BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24699_g2_i2 len=1374 path=[372:0-118 @491@!:119-321 694:322-363
14577:364-368 14629:369-464 14093:465-480 853:481-1373]

Length=1374
                                                                      Score     E

ref|XP_010677176.1|  PREDICTED: uncharacterized protein LOC104892855  90.5    7e-16   
gb|KHN37849.1|  E3 ubiquitin-protein ligase SINA-like 10              73.6    1e-10   
ref|XP_006589372.1|  PREDICTED: uncharacterized protein LOC100782920  73.6    1e-10   
ref|XP_010278752.1|  PREDICTED: uncharacterized protein LOC104612...  71.6    5e-10   
ref|XP_010278751.1|  PREDICTED: uncharacterized protein LOC104612...  71.6    5e-10   
ref|XP_010278750.1|  PREDICTED: uncharacterized protein LOC104612...  71.2    6e-10   
ref|XP_010278749.1|  PREDICTED: uncharacterized protein LOC104612...  71.2    6e-10   
ref|XP_010278748.1|  PREDICTED: uncharacterized protein LOC104612...  71.2    6e-10   
ref|XP_010278747.1|  PREDICTED: uncharacterized protein LOC104612...  71.2    7e-10   
ref|XP_010278746.1|  PREDICTED: uncharacterized protein LOC104612...  70.9    8e-10   
ref|XP_009804894.1|  PREDICTED: uncharacterized protein LOC104250...  68.6    4e-09   
ref|XP_009804893.1|  PREDICTED: uncharacterized protein LOC104250...  68.6    5e-09   
ref|XP_004234633.1|  PREDICTED: uncharacterized protein LOC101262187  68.6    5e-09   
ref|XP_009587673.1|  PREDICTED: uncharacterized protein LOC104085366  68.6    6e-09   
ref|XP_006364024.1|  PREDICTED: uncharacterized protein LOC102585...  68.2    6e-09   
ref|XP_006364023.1|  PREDICTED: uncharacterized protein LOC102585...  68.2    7e-09   
ref|XP_007011252.1|  RING/U-box and TRAF-like domains                 67.8    9e-09   
ref|XP_011002800.1|  PREDICTED: uncharacterized protein LOC105109...  67.4    1e-08   
ref|XP_011002799.1|  PREDICTED: uncharacterized protein LOC105109...  67.4    1e-08   
ref|XP_002305192.1|  hypothetical protein POPTR_0004s09080g           67.0    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011002798.1|  PREDICTED: uncharacterized protein LOC105109...  67.0    1e-08   
ref|XP_011002802.1|  PREDICTED: uncharacterized protein LOC105109...  67.0    2e-08   
ref|XP_011002801.1|  PREDICTED: uncharacterized protein LOC105109...  67.0    2e-08   
ref|XP_010660351.1|  PREDICTED: uncharacterized protein LOC100263...  66.2    3e-08   
ref|XP_010660346.1|  PREDICTED: uncharacterized protein LOC100263...  66.2    3e-08   
ref|XP_010660347.1|  PREDICTED: uncharacterized protein LOC100263...  66.2    3e-08   
emb|CBI33564.3|  unnamed protein product                              66.2    3e-08   
emb|CAN72428.1|  hypothetical protein VITISV_032233                   66.2    3e-08   Vitis vinifera
gb|KDP22662.1|  hypothetical protein JCGZ_02504                       64.7    1e-07   
ref|XP_011097137.1|  PREDICTED: uncharacterized protein LOC105176...  64.3    1e-07   
ref|XP_011097136.1|  PREDICTED: uncharacterized protein LOC105176...  64.3    1e-07   
gb|KHG25342.1|  hypothetical protein F383_32011                       63.5    2e-07   
ref|XP_010672819.1|  PREDICTED: protein PRRC2C-like                   63.2    4e-07   
ref|XP_008365752.1|  PREDICTED: uncharacterized protein LOC103429377  62.8    4e-07   
ref|XP_002532643.1|  conserved hypothetical protein                   62.0    5e-07   Ricinus communis
ref|XP_007215313.1|  hypothetical protein PRUPE_ppa003531mg           62.0    7e-07   
ref|XP_008229334.1|  PREDICTED: uncharacterized protein LOC103328702  61.6    8e-07   
emb|CDP18389.1|  unnamed protein product                              60.1    1e-06   
gb|EYU41323.1|  hypothetical protein MIMGU_mgv1a003049mg              61.2    1e-06   
ref|XP_010528520.1|  PREDICTED: uncharacterized protein LOC104805598  59.7    3e-06   
ref|XP_006430659.1|  hypothetical protein CICLE_v10011294mg           59.7    3e-06   
ref|XP_006482158.1|  PREDICTED: uncharacterized protein LOC102612380  59.7    3e-06   
gb|KDO63134.1|  hypothetical protein CISIN_1g043878mg                 59.3    4e-06   
ref|XP_010108937.1|  E3 ubiquitin-protein ligase SINA-like 2          59.3    5e-06   
ref|XP_006475687.1|  PREDICTED: uncharacterized protein LOC102608...  57.4    2e-05   
ref|XP_006475685.1|  PREDICTED: uncharacterized protein LOC102608...  57.4    2e-05   
ref|XP_006475682.1|  PREDICTED: uncharacterized protein LOC102608...  57.4    2e-05   
ref|XP_006475686.1|  PREDICTED: uncharacterized protein LOC102608...  57.4    2e-05   
gb|EPS61547.1|  hypothetical protein M569_13248                       57.0    2e-05   
gb|KDO62590.1|  hypothetical protein CISIN_1g039418mg                 56.2    2e-05   
ref|XP_010685734.1|  PREDICTED: uncharacterized protein LOC104900...  56.6    3e-05   
ref|XP_010685733.1|  PREDICTED: uncharacterized protein LOC104900...  56.6    3e-05   
ref|XP_010666722.1|  PREDICTED: uncharacterized protein LOC104883856  56.6    3e-05   
ref|XP_010646728.1|  PREDICTED: uncharacterized protein LOC104878295  54.3    4e-05   
gb|KDO38048.1|  hypothetical protein CISIN_1g014153mg                 55.5    5e-05   
ref|XP_004290281.1|  PREDICTED: uncharacterized protein LOC101292173  55.5    5e-05   
gb|KDO38049.1|  hypothetical protein CISIN_1g014153mg                 55.5    5e-05   
gb|KDO38047.1|  hypothetical protein CISIN_1g014153mg                 55.5    5e-05   
ref|XP_006471093.1|  PREDICTED: uncharacterized protein LOC102613922  55.1    8e-05   
gb|KDO50609.1|  hypothetical protein CISIN_1g036480mg                 53.9    1e-04   
ref|XP_010659348.1|  PREDICTED: uncharacterized protein LOC104881311  53.5    1e-04   
ref|XP_010646966.1|  PREDICTED: uncharacterized protein LOC104878391  54.3    2e-04   
ref|XP_010645203.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    3e-04   
ref|XP_010665511.1|  PREDICTED: uncharacterized protein LOC104882809  52.8    3e-04   
gb|EMT33355.1|  hypothetical protein F775_01902                       51.2    4e-04   
emb|CAN61901.1|  hypothetical protein VITISV_029815                   52.8    5e-04   Vitis vinifera
ref|XP_004983646.1|  PREDICTED: uncharacterized protein LOC101776...  52.8    5e-04   
ref|XP_010644061.1|  PREDICTED: uncharacterized protein LOC104877474  52.4    6e-04   



>ref|XP_010677176.1| PREDICTED: uncharacterized protein LOC104892855 [Beta vulgaris 
subsp. vulgaris]
Length=833

 Score = 90.5 bits (223),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 77/133 (58%), Gaps = 1/133 (1%)
 Frame = -1

Query  1248  LSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHMEEEEFFLGNDDVHS  1069
             +S EQ QAV+D+GFG  L       + +L  +L+E FD    ++++ +E+  +  +DV  
Sbjct  1     MSFEQRQAVKDIGFGVFLELGFGVLNNKLSLWLIENFDPYSRTLYVRDEKITIDREDVQV  60

Query  1068  TLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQMLNGII*GRDHGDMF  889
             TLG+P G + V EA     + +++ L   WR  WG++ G P T++M   I+     GD F
Sbjct  61    TLGLPMGPKVVKEAMKDDDNDEFRILFEQWRSIWGLEKGCPKTTKMPERIL-TLGAGDDF  119

Query  888   KRDFIIYIVSTLI  850
             KR F++++VS+ +
Sbjct  120   KRSFVVFVVSSCL  132



>gb|KHN37849.1| E3 ubiquitin-protein ligase SINA-like 10 [Glycine soja]
Length=613

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+PEQ +AV+ MGFGSLL     +    L  +LLERFD   CS+
Sbjct  118   LVTRCSPGRLFKVLQRLTPEQKEAVKSMGFGSLLGLRCRTLRRSLCLWLLERFDTTNCSL  177

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +   +  L  +DV   LG+    +     EV +  P+   +++  R  +        + 
Sbjct  178   EICNVDVPLTPNDVEMVLGLSASGK-----EVVNSGPE--DMISDLRNSYNA-INHGISV  229

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + GD FKR F++Y++ TL+
Sbjct  230   RLLEEQLATAESGDDFKRSFVLYVLGTLL  258



>ref|XP_006589372.1| PREDICTED: uncharacterized protein LOC100782920 [Glycine max]
Length=601

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+PEQ +AV+ MGFGSLL     +    L  +LLERFD   CS+
Sbjct  106   LVTRCSPGRLFKVLQRLTPEQKEAVKSMGFGSLLGLRCRTLRRSLCLWLLERFDTTNCSL  165

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +   +  L  +DV   LG+    +     EV +  P+   +++  R  +        + 
Sbjct  166   EICNVDVPLTPNDVEMVLGLSASGK-----EVVNSGPE--DMISDLRNSYNA-INHGISV  217

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + GD FKR F++Y++ TL+
Sbjct  218   RLLEEQLATAESGDDFKRSFVLYVLGTLL  246



>ref|XP_010278752.1| PREDICTED: uncharacterized protein LOC104612845 isoform X7 [Nelumbo 
nucifera]
 ref|XP_010278753.1| PREDICTED: uncharacterized protein LOC104612845 isoform X7 [Nelumbo 
nucifera]
Length=465

 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  117   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  176

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  177   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  236

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  237   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  268



>ref|XP_010278751.1| PREDICTED: uncharacterized protein LOC104612845 isoform X6 [Nelumbo 
nucifera]
Length=502

 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  154   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  213

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  214   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  273

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  274   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  305



>ref|XP_010278750.1| PREDICTED: uncharacterized protein LOC104612845 isoform X5 [Nelumbo 
nucifera]
Length=505

 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  157   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  216

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  217   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  276

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  277   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  308



>ref|XP_010278749.1| PREDICTED: uncharacterized protein LOC104612845 isoform X4 [Nelumbo 
nucifera]
Length=514

 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  166   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  225

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  226   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  285

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  286   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  317



>ref|XP_010278748.1| PREDICTED: uncharacterized protein LOC104612845 isoform X3 [Nelumbo 
nucifera]
Length=522

 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  174   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  233

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  234   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  293

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  294   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  325



>ref|XP_010278747.1| PREDICTED: uncharacterized protein LOC104612845 isoform X2 [Nelumbo 
nucifera]
Length=544

 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  196   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  255

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  256   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  315

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  316   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  347



>ref|XP_010278746.1| PREDICTED: uncharacterized protein LOC104612845 isoform X1 [Nelumbo 
nucifera]
Length=547

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 77/152 (51%), Gaps = 1/152 (1%)
 Frame = -1

Query  1302  DYLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + L  R SP +  +++  L+ EQ  AV ++GFGSLL     +    L ++LLERFD  RC
Sbjct  199   EILQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARC  258

Query  1122  SIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKT-GTP  946
              +H++ +  ++   DV   +G+P     V+ +       + +R  +   +  G  +  T 
Sbjct  259   CLHIDGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTG  318

Query  945   TTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +  +L   +  ++ GD FKR F ++ + T++
Sbjct  319   ISLGLLEKQLETQEAGDEFKRSFALFALGTIL  350



>ref|XP_009804894.1| PREDICTED: uncharacterized protein LOC104250057 isoform X2 [Nicotiana 
sylvestris]
Length=436

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q +AV+ MGFGS+L     +    L  +LLERF+  R S+
Sbjct  135   LVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWLLERFNTVRRSL  194

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+P   + V+ +           L+   R+++   T    + 
Sbjct  195   EICGERIPLTPRDVELVMGLPASGKDVVNS-------GSDELILELRKKYNA-TNRGISV  246

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y++ TL+
Sbjct  247   RLLEERLAAPEAGEDFKRSFVLYVMGTLV  275



>ref|XP_009804893.1| PREDICTED: uncharacterized protein LOC104250057 isoform X1 [Nicotiana 
sylvestris]
Length=639

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q +AV+ MGFGS+L     +    L  +LLERF+  R S+
Sbjct  135   LVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWLLERFNTVRRSL  194

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+P   + V+ +           L+   R+++   T    + 
Sbjct  195   EICGERIPLTPRDVELVMGLPASGKDVVNS-------GSDELILELRKKYNA-TNRGISV  246

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y++ TL+
Sbjct  247   RLLEERLAAPEAGEDFKRSFVLYVMGTLV  275



>ref|XP_004234633.1| PREDICTED: uncharacterized protein LOC101262187 [Solanum lycopersicum]
Length=637

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q +AV+ MGFGS+L     +    L  ++LERF+  R S+
Sbjct  135   LVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWILERFNTVRRSL  194

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+P   + V+ +           L+   R+R+   T    + 
Sbjct  195   EICGERIPLTPRDVELVMGLPASGKDVVNS-------GSDELILQLRKRYNA-TNRGISV  246

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y++ TL+
Sbjct  247   RLLEERLAAPEAGEDFKRSFVLYVMGTLL  275



>ref|XP_009587673.1| PREDICTED: uncharacterized protein LOC104085366, partial [Nicotiana 
tomentosiformis]
Length=598

 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q +AV+ MGFGS+L     +    L  +LLERF+  R S+
Sbjct  96    LVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWLLERFNTVRRSL  155

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+P   + V+ +           L+   R+++   T    + 
Sbjct  156   EICGERIPLTPRDVELVMGLPASGKDVVNS-------GSDELILELRKKYNA-TNRGISV  207

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y++ TL+
Sbjct  208   RLLEERLAAPEAGEDFKRSFVLYVMGTLV  236



>ref|XP_006364024.1| PREDICTED: uncharacterized protein LOC102585691 isoform X2 [Solanum 
tuberosum]
Length=602

 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q +AV+ MGFG++L     +    L  +LLERF+  R S+
Sbjct  114   LVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGNILGLRCRTLRRSLCLWLLERFNTVRRSL  173

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+P   + V+ +           L+   R+R+   T    + 
Sbjct  174   EICGERIPLTPRDVELVMGLPASGKDVVNS-------GSDELILQLRKRYNA-TNRGISV  225

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y++ TL+
Sbjct  226   RLLEERLAAPEAGEDFKRSFVLYVMGTLL  254



>ref|XP_006364023.1| PREDICTED: uncharacterized protein LOC102585691 isoform X1 [Solanum 
tuberosum]
Length=616

 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q +AV+ MGFG++L     +    L  +LLERF+  R S+
Sbjct  114   LVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGNILGLRCRTLRRSLCLWLLERFNTVRRSL  173

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+P   + V+ +           L+   R+R+   T    + 
Sbjct  174   EICGERIPLTPRDVELVMGLPASGKDVVNS-------GSDELILQLRKRYNA-TNRGISV  225

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y++ TL+
Sbjct  226   RLLEERLAAPEAGEDFKRSFVLYVMGTLL  254



>ref|XP_007011252.1| RING/U-box and TRAF-like domains [Theobroma cacao]
 gb|EOY20062.1| RING/U-box and TRAF-like domains [Theobroma cacao]
Length=639

 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 74/149 (50%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+PEQ  AV+ MGFGSLL     +    L  +LLERF+  R S+
Sbjct  129   LVTRCSPGRLFNVLQRLTPEQKAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTVRHSL  188

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+          +V +  P    L+A  R+ +   T    + 
Sbjct  189   EICGERIPLSPRDVEHVMGL-----AACGKDVVNSGPD--DLIADLRQSYNA-TNRGISV  240

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR FI+Y + TL+
Sbjct  241   RLLEEWLAAPEAGEDFKRSFILYALGTLL  269



>ref|XP_011002800.1| PREDICTED: uncharacterized protein LOC105109714 isoform X3 [Populus 
euphratica]
Length=625

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  LSPEQ+ AV+ MGFGSLL     +    L  +LLERF+   CS+
Sbjct  129   LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSL  188

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   LG+    + VI +           L+   R  +   T    + 
Sbjct  189   EICGVCIPLSPRDVEIVLGLAASGKDVINSGPDD-------LIVDLRRSYNA-TNHGISV  240

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  241   RLLEERLTAPEAGEDFKRSFVLYALGTLL  269



>ref|XP_011002799.1| PREDICTED: uncharacterized protein LOC105109714 isoform X2 [Populus 
euphratica]
Length=627

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  LSPEQ+ AV+ MGFGSLL     +    L  +LLERF+   CS+
Sbjct  118   LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSL  177

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   LG+    + VI +           L+   R  +   T    + 
Sbjct  178   EICGVCIPLSPRDVEIVLGLAASGKDVINSGPDD-------LIVDLRRSYNA-TNHGISV  229

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  230   RLLEERLTAPEAGEDFKRSFVLYALGTLL  258



>ref|XP_002305192.1| hypothetical protein POPTR_0004s09080g [Populus trichocarpa]
 gb|EEE85703.1| hypothetical protein POPTR_0004s09080g [Populus trichocarpa]
Length=628

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  LSPEQ+ AV+ MGFGSLL     +    L  +LLERF+   CS+
Sbjct  118   LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSL  177

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   LG+    + VI +           L+   R  +   T    + 
Sbjct  178   EICGMCIPLSPRDVEIVLGLAASGKDVINSGPDD-------LIVDLRRSYNA-TNHGISV  229

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  230   RLLEERLTAPEAGEDFKRSFVLYALGTLL  258



>ref|XP_011002798.1| PREDICTED: uncharacterized protein LOC105109714 isoform X1 [Populus 
euphratica]
Length=638

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  LSPEQ+ AV+ MGFGSLL     +    L  +LLERF+   CS+
Sbjct  129   LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSL  188

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   LG+    + VI +           L+   R  +   T    + 
Sbjct  189   EICGVCIPLSPRDVEIVLGLAASGKDVINSGPDD-------LIVDLRRSYNA-TNHGISV  240

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  241   RLLEERLTAPEAGEDFKRSFVLYALGTLL  269



>ref|XP_011002802.1| PREDICTED: uncharacterized protein LOC105109714 isoform X5 [Populus 
euphratica]
Length=546

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 73/149 (49%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  LSPEQ+ AV+ MGFGSLL     +    L  +LLERF+   CS+
Sbjct  37    LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSL  96

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   LG+    + VI +      P    +V L R       G   + 
Sbjct  97    EICGVCIPLSPRDVEIVLGLAASGKDVINS-----GPD-DLIVDLRRSYNATNHG--ISV  148

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  149   RLLEERLTAPEAGEDFKRSFVLYALGTLL  177



>ref|XP_011002801.1| PREDICTED: uncharacterized protein LOC105109714 isoform X4 [Populus 
euphratica]
Length=621

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  LSPEQ+ AV+ MGFGSLL     +    L  +LLERF+   CS+
Sbjct  112   LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSL  171

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   LG+    + VI +           L+   R  +   T    + 
Sbjct  172   EICGVCIPLSPRDVEIVLGLAASGKDVINSGPDD-------LIVDLRRSYNA-TNHGISV  223

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  224   RLLEERLTAPEAGEDFKRSFVLYALGTLL  252



>ref|XP_010660351.1| PREDICTED: uncharacterized protein LOC100263780 isoform X3 [Vitis 
vinifera]
Length=630

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+P+Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  113   LVTRCSPGRLFNVLQRLTPDQKAAVRSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSL  172

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+   R  +   T    + 
Sbjct  173   EICGERIPLSPKDVELVMGLAASGKDVVNSGPDD-------LIVELRNSYNA-TNHGISV  224

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR FI+Y + T++
Sbjct  225   RLLEERLAAPEAGEEFKRSFILYALGTVL  253



>ref|XP_010660346.1| PREDICTED: uncharacterized protein LOC100263780 isoform X1 [Vitis 
vinifera]
Length=637

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+P+Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  120   LVTRCSPGRLFNVLQRLTPDQKAAVRSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSL  179

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+   R  +   T    + 
Sbjct  180   EICGERIPLSPKDVELVMGLAASGKDVVNSGPDD-------LIVELRNSYNA-TNHGISV  231

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR FI+Y + T++
Sbjct  232   RLLEERLAAPEAGEEFKRSFILYALGTVL  260



>ref|XP_010660347.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660348.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660349.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660350.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
Length=635

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+P+Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  118   LVTRCSPGRLFNVLQRLTPDQKAAVRSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSL  177

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+   R  +   T    + 
Sbjct  178   EICGERIPLSPKDVELVMGLAASGKDVVNSGPDD-------LIVELRNSYNA-TNHGISV  229

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR FI+Y + T++
Sbjct  230   RLLEERLAAPEAGEEFKRSFILYALGTVL  258



>emb|CBI33564.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+P+Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  238   LVTRCSPGRLFNVLQRLTPDQKAAVRSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSL  297

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+   R  +   T    + 
Sbjct  298   EICGERIPLSPKDVELVMGLAASGKDVVNSGPDD-------LIVELRNSYNA-TNHGISV  349

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR FI+Y + T++
Sbjct  350   RLLEERLAAPEAGEEFKRSFILYALGTVL  378



>emb|CAN72428.1| hypothetical protein VITISV_032233 [Vitis vinifera]
Length=708

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+P+Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  154   LVTRCSPGRLFNVLQRLTPDQKAAVRSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSL  213

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+   R  +   T    + 
Sbjct  214   EICGERIPLSPKDVELVMGLAASGKDVVNSGPDD-------LIVELRNSYNA-TNHGISV  265

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR FI+Y + T++
Sbjct  266   RLLEERLAAPEAGEEFKRSFILYALGTVL  294



>gb|KDP22662.1| hypothetical protein JCGZ_02504 [Jatropha curcas]
Length=609

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++ SL+ EQ +AV+ MGFGSLL     +    L  +LL+RF+    S+
Sbjct  114   LVTRCSPGRLFNVLQSLTSEQKEAVKSMGFGSLLGLRCRTLRRSLCLWLLQRFNTTGRSL  173

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +   S D     L+A  R+ +   T    + 
Sbjct  174   DICGERIPLSPKDVEFVIGLTASGKDVVNS--GSDD-----LIADLRQSYNA-TNRGISV  225

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  226   RLLEERLKATEAGEEFKRSFVLYALGTLL  254



>ref|XP_011097137.1| PREDICTED: uncharacterized protein LOC105176128 isoform X2 [Sesamum 
indicum]
Length=609

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q  AV+ MGFGS+L+    +    L  +LLE+F+  R S+
Sbjct  106   LVTRCSPGRLLNVLQRLTPDQKAAVKSMGFGSILNLRCRTLRRSLCLWLLEKFNTVRRSL  165

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +      P    L++  R+++   T    + 
Sbjct  166   EICGERIPLTPRDVELVMGLASNGKDVVNS-----GPD--ELISELRKKYNA-TNRGISV  217

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + GD FKR F++Y++ TL+
Sbjct  218   RLLEERLAFPEAGDDFKRSFLLYVLGTLL  246



>ref|XP_011097136.1| PREDICTED: uncharacterized protein LOC105176128 isoform X1 [Sesamum 
indicum]
Length=613

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 77/149 (52%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q  AV+ MGFGS+L+    +    L  +LLE+F+  R S+
Sbjct  106   LVTRCSPGRLLNVLQRLTPDQKAAVKSMGFGSILNLRCRTLRRSLCLWLLEKFNTVRRSL  165

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +      P    L++  R+++   T    + 
Sbjct  166   EICGERIPLTPRDVELVMGLASNGKDVVNS-----GPD--ELISELRKKYNA-TNRGISV  217

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + GD FKR F++Y++ TL+
Sbjct  218   RLLEERLAFPEAGDDFKRSFLLYVLGTLL  246



>gb|KHG25342.1| hypothetical protein F383_32011 [Gossypium arboreum]
Length=641

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 75/150 (50%), Gaps = 10/150 (7%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ EQ  AV+ MGFGSLL     +    L  +LLERF+  R S+
Sbjct  131   LVTRCSPGRLFNVLQRLTSEQKDAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSL  190

Query  1116  HMEEEEFFLGNDDVHSTLGI-PRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTT  940
              +  E   L   DV   +G+  RG+      +V +  P    L+A  R  +   T    +
Sbjct  191   EICGERIPLSPRDVEHVMGLAARGK------DVVNSGPD--DLIADLRYIYNA-TNRGIS  241

Query  939   SQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              ++L   +   + G+ FKR FI+Y + TL+
Sbjct  242   VRLLEERLAAPEAGEDFKRSFILYALGTLL  271



>ref|XP_010672819.1| PREDICTED: protein PRRC2C-like [Beta vulgaris subsp. vulgaris]
Length=767

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 74/154 (48%), Gaps = 5/154 (3%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLS--PEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRC  1123
             + VR S     A +++++  P++ QA+ DMGFG LL   +   D      LL R+ VG  
Sbjct  352   VKVRQSTAPFKAFLAAIANQPQKRQAIIDMGFGGLLELDMPKNDPIFCARLLSRYSVGSG  411

Query  1122  SIHMEE-EEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTP  946
             S+ +    E  + + DVH   GIP G   V + +       Y+ ++  WRE  GV+ G+P
Sbjct  412   SLMLRRGREIEIRDIDVHLVYGIPLGGLLVDDNKDNDAA-DYRLMLEEWREYVGVQRGSP  470

Query  945   TTSQMLNGII*GR-DHGDMFKRDFIIYIVSTLIR  847
               S M   +        D +KR F++  V+  I+
Sbjct  471   YVSTMATHLADAAVPVTDNWKRTFLVVAVNCCIK  504



>ref|XP_008365752.1| PREDICTED: uncharacterized protein LOC103429377 [Malus domestica]
Length=616

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 74/149 (50%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ EQ  AV+ MGFGSLL     +    L  +LLERF+  R S+
Sbjct  118   LVTRCSPGRLFNVIQRLTNEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFNTTRXSL  177

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   +   +V   +G+    + V+ +   S D     L+A  R  +   T    + 
Sbjct  178   EICGERIPITPKBVELVMGLAASGKDVVNS--GSDD-----LIADLRHXYDA-TNHGISV  229

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  230   RLLEERLAZPEAGEEFKRSFVLYALGTLL  258



>ref|XP_002532643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29746.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+PEQ  AV+D+GFGSLL     +    L  +LL+RF+    S+
Sbjct  112   LVTRCSPGRLFNVLQRLTPEQKDAVKDLGFGSLLGLRCRTLRRSLCLWLLQRFNTTGRSL  171

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  +   L   DV   +G+    + V+ +   +       L+   R  +   T    + 
Sbjct  172   EICGDRIPLSPKDVEFVMGLAASGKDVVNSGPDN-------LILDLRRNYNA-TNRGISV  223

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              +L   +   + G+ FKR F++Y + TL+
Sbjct  224   SLLEERLKAPEAGEEFKRSFVLYALGTLL  252



>ref|XP_007215313.1| hypothetical protein PRUPE_ppa003531mg [Prunus persica]
 gb|EMJ16512.1| hypothetical protein PRUPE_ppa003531mg [Prunus persica]
Length=567

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 73/149 (49%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ EQ  AV+ MGFGSLL     +    L  +LLERFD  + S+
Sbjct  114   LVTRCSPGRLFNVIQRLTTEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFDTTQRSL  173

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +      P    L+A  R  +   T    + 
Sbjct  174   EICGERIPLTPKDVELVMGLAASGKDVVNS-----GPD--DLIADLRHSYDA-TNHGISV  225

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  226   RLLEERLAEPEAGEEFKRSFVLYALGTLL  254



>ref|XP_008229334.1| PREDICTED: uncharacterized protein LOC103328702 [Prunus mume]
Length=621

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ EQ  AV+ MGFGSLL     +    L  +LLERFD  + S+
Sbjct  113   LVTRCSPGRLFNVIQRLTTEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFDTTQRSL  172

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+A  R  +   T    + 
Sbjct  173   EICGERIPLTPKDVELVMGLAASGKDVVNSGPDD-------LIADLRHSYDA-TNHGISV  224

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  225   RLLEERLAEPEAGEEFKRSFVLYALGTLL  253



>emb|CDP18389.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 75/150 (50%), Gaps = 14/150 (9%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             +++R+SP QL  LVS L   + +A+R++GFG LL     S    LL +L++ F+  +C I
Sbjct  122   ITIRSSPCQLLKLVSKLDDIKKEAIREIGFGGLLEIQCHSMPSCLLTWLIQHFNPTQCHI  181

Query  1116  HMEEEEFF-LGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTT  940
              ++  +   +   DV  TLGIP       E E  S++   +  +   R +W         
Sbjct  182   QLDGGQILQVTAHDVEITLGIPGNGPIPKEDEDASEE---EVDIIPRRYKW---------  229

Query  939   SQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
               +L  +I   + G+ FK+ F+I++   L+
Sbjct  230   IDLLEELI-SMESGEEFKKKFVIFVCGCLL  258



>gb|EYU41323.1| hypothetical protein MIMGU_mgv1a003049mg [Erythranthe guttata]
Length=612

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+P+Q  AV+ MGFGS+L+    +    L  +LLE+F+  R S+
Sbjct  104   LVTRCSPGRLLNVLQRLTPDQRDAVKSMGFGSILNLKCRTLRRSLCLWLLEKFNTVRRSL  163

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +      P    L+A  R+ +   T    + 
Sbjct  164   EICGERIPLTARDVELVMGLSSSGKDVVNS-----GPD--ELIAELRKNYNA-TNRGISV  215

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ F+R F++Y++ TL+
Sbjct  216   RLLEERLAVPEAGEDFQRSFLLYVLGTLL  244



>ref|XP_010528520.1| PREDICTED: uncharacterized protein LOC104805598 [Tarenaya hassleriana]
Length=499

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 69/149 (46%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  ++  L+ EQ +AV++MGFG LL     +    L  +LLERFD  +C +
Sbjct  37    LVTRCSPGRLLNVIQRLTSEQKEAVKNMGFGGLLDLRCRTLRRSLCLWLLERFDTRKCCL  96

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   +G+    + VI +           +++  R  +   T    + 
Sbjct  97    KICGHCIPLHPKDVEHVMGLASDGKEVINSGPGD-------VISDLRLSYNA-TNHGISV  148

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
               L   +   + G+ FKR FI+Y + TLI
Sbjct  149   HNLEEKLLIPEAGEDFKRSFILYALGTLI  177



>ref|XP_006430659.1| hypothetical protein CICLE_v10011294mg [Citrus clementina]
 gb|ESR43899.1| hypothetical protein CICLE_v10011294mg [Citrus clementina]
Length=623

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ +Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  113   LVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRCRTLRRSLCLWLLERFNTTRRSL  172

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+    + V+ +           L+A  R  +   T    + 
Sbjct  173   DICGECIPLSPRDVEFVMGLAACGKDVVNSGPDD-------LIANLRHSYNA-TNHGISV  224

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  225   RLLEERLAVPEAGEDFKRSFVLYALGTLL  253



>ref|XP_006482158.1| PREDICTED: uncharacterized protein LOC102612380 [Citrus sinensis]
Length=620

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ +Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  113   LVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRCRTLRRSLCLWLLERFNTTRRSL  172

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+          +V +  P    L+A  R  +   T    + 
Sbjct  173   DICGECIPLSPRDVEFVMGL-----AACGKDVVNSGPD--DLIANLRHSYNA-TNHGISV  224

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  225   RLLEERLAVPEAGEDFKRSFVLYALGTLL  253



>gb|KDO63134.1| hypothetical protein CISIN_1g043878mg, partial [Citrus sinensis]
Length=648

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ +Q  AVR MGFGSLL     +    L  +LLERF+  R S+
Sbjct  112   LVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRCRTLRRSLCLWLLERFNTTRRSL  171

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+          +V +  P    L+A  R  +   T    + 
Sbjct  172   DICGECIPLSPRDVEFVMGL-----AACGKDVVNSGPD--DLIANLRHSYNA-TNHGISV  223

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ FKR F++Y + TL+
Sbjct  224   RLLEERLAVPEAGEDFKRSFVLYALGTLL  252



>ref|XP_010108937.1| E3 ubiquitin-protein ligase SINA-like 2 [Morus notabilis]
 gb|EXC20577.1| E3 ubiquitin-protein ligase SINA-like 2 [Morus notabilis]
Length=703

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 71/149 (48%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L+ ++  L+ EQ  AV+ MGFGSLL     +    L  +LLERF+  + S+
Sbjct  196   LVTRCSPGRLFNVLQHLTAEQKDAVKIMGFGSLLGLRCRTLRRSLCLWLLERFNTMQRSL  255

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +      L   DV   +G+    + V+ +           L+A  R  +   T    + 
Sbjct  256   EICGGHIHLYPKDVELVMGLAASGKDVVNSGPDD-------LIADLRNNYNA-TNRGISV  307

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + GD FKR F++Y + TL+
Sbjct  308   RLLEERLSAPEAGDDFKRSFVLYALGTLL  336



>ref|XP_006475687.1| PREDICTED: uncharacterized protein LOC102608522 isoform X6 [Citrus 
sinensis]
Length=603

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 7/147 (5%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
              R +P +L ALVS L+ +Q +AV D+G GS++         +L  +L+ER D  RC + +
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
                E  L  +     +G+  G    +E +  S +      VA + +++   +       M
Sbjct  161   NGHELELSPNSFGYIMGVTDGGMP-MELQGDSAE------VAAYLDKFNATSRGINIKTM  213

Query  930   LNGII*GRDHGDMFKRDFIIYIVSTLI  850
              + ++  +D  + FK  F+++ + TL+
Sbjct  214   EDILLTSKDADNDFKVAFMLFTLCTLL  240



>ref|XP_006475685.1| PREDICTED: uncharacterized protein LOC102608522 isoform X4 [Citrus 
sinensis]
Length=647

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 7/147 (5%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
              R +P +L ALVS L+ +Q +AV D+G GS++         +L  +L+ER D  RC + +
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
                E  L  +     +G+  G    +E +  S +      VA + +++   +       M
Sbjct  161   NGHELELSPNSFGYIMGVTDGGMP-MELQGDSAE------VAAYLDKFNATSRGINIKTM  213

Query  930   LNGII*GRDHGDMFKRDFIIYIVSTLI  850
              + ++  +D  + FK  F+++ + TL+
Sbjct  214   EDILLTSKDADNDFKVAFMLFTLCTLL  240



>ref|XP_006475682.1| PREDICTED: uncharacterized protein LOC102608522 isoform X1 [Citrus 
sinensis]
 ref|XP_006475683.1| PREDICTED: uncharacterized protein LOC102608522 isoform X2 [Citrus 
sinensis]
 ref|XP_006475684.1| PREDICTED: uncharacterized protein LOC102608522 isoform X3 [Citrus 
sinensis]
Length=649

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 7/147 (5%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
              R +P +L ALVS L+ +Q +AV D+G GS++         +L  +L+ER D  RC + +
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
                E  L  +     +G+  G    +E +  S +      VA + +++   +       M
Sbjct  161   NGHELELSPNSFGYIMGVTDGGMP-MELQGDSAE------VAAYLDKFNATSRGINIKTM  213

Query  930   LNGII*GRDHGDMFKRDFIIYIVSTLI  850
              + ++  +D  + FK  F+++ + TL+
Sbjct  214   EDILLTSKDADNDFKVAFMLFTLCTLL  240



>ref|XP_006475686.1| PREDICTED: uncharacterized protein LOC102608522 isoform X5 [Citrus 
sinensis]
Length=642

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 7/147 (5%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
              R +P +L ALVS L+ +Q +AV D+G GS++         +L  +L+ER D  RC + +
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
                E  L  +     +G+  G    +E +  S +      VA + +++   +       M
Sbjct  161   NGHELELSPNSFGYIMGVTDGGMP-MELQGDSAE------VAAYLDKFNATSRGINIKTM  213

Query  930   LNGII*GRDHGDMFKRDFIIYIVSTLI  850
              + ++  +D  + FK  F+++ + TL+
Sbjct  214   EDILLTSKDADNDFKVAFMLFTLCTLL  240



>gb|EPS61547.1| hypothetical protein M569_13248, partial [Genlisea aurea]
Length=414

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 76/149 (51%), Gaps = 8/149 (5%)
 Frame = -1

Query  1296  LSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSI  1117
             L  R SP +L  L+  L+ +Q  AV++MGFGS+L+    +    L  +LLE+F+  R ++
Sbjct  107   LVTRCSPGRLLNLLQRLTADQKAAVKNMGFGSILNLRCRTLRRSLCLFLLEKFNTVRRTL  166

Query  1116  HMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS  937
              +  E   L   DV   +G+     +    +V +  P     +A  R+++   T    + 
Sbjct  167   ELCGERIPLTPRDVELVMGL-----SCSGKDVVNSGPD--EAIAELRKKYNA-TNHGISV  218

Query  936   QMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
             ++L   +   + G+ F+R F++Y++ TL+
Sbjct  219   RLLEERLAIPESGEDFRRSFLLYVLGTLL  247



>gb|KDO62590.1| hypothetical protein CISIN_1g039418mg [Citrus sinensis]
Length=297

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 70/147 (48%), Gaps = 7/147 (5%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
              R +P +L ALVS L  +Q +AV D+G GS++         +L  +L+ER D  RC + +
Sbjct  101   TRCAPDRLAALVSHLIEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
                E  L  +     +G+  G    +E +  S +      VA + +++   +       M
Sbjct  161   NGHELELSPNSFGYIMGVTDGGMP-MELQGDSAE------VAAYLDKFNATSRGINIKTM  213

Query  930   LNGII*GRDHGDMFKRDFIIYIVSTLI  850
              + ++  +D  + FK  F+++ + TL+
Sbjct  214   EDILLTSKDADNDFKVAFMLFTLCTLL  240



>ref|XP_010685734.1| PREDICTED: uncharacterized protein LOC104900092 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=549

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 68/153 (44%), Gaps = 13/153 (8%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
             VR  P  L  L   LS +Q  AV  +GFGSL    L  +  +++R L   F      + +
Sbjct  146   VRCRPAALINLFKKLSTQQKDAVCSIGFGSLFELKLEEFPRDMIRMLCRNFCPKDKVLMI  205

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTG--TPTTS  937
                   L   DV    GIP G+    +  ++ +D   K L   W E +   +G  TP + 
Sbjct  206   GNHRVQLKPADVADVFGIPMGK---FKIPISKRDDDTK-LKNFWLENYAHSSGIVTPASM  261

Query  936   QML----NGII*GRDHGDMFKRDFIIYIVSTLI  850
             +ML    +  + G D    FKR F+++ + TL+
Sbjct  262   RMLMEMDDDFLSGNDD---FKRCFVMFAIITLL  291



>ref|XP_010685733.1| PREDICTED: uncharacterized protein LOC104900092 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=564

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 68/153 (44%), Gaps = 13/153 (8%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
             VR  P  L  L   LS +Q  AV  +GFGSL    L  +  +++R L   F      + +
Sbjct  161   VRCRPAALINLFKKLSTQQKDAVCSIGFGSLFELKLEEFPRDMIRMLCRNFCPKDKVLMI  220

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTG--TPTTS  937
                   L   DV    GIP G+    +  ++ +D   K L   W E +   +G  TP + 
Sbjct  221   GNHRVQLKPADVADVFGIPMGK---FKIPISKRDDDTK-LKNFWLENYAHSSGIVTPASM  276

Query  936   QML----NGII*GRDHGDMFKRDFIIYIVSTLI  850
             +ML    +  + G D    FKR F+++ + TL+
Sbjct  277   RMLMEMDDDFLSGNDD---FKRCFVMFAIITLL  306



>ref|XP_010666722.1| PREDICTED: uncharacterized protein LOC104883856 [Beta vulgaris 
subsp. vulgaris]
Length=601

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 68/153 (44%), Gaps = 13/153 (8%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
             VR  P  L  L   LS +Q  AV  +GFGSL    L  +  +++R L   F      + +
Sbjct  198   VRCRPAALINLFKKLSTQQKDAVCSIGFGSLFELKLEEFPRDMIRMLCRNFCPKDKVLMI  257

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTG--TPTTS  937
                   L   DV    GIP G+    +  ++ +D   K L   W E +   +G  TP + 
Sbjct  258   GNHRVQLKPADVADVFGIPMGK---FKIPISKRDDDTK-LKNFWLENYAHSSGIVTPASM  313

Query  936   QML----NGII*GRDHGDMFKRDFIIYIVSTLI  850
             +ML    +  + G D    FKR F+++ + TL+
Sbjct  314   RMLMEMDDDFLSGNDD---FKRCFVMFAIITLL  343



>ref|XP_010646728.1| PREDICTED: uncharacterized protein LOC104878295 [Vitis vinifera]
Length=224

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 71/151 (47%), Gaps = 9/151 (6%)
 Frame = -1

Query  1299  YLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCS  1120
             YL  R SP+++  ++ +L P+Q  A+ ++GFGSLL       D  L  +L+  F++    
Sbjct  22    YLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNLNTYM  81

Query  1119  IHMEEEEFFLGNDDVHSTLGI-PRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPT  943
             + +      L   DV   +G+  RG +  +  +V  K+   K        ++  K G   
Sbjct  82    LQLYNTCIKLSPIDVEFIMGLRARGFKIGMNKDVGHKNDLCK--------KYCDKKGRLP  133

Query  942   TSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
                + N I   ++ G+ FK  F+++++  L+
Sbjct  134   LVMLENQIREDKEGGNDFKVRFVLFVLGALL  164



>gb|KDO38048.1| hypothetical protein CISIN_1g014153mg [Citrus sinensis]
Length=329

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 70/152 (46%), Gaps = 19/152 (13%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R +P +L A V  L+ EQ   VR+MGFGSLL          L  +L+E+ D+ RC + + 
Sbjct  102   RCAPDRLAAAVLQLTDEQRVVVREMGFGSLLQLNCGRLKRNLCGWLVEKIDIARCILQLN  161

Query  1107  EEEFFLGNDDVHSTLGIPRGQQTV-IEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS--  937
               E  L        +GI  G + + +E E +S+   Y            V   TPT+   
Sbjct  162   GVEVELSPKSFSYVMGISDGGKPLQLEGE-SSEVCAY------------VDNFTPTSRGI  208

Query  936   --QMLNGII*G-RDHGDMFKRDFIIYIVSTLI  850
                +L GI+   +   D FK  F+++ + T++
Sbjct  209   NITVLAGILQKLKSADDQFKVTFMMFALCTIL  240



>ref|XP_004290281.1| PREDICTED: uncharacterized protein LOC101292173 [Fragaria vesca 
subsp. vesca]
Length=391

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 69/147 (47%), Gaps = 5/147 (3%)
 Frame = -1

Query  1290  VRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHM  1111
             +R  PK    +VS  S E+  AV +MGFG LL          L  +L++RFD  + SI +
Sbjct  37    LRCRPKLFKDVVSKFSVEKKVAVEEMGFGLLLKLQCEQLQLGLCGWLIDRFDPSKSSIEV  96

Query  1110  EEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
               + F LG  D  + +G+  G   V E   +  + Q  + +   R R  +       S+M
Sbjct  97    HGKRFNLGPTDFENIMGVKDGGHDV-EIRGSKAEIQELKNIHFGRSRHRI----SGMSKM  151

Query  930   LNGII*GRDHGDMFKRDFIIYIVSTLI  850
                +   ++  D F+  F+++ ++TL+
Sbjct  152   AEKLKEKKNVDDTFRVRFVLFALATLL  178



>gb|KDO38049.1| hypothetical protein CISIN_1g014153mg [Citrus sinensis]
Length=375

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 70/152 (46%), Gaps = 19/152 (13%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R +P +L A V  L+ EQ   VR+MGFGSLL          L  +L+E+ D+ RC + + 
Sbjct  47    RCAPDRLAAAVLQLTDEQRVVVREMGFGSLLQLNCGRLKRNLCGWLVEKIDIARCILQLN  106

Query  1107  EEEFFLGNDDVHSTLGIPRGQQTV-IEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS--  937
               E  L        +GI  G + + +E E +S+   Y            V   TPT+   
Sbjct  107   GVEVELSPKSFSYVMGISDGGKPLQLEGE-SSEVCAY------------VDNFTPTSRGI  153

Query  936   --QMLNGII*G-RDHGDMFKRDFIIYIVSTLI  850
                +L GI+   +   D FK  F+++ + T++
Sbjct  154   NITVLAGILQKLKSADDQFKVTFMMFALCTIL  185



>gb|KDO38047.1| hypothetical protein CISIN_1g014153mg [Citrus sinensis]
Length=346

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 70/152 (46%), Gaps = 19/152 (13%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R +P +L A V  L+ EQ   VR+MGFGSLL          L  +L+E+ D+ RC + + 
Sbjct  102   RCAPDRLAAAVLQLTDEQRVVVREMGFGSLLQLNCGRLKRNLCGWLVEKIDIARCILQLN  161

Query  1107  EEEFFLGNDDVHSTLGIPRGQQTV-IEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS--  937
               E  L        +GI  G + + +E E +S+   Y            V   TPT+   
Sbjct  162   GVEVELSPKSFSYVMGISDGGKPLQLEGE-SSEVCAY------------VDNFTPTSRGI  208

Query  936   --QMLNGII*G-RDHGDMFKRDFIIYIVSTLI  850
                +L GI+   +   D FK  F+++ + T++
Sbjct  209   NITVLAGILQKLKSADDQFKVTFMMFALCTIL  240



>ref|XP_006471093.1| PREDICTED: uncharacterized protein LOC102613922 [Citrus sinensis]
 gb|KDO38046.1| hypothetical protein CISIN_1g014153mg [Citrus sinensis]
Length=430

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 70/152 (46%), Gaps = 19/152 (13%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R +P +L A V  L+ EQ   VR+MGFGSLL          L  +L+E+ D+ RC + + 
Sbjct  102   RCAPDRLAAAVLQLTDEQRVVVREMGFGSLLQLNCGRLKRNLCGWLVEKIDIARCILQLN  161

Query  1107  EEEFFLGNDDVHSTLGIPRGQQTV-IEAEVTSKDPQYKRLVALWRERWGVKTGTPTTS--  937
               E  L        +GI  G + + +E E +S+   Y            V   TPT+   
Sbjct  162   GVEVELSPKSFSYVMGISDGGKPLQLEGE-SSEVCAY------------VDNFTPTSRGI  208

Query  936   --QMLNGII*G-RDHGDMFKRDFIIYIVSTLI  850
                +L GI+   +   D FK  F+++ + T++
Sbjct  209   NITVLAGILQKLKSADDQFKVTFMMFALCTIL  240



>gb|KDO50609.1| hypothetical protein CISIN_1g036480mg, partial [Citrus sinensis]
Length=290

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 19/152 (13%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R +P +L A VS L+ EQ   VR+M FGSLL          L  +L+E+ D+ RC + + 
Sbjct  48    RCAPDRLAAAVSQLTDEQRVVVREMDFGSLLQLNCGRLKRNLCGWLVEKIDIARCILQLN  107

Query  1107  EEEFFLGNDDVHSTLGIPRGQQTV-IEAEVTSKDPQYKRLVALWRERWGVKTGTPTTSQM  931
               +  L        +GI  G   + +E E +SK   Y            +   TPT+  +
Sbjct  108   GVDVELSPKSFSYVMGISDGGNPLQLEGE-SSKVSAY------------LDKFTPTSRGI  154

Query  930   ----LNGII*G-RDHGDMFKRDFIIYIVSTLI  850
                 L GI+   +   D FK  F+++ + T++
Sbjct  155   NIIVLAGILQKLKSANDQFKVTFMMFALCTIL  186



>ref|XP_010659348.1| PREDICTED: uncharacterized protein LOC104881311 [Vitis vinifera]
 ref|XP_010659349.1| PREDICTED: uncharacterized protein LOC104881311 [Vitis vinifera]
Length=247

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 70/151 (46%), Gaps = 9/151 (6%)
 Frame = -1

Query  1299  YLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCS  1120
             YL  R SP+++  ++ +L P+Q  A+ ++GFGSLL       D  L  +L+  F+     
Sbjct  85    YLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPNTYM  144

Query  1119  IHMEEEEFFLGNDDVHSTLGI-PRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPT  943
             + +      L   DV   +G+  RG +  +  +V  K+   K        ++  K G   
Sbjct  145   LQLYNTCIKLSPIDVEFIMGLRARGFKIGMNKDVGHKNDLCK--------KYCDKKGRLP  196

Query  942   TSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
                + N I   ++ G+ FK  F+++++  L+
Sbjct  197   LVMLENQIREDKEGGNDFKVRFVLFVLGALL  227



>ref|XP_010646966.1| PREDICTED: uncharacterized protein LOC104878391 [Vitis vinifera]
Length=998

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R S K+   +++ L+PE+ QA+R+MGFG LL+        EL  +L+ ++D     ++ME
Sbjct  325   RCSGKKFITVIARLAPEKQQAIREMGFGGLLTFACRELRYELCGWLISQYDFTYHRLNME  384

Query  1107  EEEFFLGNDD-VHSTLGIPR-GQQTVIEAEVTSKDPQY  1000
                    N++ V+  +GIP  G   VI    T  +  Y
Sbjct  385   TGNAITVNEEHVNKVMGIPNSGVDVVILKRTTPSNRTY  422



>ref|XP_010645203.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=283

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 69/151 (46%), Gaps = 9/151 (6%)
 Frame = -1

Query  1299  YLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCS  1120
             YL  R SP+++  ++  L P+Q  A+ ++GFGSLL       D  L  +L+  F+     
Sbjct  22    YLQTRCSPERVIRVIEKLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPNTYM  81

Query  1119  IHMEEEEFFLGNDDVHSTLGI-PRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPT  943
             + +      L   DV   +G+  RG +  +  +V  K+   K        ++  K G   
Sbjct  82    LQLYNTCIKLSPIDVEFIMGLRARGFKIGMNKDVGHKNDLCK--------KYCDKKGRLP  133

Query  942   TSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
                + N I   ++ G+ FK  F+++++  L+
Sbjct  134   LVMLENQIREDKEGGNDFKVRFVLFVLGALL  164



>ref|XP_010665511.1| PREDICTED: uncharacterized protein LOC104882809 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 72/150 (48%), Gaps = 11/150 (7%)
 Frame = -1

Query  1275  KQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME-EEE  1099
             K+L  L  + + EQ +A+ ++GFGSLL   ++  +  L  +L++ FD G     +   +E
Sbjct  107   KRLCELNEAFNSEQKKAITEIGFGSLLHLKITRTNNALSAWLVDMFDGGSGMFKVGYGKE  166

Query  1098  FFLGNDDVHSTLGIP--RGQQTVIEAEVTSKDPQYKRLVALWRERWGV-----KTGTPTT  940
             F +   DV+     P   GQ  V  +   + D  Y  L A WRE + V     + G    
Sbjct  167   FRVNQYDVYDVFQFPLVEGQDVVDVSRGPNADNPYFDLKASWREYFKVNREKGQIGLSAV  226

Query  939   SQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
                L  ++ G   G++FK+ ++++  S+ +
Sbjct  227   YYELKKLVNG---GEVFKKLYVLFAFSSFL  253



>gb|EMT33355.1| hypothetical protein F775_01902 [Aegilops tauschii]
Length=212

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 69/154 (45%), Gaps = 21/154 (14%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDV--------  1132
             R S + L  L    + EQ  A  +MG   L+     +    +  +L E +D+        
Sbjct  19    RASQEHLTVLTEGFTDEQKGAAGEMGMQDLMDVRCKNLVNPVCDWLGEIYDLASREFVIP  78

Query  1131  GRCSIHMEEEEFFLGNDDVHSTLGIPRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTG  952
             GR  + ++EE  F        TLG+PRG+  V   EV +K  +     AL+   +   T 
Sbjct  79    GRGRLPLDEESVF-------CTLGVPRGEIKV-PYEVNNKIEE-----ALFARLFPGMTS  125

Query  951   TPTTSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              P T+ + N +   + HG++FK   ++Y++S + 
Sbjct  126   MPNTTVLANSLEGMKTHGEVFKMKLLMYLISAIF  159



>emb|CAN61901.1| hypothetical protein VITISV_029815 [Vitis vinifera]
Length=634

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R S K+    ++ L+PE+ QA+R+MGFG LL+        EL  +L+ ++D     ++ME
Sbjct  25    RCSGKKFITAIARLAPEKXQAIREMGFGGLLTFACHELRYELCGWLISQYDFTYHRLNME  84

Query  1107  EEEFFLGNDD-VHSTLGIPR-GQQTVIEAEVTSKDPQY  1000
                    N++ V+  +GIP  G   VI    T  +  Y
Sbjct  85    TGNAITVNEEHVNKVMGIPNFGVDVVILKRTTPSNRTY  122



>ref|XP_004983646.1| PREDICTED: uncharacterized protein LOC101776344 isoform X1 [Setaria 
italica]
 ref|XP_004983647.1| PREDICTED: uncharacterized protein LOC101776344 isoform X2 [Setaria 
italica]
 ref|XP_004983648.1| PREDICTED: uncharacterized protein LOC101776344 isoform X3 [Setaria 
italica]
Length=581

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 15/151 (10%)
 Frame = -1

Query  1287  RTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCSIHME  1108
             R SP ++  L   L+P+Q + + D GFG LL     ++      +LL RFD   C + ++
Sbjct  26    RASPIRIVRLYPHLTPDQRKMIEDAGFGGLLKIGCPTFPLGFCGWLLRRFDTDYCELVIK  85

Query  1107  -EEEFFLGNDDVHSTLGIPRGQQTVI----EAEVTSKDPQYKRLVALWRERWGVKTGTPT  943
                   + +D VH  LGIP G   V     E  +     +       W          PT
Sbjct  86    GRGRIPVTSDSVHRVLGIPNGGGDVKYGLDEDAMAFMSDKLDASGKYW----------PT  135

Query  942   TSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
              S + N +   +   + F R F++ ++S+ +
Sbjct  136   VSSIENSLKQMKSADEHFLRTFMVLVISSFL  166



>ref|XP_010644061.1| PREDICTED: uncharacterized protein LOC104877474 [Vitis vinifera]
Length=401

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 70/151 (46%), Gaps = 9/151 (6%)
 Frame = -1

Query  1299  YLSVRTSPKQLYALVSSLSPEQHQAVRDMGFGSLLSATLSSYDGELLRYLLERFDVGRCS  1120
             YL  R SP+++  ++ +L P+Q  A+ ++GFGSLL       D  L  +L+  F+     
Sbjct  56    YLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPNTYM  115

Query  1119  IHMEEEEFFLGNDDVHSTLGI-PRGQQTVIEAEVTSKDPQYKRLVALWRERWGVKTGTPT  943
             + +      L   DV   +G+  RG +  +  +V  K+   K        ++  K G   
Sbjct  116   LQLYNTCIKLSPIDVEFIMGLRARGFKIGMNKDVGHKNDICK--------KYCDKKGRLP  167

Query  942   TSQMLNGII*GRDHGDMFKRDFIIYIVSTLI  850
                + N I   ++ G+ FK  F+++++  L+
Sbjct  168   LVMLENQIREDKEGGNDFKVRFVLFVLGALL  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3626083034370