synthase [Synechocystis sp. PCC 6714]
Length=533

 Score =   545 bits (1404),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 293/535 (55%), Positives = 375/535 (70%), Gaps = 30/535 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             S  + + +FDTTLRDGEQSPGAT+T +EKL +AR LA+LGVDIIEAGFP AS  DFEAV+
Sbjct  3     SPADRILIFDTTLRDGEQSPGATLTVEEKLSIARALARLGVDIIEAGFPFASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IAQ VG   G   PVICGL+R  Q+DI  A EA+K A K R+HTF+ATS+IH++ KL  
Sbjct  63    KIAQTVGTETG---PVICGLARATQKDIKAAAEALKPAAKHRIHTFLATSDIHLEHKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R +V+     MV+YA+SL   D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  120   TRAEVLAIVPEMVSYAKSL-VDDIEFSPEDAGRSDPEFLYQVLEVAIAAGATTINIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P E+G LI  I  N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYTTPAEYGALIKGIADNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R       L          T I+T+HI   S++V E TG++V
Sbjct  239   GERAGNAALEELVMALHVRRSYFNPFLGRPADSTEPLTNIDTKHIYATSRLVSELTGMMV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A  
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFG  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             T+++ELG+D+   E ++ F RFK VA+K+K+ITD DL A+++DE+ QP  +++L  +QV+
Sbjct  356   TRLKELGFDLSDTELNNAFIRFKEVADKRKEITDWDLEAIVNDEIRQPPELFRLERVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG   + TAT+ +     EE  A ++GTGPVDA YKA++ +V++P  LLEYS+T+VTEGI
Sbjct  416   CGEPSVPTATLTIRTPAGEEETAVAIGTGPVDAVYKAINQIVQLPNELLEYSVTSVTEGI  475

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    V +R +                 ++G  A  DI+++S RAY+GALN++
Sbjct  476   DALGKVSVRLRHNGV--------------IYTGYAANTDIIVASARAYLGALNRL  516



>ref|WP_021832269.1| 2-isopropylmalate synthase [Crocosphaera watsonii]
 emb|CCQ53962.1| 2-isopropylmalate synthase [Crocosphaera watsonii WH 0005]
Length=548

 Score =   545 bits (1405),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 287/542 (53%), Positives = 375/542 (69%), Gaps = 30/542 (6%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQSPGA++T +EKL +AR LA+LGVDIIEAGFP AS  DF+AV+ IA+ VG
Sbjct  21    IFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFQAVQKIAETVG  80

Query  539   NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVE  718
                G   P ICGL+R + +DI  A EA+K A K R+HTFIATS+IH+K KL  +R +V++
Sbjct  81    TENG---PRICGLARASTKDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKKTRSEVLD  137

Query  719   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTE  898
                 MVAYA++    D+EFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  138   IVPEMVAYAKTF-TDDIEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTVGYTTPSE  196

Query  899   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNA  1078
             FG +I  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGIGERAGNA
Sbjct  197   FGAIIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  256

Query  1079  SLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             +LEE+VMAL  R +     L          T INTQ I   S++V   TG++VQP+KAIV
Sbjct  257   ALEELVMALHVRRQYFNPFLGRAVDSTEPLTNINTQEIYKTSRLVSNLTGMIVQPNKAIV  316

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A +T++ ELG
Sbjct  317   GANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFRTRLSELG  373

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             +++   + ++ F RFK VA+KKK+ITD DL A+++DE+ Q   +++L  +QV+CG   +S
Sbjct  374   FELSDNDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVSCGDHAVS  433

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV L + + +E    ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GIDA+    
Sbjct  434   TATVTLRNPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGIDAMGEVT  493

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNK  1951
             + +R +               RT+SG  A  DI+ +S RAY+ ALN++       S+ N 
Sbjct  494   IRLRHE--------------GRTYSGYAANTDIITASARAYISALNRLYGAIQEQSKVNS  539

Query  1952  TE  1957
             +E
Sbjct  540   SE  541



>ref|XP_009358943.1| PREDICTED: 2-isopropylmalate synthase A-like [Pyrus x bretschneideri]
Length=473

 Score =   542 bits (1397),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 261/406 (64%), Positives = 323/406 (80%), Gaps = 2/406 (0%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             +P  P+YIPNRI +  YVRV DTTLRDGEQ+PGA+MT  EKL +A QLAKL VD+IEAGF
Sbjct  63    SPTHPEYIPNRIPNETYVRVVDTTLRDGEQAPGASMTRLEKLAIAHQLAKLRVDVIEAGF  122

Query  482   PAASEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PA+S+ D E V+LIA+EVG+   E  +VPVI    RC + D+D AWE+VK A +PR+  F
Sbjct  123   PASSKYDLETVKLIAKEVGSRVDECGYVPVISAYCRCVRSDVDAAWESVKDATRPRLCIF  182

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             I+TS+IHMK+KLN + +QV+E A   V YARSLG  D+ F  EDAGRS++EFLY+I GE 
Sbjct  183   ISTSKIHMKYKLNKTADQVLELAKESVRYARSLGAQDITFVCEDAGRSEKEFLYRIYGEA  242

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTL   DTVGY  P+E  Q + D+KAN  GIENVI+S HC ND GL+ ANT+AGA
Sbjct  243   IKAGATTLTFTDTVGYNFPSEVEQFVKDLKANVIGIENVILSMHCHNDFGLANANTIAGA  302

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
             YAGARQVEVTINGIGERAGNASLEE VMA+K RG+ +LGGL+TGINT+HI+ ASKMVEEY
Sbjct  303   YAGARQVEVTINGIGERAGNASLEEFVMAVKTRGKDMLGGLHTGINTKHIVAASKMVEEY  362

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             +GL VQPHKAIVGAN F+H SGIHQDG+LK+K TYEI+  EDIG   ++ +GIVLGK SG
Sbjct  363   SGLSVQPHKAIVGANIFSHASGIHQDGVLKNKSTYEIILAEDIGYVHSHDTGIVLGKHSG  422

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI  1513
             RHALK+++ +LG+D+D K+F ++F  FKS+AE KK +T +DL +L+
Sbjct  423   RHALKSRLLQLGHDLDEKKFHEVFEHFKSLAETKKSLTKEDLESLV  468



>ref|WP_023652298.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi]
 ref|YP_008855991.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi GY50]
 gb|AHB13524.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi GY50]
Length=505

 Score =   543 bits (1399),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 271/524 (52%), Positives = 365/524 (70%), Gaps = 26/524 (5%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             + +++FDTTLRDGEQ+ GA++  +EKL++ARQL KLGVDIIEAGFP  S  DFEAV+LIA
Sbjct  2     DKIKIFDTTLRDGEQAAGASLNAQEKLEIARQLEKLGVDIIEAGFPITSPGDFEAVKLIA  61

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             QEV        PVICGL+R    DIDRAWEA+K A  PR+H FI++SEIHM  ++  SR+
Sbjct  62    QEV------RTPVICGLARAIPADIDRAWEALKEAAHPRIHVFISSSEIHMVHQIKKSRD  115

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E A +MVA A+S    D+EFSP DA RSD EFLY++L  VI AGATTLNIPDTVGY 
Sbjct  116   EVLELARTMVARAKSY-TDDIEFSPMDASRSDPEFLYKLLEAVIDAGATTLNIPDTVGYA  174

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
             +P+EFG+LI  I+ N P I   +IS HC +DLG+ TAN+LA    GARQVE T+NGIGER
Sbjct  175   IPSEFGELIKGIRQNVPNINKAVISVHCHDDLGMGTANSLAAVKNGARQVECTLNGIGER  234

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNA+LEEVVMAL+ R +       TGINTQ I  +S++V   TG  +QP+KA+VG NAF
Sbjct  235   AGNAALEEVVMALRTRSD--FFNFETGINTQEIYRSSRLVSALTGFAIQPNKAVVGENAF  292

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
              H+SGIHQDG++K   T+EIM P+++G+     S +VLGKLSGRHA K  + ELG+D++ 
Sbjct  293   RHQSGIHQDGVIKMAKTFEIMDPKEVGIQ---ASSLVLGKLSGRHAFKQHLTELGFDLNE  349

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
             ++FD  F  FK +A+KKK +TD D+ AL+++E+     ++ L  +QVT G  G+ TA V+
Sbjct  350   EDFDRAFKAFKDLADKKKDVTDRDIEALVAEELRTTVELYHLDRIQVTSGDRGIPTAAVR  409

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             L   + E     ++G+GPVDA YKA++ +V VP  L E+S+ +VT GIDA+    + I  
Sbjct  410   LTTPNGEAAEDAALGSGPVDAVYKAINRIVNVPNKLTEFSVKSVTAGIDALGEVLIRIES  469

Query  1787  DNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             D                T++G G+  DI+++S +AY+ ALN++L
Sbjct  470   DGV--------------TYTGRGSDTDIIVASAKAYMNALNRLL  499



>ref|XP_006367400.1| PREDICTED: 2-isopropylmalate synthase A-like [Solanum tuberosum]
Length=382

 Score =   538 bits (1386),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 253/364 (70%), Positives = 304/364 (84%), Gaps = 2/364 (1%)
 Frame = +2

Query  329   NRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFE  508
             ++ SDPNYV +FDTTLRDGEQ+PGA+MT  +K+D+ARQL KLGVD+IEAGFPA+SE +FE
Sbjct  17    DKFSDPNYVSIFDTTLRDGEQAPGASMTATQKMDIARQLVKLGVDVIEAGFPASSEVEFE  76

Query  509   AVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMK  682
              V+ IA E+GN   E  +VP+ICGL+R  + DIDRAWE++K+AK P +H FI+TS+IHMK
Sbjct  77    LVKCIAHEIGNSVDEEGYVPMICGLARSTKEDIDRAWESLKYAKTPMIHMFISTSDIHMK  136

Query  683   FKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLN  862
             +KLNMSREQVVE+A SMV YARSLG   V F  EDA RSD+EF+Y I+GEVIKAGAT + 
Sbjct  137   YKLNMSREQVVERARSMVTYARSLGFKHVRFGLEDATRSDKEFVYHIIGEVIKAGATCIC  196

Query  863   IPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEV  1042
             + DTVG  LP EF QLI DIKANT GI+NVI++ HC NDLGL+TANTLAG  AG RQ++V
Sbjct  197   VADTVGCNLPNEFAQLIVDIKANTLGIQNVILAVHCHNDLGLATANTLAGICAGVRQIDV  256

Query  1043  TINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHK  1222
             TINGIGERAGNASLEE+VMA+KCRGE+VLGG+YTGINT+HI   S MVEEY+GL +QPHK
Sbjct  257   TINGIGERAGNASLEEIVMAIKCRGEEVLGGVYTGINTKHIFTTSNMVEEYSGLKLQPHK  316

Query  1223  AIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQ  1402
             AIVGANAF HESGIHQDG+LK++ TYE +S ED+G  RA++ GI LGKLSGRHALK KM 
Sbjct  317   AIVGANAFTHESGIHQDGILKNRGTYEFISAEDVGFIRASEHGIKLGKLSGRHALKIKML  376

Query  1403  ELGY  1414
             E+ Y
Sbjct  377   EVQY  380



>ref|XP_006289820.1| hypothetical protein CARUB_v10003425mg [Capsella rubella]
 gb|EOA22718.1| hypothetical protein CARUB_v10003425mg [Capsella rubella]
Length=508

 Score =   543 bits (1398),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 247/406 (61%), Positives = 330/406 (81%), Gaps = 3/406 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPN++ D NYVRVFDTTLRDGEQ+PG ++T  +KL++ARQLAKL VDI+E GFP 
Sbjct  74    RRPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  133

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE + E V+ IA+ VGN   E   +VPVIC ++R   +DI+ AWEAVK+AK+PR+  F 
Sbjct  134   SSEEELETVKTIAKTVGNEVDEETGYVPVICAIARSKNKDIEAAWEAVKYAKRPRILIFT  193

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A S V +A+SLG +D++   ED GRSD++FL +ILGE I
Sbjct  194   STSDIHMKYKLKKTKEEVIEMAASSVRFAKSLGFNDIQLGCEDGGRSDKDFLCKILGESI  253

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGAT +N+ DTVG  +P E+G+L+  +KANTPGI +++ S HC NDLGL+TAN++AG  
Sbjct  254   KAGATVVNVADTVGINMPHEYGELVTYLKANTPGINDIVFSVHCHNDLGLATANSIAGIR  313

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNASLEEVVMA+KCRG  VL G+YTG++T+ I+  SKMV+EYT
Sbjct  314   AGARQVEVTINGIGERSGNASLEEVVMAMKCRGAYVLDGVYTGLDTREIMATSKMVQEYT  373

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  374   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  433

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS  1516
             HA+K +++ELGY++D ++ +D+F RF+ + + KK+ITD D+ AL++
Sbjct  434   HAVKERLKELGYELDDQKLNDVFSRFRDLTKHKKRITDADMKALVT  479



>ref|WP_009556473.1| 2-isopropylmalate synthase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69565.1| 2-isopropylmalate synthase [Oscillatoriales cyanobacterium JSC-12]
Length=550

 Score =   544 bits (1402),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 283/528 (54%), Positives = 368/528 (70%), Gaps = 30/528 (6%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQSPGAT+   EKL +ARQLA+LGVD+IEAGFP +S  DFEAV+ IAQ VG
Sbjct  14    IFDTTLRDGEQSPGATLNVDEKLTIARQLARLGVDVIEAGFPYSSPGDFEAVQKIAQTVG  73

Query  539   NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVE  718
               +G   PVICGL+R  ++DI  A EA+K A + R+HTFIATS+IH+++KL  +R++V+ 
Sbjct  74    TEQG---PVICGLARATRQDIKTAAEALKPAARSRIHTFIATSDIHLEYKLRKTRKEVLA  130

Query  719   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTE  898
              A  MVAYA++    D+EFSPEDAGRSD EFLY++L   I AGATT+NIPDTVGY  P E
Sbjct  131   IAEEMVAYAKTF-MDDIEFSPEDAGRSDPEFLYEMLERAIAAGATTVNIPDTVGYLTPAE  189

Query  899   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNA  1078
             FG LI  IK N P I+N +IS H  NDLGL+ AN L     GARQ+E TINGIGERAGNA
Sbjct  190   FGALIRGIKENVPNIDNAVISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  249

Query  1079  SLEEVVMALKCRGE---QVLG------GLYTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             ++EE+VMAL  R +     LG         T I+T+ I   S++V   TG+LVQP+KAIV
Sbjct  250   AMEELVMALHVRRQYFNPFLGRPVDSEAPLTNIDTRQIYKTSRLVSNLTGMLVQPNKAIV  309

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             G NAFAHESGIHQDG+LK+K TYEIM  + IGL     + IVLGKLSGR+A +++++ELG
Sbjct  310   GTNAFAHESGIHQDGVLKNKLTYEIMDAQLIGL---TDNQIVLGKLSGRNAFRSRLKELG  366

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             +D+  +E +  F RFK +A+KKK+ITD DL A+++DE+ Q   ++KL  +QV+CG     
Sbjct  367   FDLSEQELNKAFLRFKELADKKKEITDWDLEAIVNDEIQQSPDLFKLELVQVSCGDHACP  426

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV L   D  E    + GTGPVDA YKA++ +V VP  L+E+S+ +VT GIDAI    
Sbjct  427   TATVTLQTPDGHELTDAATGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDAIGEVT  486

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             + +R D              +R FSG  A  DI+++S +AY+ ALN++
Sbjct  487   IRLRHD--------------DRIFSGHAANTDIIVASAQAYINALNRL  520



>ref|WP_035153322.1| 2-isopropylmalate synthase [Calothrix sp. 336/3]
 gb|KFB83580.1| 2-isopropylmalate synthase [Calothrix sp. 336/3]
Length=530

 Score =   543 bits (1400),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 290/541 (54%), Positives = 372/541 (69%), Gaps = 30/541 (6%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQ PGAT+  +EKL +A+QLA+LGVDIIEAGF  AS  DFEAV  IAQ+VG
Sbjct  10    IFDTTLRDGEQCPGATLNIEEKLAIAKQLARLGVDIIEAGFAFASPGDFEAVSKIAQQVG  69

Query  539   NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVE  718
                G   PVIC L+R  + DI  A E++K A K R+HTFIATS+IH+K+KL  SRE+VV 
Sbjct  70    TENG---PVICSLARARKEDIKAAAESIKPAVKGRIHTFIATSDIHLKYKLKKSREEVVA  126

Query  719   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTE  898
              A  MVAYA+S    DVEFSPEDAGRSD EFLY +L   I AGATT+NIPDTVGYT P+E
Sbjct  127   IAEEMVAYAKSF-TDDVEFSPEDAGRSDPEFLYTVLERAIAAGATTVNIPDTVGYTTPSE  185

Query  899   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNA  1078
             FG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGERAGNA
Sbjct  186   FGAIIKGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1079  SLEEVVMALKCRGE---QVLG------GLYTGINTQHIIMASKMVEEYTGLLVQPHKAIV  1231
             +LEE+VM L  R +     LG         T I+T+ I   S++V   TG+LVQP+KAIV
Sbjct  246   ALEELVMGLHVRRQYFNPFLGRAVESEAPLTNIDTKQIYKTSRLVSNLTGMLVQPNKAIV  305

Query  1232  GANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELG  1411
             GANAFAHESGIHQDG+LK+K TYEIM  + IGL   N + IVLGK SGR+A +T+++ELG
Sbjct  306   GANAFAHESGIHQDGVLKNKLTYEIMDAQLIGL---NDNQIVLGKHSGRNAFRTRLRELG  362

Query  1412  YDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLS  1591
             Y++   E +  F RFK VA+KKK+I+D DL A+++DE+ Q   ++KL  +QV+CGS    
Sbjct  363   YELSETELNKAFVRFKEVADKKKEISDWDLEAIVNDEIQQAPDLFKLELVQVSCGSNAKP  422

Query  1592  TATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTR  1771
             TATV L +   EE +  ++GTGPVDA YKA++ +V +P  L+E+S+ +VT GIDAI    
Sbjct  423   TATVTLRNPQGEELMDAAIGTGPVDAVYKAINRVVDIPNQLIEFSVQSVTAGIDAIGEVT  482

Query  1772  VLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLVSRYNK  1951
             + ++ +              +R FSG  A  DI+++S +AYV ALN++ +   + S+   
Sbjct  483   IRLKYE--------------DRVFSGRSANTDIIVASAQAYVNALNRLYAAIQVSSKQQV  528

Query  1952  T  1954
             T
Sbjct  529   T  529



>ref|WP_009543901.1| MULTISPECIES: 2-isopropylmalate synthase [Cyanothece]
 ref|YP_001805422.1| 2-isopropylmalate synthase [Cyanothece sp. ATCC 51142]
 sp|B1WQQ4.1|LEU1_CYAA5 RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Cyanothece sp. ATCC 51142]
 gb|ACB53356.1| 2-isopropylmalate synthase [Cyanothece sp. ATCC 51142]
Length=537

 Score =   544 bits (1401),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 286/535 (53%), Positives = 372/535 (70%), Gaps = 30/535 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+++ +FDTTLRDGEQSPGA++T +EKL +AR LA+LGVDIIEAGFP AS  DFEAV+
Sbjct  3     NQPDHIIIFDTTLRDGEQSPGASLTVEEKLTIARALARLGVDIIEAGFPYASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA+ VGN  G   P ICGL+R  + DI  A EA+K A K R+HTFIATS+IH+K KL  
Sbjct  63    KIAKTVGNESG---PRICGLARATKNDIKAAGEALKPAFKSRIHTFIATSDIHLKHKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+     MVAYA++    DVEFSPEDAGRSD EF+YQ+L   I AGATT+NIPDTV
Sbjct  120   TRQEVLAIVPEMVAYAKTF-TDDVEFSPEDAGRSDPEFMYQVLETAIAAGATTVNIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYTTPSEFGALIKGIKDNVPNIDQAIISVHGHDDLGLAVANFLEALKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R +     L          T INT+ I   S++V   TG++V
Sbjct  239   GERAGNAALEELVMALHVRRQYFNPFLGRPVDSMEPLTNINTKEIYKTSRLVSNLTGMIV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LK+K TYEIM  E IGL   NQ  IVLGKLSGR+A +
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGLTN-NQ--IVLGKLSGRNAFR  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             T++ ELG+++  ++ ++ F RFK VA+KKK+ITD DL A+++DE+ Q   +++L  +QV+
Sbjct  356   TRLDELGFELSERDLNNAFLRFKEVADKKKEITDWDLEAIVNDEIQQAPELFRLELVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG     TATV L   + +E    ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GI
Sbjct  416   CGDHSAPTATVTLRTPEGKELTDAAIGTGPVDAVYKAINRVVNVPNELIEFSVKSVTAGI  475

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               R +SG  A  DI+ +S RAY+ ALN++
Sbjct  476   DAMGEVTIRLRHE--------------GRIYSGYAANTDIITASARAYISALNRL  516



>gb|AAR36908.1| isopropylmalate synthase [Brassica oleracea]
Length=487

 Score =   542 bits (1396),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 251/415 (60%), Positives = 334/415 (80%), Gaps = 5/415 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQSPGA +T  +K+++ARQLAKL VDI+E GFP 
Sbjct  48    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  107

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FE ++ IA+ VGN   E   ++PVIC ++R  +RDI  AWE+VK+AK+PR+  F 
Sbjct  108   SSEEEFETIKTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  167

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IH+K+KL M+RE+VVE   S + +A+SLG  D+EF  ED GRSD++++ ++  E I
Sbjct  168   STSDIHLKYKLKMTREEVVEMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICKVFEEAI  227

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTL  PDTVG  +P E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG  
Sbjct  228   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  287

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+ I+  SKMV+EYT
Sbjct  288   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  347

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  348   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  407

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEVFQPQ  1537
             HA+K +++ELGY+I  ++ +++F RF+ + ++KK++TDDDL AL++  DE+F  +
Sbjct  408   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLRALVTCGDEIFSSE  462



>gb|AAV25874.1| 2-isopropylmalate synthase [Brassica oleracea]
Length=505

 Score =   543 bits (1398),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 251/415 (60%), Positives = 334/415 (80%), Gaps = 5/415 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQSPGA +T  +K+++ARQLAKL VDI+E GFP 
Sbjct  66    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  125

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FE ++ IA+ VGN   E   ++PVIC ++R  +RDI  AWE+VK+AK+PR+  F 
Sbjct  126   SSEEEFETIKTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  185

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IH+K+KL M+RE+VVE   S + +A+SLG  D+EF  ED GRSD++++ ++  E I
Sbjct  186   STSDIHLKYKLKMTREEVVEMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICKVFEEAI  245

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTL  PDTVG  +P E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG  
Sbjct  246   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  305

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+ I+  SKMV+EYT
Sbjct  306   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  365

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  366   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQNSGIVLGKLSGR  425

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEVFQPQ  1537
             HA+K +++ELGY+I  ++ +++F RF+ + ++KK++TDDDL AL++  DE+F  +
Sbjct  426   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLRALVTCGDEIFSSE  480



>ref|WP_010936558.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi]
 ref|YP_181557.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi 195]
 gb|AAW39927.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi 195]
 gb|AII59507.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi CG4]
Length=505

 Score =   541 bits (1395),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 271/524 (52%), Positives = 364/524 (69%), Gaps = 26/524 (5%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             + +++FDTTLRDGEQ+ GA++  +EKL++ARQL KLGVDIIEAGFP  S  DFEAV+LIA
Sbjct  2     DKIKIFDTTLRDGEQAAGASLNAQEKLEIARQLEKLGVDIIEAGFPITSPGDFEAVKLIA  61

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             QEV        PVICGL+R    DIDRAWEA+K A  PR+H FI++SEIHM  ++  SRE
Sbjct  62    QEV------RTPVICGLARAIPADIDRAWEALKEAAHPRIHVFISSSEIHMVHQIKKSRE  115

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E A +MVA A+S    D+EFSP DA RSD EFLY++L  VI AGATTLNIPDTVGY 
Sbjct  116   EVMELARTMVARAKSY-TDDIEFSPMDASRSDPEFLYKLLEAVIDAGATTLNIPDTVGYA  174

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
             +P+EFG+LI  I+ N P I   +IS HC +DLG+ TAN+LA    GARQVE T+NGIGER
Sbjct  175   IPSEFGELIKGIRQNVPNINKAVISVHCHDDLGMGTANSLAAVKNGARQVECTLNGIGER  234

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNA+LEEVVMAL+ R +       TGINTQ I  +S++V   TG  +QP+KA+VG NAF
Sbjct  235   AGNAALEEVVMALRTRSD--FFNFETGINTQEIYRSSRLVSALTGFAIQPNKAVVGENAF  292

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
              H+SGIHQDG++K   T+EIM P+++G+     S +VLGKLSGRHA K  + ELG+D++ 
Sbjct  293   RHQSGIHQDGVIKMAKTFEIMDPKEVGIQ---ASSLVLGKLSGRHAFKQHLTELGFDLNE  349

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
             ++FD  F  FK +A+KKK +TD D+ AL+++E+     ++ L  +QVT G  G+ TA V+
Sbjct  350   EDFDRAFKAFKDLADKKKDVTDRDIEALVAEELRTTVELYHLDRIQVTSGDRGIPTAAVR  409

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             L   +       ++G+GPVDA YKA++ +V VP  L E+S+ +VT GIDA+    + I  
Sbjct  410   LTTPNGGAAEDAALGSGPVDAVYKAINRIVNVPNKLTEFSVKSVTAGIDALGEVLIRIES  469

Query  1787  DNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             D                T++G G+  DI+++S +AY+ ALN++L
Sbjct  470   DGV--------------TYTGRGSDTDIIVASAKAYMNALNRLL  499



>ref|WP_015224126.1| 2-isopropylmalate synthase [Cyanobacterium stanieri]
 ref|YP_007166462.1| 2-isopropylmalate synthase [Cyanobacterium stanieri PCC 7202]
 gb|AFZ48813.1| 2-isopropylmalate synthase [Cyanobacterium stanieri PCC 7202]
Length=529

 Score =   542 bits (1397),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 286/542 (53%), Positives = 375/542 (69%), Gaps = 32/542 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ + +FDTTLRDGEQSPGA++   EKL +AR LAKLGVD+IEAGFP AS  DF+AV  I
Sbjct  5     PDRIIIFDTTLRDGEQSPGASLNVDEKLTIARALAKLGVDVIEAGFPHASPGDFDAVSKI  64

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             AQ VG   G   P ICGL+R  Q+DI  A +A++ A K R+HTF+ATS+IH+++KL  +R
Sbjct  65    AQAVGVENG---PSICGLARATQKDIKSAGDALQGAYKKRIHTFLATSDIHLQYKLKKTR  121

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
               V+     MVAYA++    DVEFSPEDAGRSD EFLYQ+L   IKAGATT+NIPDTVGY
Sbjct  122   ADVLAMVPDMVAYAKTF-TDDVEFSPEDAGRSDPEFLYQVLELAIKAGATTVNIPDTVGY  180

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
             T P+E+G LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  181   TTPSEYGALIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1064  RAGNASLEEVVMALKCRGE---QVLGGL------YTGINTQHIIMASKMVEEYTGLLVQP  1216
             RAGNA+LEE+VMAL  R +     LG         T I+T+ I   S++V   TG+LVQP
Sbjct  241   RAGNAALEELVMALHVRRQFYNPFLGRAPESTEPLTNIDTKQIYKTSRLVSNLTGMLVQP  300

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             +KAIVGANAF+HESGIHQDG+LK++ TYEIM  E IGL   NQ  IVLGKLSGR+A +T+
Sbjct  301   NKAIVGANAFSHESGIHQDGVLKNRLTYEIMDAESIGL-TTNQ--IVLGKLSGRNAFRTR  357

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             +QELG+++   + +  F RFK VA+KK++ITD DL A+++DE+ QP  +++L  +QV+CG
Sbjct  358   LQELGFELSENDLNKAFLRFKEVADKKREITDWDLEAIVNDEIQQPPELFRLELVQVSCG  417

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
                  TAT+ L + D EE    ++GTGPVDA YKA++ +V +P  L EYS+ +VT GIDA
Sbjct  418   DHSSPTATITLRNPDGEELSDAAIGTGPVDAVYKAINRVVNIPNELTEYSVKSVTAGIDA  477

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLV  1936
             +    + ++ +               RT+SG  A  D++++S RAYV ALN++  + TL 
Sbjct  478   MGEVTIRLKHE--------------GRTYSGYAANTDVIVASARAYVSALNRL--YATLK  521

Query  1937  SR  1942
             ++
Sbjct  522   AK  523



>emb|CAJ55510.1| methylthioalkylmalate synthase b [Arabidopsis cebennensis]
Length=502

 Score =   541 bits (1394),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/416 (60%), Positives = 334/416 (80%), Gaps = 5/416 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPN++   NYVRV DTTLRDGEQSPGA +T  +KL++ARQLAKL VDI+E GFP 
Sbjct  69    RRPEYIPNKLPHKNYVRVLDTTLRDGEQSPGAALTPPQKLEIARQLAKLRVDIMEVGFPV  128

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FEA++ IA+ VGN   E   +VPVICG++RC  RDI+ AWEA+K+AK+PRV  F 
Sbjct  129   SSEEEFEAIKTIAKTVGNEVDEETGYVPVICGIARCKNRDIEAAWEALKYAKRPRVILFT  188

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A + V YA+SLG  D+EF  ED GR++++FL +ILGE I
Sbjct  189   STSDIHMKYKLKKTKEEVIEMAVNSVKYAKSLGFKDIEFGCEDGGRTEKDFLCKILGESI  248

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATT+   DTVG  +P EFG+L+A +K NTPG ++++ + HC NDLG++TANT++G  
Sbjct  249   KAGATTVGFADTVGINMPPEFGELVAYVKENTPGADDIVFTIHCHNDLGVATANTISGIC  308

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+ I+  SKMV+E+T
Sbjct  309   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGEYLMDGVYTKIDTRQIMATSKMVQEHT  368

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             G+ VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGI+ GKLSGR
Sbjct  369   GMYVQPHKPIVGDNCFVHESGIHQDGILKNRSTYEILSPEDVGIVKSENSGIIFGKLSGR  428

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI--SDEVFQPQL  1540
             HA+K +++ELGY+I  ++F+D+F R++ + ++KK+ITDDDL AL+   DE+   +L
Sbjct  429   HAVKDRLKELGYEISDEKFNDIFSRYRELTKEKKRITDDDLKALVVNGDEISSDKL  484



>ref|WP_002794932.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI27285.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9808]
Length=533

 Score =   542 bits (1396),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 283/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG GE +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIASSVG-GEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +VK+P  L+ +S+  VTEGI
Sbjct  417   CGNNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R                 RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLR--------------YAGRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_023073959.1| 2-isopropylmalate synthase [Leptolyngbya sp. Heron Island J]
 gb|ESA35235.1| 2-isopropylmalate synthase [Leptolyngbya sp. Heron Island J]
Length=539

 Score =   542 bits (1397),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 290/540 (54%), Positives = 372/540 (69%), Gaps = 32/540 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGATM  +EKL VARQLA+LGVDIIEAGFP AS  DFEAV+
Sbjct  3     TQPDRVLIFDTTLRDGEQSPGATMNVEEKLAVARQLARLGVDIIEAGFPYASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IAQEVG  +G   P ICGL+R  ++DI+ A  A++ A K R+HTFIATS+IHMK+KL  
Sbjct  63    RIAQEVGTVDG---PTICGLARATKQDIEAAARAIEPAAKGRIHTFIATSDIHMKYKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             SR+QV+     MV +A+     DVEFSPEDAGRS+ EFLYQ+L   I AGATT+NIPDTV
Sbjct  120   SRDQVLAITDEMVRFAKGF-TDDVEFSPEDAGRSEPEFLYQVLEVAIAAGATTINIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GY  P+EFG LI  IK N P ++  +IS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYLTPSEFGGLIKGIKDNVPNVDQTVISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQHIIMASKMVEEYTGLL  1207
             GERAGNA+LEE+VMA+  R  Q     +          T INTQ I   S+++   TG+L
Sbjct  239   GERAGNAALEELVMAMHVR-RQYFNPFFGRPADSEAPLTNINTQEIYKTSRLISSVTGML  297

Query  1208  VQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHAL  1387
             VQP+KAIVGANAFAHESGIHQDG+LK+K TYEIM  + IGL   N + IVLGK SGR+A 
Sbjct  298   VQPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQTIGL---NDNLIVLGKHSGRNAF  354

Query  1388  KTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQV  1567
             +T++QELGY++  ++ +  F RFK +A+KKK+I+D DL A+++DE  Q    +KL  +QV
Sbjct  355   RTRLQELGYELSDQDLNKAFLRFKDLADKKKEISDRDLEAIVNDETQQVAEHYKLELVQV  414

Query  1568  TCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEG  1747
             +CGS    TATV +   + EE +  ++GTGPVDA YKA++ +V +P  L+EYS+ +VT G
Sbjct  415   SCGSNARPTATVTIRTPNGEELMDAAIGTGPVDAIYKAINRVVDIPNDLIEYSVQSVTAG  474

Query  1748  IDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFT  1927
             IDAI    + +R +               R +SG  A  DIV++S  AY+ ALN++ S T
Sbjct  475   IDAIGEVTIRLRHN--------------QRIYSGHAANTDIVVASAHAYMQALNRLYSST  520



>ref|WP_012882024.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi]
 ref|YP_003330194.1| isopropylmalate/homocitrate/citramalate synthase [Dehalococcoides 
mccartyi VS]
 gb|ACZ61866.1| isopropylmalate/homocitrate/citramalate synthase [Dehalococcoides 
mccartyi VS]
Length=505

 Score =   541 bits (1393),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 271/524 (52%), Positives = 364/524 (69%), Gaps = 26/524 (5%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             + +++FDTTLRDGEQ+ GA++  +EKL++ARQL KLGVDIIEAGFP  S  DFEAV+LIA
Sbjct  2     DKIKIFDTTLRDGEQAAGASLNAQEKLEIARQLEKLGVDIIEAGFPITSPGDFEAVKLIA  61

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             QEV         VICGL+R    DIDRAWEA+K A  PR+H FI++SEIHM  ++  SRE
Sbjct  62    QEV------RTTVICGLARAIPADIDRAWEALKEAAHPRIHVFISSSEIHMVHQIKKSRE  115

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E A +MVA A+S    D+EFSP DA RSD EFLY++L  VI AGATTLNIPDTVGY 
Sbjct  116   EVMELARTMVARAKSY-TDDIEFSPMDASRSDPEFLYKLLEAVIDAGATTLNIPDTVGYA  174

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
             +P+EFG+LI  I+ N P I   +IS HC +DLG+ TAN+LA    GARQVE T+NGIGER
Sbjct  175   IPSEFGELIKGIRQNVPNINKAVISVHCHDDLGMGTANSLAAVKNGARQVECTLNGIGER  234

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNA+LEEVVMAL+ R +       TGINTQ I  +S++V   TG  +QP+KA+VG NAF
Sbjct  235   AGNAALEEVVMALRTRSD--FFNFETGINTQEIYRSSRLVSALTGFAIQPNKAVVGENAF  292

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
              H+SGIHQDG++K   T+EIM P+++G+     S +VLGKLSGRHA K  + ELG+D++ 
Sbjct  293   RHQSGIHQDGVIKMAKTFEIMDPKEVGIQ---ASSLVLGKLSGRHAFKQHLTELGFDLNE  349

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
             ++FD  F  FK +A+KKK +TD D+ AL+++E+     ++ L  +QVT G  G+ TA V+
Sbjct  350   EDFDRAFKAFKDLADKKKDVTDRDIEALVAEELRTTVELYHLDRIQVTSGDRGIPTAAVR  409

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             L   + E     ++G+GPVDA YKA++ +V VP  L E+S+ +VT GIDA+    + I  
Sbjct  410   LTTPNGEAAEDAALGSGPVDAVYKAINRIVNVPNKLTEFSVKSVTAGIDALGEVLIRIES  469

Query  1787  DNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             D                T++G G+  DI+++S +AY+ ALN++L
Sbjct  470   DGV--------------TYTGRGSDTDIIVASAKAYMNALNRLL  499



>emb|CAJ55506.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. petraea]
Length=507

 Score =   541 bits (1393),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/416 (60%), Positives = 332/416 (80%), Gaps = 5/416 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQ+PG ++T  +KL++ARQLAKL VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE + E V+ IA+ VGN   E   +VPVIC ++R  QRDI+ AWEAVK+AK+PR+  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEETGYVPVICAIARSKQRDIEAAWEAVKYAKRPRILIFT  189

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A S +  A+SLG +D++   ED GRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAVSSIRLAKSLGFNDIQLGCEDGGRSDKEFLCKILGEAI  249

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAG T +N+ DTVG  +P E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGVTVVNVADTVGINMPHEYGELVTYLKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNASLEEVVMALKCRG  V+ G+YT I+T+ I+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVINGVYTRIDTRQIMATSKMVQEYT  369

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPEDIG+ ++  SG+VLGKLSGR
Sbjct  370   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDIGVVKSQNSGLVLGKLSGR  429

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI--SDEVFQPQL  1540
             HA+K ++ ELGY++D ++ +D+F RF+ + + KK+ITD D+ AL+  SDE+   +L
Sbjct  430   HAVKDRLNELGYELDDEKLNDVFSRFRDLTKHKKRITDADMKALVTSSDEISLEKL  485



>ref|WP_017750120.1| 2-isopropylmalate synthase [Scytonema hofmanni]
Length=532

 Score =   541 bits (1395),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 288/549 (52%), Positives = 375/549 (68%), Gaps = 30/549 (5%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P  + +FDTTLRDGEQ PGAT+   EKL +A+QLA+LGVDIIEAGF  AS  DFEAV  I
Sbjct  5     PERIIIFDTTLRDGEQCPGATLNIDEKLAIAKQLARLGVDIIEAGFAFASPGDFEAVSKI  64

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             AQ VG  +G   PVIC L+R    DI  A EA+K A K R+HTFIATS+IH+K+KL  ++
Sbjct  65    AQTVGTEDG---PVICSLARARHDDIKAAAEAIKPAVKGRIHTFIATSDIHLKYKLKKNK  121

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
              +V+  A  MVAYA+S    D+EFSPEDAGRS+ EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   AEVLAIAEEMVAYAKSF-TDDIEFSPEDAGRSEAEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  181   TTPSEFGSLIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLESVKNGARQLECTINGIGE  240

Query  1064  RAGNASLEEVVMALKCRGE---QVLGGL------YTGINTQHIIMASKMVEEYTGLLVQP  1216
             RAGNA+LEE+VMAL  R +     LG L       T I+T+ I   S++V   TGLLVQP
Sbjct  241   RAGNAALEELVMALHVRRQYFNSFLGRLVESEEPLTNIDTRQIYKTSRLVSNLTGLLVQP  300

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             +KAIVGANAFAHESGIHQDG+LK+K TYEIM  + IGL    Q+ IVLGK SGR+A +T+
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQLIGL---TQNQIVLGKHSGRNAFRTR  357

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             ++ELGY++   E +  F RFK +A+KKK+ITD DL A+++DE+ Q   +++L  +QV+CG
Sbjct  358   LRELGYELTETELNKAFVRFKEIADKKKEITDWDLEAIVNDEIQQAPDLFRLELVQVSCG  417

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
             S    TATV +   + EE +  ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GIDA
Sbjct  418   SNARPTATVTIRTPEGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGIDA  477

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTLV  1936
             +    + ++ +              +R FSG  A  DI+++S +AYV ALN++ +   + 
Sbjct  478   LGEVTIRLKYE--------------DRVFSGHAANTDIIVASAQAYVNALNRLFAALQIK  523

Query  1937  SRYNKTEDN  1963
              +  +  +N
Sbjct  524   QQQQEVANN  532



>ref|WP_012120074.1| 2-isopropylmalate synthase [Roseiflexus castenholzii]
 ref|YP_001431664.1| 2-isopropylmalate synthase [Roseiflexus castenholzii DSM 13941]
 gb|ABU57646.1| 2-isopropylmalate synthase [Roseiflexus castenholzii DSM 13941]
Length=556

 Score =   542 bits (1396),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 281/528 (53%), Positives = 375/528 (71%), Gaps = 12/528 (2%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             ++VR+FDTTLRDGEQ+PG TMT +EKL+VARQLA+LGVDIIEAGFPAAS  D+ AV  IA
Sbjct  3     DHVRIFDTTLRDGEQAPGCTMTLEEKLEVARQLARLGVDIIEAGFPAASPGDWAAVHEIA  62

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             + VG  +G   P+I  L+R N+ DID+AW A++ A K R+HTFI++S+IH++ +L  +RE
Sbjct  63    KTVGTPDG---PIIAALARANKDDIDKAWSAIQPAAKKRIHTFISSSDIHIEHQLRSTRE  119

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E+A  MV YARSL C DVEFSP DA RSD E++Y++L  V+  GATTLNIPDTVGY 
Sbjct  120   EVLERARLMVRYARSL-CDDVEFSPMDATRSDPEYVYRMLAAVVAEGATTLNIPDTVGYA  178

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
              P E+ +LIA I  + PG + VIISTHC +DLG++ AN+LAG  AGARQ+E TINGIGER
Sbjct  179   TPEEYAELIAGIYRHVPGADKVIISTHCHDDLGMAVANSLAGVRAGARQIECTINGIGER  238

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNASLEEVVMALK R  +   G+ T INT+ +  +S+++    G+ V P+KAIVGANAF
Sbjct  239   AGNASLEEVVMALKTR--RSFFGVDTRINTRELARSSRLLSTIIGMPVPPNKAIVGANAF  296

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
             AHESGIHQDG+LKH+ TYEIM    IGL   + + IVLGK SGR+AL+TK+  +GY+ D 
Sbjct  297   AHESGIHQDGVLKHRMTYEIMDATTIGL---DGNAIVLGKHSGRNALRTKLAAMGYEFDS  353

Query  1427  -KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATV  1603
              +EF+ +F RFK + +KKK + D DL  L +        +++L  +QVTCG+     ATV
Sbjct  354   EEEFNQVFQRFKELCDKKKVVDDRDLEVLATGGSLHTPELYRLEHVQVTCGTGVTPVATV  413

Query  1604  KLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIR  1783
             ++ D D       + GTGPVDA YKA+D +V  P  L+E+S+ AVTEGIDA+A   V IR
Sbjct  414   RITDPDGNTQTTAAHGTGPVDAIYKAIDKIVGRPNDLIEFSIKAVTEGIDAVAEVSVRIR  473

Query  1784  --GDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
               GD      + +  +   + +SG  A  D ++++  +Y+ ALNKM++
Sbjct  474   EPGDAVEEREYRVGRHRGPQIYSGYSANTDTIVAAAESYMAALNKMIA  521



>ref|WP_002803918.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI38114.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9701]
Length=533

 Score =   541 bits (1394),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 371/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG GE +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVG-GEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG++   TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNIARPTATVTIRTPDGSELSDSAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



>dbj|GAL93306.1| 2-isopropylmalate synthase [Microcystis aeruginosa NIES-44]
Length=533

 Score =   541 bits (1394),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 283/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG GE +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVG-GEADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +VK+P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



>emb|CAJ55507.1| methylthioalkylmalate synthase b [Arabidopsis lyrata subsp. petraea]
Length=502

 Score =   540 bits (1390),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 337/419 (80%), Gaps = 5/419 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPN++   NYVRV DTTLRDGEQSPGA +T  +KL++ARQLAKL VDI+E GFP 
Sbjct  69    RRPEYIPNKLPHKNYVRVLDTTLRDGEQSPGAALTPPQKLEIARQLAKLRVDIMEVGFPV  128

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FEA++ IA+ VGN   E   +VPVICG++RC  RDI+ AWEA+K+AK+PRV  F 
Sbjct  129   SSEEEFEAIKTIAKTVGNEVDEETGYVPVICGIARCKNRDIEAAWEALKYAKRPRVLLFT  188

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A + + YA+SLG +D+E   ED GR++++FL +ILGE+I
Sbjct  189   STSDIHMKYKLKKTKEEVIEMAVNSIKYAKSLGFTDIECGCEDGGRTEKDFLCKILGEMI  248

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATT+   DTVG  +P EFG+L+A +K NTPG ++++++ HC NDLG++TANT++G  
Sbjct  249   KAGATTVGFADTVGINMPPEFGELVAYVKENTPGADDIVLTIHCHNDLGVATANTISGIC  308

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+ I+  SKMV+E+T
Sbjct  309   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGEYLMNGVYTNIDTRQIMATSKMVQEHT  368

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             G+ VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  369   GMYVQPHKPIVGDNCFVHESGIHQDGILKNRSTYEILSPEDVGIVKSENSGIVLGKLSGR  428

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI--SDEVFQPQLVWK  1549
             HA++ +++ELGYDI  ++F+D+F R++ + ++KK+ITD DL AL+   DE+   +L  K
Sbjct  429   HAVRDRLKELGYDISDEKFNDIFSRYRELTKEKKRITDADLKALVVNGDEISSDKLNSK  487



>ref|WP_017304848.1| 2-isopropylmalate synthase [Spirulina subsalsa]
Length=535

 Score =   541 bits (1393),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 289/537 (54%), Positives = 366/537 (68%), Gaps = 30/537 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             ++ + + +FDTTLRDGEQSPGAT+   EKL +AR LAKLGVD+IEAGFP AS  DFEAV+
Sbjct  3     TEQDRIIIFDTTLRDGEQSPGATLNVDEKLTIARSLAKLGVDVIEAGFPRASAGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG  EG   PVICGL+R    DI +A EA+K A K R+HTFIATS+IH+++KL  
Sbjct  63    KIAATVGTEEG---PVICGLARATHEDIRQAAEALKPAAKWRIHTFIATSDIHLEYKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             SR++V+E    MV YA+SL   DVEFSPEDAGRSD EFLY++L   I AGATT+NIPDTV
Sbjct  120   SRKEVLEIIPEMVGYAKSL-TPDVEFSPEDAGRSDPEFLYEVLQTAIAAGATTVNIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYTTPREFGALIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVQNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGE---QVLG------GLYTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R +     LG           I+T  I   S++V   TG++V
Sbjct  239   GERAGNAALEELVMALYVRRQYYNPFLGRPRESDAPLCNIDTTQIYKTSRLVSNLTGMMV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVG NAFAHESGIHQDG+LKH+ TYEIM  + IGL + NQ  I+LGK SGRHA +
Sbjct  299   QPNKAIVGTNAFAHESGIHQDGVLKHRLTYEIMDAQSIGLTK-NQ--IILGKHSGRHAFR  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
              ++Q LGYD+   E +  F RFK VA+KKK I+D DL A+++DE+ Q   ++ L  +QV+
Sbjct  356   DRLQTLGYDLSETELNKAFLRFKEVADKKKVISDLDLEAIVNDEMQQVPELFHLELVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG     TATV L   D  E    ++GTGPVDA YKA++ +V +P  L+EYS+ +VTEGI
Sbjct  416   CGDHARPTATVVLRTPDGTELTDAAIGTGPVDAVYKAINRVVNIPNELIEYSVKSVTEGI  475

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             DA+    + +R +               +T+SG  A  DI+++S RAYV ALN++ +
Sbjct  476   DAMGEVTIRLRHE--------------GKTYSGHAANTDIIVASTRAYVSALNRLYA  518



>ref|WP_008198795.1| 2-isopropylmalate synthase [Microcystis sp. T1-4]
 emb|CCI31307.1| 2-isopropylmalate synthase [Microcystis sp. T1-4]
Length=533

 Score =   540 bits (1392),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 370/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVGS-EADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_035985134.1| 2-isopropylmalate synthase [Leptolyngbya sp. KIOST-1]
Length=539

 Score =   541 bits (1393),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 285/535 (53%), Positives = 369/535 (69%), Gaps = 30/535 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ + +FDTTLRDGEQSPGAT+  +EKL +ARQL++LGVDIIEAGFP AS  DFEAV+ I
Sbjct  7     PDRILIFDTTLRDGEQSPGATLNVEEKLAIARQLSRLGVDIIEAGFPFASPGDFEAVQKI  66

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A+EVG   G   P ICGL+R  + DI+RA EA+K A + R+HTFIATS+IHM++KL   R
Sbjct  67    AREVGTETG---PTICGLARATKGDIERAGEAIKPAARGRIHTFIATSDIHMQYKLRKGR  123

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             ++V+  A  MVAYA++    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   DEVLAIAPEMVAYAKTF-TDDVEFSPEDAGRSDPEFLYQVLEAAIAAGATTVNIPDTVGY  182

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
               PTEFG LI  IKAN P I+  +IS H  NDLGL+ AN L    AGARQ+E TINGIGE
Sbjct  183   LTPTEFGDLIRGIKANVPNIDQAVISVHGHNDLGLAVANFLEAVKAGARQLECTINGIGE  242

Query  1064  RAGNASLEEVVMALKCRG---EQVLG------GLYTGINTQHIIMASKMVEEYTGLLVQP  1216
             RAGNA+LEE+VMA+  R       LG         T I+T+ I   S++V   TG+ VQP
Sbjct  243   RAGNAALEELVMAMHVRRSFYNPFLGRPADSEAPLTAIDTRQIYKTSRLVSNLTGMFVQP  302

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             +KAIVGANAFAHESGIHQDG+LK+K TYEIM    IGL     + IVLGK SGR+A +T+
Sbjct  303   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDATSIGL---TDNQIVLGKHSGRNAFRTR  359

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             + ELGY++D +  +  F RFK +A+KKK+ITD D+ ++++DE  Q    + L  +QV+CG
Sbjct  360   LGELGYELDDQALNRAFLRFKELADKKKEITDWDIESIVNDETQQAPEHFHLELVQVSCG  419

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
                  TATV L   D +E +  ++GTGPVDA YKA++ +V +P  L+E+S+ +VT GIDA
Sbjct  420   DSAKPTATVTLRTPDGQELMDAAIGTGPVDAVYKAINRVVDIPNQLIEFSVQSVTAGIDA  479

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             +    + IR +              +R +SG  A  DIV++S  AY+ ALN++ +
Sbjct  480   LGEVTIRIRHE--------------DRVYSGHAANTDIVVASAHAYLHALNRLYA  520



>gb|AII57910.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi CG1]
Length=505

 Score =   539 bits (1388),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 270/524 (52%), Positives = 363/524 (69%), Gaps = 26/524 (5%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             + +++FDTTLRDGEQ+ GA++  +EKL++ARQL KLGVDIIEAGFP  S  DFEAV+LIA
Sbjct  2     DKIKIFDTTLRDGEQAAGASLNAQEKLEIARQLEKLGVDIIEAGFPITSPGDFEAVKLIA  61

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             QEV        PVICGL+R    DIDRAWEA+K A  PR+H FI++SEIHM  ++  SRE
Sbjct  62    QEV------RTPVICGLARAIPADIDRAWEALKEAAHPRIHVFISSSEIHMVHQIKKSRE  115

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E A +MVA A+S    D+EFSP DA RSD EFLY++L  VI AGATTLNIPDTVGY 
Sbjct  116   EVMELARTMVARAKSY-TDDIEFSPMDASRSDPEFLYKLLEAVIDAGATTLNIPDTVGYA  174

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
             +P+EFG+LI  I+ N P I   +IS HC +DLG+ TAN+LA    GARQVE T+NGIGER
Sbjct  175   IPSEFGELIKGIRQNVPNINKAVISVHCHDDLGMGTANSLAAVKNGARQVECTLNGIGER  234

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNA+LEEVVMAL+ R +       T INTQ I  +S++V   TG  +QP+KA+VG NAF
Sbjct  235   AGNAALEEVVMALRTRSDYF--NFETSINTQEIYRSSRLVSALTGFAIQPNKAVVGENAF  292

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
              H+SGIHQDG++K   T+EIM P+++G+     S +VLGKLSGRHA K  + ELG+D++ 
Sbjct  293   RHQSGIHQDGVIKMAKTFEIMDPKEVGIQ---ASSLVLGKLSGRHAFKQHLTELGFDLNE  349

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
             ++FD  F  FK +A+KKK +TD D+ AL+++E+     ++ L  +QVT G  G+ TA V+
Sbjct  350   EDFDRAFKAFKDLADKKKDVTDRDIEALVAEELRTTVELYHLDRIQVTSGDRGIPTAAVR  409

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             L   +       ++G+GPVDA YKA++ +V VP  L E+S+ +VT GIDA+    + I  
Sbjct  410   LTTPNGGAVEDAALGSGPVDAVYKAINRIVNVPNKLTEFSVKSVTAGIDALGEVLIRIES  469

Query  1787  DNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             D                T++G G+  DI+++S +AY+ ALN++L
Sbjct  470   DGV--------------TYTGRGSDTDIIVASAKAYMNALNRLL  499



>emb|CAQ56039.1| 2-isopropylmalate synthase, A genome specific 1 [Brassica juncea]
 emb|CAQ56040.1| 2-isopropylmalate synthase, A genome specific 1 [Brassica juncea]
Length=505

 Score =   539 bits (1388),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 250/412 (61%), Positives = 332/412 (81%), Gaps = 5/412 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQSPGA +T  +K+++ARQLAKL VDI+E GFP 
Sbjct  66    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  125

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FE ++ IA+ VGN   E   ++PVIC ++R  +RDI  AWE+VK+AK+PR+  F 
Sbjct  126   SSEEEFETIQTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  185

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IH+K+KL M+RE+VV+   S + +A+SLG  D+EF  ED GRSD++++  +  E I
Sbjct  186   STSDIHLKYKLKMTREEVVDMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICTVFEEAI  245

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTL  PDTVG  +P E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG  
Sbjct  246   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  305

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+ I+  SKMV+EYT
Sbjct  306   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  365

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  366   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEIISPEDVGVVKSQNSGIVLGKLSGR  425

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEVF  1528
             HA+K +++ELGY+I  ++ +++F RF+ + ++KK++TDDDL AL++  DE+F
Sbjct  426   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLKALVTCGDEIF  477



>ref|XP_008346777.1| PREDICTED: 2-isopropylmalate synthase A-like [Malus domestica]
Length=473

 Score =   538 bits (1385),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 320/406 (79%), Gaps = 2/406 (0%)
 Frame = +2

Query  302   APRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGF  481
             +P  P+YIPNRI + NYVRV DTTLRDGEQ+ GA+MT  EKL +A QLAKL VD+IEAGF
Sbjct  63    SPTHPEYIPNRIPNENYVRVVDTTLRDGEQAAGASMTRLEKLAIAHQLAKLRVDVIEAGF  122

Query  482   PAASEADFEAVRLIAQEVGNGEGE--HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTF  655
             PA+S+ D E V+ IA+EVG+   E  +VPVI    RC + D+D AWE+VK A +PR+  F
Sbjct  123   PASSKYDSETVKRIAKEVGSRVDECGYVPVISAYCRCVRSDVDAAWESVKDATRPRLCIF  182

Query  656   IATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEV  835
             I+TSEIHMK+KLN + +QV+E A   V YARSLG  D+ F  EDAGRS++EFLY+I GE 
Sbjct  183   ISTSEIHMKYKLNKTADQVLELAKESVRYARSLGAQDITFVCEDAGRSEKEFLYRIYGEA  242

Query  836   IKAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGA  1015
             IKAGATTL   DTVGY  P+E  Q + D+KAN  GIEN I+S HC ND GL+ ANT+AGA
Sbjct  243   IKAGATTLTFTDTVGYNFPSEVEQFVKDLKANVIGIENAILSMHCHNDFGLANANTIAGA  302

Query  1016  YAGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEY  1195
             YAGARQVEVTINGIGERAGNASLEE VMA+K RG+ +LGGL+TGINT+HII  SKMVEEY
Sbjct  303   YAGARQVEVTINGIGERAGNASLEEFVMAVKTRGKDILGGLHTGINTKHIIATSKMVEEY  362

Query  1196  TGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSG  1375
             +GL VQPHKAIVGAN F+H SGIH+DG+LK+K TYEI+  EDIG   +N  GIVLGK SG
Sbjct  363   SGLSVQPHKAIVGANIFSHASGIHZDGVLKNKSTYEIILAEDIGYVHSNDDGIVLGKHSG  422

Query  1376  RHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI  1513
             RHALK+++ +LG+D+D K+F ++F  FKS+AE KK +T++DL +L+
Sbjct  423   RHALKSRLLQLGHDLDEKKFHEVFEHFKSLAETKKSLTNEDLESLV  468



>gb|ACH41738.1| glucosinolate GS-Elong [Brassica rapa subsp. rapa]
 gb|ACH41739.1| glucosinolate GS-Elong [Brassica rapa subsp. rapa]
 gb|ACH41740.1| glucosinolate GS-Elong [Brassica rapa subsp. pekinensis]
Length=487

 Score =   538 bits (1385),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 250/412 (61%), Positives = 332/412 (81%), Gaps = 5/412 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQSPGA +T  +K+++ARQLAKL VDI+E GFP 
Sbjct  48    RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  107

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FE ++ IA+ VGN   E   ++PVIC ++R  +RDI  AWE+VK+AK+PR+  F 
Sbjct  108   SSEEEFETIQTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  167

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IH+K+KL M+RE+VV+   S + +A+SLG  D+EF  ED GRSD++++  +  E I
Sbjct  168   STSDIHLKYKLKMTREEVVDMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICTVFEEAI  227

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTL  PDTVG  +P E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG  
Sbjct  228   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  287

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+ I+  SKMV+EYT
Sbjct  288   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  347

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  348   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEIISPEDVGVVKSQNSGIVLGKLSGR  407

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEVF  1528
             HA+K +++ELGY+I  ++ +++F RF+ + ++KK++TDDDL AL++  DE+F
Sbjct  408   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLKALVTCGDEIF  459



>ref|WP_002758694.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCH96510.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9717]
Length=533

 Score =   539 bits (1389),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 370/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVGS-EADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRSPESTEPLTKINTREIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV + + D  E    ++GTGPVDA  KA++ +VK+P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRNPDGSELSDAAIGTGPVDALCKAINRVVKIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSAHAADTDIIVASARAYVSALNRL  517



>ref|WP_002746244.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CAO86547.1| leuA [Microcystis aeruginosa PCC 7806]
 gb|ELS46530.1| 2-isopropylmalate synthase [Microcystis aeruginosa DIANCHI905]
Length=533

 Score =   539 bits (1389),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 283/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAGSVGS-EADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV 
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVA  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +VK+P  L+ +S+  VTEGI
Sbjct  417   CGNNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVKIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



>sp|P94907.1|LEU1_MICAE RecName: Full=2-isopropylmalate synthase; AltName: Full=Alpha-IPM 
synthase; AltName: Full=Alpha-isopropylmalate synthase 
[Microcystis aeruginosa]
 dbj|BAA12849.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
Length=533

 Score =   539 bits (1389),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAGSVGS-EADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R                 RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLR--------------YAGRTYSARAADTDIIVASARAYVSALNRL  517



>ref|XP_009144531.1| PREDICTED: methylthioalkylmalate synthase 1, chloroplastic-like 
[Brassica rapa]
Length=497

 Score =   538 bits (1385),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/406 (60%), Positives = 327/406 (81%), Gaps = 3/406 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN+I+D NYVRVFDTTLRDGEQSPG  +T  +K+++ARQLAKL VD+++ GFPA
Sbjct  71    RWPEYIPNKIADKNYVRVFDTTLRDGEQSPGGALTPLQKVEIARQLAKLRVDVMDVGFPA  130

Query  488   ASEADFEAVRLIAQEVGN---GEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE + EAV+ IA+ VGN    E  +VPVIC ++RC   DI+ AWEA+K+AK+PR+  FI
Sbjct  131   SSEEELEAVKSIAKTVGNEVDAETGYVPVICVIARCKHEDIEAAWEALKYAKRPRIFLFI  190

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
              TSEIHMK+KL  ++++V+E A S + +A+ +G SD++F  ED GRSD++FL +I+G+ I
Sbjct  191   CTSEIHMKYKLKKTKDEVIEMAKSSIRFAKRIGFSDIQFGCEDGGRSDKDFLCKIMGDAI  250

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
               G TT+ + DTVG  +P EFG+++  +K NTPGI++V+ S HC NDLGL+TANT++G  
Sbjct  251   NEGVTTVTLADTVGNNIPQEFGEMVTYLKTNTPGIDDVVFSLHCHNDLGLATANTISGVC  310

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNASLEEVV+ALKCRG  V+GG+YT I+T+HI+  SKMV+EYT
Sbjct  311   AGARQVEVTINGIGERSGNASLEEVVLALKCRGAYVMGGVYTRIDTRHIMATSKMVQEYT  370

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVG N F HESGIHQDG+LKH+ TYEI SPEDIG  ++  S IVLGKLSGR
Sbjct  371   GLYVQPHKPIVGTNCFVHESGIHQDGILKHRSTYEIFSPEDIGAEKSQDSCIVLGKLSGR  430

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS  1516
             HA+K +++++GY+I  ++F+D+F RF+ + ++KK+ITD DLIAL++
Sbjct  431   HAVKDRLRKIGYEISDEKFNDIFSRFRELTKQKKRITDADLIALVA  476



>ref|XP_002872030.1| methylthioalkylmalate synthase b [Arabidopsis lyrata subsp. lyrata]
 emb|CAJ55516.1| methylthioalkylmalate synthase b [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48289.1| methylthioalkylmalate synthase b [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   538 bits (1385),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 247/419 (59%), Positives = 336/419 (80%), Gaps = 5/419 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             RRP+YIPN++   NYVRV DTTLRDGEQSPGA +   +KL++ARQLAKL VDI+E GFP 
Sbjct  69    RRPEYIPNKLPHKNYVRVLDTTLRDGEQSPGAALIPPQKLEIARQLAKLRVDIMEVGFPV  128

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FEA++ IA+ VGN   E   +VPVICG++RC  RDI+ AWEA+K+AK+PRV  F 
Sbjct  129   SSEEEFEAIKTIAKTVGNEVDEETGYVPVICGIARCKNRDIEAAWEALKYAKRPRVLLFT  188

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A + + YA+SLG +D+E   ED GR++++FL +ILGE+I
Sbjct  189   STSDIHMKYKLKKTKEEVIEMAVNSIKYAKSLGFTDIECGCEDGGRTEKDFLCKILGEMI  248

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATT+   DTVG  +P EFG+L+A +K NTPG ++++++ HC NDLG++TANT++G  
Sbjct  249   KAGATTVGFADTVGINMPPEFGELVAYVKENTPGADDIVLAIHCHNDLGVATANTISGIC  308

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+ I+  SKMV+E+T
Sbjct  309   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGEYLMNGVYTNIDTRQIMATSKMVQEHT  368

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             G+ VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  369   GMYVQPHKPIVGDNCFVHESGIHQDGILKNRSTYEILSPEDVGIVKSENSGIVLGKLSGR  428

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI--SDEVFQPQLVWK  1549
             HA++ +++ELGYDI  ++F+D+F R++ + ++KK+ITD DL AL+   DE+   +L  K
Sbjct  429   HAVRDRLKELGYDISDEKFNDIFSRYRELTKEKKRITDADLKALVVNGDEISSDKLNSK  487



>ref|XP_009130133.1| PREDICTED: methylthioalkylmalate synthase 1, chloroplastic-like 
[Brassica rapa]
Length=543

 Score =   539 bits (1388),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 250/412 (61%), Positives = 332/412 (81%), Gaps = 5/412 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQSPGA +T  +K+++ARQLAKL VDI+E GFP 
Sbjct  104   RWPEYIPNKLPDKNYVRVFDTTLRDGEQSPGAALTPPQKIEIARQLAKLRVDIMEVGFPV  163

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FE ++ IA+ VGN   E   ++PVIC ++R  +RDI  AWE+VK+AK+PR+  F 
Sbjct  164   SSEEEFETIQTIAKTVGNEVDEETGYIPVICVIARSKERDIKAAWESVKYAKRPRIVIFT  223

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IH+K+KL M+RE+VV+   S + +A+SLG  D+EF  ED GRSD++++  +  E I
Sbjct  224   STSDIHLKYKLKMTREEVVDMVASSIRFAKSLGFEDIEFGCEDGGRSDKDYICTVFEEAI  283

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATTL  PDTVG  +P E+G+L+  IKANTPGI++VI S HC NDLG++TANT+AG  
Sbjct  284   KAGATTLACPDTVGINMPHEYGKLVRYIKANTPGIDDVIFSAHCHNDLGVATANTIAGIC  343

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNA LEEVVMALKCRG  V+GG+YT I+T+ I+  SKMV+EYT
Sbjct  344   AGARQVEVTINGIGERSGNAPLEEVVMALKCRGAFVMGGVYTRIDTRQIMATSKMVQEYT  403

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  SGIVLGKLSGR
Sbjct  404   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEIISPEDVGVVKSQNSGIVLGKLSGR  463

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEVF  1528
             HA+K +++ELGY+I  ++ +++F RF+ + ++KK++TDDDL AL++  DE+F
Sbjct  464   HAVKGRLKELGYEISDEKLNEVFSRFRDLTKQKKRVTDDDLKALVTCGDEIF  515



>ref|WP_018399927.1| 2-isopropylmalate synthase [filamentous cyanobacterium ESFC-1]
Length=535

 Score =   538 bits (1387),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 288/533 (54%), Positives = 360/533 (68%), Gaps = 30/533 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ + +FDTTLRDGEQSPGAT+  +EKL +AR LAKLGVD+IEAGFP AS  DFEAV+ I
Sbjct  5     PDRIIIFDTTLRDGEQSPGATLNVEEKLLIARSLAKLGVDVIEAGFPFASPGDFEAVQKI  64

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A  VG  +G   P ICGL+R  + DI RA EA+K A K R+HTFIATS+IH+K+KL  SR
Sbjct  65    ADTVGTQDG---PTICGLARARKDDIKRAGEALKPAAKGRIHTFIATSDIHLKYKLRKSR  121

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             E V+     MV YA+S    DVEFSPEDAGRSD EFLYQ+L   I +GATT+NIPDTVGY
Sbjct  122   EDVLATIPEMVGYAKSF-VDDVEFSPEDAGRSDPEFLYQVLETAIASGATTVNIPDTVGY  180

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
               P EFGQLI  I  N P I   IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  181   LTPGEFGQLIRGITENVPNINQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1064  RAGNASLEEVVMALKCRGE---QVLG------GLYTGINTQHIIMASKMVEEYTGLLVQP  1216
             RAGNA+LEE+VMAL  R +     LG         T I+T+ I   S++V   TG+ VQP
Sbjct  241   RAGNAALEELVMALYVRRQYYNPFLGRPPESEAPLTNIDTKQIYKTSRLVSNLTGMTVQP  300

Query  1217  HKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTK  1396
             +KAIVGANAFAHESGIHQDG+LK+K TYEIM  E IGL   N++ IVLGK SGRHA   +
Sbjct  301   NKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAESIGL---NENQIVLGKHSGRHAFSKR  357

Query  1397  MQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCG  1576
             +QELGY++   E +  F  FK VA+KKK ITD DL A++ DE  QP  +++L  +QV+CG
Sbjct  358   LQELGYNLSDTELNRAFLVFKDVADKKKVITDWDLEAIVGDETQQPPELFRLEYVQVSCG  417

Query  1577  SLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDA  1756
                  TATV +   +  E    ++GTGPVDA YKA++ +V V   L E+++ +VTEGIDA
Sbjct  418   DRAQPTATVTIRTPEGRELTDAAIGTGPVDAVYKAINRVVNVSNQLSEFAVKSVTEGIDA  477

Query  1757  IASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             +    + +R +              N+T+SG  A  DI+++S RAY+ ALN++
Sbjct  478   MGEVTIRLRHE--------------NQTYSGHAADTDIIVASARAYINALNRL  516



>ref|XP_005704188.1| 2-isopropylmalate synthase [Galdieria sulphuraria]
 gb|EME27668.1| 2-isopropylmalate synthase [Galdieria sulphuraria]
Length=663

 Score =   543 bits (1399),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 295/566 (52%), Positives = 381/566 (67%), Gaps = 31/566 (5%)
 Frame = +2

Query  305   PRRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFP  484
             P + D +  R  DP  V+ FDTTLRDGEQSPGAT+T +EKL +ARQLAKLGVDIIEAGFP
Sbjct  118   PTKHDLVTGR--DPTRVKFFDTTLRDGEQSPGATLTGEEKLVIARQLAKLGVDIIEAGFP  175

Query  485   AASEADFEAVRLIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIAT  664
              AS  DFEAVR IA+ VG  E    P+ICGL+R  + DI R WEAVK A   R+HTFIAT
Sbjct  176   VASNGDFEAVRNIARTVGTRENP--PIICGLARAVESDIARCWEAVKDAAFARIHTFIAT  233

Query  665   SEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKA  844
             S+IHM+ KL  SR QV+E  T  V YA+SL C D+EFS EDA RSD EFLY++    I+A
Sbjct  234   SDIHMEHKLKKSRSQVLETVTRTVQYAKSL-CEDIEFSAEDATRSDPEFLYEVFSRAIEA  292

Query  845   GATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAG  1024
             GATT+N+PDTVGYT P EFG L+  I+ N  GIENV +S H  +DLGL+ +N L+    G
Sbjct  293   GATTINVPDTVGYTTPAEFGSLMRGIRRNVRGIENVCLSVHGHDDLGLAVSNFLSAIENG  352

Query  1025  ARQVEVTINGIGERAGNASLEEVVMALKCR--------GEQVLGGLYTGINTQHIIMASK  1180
             A+QVE T+NGIGERAGNASLEE+VMAL  R        G      L T ++TQ I   SK
Sbjct  353   AQQVECTVNGIGERAGNASLEEIVMALYVRRQYYNNKLGRPDPNALLTCVDTQEIWKTSK  412

Query  1181  MVEEYTGLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVL  1360
             +V   TG++VQP+KAIVG+NAFAHESGIHQDG+LK++ TYEIM    IG+    ++ +VL
Sbjct  413   LVSNLTGMIVQPNKAIVGSNAFAHESGIHQDGILKNRLTYEIMDARLIGMQ---ENQLVL  469

Query  1361  GKLSGRHALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEV-FQPQ  1537
             GK SGRHA + ++ ELG+D+   E +  F RFK +A+KKK++T  DL ++++DEV  Q  
Sbjct  470   GKHSGRHAFRKRLGELGFDLTEDELNRAFVRFKELADKKKEVTLWDLESIVNDEVRLQGT  529

Query  1538  LVWKLGDLQVTCGSLGLSTATVKLIDAD-DEEHVACSVGTGPVDAAYKAVDLLVKVP-VT  1711
                KL  +QV CG   +STATV ++  +   E  A S+GTGPVDAA+KA++ +  VP V 
Sbjct  530   EYLKLERVQVQCGDKLISTATVTIMHMELSRELTAVSIGTGPVDAAFKALNSIEGVPKVV  589

Query  1712  LLEYSLTAVTEGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRA  1891
             L EY + ++T+GIDA+    V IRG+              +R+F G+ A  DIV++SV+A
Sbjct  590   LQEYMVNSITQGIDALGEVTVRIRGETD------------SRSFIGSAANTDIVVASVQA  637

Query  1892  YVGALNKMLSFTTLVSRYNKTEDNVV  1969
             YV ALN++  +       +  +D VV
Sbjct  638   YVNALNRLARYAQYPKSVHPQKDAVV  663



>ref|WP_006622399.1| MULTISPECIES: 2-isopropylmalate synthase [Arthrospira]
 emb|CCE20079.1| 2-isopropylmalate synthase [Arthrospira sp. PCC 8005]
 gb|EKD09588.1| 2-isopropylmalate synthase [Arthrospira platensis C1]
 emb|CDM98586.1| 2-isopropylmalate synthase [Arthrospira sp. PCC 8005]
Length=538

 Score =   538 bits (1387),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 286/536 (53%), Positives = 369/536 (69%), Gaps = 32/536 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ V +FDTTLRDGEQ PGAT+   EKL +ARQLA+LGVD+IEAGF  AS  DFEAV+ I
Sbjct  7     PDRVIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASSGDFEAVQRI  66

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A+ VG   G   P+IC L+R  + DI+ A +A+K A  PR+HTFIATS+IH+K+KL  +R
Sbjct  67    AETVGTENG---PIICSLARSVKADIEAAAKALKPAAHPRIHTFIATSDIHLKYKLKKTR  123

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             ++V++  + MVAYA+SL C D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   QEVLDITSEMVAYAKSL-CQDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  182

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  183   TTPSEFGGLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  242

Query  1064  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQHIIMASKMVEEYTGLLVQ  1213
             RAGNA+LEE+VMAL  R  Q     +          T INT+ I   S++V   TG+LVQ
Sbjct  243   RAGNAALEELVMALHVR-RQFFNPFFGRPADSEAPITNINTREIYKTSRLVSNLTGMLVQ  301

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             P+KAIVGANAFAHESGIHQDG+LK+K TYEIM  + IGL   N + IVLGK SGRHA + 
Sbjct  302   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQN  358

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             ++QELG+D+   E +  F RFK VA+KKK++T+ D+ A+++DE+ Q   +++L  +QV+C
Sbjct  359   RLQELGFDLSDDEINKAFVRFKDVADKKKEVTNWDIEAIVNDEIQQTPELFRLELVQVSC  418

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+    TATV L     +E    + GTGPVDA YKA++ +V VP  L+E+S+ +VT GID
Sbjct  419   GNNARPTATVTLRTPQGQELTDAATGTGPVDAVYKAINRVVNVPNELIEFSVQSVTAGID  478

Query  1754  AIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
             AI    + +R                 R FSG  A  DI+++S +AY+ ALN++ S
Sbjct  479   AIGEVTIRLRYQ--------------GRVFSGHAANTDIIVASAQAYINALNRLQS  520



>ref|XP_009137065.1| PREDICTED: methylthioalkylmalate synthase 2, chloroplastic-like, 
partial [Brassica rapa]
Length=442

 Score =   535 bits (1377),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 249/411 (61%), Positives = 332/411 (81%), Gaps = 5/411 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIP+++ D NYVRVFDTTLRDGEQ+PG  +T  +KL++ARQLAKL VDI+E GFP 
Sbjct  8     RWPEYIPHKLPDKNYVRVFDTTLRDGEQAPGGALTPPQKLEIARQLAKLRVDIMEVGFPV  67

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE +FE V+ IA+ VGN   E   +VPVIC ++R    DI+ AWEAVK+AK+P++  F 
Sbjct  68    SSEEEFETVKTIAKTVGNEVDEATGYVPVICAIARSKPEDIEAAWEAVKYAKRPKILIFT  127

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A S V +A+SLG  DV+   ED GRS++EFL +ILGE I
Sbjct  128   STSDIHMKYKLKKTKEEVIEMAASSVKFAKSLGFVDVQLGCEDGGRSEKEFLCKILGESI  187

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAGATT+N+ DTVG  +P E+G+L++ +KANTPGI++VI S HC NDLG++TANT+AG  
Sbjct  188   KAGATTVNVADTVGINMPDEYGELVSYLKANTPGIDDVIFSVHCHNDLGVATANTIAGVC  247

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVT+NGIGER+GNA LEEVVMALKCRGE ++ G+YT I+T+ I+  S+MV+EYT
Sbjct  248   AGARQVEVTVNGIGERSGNAPLEEVVMALKCRGEYLMDGVYTRIDTRQIMATSQMVQEYT  307

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVGAN F HESGIHQDG+LK++ TYEI+SPED+G+ ++  + IVLGKLSGR
Sbjct  308   GLYVQPHKPIVGANCFVHESGIHQDGILKNRSTYEILSPEDVGVVKSQSASIVLGKLSGR  367

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALIS--DEV  1525
             HA+K +++ELGY++D ++ +D+F RF+ + + KK+ITDDDL AL++  DEV
Sbjct  368   HAVKDRLKELGYELDDEKLNDIFSRFRDLTKHKKRITDDDLKALVTCRDEV  418



>gb|KDR56307.1| 2-isopropylmalate synthase [Arthrospira platensis str. Paraca]
Length=536

 Score =   538 bits (1386),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 288/549 (52%), Positives = 376/549 (68%), Gaps = 34/549 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ V +FDTTLRDGEQ PGAT+   EKL +ARQLA+LGVD+IEAGF  AS  DFEAV+ I
Sbjct  5     PDRVIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASSGDFEAVQRI  64

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A+ VG   G   P+IC L+R  + DI+ A +A+K A  PR+HTFIATS+IH+K+KL  +R
Sbjct  65    AETVGTENG---PIICSLARSVKADIEAAAKALKPAAHPRIHTFIATSDIHLKYKLKKTR  121

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             ++V++  + MVAYA+SL C D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  122   QEVLDITSEMVAYAKSL-CEDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  180

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  181   TTPSEFGGLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  240

Query  1064  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQHIIMASKMVEEYTGLLVQ  1213
             RAGNA+LEE+VMAL  R  Q     +          T INT+ I   S++V   TG+LVQ
Sbjct  241   RAGNAALEELVMALHVR-RQFFNPFFGRPADSEVPITNINTREIYKTSRLVSNLTGMLVQ  299

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             P+KAIVGANAFAHESGIHQDG+LK+K TYEIM  + IGL   N + IVLGK SGRHA + 
Sbjct  300   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQN  356

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             ++QELG+D+   E +  F RFK VA+KKK++T+ D+ A+++DE+ Q   +++L  +QV+C
Sbjct  357   RLQELGFDLSDDEINKAFVRFKDVADKKKEVTNWDIEAIVNDEIQQTPELFRLELVQVSC  416

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+    TATV L   + +E    + GTGPVDA YKA++ +V VP  L+E+++ +VT GID
Sbjct  417   GNNARPTATVTLRTPEGQELTDAATGTGPVDAVYKAINRVVNVPNELIEFAVQSVTAGID  476

Query  1754  AIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTL  1933
             AI    + +R                 R FSG  A  DI+++S +AY+ ALN++ S  +L
Sbjct  477   AIGEVTIRLRYQ--------------GRVFSGHAANTDIIVASAQAYINALNRLQS--SL  520

Query  1934  VSRYNKTED  1960
               + N+  D
Sbjct  521   EPKSNQVGD  529



>ref|WP_015202275.1| 2-isopropylmalate synthase [Crinalium epipsammum]
 ref|YP_007141663.1| 2-isopropylmalate synthase [Crinalium epipsammum PCC 9333]
 gb|AFZ12153.1| 2-isopropylmalate synthase [Crinalium epipsammum PCC 9333]
Length=550

 Score =   539 bits (1388),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 289/538 (54%), Positives = 375/538 (70%), Gaps = 30/538 (6%)
 Frame = +2

Query  329   NRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFE  508
             N  + P+ + +FDTTLRDGEQSPGAT+   EKL +ARQLAKLGVD+IEAGFP AS  DFE
Sbjct  2     NTPAQPDRIIIFDTTLRDGEQSPGATLNVDEKLTIARQLAKLGVDVIEAGFPYASSGDFE  61

Query  509   AVRLIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFK  688
             AV+ IAQ VG   G   P ICGL+R  ++DI  A EA+K A K R+HTFIATS+IH+++K
Sbjct  62    AVQKIAQVVGVESG---PTICGLARATRQDIKAAAEALKPAAKHRIHTFIATSDIHLEYK  118

Query  689   LNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIP  868
             L  +R++V+E A+ MVAYA+SL   DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIP
Sbjct  119   LKKTRQEVIEIASEMVAYAKSL-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTINIP  177

Query  869   DTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTI  1048
             DTVGYT P+EFG +I  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TI
Sbjct  178   DTVGYTTPSEFGAIIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTI  237

Query  1049  NGIGERAGNASLEEVVMALKCRGE---QVLGGL------YTGINTQHIIMASKMVEEYTG  1201
             NGIGERAGNA+LEE+VMAL  R +     LG         T I+T+ I   S++V   TG
Sbjct  238   NGIGERAGNAALEELVMALHVRRQYYNPFLGRAVDSEEPLTNIDTRQIYKTSRLVSSLTG  297

Query  1202  LLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRH  1381
             +LVQP+KAIVGANAF+HESGIHQDG+LK+K TYEIM  + IGL     + IVLGKLSGR+
Sbjct  298   MLVQPNKAIVGANAFSHESGIHQDGVLKNKRTYEIMDAQLIGL---TDNQIVLGKLSGRN  354

Query  1382  ALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDL  1561
             A +T++QELG+++   E +  F +FK +A+KKK+ITD DL A+++DE+ Q   +++L  +
Sbjct  355   AFRTRLQELGFELSETELNKAFVKFKELADKKKEITDWDLEAIVNDEIQQAPELFRLEFV  414

Query  1562  QVTCGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVT  1741
             QV+CG+    TAT+ L     EE    ++GTGPVDA YKA++ +V VP  L+E+S+ +VT
Sbjct  415   QVSCGNQARPTATITLRTPTGEELTDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVT  474

Query  1742  EGIDAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
              GIDAI    + ++                 R +SG  A  DI+++S +AYV ALN++
Sbjct  475   AGIDAIGEVTIRLKHK--------------ERIYSGHAANTDIIVASAQAYVNALNRL  518



>ref|WP_017323659.1| 2-isopropylmalate synthase [cyanobacterium PCC 7702]
Length=531

 Score =   538 bits (1386),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 290/538 (54%), Positives = 374/538 (70%), Gaps = 30/538 (6%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P  + +FDTTLRDGEQ PGAT+   EKL +A+QLA+LGVDIIEAGF  AS  DFEA+ 
Sbjct  3     TKPERIIIFDTTLRDGEQCPGATLNIDEKLTIAKQLARLGVDIIEAGFAFASPGDFEAIS  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IAQ VG  +G   PVIC L+R  + DI  A EA+K A K R+HTFIATS+IH+K+KL  
Sbjct  63    KIAQTVGTEDG---PVICSLARARKEDIKAAAEAIKPAAKGRIHTFIATSDIHLKYKLKK  119

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++VV  A  MVAYA++   SDVEFSPEDAGRSD EFLY++L  VI AGATT+NIPDTV
Sbjct  120   TRQEVVAIAEEMVAYAKNF-TSDVEFSPEDAGRSDPEFLYEVLERVISAGATTVNIPDTV  178

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGI
Sbjct  179   GYTTPSEFGALIKGIKENVPNIDKAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI  238

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNA+LEE+VMAL  R +     L          T I+T+ I   S++V   TG+LV
Sbjct  239   GERAGNAALEELVMALHVRRQYFNPFLGRPVDSEEPLTNIDTKQIYRTSRLVSNLTGILV  298

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LK+K TYEIM  + IGL    ++ IVLGK SGR+A +
Sbjct  299   QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---TENQIVLGKHSGRNAFR  355

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             T+++ELGY++   E +  F RFK +A+KKK+ITD DL A+++DE+ Q   ++KL  +QV+
Sbjct  356   TRLRELGYELTETELNQAFIRFKEIADKKKEITDWDLQAIVNDEIQQAPELFKLELVQVS  415

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CGS    TATV L   + EE +  ++GTGPVDA YKA++ +V VP  L+E+S+ +VT GI
Sbjct  416   CGSNAKPTATVTLRTPEGEELMDAAIGTGPVDAVYKAINRVVNVPNQLIEFSVQSVTAGI  475

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSF  1924
             DAI    + ++ +              NR FSG  A  DI+++S +AYV ALN++ ++
Sbjct  476   DAIGEVTIRLKHE--------------NRVFSGHAANTDIIVASAQAYVNALNRLYAW  519



>ref|WP_006509230.1| 2-isopropylmalate synthase [Xenococcus sp. PCC 7305]
 gb|ELS03692.1| 2-isopropylmalate synthase [Xenococcus sp. PCC 7305]
Length=532

 Score =   538 bits (1386),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 283/531 (53%), Positives = 365/531 (69%), Gaps = 32/531 (6%)
 Frame = +2

Query  359   VFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIAQEVG  538
             +FDTTLRDGEQSPGAT+  +EKL+VA  LA+LGVD+IEAGFP AS  DF+AV+ +A  VG
Sbjct  10    IFDTTLRDGEQSPGATLNVEEKLEVAHALARLGVDVIEAGFPYASPGDFDAVQKVAAAVG  69

Query  539   NGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSREQVVE  718
                G   P ICGL+R  + DI  A EA+K A   R+HTFIATS+IH+++KL  SR +V+ 
Sbjct  70    TENG---PTICGLARATKNDIKTAAEALKPAANGRIHTFIATSDIHLEYKLRKSRAEVLA  126

Query  719   KATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYTLPTE  898
              A  MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGYT P+E
Sbjct  127   IAPEMVAYAKSF-VNDVEFSPEDAGRSDPEFLYQVLEAAIAAGATTVNIPDTVGYTTPSE  185

Query  899   FGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGERAGNA  1078
             FG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGERAGNA
Sbjct  186   FGALIKGIKDNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGERAGNA  245

Query  1079  SLEEVVMALKCRGEQVLGGLY----------TGINTQHIIMASKMVEEYTGLLVQPHKAI  1228
             +LEE+VMAL  R  Q     +          T ++T+ I   S++V   TG+ VQP+KAI
Sbjct  246   ALEELVMALHVR-RQYFNPFFGRPAESTEPLTQVDTKQIYKTSRLVSNLTGMAVQPNKAI  304

Query  1229  VGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQEL  1408
             VGANAFAHESGIHQDG+LK+K TYEIM    IGL     + IVLGKLSGR+A +T+++EL
Sbjct  305   VGANAFAHESGIHQDGVLKNKLTYEIMDATSIGL---TDNQIVLGKLSGRNAFRTRLKEL  361

Query  1409  GYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGL  1588
             G+++   E +  F RFK VA+KKK+ITD D+ A+++DE+ QP  +++L  +QV+CG    
Sbjct  362   GFELSENELNKAFIRFKDVADKKKEITDWDIEAIVNDEIRQPPELFRLELVQVSCGDNSC  421

Query  1589  STATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIAST  1768
              TATV +   + EE    ++GTGPVDA YKA++ + +VP  L+E+S+ +VT GIDA+   
Sbjct  422   PTATVTIRTPEGEELTDAAIGTGPVDAIYKAINRVAEVPNELIEFSVQSVTGGIDAMGEV  481

Query  1769  RVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLS  1921
              + +R D              N+ +SG  A  DIV++S RAYV ALN++ S
Sbjct  482   TIRLRYD--------------NQVYSGYSANTDIVVASARAYVKALNRLYS  518



>ref|WP_002736592.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 gb|ELP54125.1| 2-isopropylmalate synthase [Microcystis aeruginosa TAIHU98]
Length=533

 Score =   538 bits (1386),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 281/535 (53%), Positives = 370/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVGS-EADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_011309308.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi]
 ref|YP_307873.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi CBDB1]
 ref|YP_001214211.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi BAV1]
 ref|YP_003462532.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi GT]
 ref|YP_007483752.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi DCMB5]
 ref|YP_007485183.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi BTF08]
 emb|CAI82957.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi CBDB1]
 gb|ABQ17333.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi BAV1]
 gb|ADC74076.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi GT]
 gb|AGG06410.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi DCMB5]
 gb|AGG07841.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi BTF08]
 gb|AII60920.1| 2-isopropylmalate synthase [Dehalococcoides mccartyi CG5]
Length=505

 Score =   537 bits (1383),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 270/524 (52%), Positives = 362/524 (69%), Gaps = 26/524 (5%)
 Frame = +2

Query  347   NYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLIA  526
             + +++FDTTLRDGEQ+ GA++  +EKL++ARQL KLGVDIIEAGFP  S  DFEAV+LIA
Sbjct  2     DRIKIFDTTLRDGEQAAGASLNAQEKLEIARQLEKLGVDIIEAGFPITSPGDFEAVKLIA  61

Query  527   QEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSRE  706
             QEV        PVICGL+R    DIDRAWEA+K A  PR+H FI++SEIHM  ++  SR+
Sbjct  62    QEV------RTPVICGLARAIPADIDRAWEALKEAAHPRIHVFISSSEIHMVHQIKKSRD  115

Query  707   QVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGYT  886
             +V+E A +MVA A+     D+EFSP DA RSD EFLY++L  VI AGATTLNIPDTVGY 
Sbjct  116   EVLELARTMVAKAKGY-TDDIEFSPMDASRSDPEFLYKLLEAVIDAGATTLNIPDTVGYA  174

Query  887   LPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGER  1066
             +P+EFG+LI  I+ N P I   +IS HC +DLG+ TAN+LA    GARQVE T+NGIGER
Sbjct  175   IPSEFGELIKGIRQNVPNIGKAVISVHCHDDLGMGTANSLAAVKNGARQVECTLNGIGER  234

Query  1067  AGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYTGLLVQPHKAIVGANAF  1246
             AGNA+LEEVVMAL+ R +       TGINTQ I   S++V   TG  +QP+KA+VG NAF
Sbjct  235   AGNAALEEVVMALRTRSD--FFNFETGINTQEIYRTSRLVSALTGFAIQPNKAVVGENAF  292

Query  1247  AHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKTKMQELGYDIDG  1426
              H+SGIHQDG++K   T+EIM P+++G+     S +VLGKLSGRHA K  + ELG+D++ 
Sbjct  293   RHQSGIHQDGVIKMAKTFEIMDPKEVGIQ---ASSLVLGKLSGRHAFKQHLTELGFDLNE  349

Query  1427  KEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTCGSLGLSTATVK  1606
             ++FD  F  FK +A+KKK +TD D+ AL+++E+     ++ L  +QVT G  G+ TA V+
Sbjct  350   EDFDRAFKAFKDLADKKKDVTDRDIEALVAEELRTTVELYHLDRIQVTSGDRGIPTAAVR  409

Query  1607  LIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGIDAIASTRVLIRG  1786
             L   +       S+G+GPVDA YKA++ +V VP  L E+S+ +VT GIDA+    + I  
Sbjct  410   LTTPNGGAVEDASLGSGPVDAVYKAINRIVNVPNKLTEFSVKSVTAGIDALGEVLIRIES  469

Query  1787  DNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKML  1918
             D                T++G G+  DI+++S +AY+ ALN++L
Sbjct  470   DGV--------------TYTGRGSDTDIIVASAKAYMNALNRLL  499



>ref|WP_016516646.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 gb|EPF19322.1| 2-isopropylmalate synthase [Microcystis aeruginosa SPC777]
Length=533

 Score =   538 bits (1386),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 281/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVGS-EADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



>ref|XP_002872029.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. lyrata]
 emb|CAJ55515.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48288.1| methylthioalkylmalate synthase a [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   537 bits (1383),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 249/416 (60%), Positives = 330/416 (79%), Gaps = 5/416 (1%)
 Frame = +2

Query  308   RRPDYIPNRISDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPA  487
             R P+YIPN++ D NYVRVFDTTLRDGEQ+PG ++T  +KL++ARQLAKL VDI+E GFP 
Sbjct  70    RWPEYIPNKLPDKNYVRVFDTTLRDGEQAPGGSLTPPQKLEIARQLAKLRVDIMEVGFPG  129

Query  488   ASEADFEAVRLIAQEVGNGEGE---HVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFI  658
             +SE + E V+ IA+ VGN   E   +VPVIC ++R   RDI+ AWEAVK+AK+PR+  F 
Sbjct  130   SSEEELETVKTIAKTVGNEVDEETGYVPVICAIARSKHRDIEAAWEAVKYAKRPRILIFT  189

Query  659   ATSEIHMKFKLNMSREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVI  838
             +TS+IHMK+KL  ++E+V+E A S +  A+SLG +D++   ED GRSD+EFL +ILGE I
Sbjct  190   STSDIHMKYKLKKTKEEVIEMAVSSIRLAKSLGFNDIQLGCEDGGRSDKEFLCKILGEAI  249

Query  839   KAGATTLNIPDTVGYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAY  1018
             KAG T +N+ DTVG  +P E+G+L+  +KANTPGI++++ S HC NDLGL+TAN++AG  
Sbjct  250   KAGVTVVNVADTVGINMPHEYGELVTYLKANTPGIDDIVFSVHCHNDLGLATANSIAGIR  309

Query  1019  AGARQVEVTINGIGERAGNASLEEVVMALKCRGEQVLGGLYTGINTQHIIMASKMVEEYT  1198
             AGARQVEVTINGIGER+GNASLEEVVMALKCRG  V+ G+YT I+T+ I+  SKMV+EYT
Sbjct  310   AGARQVEVTINGIGERSGNASLEEVVMALKCRGAYVINGVYTRIDTRQIMATSKMVQEYT  369

Query  1199  GLLVQPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGR  1378
             GL VQPHK IVG N F HESGIHQDG+LK++ TYEI+SPEDIG+ ++  SG+VLGKLSGR
Sbjct  370   GLYVQPHKPIVGTNCFVHESGIHQDGILKNRSTYEILSPEDIGVVKSQNSGLVLGKLSGR  429

Query  1379  HALKTKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALI--SDEVFQPQL  1540
             HA+K ++ ELGY++D ++ +D+F RF+ + + KK+ITD D+ AL+  SDE+   +L
Sbjct  430   HAVKDRLNELGYELDDEKLNDVFSRFRDLTKHKKRITDADMKALVTSSDEISLEKL  485



>ref|WP_006618368.1| 2-isopropylmalate synthase [Arthrospira platensis]
 ref|YP_005066483.1| 2-isopropylmalate synthase [Arthrospira platensis NIES-39]
 dbj|BAI87945.1| 2-isopropylmalate synthase [Arthrospira platensis NIES-39]
Length=538

 Score =   538 bits (1385),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 288/549 (52%), Positives = 376/549 (68%), Gaps = 34/549 (6%)
 Frame = +2

Query  344   PNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVRLI  523
             P+ V +FDTTLRDGEQ PGAT+   EKL +ARQLA+LGVD+IEAGF  AS  DFEAV+ I
Sbjct  7     PDRVIIFDTTLRDGEQCPGATLNVDEKLVIARQLARLGVDVIEAGFAIASSGDFEAVQRI  66

Query  524   AQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNMSR  703
             A+ VG   G   P+IC L+R  + DI+ A +A+K A  PR+HTFIATS+IH+K+KL  +R
Sbjct  67    AETVGTENG---PIICSLARSVKADIEAAAKALKPAAHPRIHTFIATSDIHLKYKLKKTR  123

Query  704   EQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTVGY  883
             ++V++  + MVAYA+SL C D+EFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTVGY
Sbjct  124   QEVLDITSEMVAYAKSL-CEDIEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTVGY  182

Query  884   TLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGIGE  1063
             T P+EFG LI  IK N P I+  IIS H  NDLGL+ AN L     GARQ+E TINGIGE
Sbjct  183   TTPSEFGGLIRGIKENVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE  242

Query  1064  RAGNASLEEVVMALKCRGEQVLGGLY----------TGINTQHIIMASKMVEEYTGLLVQ  1213
             RAGNA+LEE+VMAL  R  Q     +          T INT+ I   S++V   TG+LVQ
Sbjct  243   RAGNAALEELVMALHVR-RQFFNPFFGRPADSEVPITNINTREIYKTSRLVSNLTGMLVQ  301

Query  1214  PHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALKT  1393
             P+KAIVGANAFAHESGIHQDG+LK+K TYEIM  + IGL   N + IVLGK SGRHA + 
Sbjct  302   PNKAIVGANAFAHESGIHQDGVLKNKLTYEIMDAQSIGL---NDNLIVLGKHSGRHAFQN  358

Query  1394  KMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVTC  1573
             ++QELG+D+   E +  F RFK VA+KKK++T+ D+ A+++DE+ Q   +++L  +QV+C
Sbjct  359   RLQELGFDLSDDEINKAFVRFKDVADKKKEVTNWDIEAIVNDEIQQTPELFRLELVQVSC  418

Query  1574  GSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGID  1753
             G+    TATV L   + +E    + GTGPVDA YKA++ +V VP  L+E+++ +VT GID
Sbjct  419   GNNARPTATVTLRTPEGQELTDAATGTGPVDAVYKAINRVVNVPNELIEFAVQSVTAGID  478

Query  1754  AIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKMLSFTTL  1933
             AI    + +R                 R FSG  A  DI+++S +AY+ ALN++ S  +L
Sbjct  479   AIGEVTIRLRYQ--------------GRVFSGHAANTDIIVASAQAYINALNRLQS--SL  522

Query  1934  VSRYNKTED  1960
               + N+  D
Sbjct  523   EPKSNQVGD  531



>ref|WP_002765307.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI05186.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9443]
Length=533

 Score =   538 bits (1385),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 281/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DFEAV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFEAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+ E +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVGS-EADS-PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V++    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLDIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---TNNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNNARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R                 RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLR--------------YAGRTYSARAADTDIIVASARAYVSALNRL  517



>ref|WP_002783894.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI13647.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 9806]
Length=533

 Score =   538 bits (1385),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 280/535 (52%), Positives = 368/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG+      P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAASVGSEADS--PIICGLARTTQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S   +DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-LNDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPAESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA+D +V++P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAIDRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSAHAADTDIIVASARAYVSALNRL  517



>ref|WP_002773852.1| 2-isopropylmalate synthase [Microcystis aeruginosa]
 emb|CCI09342.1| 2-isopropylmalate synthase [Microcystis aeruginosa PCC 7941]
Length=533

 Score =   537 bits (1384),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 281/535 (53%), Positives = 369/535 (69%), Gaps = 29/535 (5%)
 Frame = +2

Query  338   SDPNYVRVFDTTLRDGEQSPGATMTTKEKLDVARQLAKLGVDIIEAGFPAASEADFEAVR  517
             + P+ V +FDTTLRDGEQSPGA +   EKL +AR LA+LGVD+IEAGFP AS  DF+AV+
Sbjct  3     TSPDRVIIFDTTLRDGEQSPGAALNVDEKLTIARALARLGVDVIEAGFPHASPGDFDAVQ  62

Query  518   LIAQEVGNGEGEHVPVICGLSRCNQRDIDRAWEAVKHAKKPRVHTFIATSEIHMKFKLNM  697
              IA  VG GE +  P+ICGL+R  Q+DI  A +A++ A KPR+HTF+ATS+IH+++KL  
Sbjct  63    KIAGSVG-GEADS-PIICGLARATQKDIKSAADALRPAAKPRIHTFLATSDIHLQYKLKK  120

Query  698   SREQVVEKATSMVAYARSLGCSDVEFSPEDAGRSDREFLYQILGEVIKAGATTLNIPDTV  877
             +R++V+E    MVAYA+S    DVEFSPEDAGRSD EFLYQ+L   I AGATT+NIPDTV
Sbjct  121   TRQEVLEIVPEMVAYAKSF-VDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTVNIPDTV  179

Query  878   GYTLPTEFGQLIADIKANTPGIENVIISTHCQNDLGLSTANTLAGAYAGARQVEVTINGI  1057
             GYT P+EFG LI  IK N P I+  IIS H  +DLGL+ AN L     GARQ+E TINGI
Sbjct  180   GYTTPSEFGALIRGIKENVPNIDQAIISVHGHDDLGLAVANFLEAVKNGARQLECTINGI  239

Query  1058  GERAGNASLEEVVMALKCRGEQVLGGL---------YTGINTQHIIMASKMVEEYTGLLV  1210
             GERAGNASLEE+VMAL  R       L          T INT+ I   S++V   TG++V
Sbjct  240   GERAGNASLEELVMALHVRRSYFNPFLGRPPESTEPLTKINTKEIYRTSRLVSNLTGMIV  299

Query  1211  QPHKAIVGANAFAHESGIHQDGMLKHKDTYEIMSPEDIGLHRANQSGIVLGKLSGRHALK  1390
             QP+KAIVGANAFAHESGIHQDG+LKHK TYEIM  E IGL     + IVLGKLSGR+A +
Sbjct  300   QPNKAIVGANAFAHESGIHQDGVLKHKLTYEIMDAESIGL---THNQIVLGKLSGRNAFR  356

Query  1391  TKMQELGYDIDGKEFDDLFWRFKSVAEKKKKITDDDLIALISDEVFQPQLVWKLGDLQVT  1570
             +++QELG+++   E ++ F +FK +A++KK+ITD DL A+++DE+      ++L  +QV+
Sbjct  357   SRLQELGFELSETELNNAFIQFKEMADRKKEITDRDLEAIVNDEIDTVPDHFRLELVQVS  416

Query  1571  CGSLGLSTATVKLIDADDEEHVACSVGTGPVDAAYKAVDLLVKVPVTLLEYSLTAVTEGI  1750
             CG+    TATV +   D  E    ++GTGPVDA  KA++ +V++P  L+ +S+  VTEGI
Sbjct  417   CGNSARPTATVTIRTPDGSELSDAAIGTGPVDALCKAINRVVQIPNELISFSVREVTEGI  476

Query  1751  DAIASTRVLIRGDNSHTSTHALTGNVVNRTFSGTGAGMDIVISSVRAYVGALNKM  1915
             DA+    + +R +               RT+S   A  DI+++S RAYV ALN++
Sbjct  477   DALGEVTIRLRYE--------------GRTYSARAADTDIIVASARAYVSALNRL  517



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11517396341472