BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24691_g2_i1 len=538 path=[25:0-275 301:276-276 2409:277-299
2432:300-329 3984:330-333 3988:334-334 3299:335-375 2507:376-401
4009:402-404 2536:405-470 2602:471-491 4043:492-503 649:504-506
652:507-532 2658:533-537]

Length=538
                                                                      Score     E

ref|XP_006437592.1|  hypothetical protein CICLE_v10033516mg           84.3    2e-17   
ref|XP_004233683.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    3e-17   
ref|XP_009785298.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    1e-16   
ref|XP_006484285.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    2e-16   
ref|XP_006437824.1|  hypothetical protein CICLE_v10033852mg           81.3    3e-16   
sp|P10973.1|NLTPA_RICCO  RecName: Full=Non-specific lipid-transfe...  80.5    3e-16   Ricinus communis
ref|XP_002511594.1|  Nonspecific lipid-transfer protein A, putative   80.9    4e-16   Ricinus communis
ref|XP_009623063.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    7e-16   
ref|XP_006485829.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    1e-15   
ref|XP_002511596.1|  Nonspecific lipid-transfer protein A, putative   79.3    1e-15   Ricinus communis
ref|XP_006451724.1|  hypothetical protein CICLE_v10010357mg           79.0    1e-15   
ref|XP_006484581.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    1e-15   
gb|KDO70214.1|  hypothetical protein CISIN_1g043414mg                 78.6    3e-15   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    4e-15   
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    5e-15   
ref|XP_009773021.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    8e-15   
gb|KEH22495.1|  Nodule Cysteine-Rich (NCR) secreted peptide           76.6    8e-15   
ref|XP_006338457.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    2e-14   
sp|P10974.1|NLTPB_RICCO  RecName: Full=Non-specific lipid-transfe...  75.5    2e-14   Ricinus communis
ref|XP_006437630.1|  hypothetical protein CICLE_v10033367mg           75.9    2e-14   
ref|XP_002527125.1|  Nonspecific lipid-transfer protein B, putative   75.9    3e-14   Ricinus communis
ref|XP_002527124.1|  Nonspecific lipid-transfer protein B, putative   74.7    6e-14   Ricinus communis
ref|XP_004492552.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    8e-14   
ref|XP_002283359.2|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   Vitis vinifera
ref|XP_004492553.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
ref|XP_010540223.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    3e-13   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    3e-13   
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              72.4    4e-13   
gb|AAM00273.1|AF363506_1  lipid transfer protein 2                    72.8    4e-13   Euphorbia lagascae
gb|KDP34869.1|  hypothetical protein JCGZ_09157                       72.4    5e-13   
gb|AII99867.1|  protease inhibitor/seed storage/ltp family            72.4    5e-13   
ref|XP_010106165.1|  Auxin response factor 6                          77.0    6e-13   
emb|CAN72931.1|  hypothetical protein VITISV_020613                   71.6    7e-13   Vitis vinifera
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 71.6    8e-13   
gb|KHG04165.1|  Non-specific lipid-transfer A                         71.6    9e-13   
gb|ACI47547.1|  nonspecific lipid transfer protein                    71.6    9e-13   Juglans regia
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  71.2    1e-12   
ref|XP_007141467.1|  hypothetical protein PHAVU_008G198300g           70.9    2e-12   
gb|KDP28851.1|  hypothetical protein JCGZ_14622                       70.5    2e-12   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 70.5    2e-12   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    3e-12   
ref|XP_007141461.1|  hypothetical protein PHAVU_008G197700g           70.1    3e-12   
ref|XP_011031945.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    4e-12   
emb|CDP14198.1|  unnamed protein product                              69.3    5e-12   
ref|XP_004970395.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    6e-12   
gb|KDP28819.1|  hypothetical protein JCGZ_14590                       69.3    6e-12   
ref|XP_006412367.1|  hypothetical protein EUTSA_v10026585mg           69.3    6e-12   
ref|XP_010437771.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    7e-12   
emb|CDY68862.1|  BnaCnng60800D                                        70.1    7e-12   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 69.3    7e-12   
ref|XP_010447248.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    9e-12   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        68.9    9e-12   
ref|XP_009108805.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
gb|ADR66949.1|  non-specific lipid transfer protein                   68.6    1e-11   
ref|XP_011031956.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
emb|CDY46122.1|  BnaA03g52460D                                        68.6    1e-11   
ref|XP_002869218.1|  predicted protein                                68.6    1e-11   
gb|ADR66953.1|  non-specific lipid transfer protein                   68.2    1e-11   
emb|CDP14199.1|  unnamed protein product                              68.2    2e-11   
ref|XP_008229617.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|AGW21344.1|  lipid transfer protein                                68.2    2e-11   
ref|XP_006468966.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  67.8    2e-11   Prunus dulcis [sweet almond]
ref|XP_007217372.1|  hypothetical protein PRUPE_ppa021924mg           67.8    2e-11   
ref|XP_003623615.1|  Non-specific lipid-transfer protein              67.8    2e-11   
ref|XP_002282792.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   Vitis vinifera
emb|CDX72398.1|  BnaC07g44200D                                        67.8    2e-11   
ref|XP_009138182.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    2e-11   
ref|XP_010527034.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
gb|ADR66950.1|  non-specific lipid transfer protein                   67.4    3e-11   
ref|XP_003560704.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
gb|AGH27866.1|  lipid transfer protein precursor                      67.4    3e-11   
ref|XP_007161356.1|  hypothetical protein PHAVU_001G062300g           67.4    3e-11   
gb|ADR66942.1|  non-specific lipid transfer protein                   67.4    3e-11   
ref|XP_007141462.1|  hypothetical protein PHAVU_008G197800g           67.4    3e-11   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  67.4    3e-11   Prunus avium [gean]
emb|CDY45038.1|  BnaA08g11810D                                        67.8    4e-11   
gb|AGH27864.1|  lipid transfer protein precursor                      67.0    4e-11   
gb|AGW21333.1|  lipid transfer protein                                67.0    4e-11   
ref|XP_007141468.1|  hypothetical protein PHAVU_008G198400g           66.6    5e-11   
ref|NP_680758.3|  pathogenesis-related lipid-transfer family protein  66.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 67.0    6e-11   
emb|CAB96876.2|  pru p 1                                              65.9    6e-11   Prunus persica
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  65.9    6e-11   
ref|XP_010523199.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    6e-11   
ref|XP_006446845.1|  hypothetical protein CICLE_v10017229mg           66.2    6e-11   
pdb|1MID|A  Chain A, Non-Specific Lipid Transfer Protein 1 From B...  65.9    7e-11   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           66.2    7e-11   
gb|KFK29949.1|  hypothetical protein AALP_AA7G198800                  66.2    7e-11   
gb|AGH27863.1|  lipid transfer protein precursor                      66.2    7e-11   
pdb|1BE2|A  Chain A, Lipid Transfer Protein Complexed With Palmit...  65.9    7e-11   
pdb|1BWO|A  Chain A, The Crystal Structure Of Wheat Non-Specific ...  65.5    8e-11   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        66.2    8e-11   Vitis cinerea var. helleri x Vitis vinifera
ref|XP_010432572.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    9e-11   
pdb|1CZ2|A  Chain A, Solution Structure Of Wheat Ns-Ltp Complexed...  65.5    9e-11   
gb|ADR66943.1|  non-specific lipid transfer protein                   65.9    9e-11   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  65.9    9e-11   Hordeum vulgare [barley]
dbj|BAK05317.1|  predicted protein                                    65.9    9e-11   
emb|CDM80963.1|  unnamed protein product                              65.9    9e-11   
gb|ACM78614.1|  lipid transfer protein 2                              65.9    9e-11   Tamarix hispida
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  65.9    1e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CDP07650.1|  unnamed protein product                              65.9    1e-10   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
ref|XP_010553199.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    65.9    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EMT21909.1|  Non-specific lipid-transfer protein 4.1               66.6    1e-10   
ref|XP_004229753.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AGC08425.1|  lipid transfer protein                                65.9    1e-10   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  65.1    1e-10   Prunus persica
ref|NP_001031782.1|  pathogenesis-related lipid-transfer family p...  65.5    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAA42832.1|  LTP 1                                                65.9    1e-10   Hordeum vulgare [barley]
ref|XP_007141469.1|  hypothetical protein PHAVU_008G198500g           65.5    1e-10   
ref|XP_007141470.1|  hypothetical protein PHAVU_008G198600g           64.7    2e-10   
emb|CDM80997.1|  unnamed protein product                              65.1    2e-10   
ref|NP_001067782.1|  Os11g0427800                                     65.1    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_003605294.1|  Non-specific lipid-transfer protein              65.1    2e-10   
dbj|BAD54259.1|  hypothetical protein                                 65.1    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  65.1    2e-10   
ref|XP_002305878.2|  lipid transfer family protein                    65.1    2e-10   Populus trichocarpa [western balsam poplar]
gb|AAV40850.1|  lipid transfer protein 1 precursor                    64.7    3e-10   Prunus persica
gb|EYU42244.1|  hypothetical protein MIMGU_mgv1a024175mg              64.7    3e-10   
gb|AES79814.2|  Lipid transfer protein                                65.1    3e-10   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   64.7    3e-10   
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
gb|ABO28527.1|  lipid transfer protein                                64.3    3e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CDM80964.1|  unnamed protein product                              64.3    3e-10   
gb|AES87491.2|  Lipid transfer protein                                64.7    3e-10   
ref|XP_004977378.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   
gb|EYU37388.1|  hypothetical protein MIMGU_mgv1a018287mg              64.3    3e-10   
ref|XP_007141473.1|  hypothetical protein PHAVU_008G198900g           64.3    4e-10   
gb|KHG13955.1|  Non-specific lipid-transfer 1                         64.3    4e-10   
gb|KFK36763.1|  lipid transfer protein                                64.3    4e-10   
ref|XP_006375125.1|  hypothetical protein POPTR_0014s04590g           64.3    4e-10   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
gb|AFM39014.1|  lipid transfer protein                                63.9    4e-10   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  63.9    4e-10   Triticum turgidum subsp. durum
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       63.9    4e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006285119.1|  hypothetical protein CARUB_v10006452mg           63.9    4e-10   
gb|AAB33171.1|  acyl-binding/lipid-transfer protein isoform II, A...  63.5    5e-10   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  63.5    5e-10   Prunus domestica
ref|XP_007206161.1|  hypothetical protein PRUPE_ppa013565mg           63.9    5e-10   
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    5e-10   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           63.9    5e-10   
gb|ABK96515.1|  unknown                                               63.9    5e-10   Populus trichocarpa x Populus deltoides
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  63.5    6e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ABB90546.1|  lipid transfer protein                                63.5    6e-10   Triticum aestivum [Canadian hard winter wheat]
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            63.9    6e-10   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  63.5    6e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003623596.1|  Non-specific lipid-transfer protein              64.7    7e-10   
ref|XP_004978536.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    7e-10   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  63.5    7e-10   Triticum aestivum [Canadian hard winter wheat]
gb|AEC04836.1|  lipid transfer protein                                63.2    8e-10   
gb|AFR43288.1|  lipid transfer protein precursor                      63.2    8e-10   
gb|EYU34081.1|  hypothetical protein MIMGU_mgv1a024111mg              63.2    9e-10   
sp|P85206.1|NLTP2_ACTDE  RecName: Full=Non-specific lipid-transfe...  62.8    9e-10   
ref|XP_009607859.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    9e-10   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    9e-10   
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  63.2    9e-10   Hordeum vulgare [barley]
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  63.2    9e-10   Triticum aestivum [Canadian hard winter wheat]
gb|AFV30232.1|  lipid transfer protein                                63.2    9e-10   
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        63.2    9e-10   Sorghum bicolor [broomcorn]
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            63.2    9e-10   Triticum aestivum [Canadian hard winter wheat]
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  63.2    9e-10   Hordeum vulgare [barley]
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       63.2    9e-10   
sp|P86137.2|NLTP1_ACTDE  RecName: Full=Non-specific lipid-transfe...  62.4    1e-09   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           63.2    1e-09   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   63.2    1e-09   
gb|AAY84146.1|  lipid transfer protein                                63.2    1e-09   Catharanthus roseus [chatas]
ref|XP_003595853.1|  Non-specific lipid-transfer protein              62.8    1e-09   
ref|XP_009788621.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   
ref|XP_008244927.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   
gb|EEE65837.1|  hypothetical protein OsJ_21599                        62.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAA03284.1|  CW21=non-specific lipid transfer protein              62.0    1e-09   
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       62.8    1e-09   Triticum aestivum [Canadian hard winter wheat]
sp|P82007.2|NLTP1_HELAN  RecName: Full=Non-specific lipid-transfe...  62.8    1e-09   Helianthus annuus
ref|XP_006298841.1|  hypothetical protein CARUB_v10014953mg           62.8    1e-09   
gb|ADR66946.1|  non-specific lipid transfer protein                   62.8    1e-09   
gb|AFK35133.1|  unknown                                               62.4    2e-09   
emb|CAB53447.1|  non-specific lipid transfer protein                  62.4    2e-09   Brassica napus [oilseed rape]
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               62.4    2e-09   
gb|ABY54820.1|  lipid transfer protein                                62.4    2e-09   
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  62.4    2e-09   Cicer arietinum [garbanzo]
ref|XP_006347954.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    62.4    2e-09   
ref|NP_001275802.1|  lipid-transfer protein precursor                 62.4    2e-09   
gb|AFR43295.1|  lipid transfer protein precursor                      62.4    2e-09   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  62.4    2e-09   Hordeum vulgare [barley]
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
ref|XP_008344642.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
ref|NP_001147136.1|  LOC100280743 precursor                           62.4    2e-09   Zea mays [maize]
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        62.4    2e-09   Sorghum bicolor [broomcorn]
ref|XP_003579022.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
gb|AAA74624.1|  lipid transfer protein precursor                      62.4    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
gb|KHN40623.1|  Non-specific lipid-transfer protein                   62.4    2e-09   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
gb|AFK45186.1|  unknown                                               62.0    2e-09   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           62.0    2e-09   
gb|AAC63372.1|  lipid transfer protein                                62.0    2e-09   Brassica oleracea
prf||2115353B  lipid transfer protein                                 62.0    2e-09
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               62.0    2e-09   
gb|AAM22768.1|  lipid transfer protein                                61.2    3e-09   Prunus persica
gb|ABK22458.1|  unknown                                               61.6    3e-09   Picea sitchensis
gb|AFR43289.1|  lipid transfer protein precursor                      61.6    3e-09   
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
sp|P83434.1|NLTP1_VIGRR  RecName: Full=Non-specific lipid-transfe...  61.2    3e-09   Vigna radiata var. radiata [golden gram]
gb|ABK21290.1|  unknown                                               61.6    3e-09   Picea sitchensis
ref|XP_004135897.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
gb|ABK94706.1|  unknown                                               61.6    3e-09   Populus trichocarpa [western balsam poplar]
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  61.6    3e-09   Triticum aestivum [Canadian hard winter wheat]
gb|EAY73049.1|  hypothetical protein OsI_00923                        61.6    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 61.6    3e-09   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_004229752.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
emb|CAA69949.1|  lipid transfer protein                               61.6    3e-09   Oryza sativa Indica Group [Indian rice]
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  60.8    3e-09   Prunus armeniaca
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|NP_001042420.1|  Os01g0219500                                     61.6    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965551.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
gb|ADR66947.1|  non-specific lipid transfer protein                   61.6    3e-09   
ref|NP_001065986.1|  Os12g0115000                                     61.2    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001176316.1|  Os11g0115466                                     61.2    4e-09   
gb|AFR43294.1|  lipid transfer protein precursor                      61.6    4e-09   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  61.6    4e-09   
ref|XP_003623613.1|  Non-specific lipid-transfer protein              61.6    4e-09   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           61.6    4e-09   
ref|XP_008342316.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    4e-09   
gb|AFK36168.1|  unknown                                               61.2    4e-09   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 61.6    4e-09   
gb|AET05733.1|  lipid transfer protein isoform d                      60.8    4e-09   
ref|XP_006347955.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    4e-09   
emb|CDX93316.1|  BnaC04g45800D                                        61.2    4e-09   
prf||2115353A  lipid transfer protein                                 61.2    4e-09
ref|NP_001236847.1|  uncharacterized protein LOC100306055             61.6    4e-09   
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  61.2    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527037.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-09   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  61.2    5e-09   Triticum aestivum [Canadian hard winter wheat]
gb|AAB70539.1|  lipid transfer protein LPT II                         61.2    5e-09   Oryza sativa Indica Group [Indian rice]
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  61.2    5e-09   Brassica oleracea var. italica [asparagus broccoli]
gb|AAB33172.1|  acyl-binding/lipid-transfer protein isoform I, AB...  60.5    5e-09   
ref|XP_009607860.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    5e-09   
gb|ACJ62381.1|  lipid-transfer protein                                61.2    5e-09   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  60.8    5e-09   Oryza sativa Japonica Group [Japonica rice]
sp|Q43304.1|NLTPD_BRAOT  RecName: Full=Non-specific lipid-transfe...  60.8    5e-09   Brassica oleracea var. italica [asparagus broccoli]
gb|ACJ62387.1|  lipid-transfer protein                                60.8    5e-09   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001065583.1|  Os11g0115400                                     60.8    5e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CDP15101.1|  unnamed protein product                              60.8    5e-09   
gb|ACJ62361.1|  lipid-transfer protein                                60.8    5e-09   Zea mays subsp. parviglumis [Balsas teosinte]
pir||EPRZ  phospholipid transfer protein homolog - rice               60.5    6e-09
gb|ACE07189.1|  Art v 3 allergen precursor                            60.8    6e-09   Artemisia vulgaris [common wormwood]
gb|ABX56711.1|  LTP isoallergen 1 precursor                           60.8    6e-09   Arachis hypogaea [goober]
ref|XP_009607858.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
ref|NP_001105392.1|  phospholipid transfer protein precursor          60.8    6e-09   Zea mays [maize]
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    6e-09   
gb|KEH29195.1|  Lipid transfer protein                                61.6    6e-09   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           60.8    6e-09   
ref|XP_004978533.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        60.8    7e-09   Zea mays [maize]
gb|AHG99490.1|  lipid-transfer protein                                60.5    7e-09   
ref|XP_007218611.1|  hypothetical protein PRUPE_ppa013464mg           60.8    7e-09   
ref|XP_009788622.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    7e-09   
gb|ACJ62355.1|  lipid-transfer protein                                60.5    7e-09   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    7e-09   
gb|ACJ62320.1|  lipid-transfer protein                                60.8    7e-09   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004137680.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
gb|ACN31691.1|  unknown                                               62.0    7e-09   Zea mays [maize]
gb|ACJ62316.1|  lipid-transfer protein                                60.5    7e-09   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62323.1|  lipid-transfer protein                                60.5    7e-09   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62315.1|  lipid-transfer protein                                60.5    7e-09   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010109650.1|  Non-specific lipid-transfer protein              60.8    8e-09   
gb|ADK60918.1|  lipid transfer protein                                60.5    8e-09   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       60.5    8e-09   Artemisia vulgaris [common wormwood]
gb|ACJ62319.1|  lipid-transfer protein                                60.5    8e-09   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62318.1|  lipid-transfer protein                                60.5    8e-09   
ref|NP_001065987.1|  Os12g0115100                                     60.5    8e-09   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  60.8    8e-09   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    8e-09   
ref|NP_001236518.1|  uncharacterized protein LOC100306032 precursor   60.5    8e-09   
ref|XP_007163898.1|  hypothetical protein PHAVU_L007100g              60.5    8e-09   
ref|XP_009796551.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    8e-09   
gb|ACL01093.1|  lipid transfer protein                                60.5    8e-09   
gb|ABX75045.1|  LTP isoallergen 2                                     60.1    8e-09   
gb|EMS52738.1|  Non-specific lipid-transfer protein 4.1               60.5    8e-09   
gb|ACJ62339.1|  lipid-transfer protein                                60.5    8e-09   
ref|XP_009359208.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    8e-09   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         60.5    9e-09   
ref|XP_008231388.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    9e-09   
gb|ABG54494.1|  putative allergen Rub i 3                             60.5    9e-09   
ref|XP_004137679.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    9e-09   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    9e-09   
gb|AAV66924.1|  lipid transfer protein 4                              60.1    9e-09   
gb|KDP35110.1|  hypothetical protein JCGZ_10952                       60.1    9e-09   
gb|ADR66948.1|  non-specific lipid transfer protein                   60.1    1e-08   
gb|ACJ62342.1|  lipid-transfer protein                                60.1    1e-08   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         60.1    1e-08   
gb|AAB70538.1|  lipid transfer protein                                60.1    1e-08   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
ref|XP_007141471.1|  hypothetical protein PHAVU_008G198700g           60.1    1e-08   
gb|AES79831.2|  Lipid transfer protein                                60.1    1e-08   
ref|NP_001241103.1|  uncharacterized protein LOC100798112 precursor   60.1    1e-08   
ref|XP_010690792.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            60.1    1e-08   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           59.7    1e-08   
gb|ACE07186.1|  Art v 3.0201 allergen precursor                       59.7    1e-08   
gb|AEG79730.1|  lipid transfer protein precursor                      60.1    1e-08   
ref|XP_006409161.1|  hypothetical protein EUTSA_v10022915mg           59.7    1e-08   
ref|XP_003562719.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
emb|CBW38499.1|  lipid transfer protein                               59.7    1e-08   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              59.7    1e-08   
ref|XP_002884130.1|  protease inhibitor/seed storage/lipid transf...  59.7    1e-08   
ref|XP_004492085.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
emb|CAC86258.1|  lipid transfer protein                               59.7    1e-08   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  59.7    1e-08   
emb|CBW38503.1|  lipid transfer protein                               59.3    1e-08   
ref|XP_009365066.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
gb|ACJ62326.1|  lipid-transfer protein                                59.7    1e-08   
gb|ABI26087.1|  lipid transfer protein precursor                      59.7    1e-08   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            59.7    1e-08   
gb|AEI70829.1|  non-specific lipid-transfer protein                   59.7    1e-08   
ref|NP_001238031.1|  uncharacterized protein LOC100500178 precursor   59.7    1e-08   
ref|XP_010257636.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  59.7    1e-08   
emb|CBW38504.1|  lipid transfer protein                               59.3    1e-08   
ref|XP_003533715.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
gb|AAQ54611.1|  Gly d Mal d 3-like protein                            59.7    2e-08   
gb|AAB70541.1|  lipid transfer protein LPT IV                         59.7    2e-08   
gb|ACE80968.1|  putative allergen Pru du 3.03                         59.7    2e-08   
gb|ADP37976.1|  lipid transfer protein                                59.7    2e-08   
gb|EMS59740.1|  Non-specific lipid-transfer protein 4.1               59.3    2e-08   
ref|NP_001159077.1|  nonspecific lipid-transfer protein 3 precursor   59.7    2e-08   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           59.3    2e-08   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  59.7    2e-08   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
emb|CAN76145.1|  hypothetical protein VITISV_034315                   60.1    2e-08   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              59.3    2e-08   
gb|KHG09722.1|  Non-specific lipid-transfer                           59.3    2e-08   
gb|AFK41091.1|  unknown                                               59.7    2e-08   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    58.9    2e-08   
gb|AGV40202.1|  nonspecific lipid-transfer protein 1                  59.3    2e-08   
emb|CBW38497.1|  lipid transfer protein                               58.9    2e-08   
emb|CAB96874.1|  mal d 3                                              58.9    2e-08   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
gb|AER92599.1|  putative lipid transfer protein                       59.3    2e-08   
gb|ABA33853.1|  phospholipid transfer protein 1                       59.3    2e-08   
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  58.9    2e-08   
gb|AAS13435.1|  lipid-transfer protein                                59.3    2e-08   
ref|XP_009591276.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
emb|CDX91474.1|  BnaC04g06760D                                        59.3    2e-08   
gb|AGN56421.1|  non-specific lipid transfer protein 1                 59.3    2e-08   
gb|AAT80649.1|  lipid transfer protein precursor                      59.3    2e-08   
ref|XP_002269620.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
ref|NP_179428.1|  non-specific lipid-transfer protein 8               58.9    2e-08   
gb|AGC08426.1|  lipid transfer protein                                59.3    2e-08   
gb|AGN56422.1|  non-specific lipid transfer protein 2                 58.9    2e-08   
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           58.9    2e-08   
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        59.3    2e-08   
gb|ABA33854.1|  phospholipid transfer protein 1                       59.3    2e-08   
gb|ABA33860.1|  phospholipid transfer protein 1                       58.9    2e-08   
gb|ABA34092.1|  phospholipid transfer protein 2                       58.9    2e-08   
gb|ABA34089.1|  phospholipid transfer protein 2                       58.9    3e-08   
gb|ABA34083.1|  phospholipid transfer protein 2                       58.9    3e-08   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  58.9    3e-08   
gb|AEI70827.1|  non-specific lipid-transfer protein                   58.9    3e-08   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    3e-08   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         58.9    3e-08   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    3e-08   
gb|ACE80969.1|  putative allergen Pru p 3.03                          58.9    3e-08   
gb|AGC08421.1|  lipid transfer protein                                59.3    3e-08   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    58.9    3e-08   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   58.9    3e-08   
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        58.9    3e-08   
gb|ACG43443.1|  nonspecific lipid-transfer protein 4 precursor        58.5    3e-08   
gb|KHG09723.1|  Non-specific lipid-transfer                           58.9    3e-08   
gb|AFM35695.1|  nonspecific lipid transfer protein                    58.9    3e-08   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    3e-08   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   58.9    3e-08   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  58.5    3e-08   
gb|ABA34080.1|  phospholipid transfer protein 2                       58.9    3e-08   
ref|XP_011069906.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    3e-08   
gb|ABA33855.1|  phospholipid transfer protein 1                       58.9    3e-08   
gb|ABA33858.1|  phospholipid transfer protein 1                       58.9    3e-08   
gb|EMT31304.1|  Non-specific lipid-transfer protein 3                 58.9    3e-08   
gb|ABA33856.1|  phospholipid transfer protein 1                       58.9    3e-08   
gb|ABA33847.1|  phospholipid transfer protein 1                       58.9    3e-08   
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    58.9    3e-08   
gb|ABA33849.1|  phospholipid transfer protein 1                       58.9    3e-08   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  58.2    3e-08   
gb|ABA33850.1|  phospholipid transfer protein 1                       58.9    3e-08   
gb|KFK40228.1|  hypothetical protein AALP_AA3G347300                  58.5    3e-08   
gb|ABA33866.1|  phospholipid transfer protein 1                       58.5    3e-08   
emb|CAH03799.1|  lipid transfer protein                               58.2    3e-08   
gb|AAR22488.1|  allergen Mal d 3                                      58.5    3e-08   
gb|AFR43285.1|  lipid transfer protein precursor                      58.5    3e-08   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    3e-08   
gb|AEN70935.1|  lipid transfer protein                                58.5    4e-08   
gb|ABA33857.1|  phospholipid transfer protein 1                       58.5    4e-08   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           58.5    4e-08   
ref|NP_001236359.1|  uncharacterized protein LOC100306531 precursor   58.5    4e-08   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  58.5    4e-08   
gb|ACG24840.1|  nonspecific lipid-transfer protein 4 precursor        58.5    4e-08   
gb|AFR43291.1|  lipid transfer protein precursor                      58.5    4e-08   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    4e-08   
gb|AFX65219.1|  lipid transfer precursor protein                      58.5    4e-08   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    4e-08   
ref|XP_002533769.1|  Nonspecific lipid-transfer protein C, cotyle...  58.2    4e-08   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   58.2    4e-08   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  58.2    4e-08   
sp|P10975.2|NLTPC_RICCO  RecName: Full=Non-specific lipid-transfe...  58.2    4e-08   
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           58.2    4e-08   
emb|CDY18379.1|  BnaA04g22080D                                        58.2    4e-08   
dbj|BAO51648.1|  lipid transfer protein                               58.2    4e-08   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  58.2    5e-08   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         58.2    5e-08   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_003522131.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
gb|ACG25358.1|  nonspecific lipid-transfer protein 2 precursor        58.5    5e-08   
gb|AAT68262.1|  lipid transfer protein                                58.2    5e-08   
gb|ABA34094.1|  phospholipid transfer protein 2                       58.2    5e-08   
gb|AFR43276.1|  lipid transfer protein precursor                      58.2    5e-08   
gb|AEI70828.1|  non-specific lipid-transfer protein                   58.2    5e-08   
ref|NP_001148362.1|  LOC100281973 precursor                           58.2    5e-08   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  58.2    5e-08   
gb|AAV49759.1|  non-specific lipid transfer protein 6                 58.2    5e-08   
ref|XP_004978532.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
gb|ABK41612.1|  lipid transfer protein                                57.8    5e-08   
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  58.2    5e-08   
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
gb|EMS59737.1|  Non-specific lipid-transfer protein 4.1               58.2    5e-08   
gb|AHB19225.1|  non specific lipid transfer protein 1C                58.2    6e-08   
gb|ABA34096.1|  phospholipid transfer protein 2                       57.8    6e-08   
gb|AES87466.2|  Lipid transfer protein                                58.2    6e-08   
ref|XP_009112488.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    6e-08   
gb|AAQ96338.1|  lipid transfer protein                                57.8    6e-08   
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            57.8    6e-08   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    57.8    6e-08   
gb|KHN12011.1|  Non-specific lipid-transfer protein A                 57.4    7e-08   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  58.5    7e-08   
gb|ABA33848.1|  phospholipid transfer protein 1                       57.8    7e-08   
gb|KHN12008.1|  Non-specific lipid-transfer protein A                 57.8    7e-08   
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    7e-08   
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        57.8    7e-08   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    7e-08   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         57.8    7e-08   
gb|AAQ74627.1|  lipid transfer protein I                              57.8    7e-08   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            57.8    7e-08   
ref|XP_009798115.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    7e-08   
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  57.8    7e-08   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    57.4    7e-08   
gb|ACE07187.1|  Art v 3 allergen precursor                            57.8    7e-08   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  57.8    7e-08   
emb|CDY60751.1|  BnaA05g34760D                                        57.8    7e-08   
sp|Q41073.1|NLTP_PINTA  RecName: Full=Non-specific lipid-transfer...  57.8    8e-08   
gb|KHN44022.1|  Non-specific lipid-transfer protein A                 57.4    8e-08   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  57.8    8e-08   
ref|XP_010103101.1|  Non-specific lipid-transfer protein 8            57.4    8e-08   
gb|AFK44274.1|  unknown                                               57.4    8e-08   
emb|CBW38502.1|  lipid transfer protein                               57.4    8e-08   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              57.4    8e-08   
gb|ABA33862.1|  phospholipid transfer protein 1                       57.4    8e-08   
gb|AFK38461.1|  unknown                                               57.4    8e-08   
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   57.8    8e-08   
emb|CDM80995.1|  unnamed protein product                              57.4    8e-08   
dbj|BAK05751.1|  predicted protein                                    57.4    8e-08   
gb|ABA34098.1|  phospholipid transfer protein 2                       57.4    9e-08   
ref|XP_004506518.1|  PREDICTED: uncharacterized protein LOC101489329  59.7    9e-08   
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     57.0    9e-08
ref|NP_001146759.1|  uncharacterized protein LOC100280361 precursor   57.8    9e-08   
gb|AEN70917.1|  lipid transfer protein                                57.4    9e-08   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            57.4    9e-08   
gb|AFK46170.1|  unknown                                               57.4    9e-08   
gb|ABA33846.1|  phospholipid transfer protein 1                       57.4    9e-08   
ref|XP_004972928.1|  PREDICTED: probable non-specific lipid-trans...  57.4    9e-08   
ref|XP_002533768.1|  Nonspecific lipid-transfer protein D, cotyle...  57.4    9e-08   
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    9e-08   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              60.5    9e-08   
ref|XP_007140136.1|  hypothetical protein PHAVU_008G087000g           57.4    1e-07   
gb|AGN56423.1|  non-specific lipid transfer protein 3                 57.0    1e-07   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    1e-07   
ref|XP_002457117.1|  hypothetical protein SORBIDRAFT_03g001580        57.4    1e-07   
ref|XP_010035998.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    1e-07   
gb|ADV02772.1|  lipid transfer protein 1a                             57.4    1e-07   
sp|Q43193.1|NLTP1_SORBI  RecName: Full=Non-specific lipid-transfe...  57.0    1e-07   
emb|CAH69188.1|  type 1 non specific lipid transfer protein precu...  57.0    1e-07   
dbj|BAI94498.1|  lipid transfer protein                               57.0    1e-07   
ref|XP_004249053.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    1e-07   
sp|P80450.1|NLTP_AMACA  RecName: Full=Non-specific lipid-transfer...  56.6    1e-07   
ref|XP_007140089.1|  hypothetical protein PHAVU_008G083400g           57.0    1e-07   
ref|XP_007022999.1|  Non-specific lipid-transfer protein C, cotyl...  57.0    1e-07   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    1e-07   
ref|XP_002442777.1|  hypothetical protein SORBIDRAFT_08g002700        57.0    1e-07   
gb|AGH32497.1|  non-specific lipid transfer protein                   57.0    1e-07   
ref|XP_011039303.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    1e-07   
gb|ADV02773.1|  lipid transfer protein 1b                             56.6    1e-07   



>ref|XP_006437592.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
 gb|ESR50832.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
Length=119

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QVD  + SC+ YL GG  +P   CCD  ++L   TP   DR+AAC+C+KA AAR P+
Sbjct  31   TCGQVDSSLASCIPYLMGGGNNPAAACCDGLKNLKAITPTTADRRAACDCVKAAAARYPN  90

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            IK D A+ LP  CG+     IS+  NC
Sbjct  91   IKEDAASSLPTKCGVQIGIPISKTTNC  117



>ref|XP_004233683.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=112

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
            NC +V   +  C+ YL QGG   P + CCD  + ++  TP QQDRQ ACEC+K+ AAR P
Sbjct  23   NCGEVGGALAPCVPYLTQGG--DPSVSCCDGVKKVVETTPTQQDRQVACECMKSAAARYP  80

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++K D A+ LP  CGL +   IS  INC++V
Sbjct  81   NVKPDAASNLPSRCGLTTPIPISPTINCKSV  111



>ref|XP_009785298.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=112

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
            NC QVD  +  C+ YL QGG  +P  PCCD  + L+  TP QQDRQ ACEC+K  AAR  
Sbjct  23   NCGQVDATLVPCVPYLTQGG--NPTGPCCDGVKRLIAMTPTQQDRQDACECMKTAAARYT  80

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++K D A  LP  CG+ ++  IS   NC+++
Sbjct  81   NLKPDAATNLPSRCGVTTNIPISPTTNCKSI  111



>ref|XP_006484285.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=115

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QVD  + SC+ YL  G  +P   CCD  ++L   TPA  D +AACEC+KA AAR P+I
Sbjct  27   CGQVDASLASCIPYLIAGG-NPDAACCDGVKNLKSITPATADGRAACECVKAAAARYPNI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K D A+ LP+ CG+  +  IS+  NC N+
Sbjct  86   KEDAASSLPQKCGVQMNIPISKTTNCANI  114



>ref|XP_006437824.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
 gb|ESR51064.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
Length=113

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QVD  + SC+ YL  G  +P   CCD  ++L   TPA  DR+AACEC+KA AAR P+
Sbjct  26   TCGQVDASLASCIPYLIAGG-NPDAACCDGVKNLKSITPATADRRAACECVKAAAARYPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            IK D A+ LP+ CG+  +  IS+  NC
Sbjct  85   IKEDAASSLPQKCGVQMNIPISKTTNC  111



>sp|P10973.1|NLTPA_RICCO RecName: Full=Non-specific lipid-transfer protein A; Short=NS-LTP 
A; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
 prf||1204170A protein,nonspecific lipid transfer
Length=92

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  + SC+ +L GG A P   CC   ++L    P   DR+AACEC+KA AAR P 
Sbjct  2    DCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPT  61

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IK D A+ LP+ CG+  +  IS+  NCQ +
Sbjct  62   IKQDAASSLPKKCGVDINIPISKTTNCQAI  91



>ref|XP_002511594.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50263.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=113

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  + SC+ +L GG A P   CC   ++L    P   DR+AACEC+KA AAR P 
Sbjct  25   DCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPT  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            IK D A+ LP+ CG+  +  IS+  NCQ
Sbjct  85   IKQDAASSLPKKCGVDINIPISKTTNCQ  112



>ref|XP_009623063.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=112

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
            NC QVD  +  C+ YL QGG   P  PCCD  + ++  TP QQDRQ ACEC+K  AAR  
Sbjct  23   NCGQVDATLVPCVPYLTQGG--DPTGPCCDGVKRVIAMTPTQQDRQDACECVKTAAARYT  80

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++K D A  LP  CG+ ++  IS   NC+++
Sbjct  81   NLKPDAATNLPSRCGVTTNIPISATTNCKSI  111



>ref|XP_006485829.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=113

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QVD  + SC+ YL  G   P   CCD  ++L   TP   DR+AAC+C+KA AAR P+
Sbjct  26   TCGQVDASLASCISYLTAG-GSPSAVCCDGLKNLKTITPPTADRRAACDCVKAAAARYPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            IK D A+ LP  CG+  +  ISR  NC
Sbjct  85   IKEDAASSLPTKCGVQMNIPISRSTNC  111



>ref|XP_002511596.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50265.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=115

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  + SC+ +L GG A P   CC   ++L    P   DR+AAC+C+KA AAR P 
Sbjct  25   DCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTTADRRAACDCIKAAAARFPT  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IK D A+ LP+ CG+  +  IS+  NCQ +
Sbjct  85   IKQDAASSLPKKCGVDINIPISKTTNCQAI  114



>ref|XP_006451724.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|ESR64964.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|KDO48328.1| hypothetical protein CISIN_1g047252mg [Citrus sinensis]
Length=105

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QVD  + SC+ YL  G   P   CCD  ++L   TP   DR+AAC+C+KA AAR P+
Sbjct  18   TCGQVDASLASCISYLTAG-GSPSAVCCDGLKNLKTITPPTADRRAACDCVKAAAARYPN  76

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            IK D A+ LP  CG+  +  ISR  NC
Sbjct  77   IKEDAASSLPTKCGVQMNIPISRSTNC  103



>ref|XP_006484581.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=119

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C Q D  + SC+ YL GG  +P   CCD  ++L   TP   DR+AAC+C+KA AAR P+I
Sbjct  31   CGQEDSSLASCIPYLMGGG-NPAAACCDGLKNLKAITPTTADRRAACDCVKAAAARNPNI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K + A+ LP  CG+     IS+  NC N+
Sbjct  90   KENAASSLPSKCGVQIDIPISKTTNCANI  118



>gb|KDO70214.1| hypothetical protein CISIN_1g043414mg [Citrus sinensis]
Length=113

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QVD  + SC+ YL  G  +P   CCD  ++L   TPA  D +AACEC+KA AAR P+
Sbjct  26   TCGQVDASLASCIPYLIAGG-NPDAACCDGVKNLKSITPATADGRAACECVKAAAARYPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            IK D A+ LP+ CG+  +  IS+  NC
Sbjct  85   IKEDAASSLPQKCGVQMNIPISKTTNC  111



>ref|XP_009613304.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
tomentosiformis]
Length=111

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
             C  V   I  CL YLQG    PP PCC + + L   T    DRQAAC CLK  A + +I
Sbjct  22   TCGTVISTIRPCLSYLQGTGGKPPQPCCTACQSLASATSTTPDRQAACTCLKNAAQKINI  81

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A +A  LP+SCG+  SF IS  ++C  +
Sbjct  82   NAQLAQGLPQSCGISLSFPISTSVDCTKI  110



>ref|XP_006359128.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
             C  V   I  CL YLQG    PP PCCD  + L+       D+QAAC CLK  + + +I
Sbjct  32   TCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLVSAATTVPDKQAACTCLKNASQKINI  91

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  LP+SCG+  SF IS  ++C  +
Sbjct  92   NSQLAGSLPKSCGISLSFPISSTVDCTKI  120



>ref|XP_009773021.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
sylvestris]
Length=111

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   I  C  YLQG    PP PCC + + L   T    DRQAAC CLK  A + +I
Sbjct  22   SCGTVISTIKPCFSYLQGTGGKPPQPCCTACQSLQSATSTTPDRQAACTCLKNAAQKVNI  81

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A +A  LP+SCG+  SF IS  ++C  +
Sbjct  82   NAQLAKGLPQSCGISLSFPISTSVDCTKI  110



>gb|KEH22495.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=99

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C +    I  C+GYL G   HP + CC+  +DL    P + DR  ACECLK T++   +
Sbjct  9    DCEEAKTSILPCIGYLIGEDDHPSIACCNGVKDLKSSVPTKGDRHKACECLKKTSSHFHN  68

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I+ D+ A+LP+ CG+  +FTI++ I C  +
Sbjct  69   IRDDLNALLPKRCGVDLNFTINKSIKCDQI  98



>ref|XP_006338457.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Solanum 
tuberosum]
Length=111

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
            NC +V   +  C+ YL QGG   P   CCD  + +++ TP QQDRQ ACEC+KA AAR  
Sbjct  22   NCGEVGGAVAPCVPYLTQGG--DPSGSCCDGVKKVVQLTPTQQDRQDACECMKAAAARYS  79

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++K D A+ LP  CG+ ++  IS   NC++V
Sbjct  80   NLKPDAASNLPSRCGITTAIPISPTTNCKSV  110



>ref|XP_004229551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=121

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
             C  V   I  CL YLQG    PP PCCD  + L        DRQAAC CLK  + +  I
Sbjct  32   TCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLASAATTVPDRQAACTCLKNASQKIKI  91

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  LP+SCG+  SF IS  ++C  +
Sbjct  92   NSQLAGSLPKSCGISLSFPISPTVDCTKI  120



>sp|P10974.1|NLTPB_RICCO RecName: Full=Non-specific lipid-transfer protein B; Short=NS-LTP 
B; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
Length=92

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            NC QV+  + SC+ +L G    P + CC    +L R  P  +D++ ACEC+K  AAR P+
Sbjct  2    NCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPN  61

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I+ D A+ LP  CG++ +  IS+  NC  +
Sbjct  62   IREDAASSLPYKCGVVINVPISKTTNCHEI  91



>ref|XP_006437630.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
 gb|ESR50870.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
Length=117

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C Q D  + SC+ YL GG  +P   CCD  ++L   TP   DR+AAC+C+KA AAR P+I
Sbjct  31   CGQEDSSLASCIPYLMGGG-NPAAACCDGLKNLKAITPTTADRRAACDCVKAAAARNPNI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINC  397
            K + A+ LP  CG+     IS+  NC
Sbjct  90   KENAASSLPSKCGVQIDIPISKTTNC  115



>ref|XP_002527125.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35288.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+L + +C+ YL G  + P + CC   R+L R  P   DR+ AC+C+KA AAR P+
Sbjct  27   DCAQVNLLLGTCMPYLIGFDSSPSLACCAGVRNLKRLAPTTADRRVACDCVKAAAARHPN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQN  403
            I+ D A+ LP  CG+  +  +S    CQ 
Sbjct  87   IRDDAASTLPNKCGVDFNIPVSNTTKCQE  115



>ref|XP_002527124.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35287.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            NC QV+  + SC+ +L G    P + CC    +L R  P  +D++ ACEC+K  AAR P+
Sbjct  27   NCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQN  403
            I+ D A+ LP  CG++ +  IS+  NC  
Sbjct  87   IREDAASSLPYKCGVVINVPISKTTNCHE  115



>ref|XP_004492552.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=122

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C QV LY+ SC+GYL+      P PCC+  R +  Q+    DRQ+ C+CLK T+ + P +
Sbjct  32   CGQVQLYVASCIGYLRSPGPSVPAPCCNGIRTVNSQSKTTSDRQSVCKCLKTTSLSLPGL  91

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                 A LP  CG+   +T++  INC  +
Sbjct  92   NLPALAALPAKCGVNLPYTVTPSINCNTI  120



>ref|XP_002283359.2| PREDICTED: non-specific lipid-transfer protein 1-like [Vitis 
vinifera]
Length=115

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C  V+  +  C+ YL GG A P   CCD  R L   +P   DRQ AC+C K  A+R P+
Sbjct  26   TCSDVNKALAPCVSYLTGGGA-PTSACCDGVRTLKSLSPTTSDRQTACQCAKDAASRNPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I+ D AA LP  CG+ +   ISR  +C  V
Sbjct  85   IREDAAAALPNKCGVQTDIPISRSTDCSTV  114



>ref|XP_004492553.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=122

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C QV LY+ SC+GYL+      P PCC+  R +  Q+    DRQ+ C CLK+TA + P +
Sbjct  32   CGQVQLYVASCVGYLRSPGPSVPEPCCNGIRTVNSQSKTTADRQSVCNCLKSTALSFPGL  91

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                 A LP +CG+   + IS  I+C  +
Sbjct  92   NPQALAALPANCGVNLPYKISTSIDCNTI  120



>ref|XP_010540223.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=119

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 2/116 (2%)
 Frame = +2

Query  62   ATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDL  241
            A + P++  ++F+           A+ C +VD  +  C+ YLQ G + P   CC   R++
Sbjct  4    AVIIPSLVVLVFMFQSFMTHPTQAAITCGEVDRSLVPCIVYLQNGGS-PSAACCAGVRNI  62

Query  242  LRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
               TP   DRQ ACECLK  A   P+ K D A+ LP  CG+  +  IS+  NC+++
Sbjct  63   EAITPTTTDRQVACECLKLAAQNYPNFKEDAASTLPAKCGVTFNIPISKATNCKSI  118



>ref|XP_010547844.1| PREDICTED: non-specific lipid-transfer protein 1 [Tarenaya hassleriana]
Length=115

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C +VD  +  CL YL  G A P   CCD  RDL   TP   DRQ AC C+K  A+R  +
Sbjct  26   TCGEVDSSLRPCLPYLMAGGA-PTSKCCDGVRDLKMMTPTTADRQTACRCMKDDASRFRE  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IKA+ AA LP  C +     ISR+++C  +
Sbjct  85   IKAEAAAQLPSKCSVEFGVPISREVDCDRI  114



>gb|EYU34080.1| hypothetical protein MIMGU_mgv1a026469mg, partial [Erythranthe 
guttata]
Length=112

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C ++   +  CL YLQ G   P   CC   R +     + QDRQ AC CLK+ A+  ++
Sbjct  26   SCGELQSSLSPCLSYLQAGGGEPSESCCGGVRSVTGSIQSTQDRQTACNCLKSAASSYNV  85

Query  320  KADVAAVLPRSCGLISSFTISRDINC  397
            + DVAA LP  CG     TIS +++C
Sbjct  86   RTDVAANLPGKCGASIGMTISPNVDC  111



>gb|AAM00273.1|AF363506_1 lipid transfer protein 2 [Euphorbia lagascae]
Length=116

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V+  + +C+ YL G    PP  CCD  ++L +      DR+AACEC+KA A+   I
Sbjct  27   DCKDVNSNLATCIPYLTGKDTAPPTTCCDGVKNLPKIAQTTADRRAACECVKAAASHYTI  86

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                A+ LP+ CG + +  IS+  NCQ +
Sbjct  87   NEKAASSLPKDCGAVINIPISKTTNCQQI  115



>gb|KDP34869.1| hypothetical protein JCGZ_09157 [Jatropha curcas]
Length=114

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  C+ +L GG   P   CC   ++L    P   DR+AAC+C+KA A+  P+
Sbjct  26   DCGQVNSSLAPCIPFLTGGDTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAASHYPN  85

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            I  D A+ LP+ CG+  +  IS++ NCQ
Sbjct  86   INEDSASSLPKKCGVEVTIPISKNTNCQ  113



>gb|AII99867.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=131

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C QV LY+ SC+GYL+      P PCC+  R +  Q+    DRQ+ C CLK+TA + P +
Sbjct  32   CGQVQLYVASCVGYLRSPGPSVPEPCCNGIRTVNSQSKTTADRQSVCNCLKSTALSFPGL  91

Query  320  KADVAAVLPRSCGLISSFTISRDINCQ  400
                 A LP +CG+   + IS  I+C 
Sbjct  92   NPQALAALPANCGVNLPYKISTSIDCN  118



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPDI  319
            C QVD+ +  CL YL+G +  PP+ CC+    + + TP + DRQAAC+C+K A  +   +
Sbjct  30   CAQVDIALRPCLDYLKGTTGQPPVECCNGVASIKQNTPTKADRQAACQCVKRAAESLAGL  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  C +  S  ISR++NC  +
Sbjct  90   SDDAAKNLPVRCNVQISVPISRNVNCNKM  118



>emb|CAN72931.1| hypothetical protein VITISV_020613 [Vitis vinifera]
Length=113

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C  V+  +  C+ YL GG A P   CCD  R L   +P   DRQ AC+C K  A+R P+
Sbjct  26   TCSDVNKALAPCVSYLTGGGA-PTSACCDGVRTLKSLSPTTSDRQTACQCAKDAASRNPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQN  403
            I+ D AA LP  CG+ +   ISR  +C  
Sbjct  85   IREDAAAALPNKCGVQTDIPISRSTDCST  113



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 50/91 (55%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
             C QV   +  C+ +L+ G   PP PCC+  R L        DRQAAC CLK A  + P 
Sbjct  25   TCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPG  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNVL  409
            I A+VAA LPR CG+   + IS + +C  +L
Sbjct  85   INANVAAGLPRQCGVSIPYKISPNTDCSRIL  115



>gb|KHG04165.1| Non-specific lipid-transfer A [Gossypium arboreum]
Length=117

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QVD  + +C+ YL  G   P  PCC+   +L        DRQAAC C+K  AAR P I
Sbjct  29   CKQVDDALAACVPYLTNGGV-PSTPCCNGVGELRNSAETTADRQAACNCVKQAAARIPTI  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K D AA LP  C +   F IS++ NC+++
Sbjct  88   KEDDAATLPAKCHVQVDFPISKNTNCEDI  116



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QV   + SC+GYL+G     P  CC+  + L +      DRQAACECLK T+   P 
Sbjct  29   TCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIPG  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +   +AA LP  CG+   + IS   NC+ V
Sbjct  89   LNPGLAAGLPGKCGVSVPYKISTSTNCKAV  118



>gb|KFK36745.1| hypothetical protein AALP_AA4G164400 [Arabis alpina]
Length=118

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGY-LQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK--ATAAR  310
             C QV+  +  C+GY LQGG+  P   CC+  R L        DR+AAC+CLK  A A  
Sbjct  28   GCGQVNSAVAPCIGYILQGGAVTPG--CCNGIRRLNGAARTTPDRKAACQCLKNAAAALG  85

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P + A  AA LPR+CG+   F IS   NC NV
Sbjct  86   PGLNAGRAAGLPRACGVSVPFPISTSTNCNNV  117



>ref|XP_007141467.1| hypothetical protein PHAVU_008G198300g [Phaseolus vulgaris]
 gb|ESW13461.1| hypothetical protein PHAVU_008G198300g [Phaseolus vulgaris]
Length=121

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C +    +  CL +L   +  PP PCC+    L+  TP ++++ AAC+CLK  A+  P+ 
Sbjct  30   CEETKSLVTPCLDFLTDKTNTPPTPCCEGLNKLIVSTPTKEEKLAACKCLKEAASHIPNF  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNVL  409
                   LP+ C +  +F+IS+D +C+N++
Sbjct  90   DVGRVNNLPKVCNINVNFSISKDFDCENII  119



>gb|KDP28851.1| hypothetical protein JCGZ_14622 [Jatropha curcas]
Length=114

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  C+ +L G    P   CC   ++L    P   DR+AAC+C+KA ++  P+
Sbjct  26   DCGQVNAALAPCIPFLTGADTAPSAACCGGVKNLKVLAPTTADRRAACDCVKAASSHYPN  85

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            I  D A+ LP+ CG+  +  IS++INCQ
Sbjct  86   INEDSASSLPKKCGVEVNIPISKNINCQ  113



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPDI  319
            C QV   +  C+ +L+ G   PP PCC+  R L        DRQAAC CLK A  + P I
Sbjct  26   CGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A+VAA LPR CG+   + IS + +C  V
Sbjct  86   NANVAAGLPRQCGVSIPYKISPNTDCSRV  114



>ref|XP_011098616.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Sesamum 
indicum]
Length=114

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  CL YL GG   P   CC   R L     +QQDRQ AC C+K+ A+  ++
Sbjct  26   SCGDVQGSLAPCLAYLTGG-GEPSSSCCGGVRSLAGSLQSQQDRQTACYCMKSAASSFNV  84

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++D A+ LP  CG+    T++ DI+C  V
Sbjct  85   RSDAASNLPGKCGVSIGMTVTPDIDCSKV  113



>ref|XP_007141461.1| hypothetical protein PHAVU_008G197700g [Phaseolus vulgaris]
 gb|ESW13455.1| hypothetical protein PHAVU_008G197700g [Phaseolus vulgaris]
Length=123

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = +2

Query  56   IKATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR  235
            +K+   P ++ V+ +   +AA +  +AL C Q    +  CL YL   ++ P  PCC    
Sbjct  1    MKSVFVPFLSLVVVLALTVAATKPPKALTCEQTKSLVTPCLDYLTKKTSTPSTPCCQGLN  60

Query  236  DLLRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNVL  409
             L+  TP ++++ AAC+CLK  A+  P++  D A  LP+ C +   + IS+D +C+ ++
Sbjct  61   KLIASTPTKKEKCAACKCLKKEASHIPNLDVDRANKLPKVCNINVDYPISKDFDCEKII  119



>ref|XP_011031945.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=118

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQG-GSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
             C +V+  + +C+ YL G G   PP  CC     L     +  D+QAACEC+KA AAR P
Sbjct  27   TCGEVNSDLAACVSYLTGKGGDFPPPQCCAGVIKLKESAVSIADKQAACECVKAAAARIP  86

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            DIK + A+ LP  C + + F IS++ NC ++
Sbjct  87   DIKDEAASSLPAKCKVQADFPISKNFNCADI  117



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QV   +  C+ Y++ G   PP  CC   R L+       DR+ AC CLK+ A R P 
Sbjct  29   TCGQVSGAVAPCINYVRSGGVVPPS-CCGGIRGLVGAAKTTADRRTACNCLKSAAGRIPG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +K  +AA LP  CG+   F IS  +NC  V
Sbjct  88   LKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>ref|XP_004970395.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Setaria 
italica]
Length=124

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK----ATAA  307
            +C  V   +  CL ++Q G A PP PCCD  R+LLRQ     DR+  C CLK    + A 
Sbjct  31   SCTTVYNTLMPCLPFVQMGGAMPPQPCCDGIRNLLRQASNTPDRRTICGCLKNVANSAAG  90

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
                  D AAVLP  CG+   + IS  +NC  +
Sbjct  91   GSGTYIDRAAVLPSKCGVSLPYKISTSVNCNTI  123



>gb|KDP28819.1| hypothetical protein JCGZ_14590 [Jatropha curcas]
Length=114

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  + SC+ +L G    P   CC   ++L    P   DR+AAC+C+KA A+  P+
Sbjct  26   DCGQVNSALASCIPFLTGADTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAASHYPN  85

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            I  D A+ LP+ C +  +  IS++ NCQ
Sbjct  86   INEDSASSLPKKCAVEVNIPISKNTNCQ  113



>ref|XP_006412367.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
 gb|ESQ53820.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
Length=120

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C QV++Y+  CL YL+ G  +P +PCC     L    P + D+QAAC+CLK  A A P I
Sbjct  32   CSQVNMYLAPCLPYLRAG-GNPSVPCCGGLNSLKAAAPGKPDKQAACQCLKNVANAIPGI  90

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      SR ++C ++
Sbjct  91   IDDNAKQLPAKCGVNLGVPFSRSVDCNSI  119



>ref|XP_010437771.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G   PP  CC+    L    PA+ DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGT-PPAMCCNGLNSLKAAAPAKSDRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      S+ ++C ++
Sbjct  90   NDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>emb|CDY68862.1| BnaCnng60800D [Brassica napus]
Length=162

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = +2

Query  65   TMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLL  244
            T N  M  ++F   ++ A   G+A+ C Q+ +Y+  CL Y++GG  +PP PCC    +L 
Sbjct  5    TKNQTMLLLVFTLLMVIAYHEGEAIQCSQITMYLAPCLSYVKGG-GNPPPPCCAGLNNLK  63

Query  245  RQTPAQQDRQAACECLKATA-ARPDIKADVAAVLPRSCGLISSFTISRDINC  397
               P + D+QAAC+CLK  A A      D A  LP  CG+      S+ ++C
Sbjct  64   ASAPGKPDKQAACQCLKNVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDC  115



>gb|KDO49686.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=126

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
             C QV   +  C+ +L+ G   PP PCC+  R L        DRQAAC CLK A  + P 
Sbjct  25   TCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPG  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            I A+VAA LPR CG+   + IS + +C 
Sbjct  85   INANVAAGLPRQCGVSIPYKISPNTDCS  112



>ref|XP_010447248.1| PREDICTED: non-specific lipid-transfer protein 11 [Camelina sativa]
Length=119

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G    PM CC+    L    PA+ DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGTPSPM-CCNGLNSLKAAAPAKADRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      S+ ++C ++
Sbjct  90   NDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>gb|KHG09865.1| Non-specific lipid-transfer P3 [Gossypium arboreum]
Length=116

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 50/90 (56%), Gaps = 4/90 (4%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--PD  316
            C QV     SC+ YLQ G  +PP  CC+  R+L RQ    +DRQ AC CL+ TAAR    
Sbjct  28   CGQVASQTGSCIRYLQRG-GNPPAACCNGVRNLNRQARTTRDRQTACRCLQ-TAARTISG  85

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I A +AA LP  CG+   + IS   NC  V
Sbjct  86   INAKLAAGLPAKCGVKIPYKISPSTNCNRV  115



>ref|XP_009108805.1| PREDICTED: non-specific lipid-transfer protein 11-like [Brassica 
rapa]
Length=119

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C Q+ +Y+  CL Y++GG  +PP PCC    +L    P + D+QAAC+CLK  A A    
Sbjct  31   CSQITMYLAPCLSYVKGG-GNPPPPCCAGLNNLKSSAPGRPDKQAACQCLKNVANAISGF  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      S+ ++C ++
Sbjct  90   NDDNAKQLPAKCGVSVGVPFSKSVDCNSI  118



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  RD   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRDVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AAVLP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>ref|XP_011031956.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=117

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQG-GSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
             C  V+  + +C+ YL G G   PP  CC     L     +  D+QAACEC+KA AAR P
Sbjct  26   TCGDVNSDLAACVSYLTGKGGDFPPPECCAGGIKLKESAVSIADKQAACECVKAAAARIP  85

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            DIK + A+ LP  C + + F IS++ NC ++
Sbjct  86   DIKDEAASSLPAKCKVQADFPISKNFNCADI  116



>emb|CDY46122.1| BnaA03g52460D [Brassica napus]
Length=120

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV++++  CL YL+GG  +P  PCC     L    P + +RQ AC+CLK+ +   P 
Sbjct  31   SCSQVNMFLAPCLSYLRGG-GNPSQPCCAGLNSLKAAAPGKAERQTACQCLKSVSNTIPG  89

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I  D A  LP  CG+      S+ ++C ++
Sbjct  90   INDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>ref|XP_002869218.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45477.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=119

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G    PM CC+    L    PA+ DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGNPTPM-CCNGLNSLKAAAPAKSDRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      S+ ++C ++
Sbjct  90   NDDYAKQLPAKCGVNIGVPFSKTVDCNSI  118



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSNLAPCIPYVKGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC NV
Sbjct  85   PGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIK  322
            C+ V   + +CLGYLQ G A P   CC   R L  Q     DR+ AC CLK+ A R  + 
Sbjct  30   CNTVAGDLGACLGYLQKGGAVPA-GCCTGIRSLNSQAKTTVDRRTACSCLKSLAGRVRVN  88

Query  323  ADVAAVLPRSCGLISSFTISRDINCQNV  406
              +AA LP  CG+   + IS   NC +V
Sbjct  89   QGLAAGLPGKCGVNVGYPISTSTNCNSV  116



>ref|XP_008229617.1| PREDICTED: non-specific lipid-transfer protein A-like [Prunus 
mume]
Length=117

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV   +  C+ YL  G+  PP  CC+    L +     +DR+AAC+CLK  A    +I
Sbjct  28   CQQVASSVAPCVPYLTSGTGSPPTACCNGVSGLKQLASTTKDRRAACQCLKDAADHYQNI  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K DVAA LP +C +  +  ISR +NC +V
Sbjct  88   KEDVAAGLPTACKVQINVPISRSVNCNDV  116



>gb|AGW21344.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AAVLP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAVLPGKCGVSIPYKISASTNCATV  116



>ref|XP_006468966.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
Length=115

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +2

Query  89   VIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQD  268
            VI + A++   +   A+ C QVD ++  CL YL G  A P   CC     L   TP   D
Sbjct  9    VILMAAIVMVERGQAAITCGQVDSFLAPCLAYLTG-EAKPSRACCTGVEYLKDNTPTTAD  67

Query  269  RQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            RQAAC+C+K  A R   IK D A  LP+ CG+     I+ DI+C  +
Sbjct  68   RQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC NV
Sbjct  85   PGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>ref|XP_007217372.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
 gb|EMJ18571.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
Length=116

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV   +  C+ YL  G+  PP  CC+    L +     +DR+AAC+CLK TA    +I
Sbjct  29   CQQVVSSVAPCIPYLTSGTGSPPTACCNGVSGLNQLASTTKDRRAACQCLKDTADHYQNI  88

Query  320  KADVAAVLPRSCGLISSFTISRDINC  397
            K DVAA LP +C +  +  ISR +NC
Sbjct  89   KEDVAAGLPTACKVQINVPISRSVNC  114



>ref|XP_003623615.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES79833.1| Lipid transfer protein [Medicago truncatula]
Length=119

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  CLGY++   A  P PCC+  R +  +     DRQ+ C CLK+T   P I
Sbjct  29   SCGQVLSTLYPCLGYIRNPGASVPAPCCNGIRIVNDEAKNTSDRQSVCRCLKSTIVLPGI  88

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D  A LP +CG+   + I+ DI+C  +
Sbjct  89   NLDALANLPTNCGVNLPYKITPDIDCNKI  117



>ref|XP_002282792.1| PREDICTED: non-specific lipid-transfer protein A-like [Vitis 
vinifera]
Length=116

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV+  +  C+ YL GG  +P  PCC+  ++L   TP   DR+ AC C+KA A++  +I
Sbjct  28   CGQVETSLAPCMPYLTGG-GNPAAPCCNGVQNLKLLTPTTTDRRDACRCVKAAASKFQNI  86

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K D A+ LP  CG+     IS   NC  +
Sbjct  87   KEDAASALPTKCGVQIGIPISMTTNCDQI  115



>emb|CDX72398.1| BnaC07g44200D [Brassica napus]
Length=118

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV++++  CL YL+GG  +P  PCC     L    P + +RQ AC+CLK+ +   P 
Sbjct  29   SCSQVNMFLAPCLSYLRGG-GNPSQPCCAGLNSLKAAAPGKAERQTACQCLKSVSNTIPG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I  D A  LP  CG+      S+ ++C ++
Sbjct  88   INDDNAKQLPSKCGVDLGVPFSKSVDCNSI  117



>ref|XP_009138182.1| PREDICTED: non-specific lipid-transfer protein 11 [Brassica rapa]
Length=120

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C Q+++++  CL YL+GG  +P  PCC     L    P + +RQ AC+CLK+ +   P 
Sbjct  31   SCSQINMFLAPCLSYLRGG-GNPSQPCCAGLNSLKAAAPGKAERQTACQCLKSVSNTIPG  89

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I  D A  LP  CG+      S+ ++C ++
Sbjct  90   INDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>ref|XP_010527034.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
 ref|XP_010527036.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
Length=115

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C Q +L +  CL YL  G  +P   CC   ++L + TP + DRQ  C CLK TA + P I
Sbjct  27   CSQANLSMAPCLSYLMNG-GNPSALCCKGMKNLKKATPEKDDRQTVCRCLKDTATKNPKI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K D A+ LP  CG+      S   NC +V
Sbjct  86   KDDNASQLPGKCGVDFGVPFSTGTNCDSV  114



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AAVLP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>ref|XP_003560704.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Brachypodium 
distachyon]
Length=123

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V      CLG+LQG   +P   CC+    L+       DRQ ACECLK+ A     
Sbjct  34   SCSDVVSGASPCLGFLQGEEDYPSSDCCEGVSSLVAAAATTADRQQACECLKSAAGDGSA  93

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            +A  A  LP  CGL   FTIS D++C  +
Sbjct  94   EASAARDLPADCGLSLPFTISPDVDCSQI  122



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSSLAPCIAYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_007161356.1| hypothetical protein PHAVU_001G062300g [Phaseolus vulgaris]
 gb|ESW33350.1| hypothetical protein PHAVU_001G062300g [Phaseolus vulgaris]
Length=121

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C +    +  CL +L   +  PP PCC     L+  TP ++++ AAC+CLK  A+  P+ 
Sbjct  30   CEETKSLVTPCLDFLTDKTNTPPTPCCQGLNKLIVSTPTKEEKLAACKCLKEAASHIPNF  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNVL  409
                   LP+ C +  ++ IS+D +C+N++
Sbjct  90   DVGRVNNLPKVCNINVNYPISKDFDCENII  119



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   +  C+ Y++GG A PP  CC+  R++        DRQ AC CLK  +A+ P +
Sbjct  29   CGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGV  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A+ AA LP  CG+   + IS   NC  V
Sbjct  88   NANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_007141462.1| hypothetical protein PHAVU_008G197800g [Phaseolus vulgaris]
 gb|ESW13456.1| hypothetical protein PHAVU_008G197800g [Phaseolus vulgaris]
Length=117

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = +2

Query  56   IKATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR  235
            +K+   P ++ V+ +   +AA +  +AL C Q    +  CL YL   ++ P  PCC    
Sbjct  1    MKSVFVPFLSLVVVLGLTVAATKPPKALTCEQTKSLVTPCLDYLTKKTSTPSTPCCQGLN  60

Query  236  DLLRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQN  403
              +  TP ++++ AAC+CLK  A+  P++  D A  LP+ C +   + IS+D +C+ 
Sbjct  61   KFIASTPTKKEKCAACKCLKKEASHIPNLDVDRANKLPKVCNISVDYPISKDFDCEK  117



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   +  C+ Y++GG A PP  CC+  R++        DRQ AC CLK  +A+ P +
Sbjct  29   CGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGV  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A+ AA LP  CG+   + IS   NC  V
Sbjct  88   NANNAAALPGKCGVNVPYKISPSTNCATV  116



>emb|CDY45038.1| BnaA08g11810D [Brassica napus]
Length=162

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C Q+ +Y+  CL Y++GG  +PP PCC    +L    P + D+QAAC+CLK  A A    
Sbjct  31   CSQITMYLAPCLSYVKGG-GNPPPPCCAGLNNLKSSAPGRPDKQAACQCLKNVANAISGF  89

Query  320  KADVAAVLPRSCGLISSFTISRDINC  397
              D A  LP  CG+      S+ ++C
Sbjct  90   NDDNAKQLPAKCGVSVGVPFSKSVDC  115



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC NV
Sbjct  85   PGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC NV
Sbjct  85   PGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>ref|XP_007141468.1| hypothetical protein PHAVU_008G198400g [Phaseolus vulgaris]
 gb|ESW13462.1| hypothetical protein PHAVU_008G198400g [Phaseolus vulgaris]
Length=117

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            NC Q    +  CL YL   ++ P  PCC     L+  TP ++++ AAC+CLK  A+  P+
Sbjct  29   NCEQTKSLMSPCLDYLTKKTSTPSTPCCLGLNKLIVSTPTKEEKCAACKCLKGEASHIPN  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            +  D A  LP+ C +   + IS+D +C+
Sbjct  89   LDVDRANSLPKVCKINVDYPISKDFDCE  116



>ref|NP_680758.3| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 sp|Q2V3C1.1|NLTPB_ARATH RecName: Full=Non-specific lipid-transfer protein 11; Short=LTP 
11; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86211.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=119

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G    PM CC+    L    P + DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      S+ ++C ++
Sbjct  90   NDDFAKQLPAKCGVNIGVPFSKTVDCNSI  118



>gb|KDO63444.1| hypothetical protein CISIN_1g044686mg, partial [Citrus sinensis]
Length=130

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 55/104 (53%), Gaps = 2/104 (2%)
 Frame = +2

Query  89   VIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQD  268
            VI + A++   +   A+ C QVD ++  CL YL G  A P   CC     L   TP   D
Sbjct  26   VILMAAIVMVERGQAAITCGQVDSFLAPCLAYLTG-EAKPSRACCTGVEYLKDNTPTTAD  84

Query  269  RQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINC  397
            RQAAC+C+K  A R   IK D A  LP+ CG+     I+ DI+C
Sbjct  85   RQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDC  128



>emb|CAB96876.2| pru p 1 [Prunus persica]
Length=91

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  3    CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  58

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  59   PGVNPNNAAALPGKCGVSIPYKISASTNCATV  90



>pdb|2ALG|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2ALG|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
Length=92

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  4    CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  59

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  60   PGVNPNNAAALPGKCGVSIPYKISASTNCATV  91



>ref|XP_010523199.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=111

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            NC +VD  +  C+ YLQ G + P   CC   + +   TP   DRQ ACECLK  A   P+
Sbjct  24   NCGEVDRSLVPCIIYLQNGGS-PSASCCGGVKHIEAITPTTTDRQDACECLKQAAQNYPN  82

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            +K + A+ LP  CG+  +  IS+  NC+
Sbjct  83   LKEEAASTLPAKCGVSFNIPISKATNCK  110



>ref|XP_006446845.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
 gb|ESR60085.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
Length=115

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QVD ++  CL YL G    P   CC     L   TP   DRQAAC+C+K  A R   
Sbjct  26   TCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRG  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IK D A  LP+ CG+     I+ DI+C  +
Sbjct  85   IKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>pdb|1MID|A Chain A, Non-Specific Lipid Transfer Protein 1 From Barley In 
Complex With L-Alfa-Lysophosphatidylcholine, Laudoyl
 pdb|3GSH|A Chain A, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
 pdb|3GSH|B Chain B, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
Length=91

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            NC QVD  +  CL Y+QGG   P   CC+  RDL  Q  +  DRQ  C CLK  A    +
Sbjct  2    NCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  60

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  + AA +P  C +   +TIS DI+C  +
Sbjct  61   LNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>gb|KFK29949.1| hypothetical protein AALP_AA7G198800 [Arabis alpina]
Length=113

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++++  CL YL+ G A P +PCC     L    P   D+QAAC CLK  A+  P I
Sbjct  25   CSQVNMFLAPCLTYLKAGGA-PSVPCCGGLNSLKNAAPGIADKQAACNCLKNVASTIPGI  83

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      ++ ++C ++
Sbjct  84   NDDNAKQLPAKCGVDLGVPFTKTVDCNSI  112



>gb|AGH27863.1| lipid transfer protein precursor [Prunus mira]
 gb|AGW21339.1| lipid transfer protein [Prunus mira]
Length=117

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQVSSNLAPCIPYVRGGGAVPPT-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>pdb|1BE2|A Chain A, Lipid Transfer Protein Complexed With Palmitate, Nmr, 
10 Structures
 pdb|1JTB|A Chain A, Lipid Transfer Protein Complexed With Palmitoyl Coenzyme 
A, Nmr, 16 Structures
 pdb|1LIP|A Chain A, Barley Lipid Transfer Protein (Nmr, 4 Structures)
Length=91

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            NC QVD  +  CL Y+QGG   P   CC+  RDL  Q  +  DRQ  C CLK  A    +
Sbjct  2    NCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  60

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  + AA +P  C +   +TIS DI+C  +
Sbjct  61   LNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>pdb|1BWO|A Chain A, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1BWO|B Chain B, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1GH1|A Chain A, Nmr Structures Of Wheat Nonspecific Lipid Transfer Protein
 gb|AAB22334.1| non-specific phospholipid transfer protein, nsPLTP [Tricum aestivum=wheat, 
var. Camp Remy, seeds, Peptide, 90 aa]
 prf||1814270A phospholipid transfer protein
Length=90

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C  VD  +  CL Y+QGG   P   CCD  ++L  Q  +Q DRQ+AC CLK  A    +
Sbjct  2    DCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  60

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  D A  +P  CG+   +TIS +I+C  V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   + SCLGYL+ G A PP  CC   ++L        DRQAAC+CLK  + + P I
Sbjct  31   CGQVSSALSSCLGYLKNGGAVPP-GCCSGIKNLNSAAQTTADRQAACKCLKTFSNSIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
               +A+ LP  CG+   + IS   +C  V
Sbjct  90   NLGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_010432572.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G   P   CC+    L    PA+ DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGT-PSAMCCNGLNSLKAAAPAKSDRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              D A  LP  CG+      S+ ++C ++
Sbjct  90   NDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>pdb|1CZ2|A Chain A, Solution Structure Of Wheat Ns-Ltp Complexed With Prostaglandin 
B2.
Length=90

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C  VD  +  CL Y+QGG   P   CCD  ++L  Q  +Q DRQ+AC CLK  A    +
Sbjct  2    DCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  60

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  D A  +P  CG+   +TIS +I+C  V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   +  C+ Y++GG A PP  CC+  R++        DRQ AC CLK  +A+ P +
Sbjct  29   CGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGV  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A+ AA LP  CG+   + IS   NC  V
Sbjct  88   NANNAAALPGKCGVNVPYKISPSTNCATV  116



>sp|P07597.1|NLTP1_HORVU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Probable amylase/protease inhibitor; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA41946.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 emb|CAA28805.1| unnamed protein product [Hordeum vulgare]
 gb|AAA32970.1| amylase/protease inhibitor [Hordeum vulgare]
 emb|CAP16136.1| non-specific lipid transport protein 1 precursor [Hordeum vulgare]
Length=117

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            NC QVD  +  CL Y+QGG   P   CC+  RDL  Q  +  DRQ  C CLK  A    +
Sbjct  28   NCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  + AA +P  C +   +TIS DI+C  +
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>dbj|BAK05317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            NC QVD  +  CL Y+QGG   P   CC+  RDL  Q  +  DRQ  C CLK  A    +
Sbjct  28   NCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  + AA +P  C +   +TIS DI+C  +
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>emb|CDM80963.1| unnamed protein product [Triticum aestivum]
 emb|CDM80970.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+P   CC   R L     +  D+QAAC+C+K+ AA   +
Sbjct  28   SCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   +TIS  ++C  +
Sbjct  86   NAGKAAGIPTKCGVSVPYTISSSVDCSKI  114



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  CLG+L+GG + PP  CC   R+L     +  DRQAAC CLK+ +A  ++
Sbjct  30   SCGTVVSKLAPCLGFLRGGGSPPPA-CCSGIRNLQSMARSTPDRQAACGCLKSASAGVNM  88

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            +   AA LP  CG+   + ISR ++C  V
Sbjct  89   RN--AAALPGKCGVNIGYPISRSVDCSRV  115



>sp|P24296.2|NLTP1_WHEAT RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Full=ns-LTP1; Flags: Precursor, partial [Triticum aestivum]
 pir||S22528 lipid transfer protein precursor - durum wheat (fragment)
 emb|CAA45210.1| lipid transfer protein [Triticum turgidum subsp. durum]
Length=113

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C  VD  +  CL Y+QGG   P   CCD  ++L  Q  +Q DRQ+AC CLK  A    +
Sbjct  25   DCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  83

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  D A  +P  CG+   +TIS +I+C  V
Sbjct  84   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  113



>emb|CDP07650.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
             C  V   I  C+ YL+ GS  PP PCC   + L        D+QAAC CLK  +   +I
Sbjct  30   TCGDVAKKIAPCVDYLRSGSGAPPPPCCGGVKALAASATTTPDKQAACACLKTQSKNLNI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K ++A  LP +CG+   + IS + +C  +
Sbjct  90   KPELAQALPGNCGVSLPYPISPNFDCTTI  118



>ref|XP_008461223.1| PREDICTED: non-specific lipid-transfer protein 8 [Cucumis melo]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CCD  + L     +  D++AAC+C+K+ A+  + 
Sbjct  26   SCSDVTKDLMPCVSYLVSGSGKPPSACCDGAKALSSAATSGADKKAACQCIKSAASNVNY  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A +A  LP +CG+   F+IS  I+C  +
Sbjct  86   NAKLAQDLPSNCGITLPFSISAGIDCSKI  114



>ref|XP_010553199.1| PREDICTED: non-specific lipid-transfer protein 4-like [Tarenaya 
hassleriana]
Length=118

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
             C  V   +  C+ Y+ GG    P PCC   +DL        DR+ AC CL++ A     
Sbjct  28   TCGTVQSKLAPCIMYVTGGGGTVPPPCCAGIKDLYGMAGTTPDRRQACLCLQSAAKGITG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IK D+AA LPR+CG+   + IS  INC ++
Sbjct  88   IKPDLAASLPRACGVSLPYPISGSINCNSI  117



>gb|AAN75627.1| lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CAH69187.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C  VD  +  CL Y+QGG   P   CCD  ++L  Q  +Q DRQ+AC CLK  A    +
Sbjct  28   DCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  D A  +P  CG+   +TIS +I+C  V
Sbjct  87   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  116



>gb|EMT21909.1| Non-specific lipid-transfer protein 4.1 [Aegilops tauschii]
Length=155

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = +2

Query  173  CLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIKADVAAVLPRS  352
            CLG+LQG   +P   CCD    L+       DRQ ACECLK+ A     +   +  LP  
Sbjct  44   CLGFLQGEEDYPSADCCDGASSLVAAAATTADRQEACECLKSAAGEGSAEVTASRDLPAD  103

Query  353  CGLISSFTISRDINCQN  403
            CGL   FTIS D++C  
Sbjct  104  CGLSLPFTISPDVDCSQ  120



>ref|XP_004229753.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            C QVD  +  C+ +L QGG   P   CC   R L   T +  DR+ AC C+KA A R P+
Sbjct  27   CGQVDANLAPCVPFLTQGG--EPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +K D A  LP  CG+  +  ISR +NC  +
Sbjct  85   LKDDAAQSLPSKCGISLTVPISRTVNCDTI  114



>gb|AGC08425.1| lipid transfer protein [Gossypium hirsutum]
Length=129

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--PD  316
            C QV     SC+ YLQ G  +PP  CC+  R+L RQ    +DRQ AC CL+ TAAR    
Sbjct  28   CGQVASQTGSCIRYLQRG-GNPPAACCNGVRNLNRQARTTRDRQTACRCLQ-TAARTISG  85

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            I   +AA LP  CG+   + IS   NC
Sbjct  86   INTKLAAGLPAKCGVKIPYKISPSTNC  112



>sp|P81402.1|NLTP1_PRUPE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Allergen Pru p 1; AltName: Full=Major allergen 
Pru p 3; AltName: Allergen=Pru p 3 [Prunus persica]
Length=91

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  3    CGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  58

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  59   PGVNPNNAAALPGKCGVHIPYKISASTNCATV  90



>ref|NP_001031782.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 gb|AAS47601.1| At4g33355 [Arabidopsis thaliana]
 gb|AAS76723.1| At4g33355 [Arabidopsis thaliana]
 gb|AEE86212.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=117

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 2/87 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G    PM CC+    L    P + DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQ  400
              D A  LP  CG+      S+ ++C 
Sbjct  90   NDDFAKQLPAKCGVNIGVPFSKTVDCN  116



>emb|CAA42832.1| LTP 1 [Hordeum vulgare]
Length=134

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 2/87 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            NC QVD  +  CL Y+QGG   P   CC+  RDL  Q  +  DRQ  C CLK  A    +
Sbjct  28   NCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            +  + AA +P  C +   +TIS DI+C
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDC  113



>ref|XP_007141469.1| hypothetical protein PHAVU_008G198500g [Phaseolus vulgaris]
 gb|ESW13463.1| hypothetical protein PHAVU_008G198500g [Phaseolus vulgaris]
Length=121

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C +    +  CL +L   +  PP PCC     L+  TP ++++  AC+CLK  A++ P+ 
Sbjct  30   CEETKSLVTPCLDFLTDKTNTPPTPCCQGLNKLIVSTPTKEEKLTACKCLKEAASQIPNF  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNVL  409
                   LP+ C +  ++ IS+D +C N++
Sbjct  90   DVSRVNNLPKVCNINVNYPISKDFDCDNII  119



>ref|XP_007141470.1| hypothetical protein PHAVU_008G198600g, partial [Phaseolus vulgaris]
 gb|ESW13464.1| hypothetical protein PHAVU_008G198600g, partial [Phaseolus vulgaris]
Length=96

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C Q    +  CL YL   ++ P  PCC     L+  TP ++++ AAC+CLK  A+  P++
Sbjct  9    CEQTKSLMSPCLDYLTKKTSTPSTPCCQGLNKLIVSTPTKEEKCAACKCLKGEASHIPNL  68

Query  320  KADVAAVLPRSCGLISSFTISRDINCQ  400
              D A  LP+ C +   + IS+D +C+
Sbjct  69   DVDRANGLPKVCKINVDYPISKDFDCE  95



>emb|CDM80997.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+PP  CC   R L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>ref|NP_001067782.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|AAX96637.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|ABA93211.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28145.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|EAY80752.1| hypothetical protein OsI_35929 [Oryza sativa Indica Group]
 gb|EAZ18211.1| hypothetical protein OsJ_33751 [Oryza sativa Japonica Group]
 dbj|BAG87838.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92398.1| unnamed protein product [Oryza sativa Japonica Group]
Length=117

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 3/90 (3%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--PD  316
            C QV+  +  CL Y +GG A P   CC+  R L        DR+ AC CLK  AAR    
Sbjct  28   CGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLK-NAARGIKG  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C  V
Sbjct  87   LNAGNAASIPSKCGVSVPYTISASIDCSRV  116



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
             C QV   I  CL YLQ G A PP  CC   + L        DRQ AC CLK+ A + P 
Sbjct  30   TCGQVVSSIAPCLNYLQKGGAVPPA-CCSGVKSLNSAAKTTPDRQTACNCLKSAAVSNPS  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I+A +A+ LP  CG+   + IS   +C  V
Sbjct  89   IQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>ref|XP_003605294.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=121

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
            +C QV+  +  C+ Y+ G   + P PCCD  + +  Q   + DRQAAC C+K AT+A   
Sbjct  31   SCLQVETKLMPCVPYVTGNGGYVPQPCCDGVKAINNQAVTKSDRQAACRCIKTATSAIHG  90

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  D+ A LP  CG+   +T+     C+ +
Sbjct  91   LNMDILAGLPSKCGVHLPYTLGPSTTCEKI  120



>dbj|BAD54259.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEC80769.1| hypothetical protein OsI_23278 [Oryza sativa Indica Group]
Length=123

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--P  313
            +C  V   +  CLG+LQG   HP   CCD    L+      +DRQAACECLK+  +    
Sbjct  34   SCSDVVADVTPCLGFLQGDDDHPSGECCDGLSGLVAAAATTEDRQAACECLKSAVSGQFT  93

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQN  403
             ++A  A  LP  CGL   +T S D++C  
Sbjct  94   AVEAAPARDLPADCGLSLPYTFSPDVDCSQ  123



>gb|AFR54362.1| nonspecific lipid transfer protein 5 [Triticum aestivum]
 emb|CDM80962.1| unnamed protein product [Triticum aestivum]
 emb|CDM80969.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+PP  CC   R L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV   +  C+GYLQ G A P   CC   + L        DRQ  C CLK+ A +   
Sbjct  29   SCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLKGLNSAATTTADRQGVCNCLKSLAGKISG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I   VAA LP  CG+  S+ IS   +C++V
Sbjct  88   INYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>gb|AAV40850.1| lipid transfer protein 1 precursor [Prunus persica]
Length=117

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C Q    +  C+ Y++GG A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  29   CGQASSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  85   PGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>gb|EYU42244.1| hypothetical protein MIMGU_mgv1a024175mg [Erythranthe guttata]
Length=119

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 3/111 (3%)
 Frame = +2

Query  74   PAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGS--AHPPMPCCDSFRDLLR  247
            P +A VIF   V  A     ++ C  V   +  C+ YL+GGS  A PP PCC    +L  
Sbjct  9    PLLASVIF-GLVFFAAPSSSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLAT  67

Query  248  QTPAQQDRQAACECLKATAARPDIKADVAAVLPRSCGLISSFTISRDINCQ  400
                  D+Q AC CLK  A   ++  D+A  LP  CG+  SF IS  ++C 
Sbjct  68   SATTTADKQTACACLKNAATNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>gb|AES79814.2| Lipid transfer protein [Medicago truncatula]
Length=149

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C QV L +  CLGYL+      P PCC+  R L  Q     +RQ+ C CLK TA +   
Sbjct  29   SCPQVQLTVVPCLGYLRNPGPSVPAPCCNGLRGLNNQAKTTPERQSVCRCLKTTAQSLSG  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            +     A LP+ CG+   + IS  I+C 
Sbjct  89   LNVPALATLPKKCGVNLPYKISTAIDCN  116



>ref|NP_001236948.1| uncharacterized protein LOC100306062 precursor [Glycine max]
 gb|ACU14054.1| unknown [Glycine max]
Length=125

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 45/89 (51%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C +V + +  C+GYL+G     P  CC+  R + ++     DRQ  C CLK TA + P +
Sbjct  35   CGRVQITVAPCIGYLRGPGGGVPAACCNGVRSINKEAKTTPDRQGVCRCLKTTALSLPGL  94

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                 A LP  CG+   + IS  I+C  V
Sbjct  95   NLATLAALPSKCGVNLPYKISPTIDCNTV  123



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = +2

Query  80   MAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPA  259
            +  +IFIT ++ A    QAL C QV   +  CLGYL+ G + P   CC   ++L      
Sbjct  10   LVGLIFITMLVVAPHAAQALTCGQVLNMVMPCLGYLKNGGSIPAT-CCGGVKNLASSAKT  68

Query  260  QQDRQAACECLKATAARPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + DRQ AC+CLK  A    I  D A  LP +CG+     IS  I+C  V
Sbjct  69   KPDRQQACKCLKPAAKSYGINYDRANKLPSACGVDYKINISPTIDCSTV  117



>gb|ABO28527.1| lipid transfer protein [Triticum aestivum]
Length=115

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A P   CC   R L+    +  D+QAAC+C+K+ AA   +
Sbjct  28   SCGQVSSALSPCISYARGNGASPSAACCSGVRSLVSSARSTADKQAACKCIKSAAA--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



>emb|CDM80964.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26653.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+PP  CC   R L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSPALSPCISYARGNGANPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSKCGVSVPYAISATVDCSKI  114



>gb|AES87491.2| Lipid transfer protein [Medicago truncatula]
Length=125

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 1/89 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
            +C QV+  +  C+ Y+ G   + P PCCD  + +  Q   + DRQAAC C+K AT+A   
Sbjct  31   SCLQVETKLMPCVPYVTGNGGYVPQPCCDGVKAINNQAVTKSDRQAACRCIKTATSAIHG  90

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQN  403
            +  D+ A LP  CG+   +T+     C+ 
Sbjct  91   LNMDILAGLPSKCGVHLPYTLGPSTTCEK  119



>ref|XP_004977378.1| PREDICTED: non-specific lipid-transfer protein 4-like [Setaria 
italica]
Length=121

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPD  316
             C QV  Y++ C+ Y  G  + PP  CC   R+L     +  DRQAAC+CLK  T + P 
Sbjct  31   TCGQVAGYLNPCISYAMGHGSAPPEACCSGVRNLNAAARSTADRQAACKCLKQITGSMPA  90

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +K D+ A +P  CG+   + I    +C  V
Sbjct  91   LKPDIVAGIPSKCGVDIPYPIRPSTDCAKV  120



>gb|EYU37388.1| hypothetical protein MIMGU_mgv1a018287mg [Erythranthe guttata]
Length=119

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 3/111 (3%)
 Frame = +2

Query  74   PAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGS--AHPPMPCCDSFRDLLR  247
            P +A VIF   V  A     ++ C  V   +  C+ YL+GGS  A PP PCC    +L  
Sbjct  9    PLLASVIF-GLVFFAAPSSSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLAT  67

Query  248  QTPAQQDRQAACECLKATAARPDIKADVAAVLPRSCGLISSFTISRDINCQ  400
                  D+Q AC CLK  A   ++  D+A  LP  CG+  SF IS  ++C 
Sbjct  68   SATTTADKQTACACLKNAAKNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>ref|XP_007141473.1| hypothetical protein PHAVU_008G198900g [Phaseolus vulgaris]
 gb|ESW13467.1| hypothetical protein PHAVU_008G198900g [Phaseolus vulgaris]
Length=123

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C Q    +  CL +L   +  P  PCC+ F +++   P +++++A C CLK  A+  P++
Sbjct  30   CEQTKSLVTPCLDFLTSKTNTPSTPCCEGFNEVIFSAPTKEEKRATCNCLKEAASHIPNL  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNVL  409
              D A  LP+ C       IS+D +C+ ++
Sbjct  90   DNDKANKLPKVCNFDLDNLISKDFDCEKII  119



>gb|KHG13955.1| Non-specific lipid-transfer 1 [Gossypium arboreum]
Length=114

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 42/88 (48%), Gaps = 1/88 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIK  322
            C  V   +  CL YLQ G  + P  CCD  R L        DRQ  C CL+A A    IK
Sbjct  27   CGDVTSKVAGCLSYLQNG-GNVPKACCDGIRSLNNMARTTPDRQTVCGCLQAAAKAVKIK  85

Query  323  ADVAAVLPRSCGLISSFTISRDINCQNV  406
             ++A  LP  C +   + IS   NC+NV
Sbjct  86   GNLAETLPAKCSVNIPYKISTSTNCKNV  113



>gb|KFK36763.1| lipid transfer protein [Arabis alpina]
Length=119

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 48/90 (53%), Gaps = 5/90 (6%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGY-LQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK--ATAAR  310
             C QV+  +  C+GY LQGG+      CC+  R L        DR+AAC+CLK  A A  
Sbjct  28   GCGQVNNAVAPCIGYILQGGAITSG--CCNGVRGLNNAARTTPDRKAACQCLKNAAAALG  85

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQ  400
            P + A  AA LPR+CG+   F IS   NC 
Sbjct  86   PGLNAGRAAGLPRACGVSVPFPISTSTNCN  115



>ref|XP_006375125.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
 gb|ERP52922.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
Length=115

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 2/88 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQG-GSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
             C  V+  + +C+ YL G G   PP  CC     L     +  D+QAACEC+KA AAR P
Sbjct  26   TCGDVNSDLSACVSYLTGKGGDFPPPQCCAGVNKLKESAVSIADKQAACECVKAAAARIP  85

Query  314  DIKADVAAVLPRSCGLISSFTISRDINC  397
            D+K + A+ LP  C +     IS++ NC
Sbjct  86   DMKDEAASSLPAKCKVQVDVPISKNFNC  113



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 45/89 (51%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C +V   +  CLGYLQGG   P   CC   R+L        DRQAAC CLK+ A     +
Sbjct  27   CGRVSAALAPCLGYLQGGPG-PSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A+ AA LP  CG+   + IS   NC  +
Sbjct  86   NANNAAALPGKCGVNIPYKISTSTNCATI  114



>ref|XP_004488587.1| PREDICTED: non-specific lipid-transfer protein 8-like [Cicer 
arietinum]
Length=115

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIK  322
            C  V   +  CL YL  GS  PP  CC   + L       +D++A C C+K+TA    I 
Sbjct  27   CSDVIKDLKPCLSYLVSGSGQPPSACCSGAKALASVVSTSEDKKATCNCIKSTAKSVKIN  86

Query  323  ADVAAVLPRSCGLISSFTISRDINCQNV  406
            + +A  LP +CG+ +  ++S D +C  +
Sbjct  87   SQLAKALPGNCGINTPISVSPDADCSKI  114



>gb|AFM39014.1| lipid transfer protein [Sinapis alba]
 gb|AGU28434.1| lipid transfer protein 1 [Sinapis alba]
Length=118

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 7/93 (8%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCD---SFRDLLRQTPAQQDRQAACECLKATA-A  307
            +C  V  Y+  C+GYL  G+   P  CC    S  +L R TP   DRQ AC CL   A A
Sbjct  28   SCGTVSGYVAPCIGYLAQGAPALPGACCSGVTSLNNLARSTP---DRQQACRCLVGAANA  84

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P + A  AA LP++CG+   + IS+  NC +V
Sbjct  85   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>emb|CAH04990.1| type 1 non-specific lipid transfer protein precursor [Triticum 
turgidum subsp. durum]
Length=103

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A P   CC   R L     +  D+QAAC+C+K+ AA   +
Sbjct  16   SCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--GL  73

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  74   NAGKAAGIPTKCGVSVPYAISSSVDCSKI  102



>gb|ABF14722.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
 gb|ABF14724.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CDM80971.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+P   CC   R L     +  D+QAAC+C+K+ AA   +
Sbjct  28   SCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



>ref|XP_006285119.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
 gb|EOA18017.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
Length=117

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 2/87 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV++Y+  CL YL+ G   P   CC+    L    PA+ DRQ AC CLK+ A   P I
Sbjct  31   CPQVNMYLAQCLPYLKAGGT-PSAMCCNGLNSLKAAAPAKPDRQVACNCLKSVANTIPGI  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQ  400
              D A  LP  CG+      S+ ++C 
Sbjct  90   NDDYAKQLPSKCGVNLGVPFSKTVDCN  116



>gb|AAB33171.1| acyl-binding/lipid-transfer protein isoform II, AB/LTP II [rape, 
seedlings, Peptide, 93 aa]
 prf||2107184B acyl-binding/lipid transfer protein:ISOTYPE=II
Length=93

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 7/93 (8%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCD---SFRDLLRQTPAQQDRQAACECLKATA-A  307
            +C  V  Y+  C+GYL  G+   P  CC    S  +L R TP   DRQ AC CL   A A
Sbjct  3    SCGTVSGYVAPCIGYLAQGAPALPRACCSGVTSLNNLARTTP---DRQQACRCLVGAANA  59

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P + A  AA LP++CG+   + IS+  NC +V
Sbjct  60   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  92



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   +  C+ Y++GG A PP  CC+  R++        DR+AAC CLK  + + P +
Sbjct  3    CGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGV  61

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP  CG+   + IS   NC  V
Sbjct  62   NPNNAAALPGKCGVNVPYKISASTNCATV  90



>ref|XP_007206161.1| hypothetical protein PRUPE_ppa013565mg [Prunus persica]
 gb|EMJ07360.1| hypothetical protein PRUPE_ppa013565mg [Prunus persica]
Length=116

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C +V  Y+  C+ YL+ G A P +PCC+  R L+       DRQ  C CL ATA +   I
Sbjct  28   CSRVSQYVGPCISYLKTGGAVP-VPCCNGIRSLIGLAGTTPDRQGVCRCLVATAKSITGI  86

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K ++ + LPR+C +   + I  +++C  +
Sbjct  87   KGELVSGLPRACNVRLPYPIGPNVDCNRI  115



>ref|XP_009143379.1| PREDICTED: non-specific lipid-transfer protein D [Brassica rapa]
 gb|ABM69132.1| lipid transfer protein precursor [Brassica rapa subsp. pekinensis]
 emb|CDY68529.1| BnaAnng27610D [Brassica napus]
Length=118

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 7/93 (8%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCD---SFRDLLRQTPAQQDRQAACECLKATA-A  307
            +C  V  Y+  C+GYL  G+   P  CC    S  +L R TP   DRQ AC CL   A A
Sbjct  28   SCGTVSGYVAPCIGYLAQGAPALPRACCSGVTSLNNLARTTP---DRQQACRCLVGAANA  84

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P + A  AA LP++CG+   + IS+  NC +V
Sbjct  85   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>ref|XP_007206674.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
 gb|EMJ07873.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
Length=118

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C Q+   +  C+ Y++GG A PP  CC+  R++        DRQAAC CLK  +A+ P +
Sbjct  30   CGQLFSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLAKTTPDRQAACNCLKQLSASIPGV  88

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP  CG+   + IS   NC+ V
Sbjct  89   NPNNAAALPGKCGVSIPYKISASTNCKTV  117



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (52%), Gaps = 2/118 (2%)
 Frame = +2

Query  56   IKATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR  235
            + ++M+  +A  + +  V++A     A++C QV   +  C+GYLQ G A P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  236  DLLRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             L        DRQ  C CLK+ A +   I   +AA LP  CG+  S+ IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGVSISYKISPSTDCKSV  117



>emb|CAH04989.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C  VD  +  CL Y+QGG   P   CCD  ++L  Q  +Q DRQ+AC CL+  A    +
Sbjct  28   DCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLRGIARGIHN  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +  D A   P  CG+   +TIS +I+C  V
Sbjct  87   LNEDNARGTPLKCGVNLPYTISLNIDCSRV  116



>gb|ABB90546.1| lipid transfer protein [Triticum aestivum]
 gb|ABF14725.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  + PP  CC   R L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSKCGVSIPYAISSSVDCSKI  114



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 44/86 (51%), Gaps = 2/86 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C +V   +  CLGYLQGG   P   CC   R+L        DRQAAC CLK+ A     +
Sbjct  27   CGRVSAALAPCLGYLQGGPG-PSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINC  397
             A+ AA LP  CG+   + IS   NC
Sbjct  86   NANNAAALPGKCGVNIPYKISTSTNC  111



>emb|CAH69206.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|AEG47274.1| lipid transfer protein [Triticum turgidum subsp. durum]
 emb|CDM80972.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A P   CC   R L     +  D+QAAC+C+K+ AA   +
Sbjct  28   SCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



>ref|XP_003623596.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=189

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 1/87 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C QV L +  CLGYL+      P PCC+  R L  Q     +RQ+ C CLK TA +   
Sbjct  29   SCPQVQLTVVPCLGYLRNPGPSVPAPCCNGLRGLNNQAKTTPERQSVCRCLKTTAQSLSG  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            +     A LP+ CG+   + IS  I+C
Sbjct  89   LNVPALATLPKKCGVNLPYKISTAIDC  115



>ref|XP_004978536.1| PREDICTED: non-specific lipid-transfer protein 4-like [Setaria 
italica]
Length=121

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPD  316
             C QV  Y+  C+ Y  G  + PP  CC   R+L     +  DRQAAC+CLK  T + P 
Sbjct  31   TCGQVAGYLTPCISYAMGHGSAPPEACCSGVRNLNAAARSTADRQAACKCLKQITGSMPA  90

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +K D+ A +P  CG+   + I    +C  V
Sbjct  91   LKPDIVAGIPSKCGVDIPYPIRPSTDCAKV  120



>emb|CAH69190.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69209.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C  V   I  C+ Y  G ++ P   CC   R L  +     DRQAAC CLK  A     I
Sbjct  28   CGDVTSAIAPCMSYATGKASAPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSFKGI  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                AA +P  CG+  SF I+ ++NC N+
Sbjct  88   SMGNAATIPGKCGVSVSFPINTNVNCNNI  116



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPDI  319
            C QV   +  C+ YL+ G + PP PCC+  + L        DRQ AC CL+ A  A P I
Sbjct  27   CGQVTSSVAPCIQYLRSGGSVPP-PCCNGIKSLNNAARTTPDRQQACRCLQNAAKAIPGI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              ++AA LP  CG+   + IS   NC +V
Sbjct  86   NTNLAAGLPGKCGVNIPYKISTSTNCASV  114



>gb|AFR43288.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
Length=120

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = +2

Query  65   TMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMP-CCDSFRDL  241
            +M+  +A V+ +  ++ A     A++C QV   +  C+GY++G SA P  P CC   R L
Sbjct  4    SMSLKLACVVVLCLLVGAPLAQGAISCVQVKYSLLPCVGYVRGNSAGPAPPDCCKGIRSL  63

Query  242  LRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
                  + DRQAAC+C+K+ AA   DI   VAA LP  C +   + IS  I+C+ V
Sbjct  64   KSAARRRLDRQAACKCIKSLAADISDINYSVAAGLPGQCKVHIPYKISPSIDCKRV  119



>gb|EYU34081.1| hypothetical protein MIMGU_mgv1a024111mg, partial [Erythranthe 
guttata]
Length=109

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C ++   +  CL YL GG   P   CC   R       + QDRQ AC C+K+ A+  ++
Sbjct  24   SCGELQSSLAPCLSYLTGG-GEPSESCCGGLRSASGSIQSTQDRQTACYCMKSAASTYNV  82

Query  320  KADVAAVLPRSCGLISSFTISRDINC  397
              D AA LP  CG+    T+S +++C
Sbjct  83   PTDAAASLPGKCGVSVGMTVSPNVDC  108



>sp|P85206.1|NLTP2_ACTDE RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
AltName: Allergen=Act d 10.02 [Actinidia deliciosa]
Length=92

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQ-QDRQAACECLKATAARPD  316
            +C QVD  +  CL YL  G   P   CC   R L   T  +  DRQAAC CLK  AAR  
Sbjct  3    SCGQVDTALTPCLTYLTKG-GTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARYQ  61

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
               D AA L + CG+  S  ISR  +C  +
Sbjct  62   GIKDAAAALSQKCGVQLSVPISRSTDCSKI  91



>ref|XP_009607859.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=113

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
             C QVD  +  C+ YL QGG   P   CC+  +DL     +  DR+ AC C+KA A R  
Sbjct  26   TCGQVDASLAPCVPYLTQGG--EPGTACCNGVKDLKVMAQSIADRRTACNCVKAAANRYA  83

Query  314  DIKADVAAVLPRSCGLISSFTISRDINC  397
            ++K D A  LP  CG+     +SR INC
Sbjct  84   NLKDDAAQALPSKCGVTMDIPVSRTINC  111



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
             C QV   +  C+ Y++ G + P   CC   R L        DR+  C CLK+TAAR   
Sbjct  29   TCGQVASSVSGCISYVRSGGSIP-ASCCSGVRSLAGSAKTTADRRTVCNCLKSTAARISG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IK  +AA LP  CG+   FTIS   +C  V
Sbjct  88   IKPALAAGLPSKCGVRIPFTISPSTDCSKV  117



>sp|Q43875.1|NLT42_HORVU RecName: Full=Non-specific lipid-transfer protein 4.2; Short=LTP 
4.2; AltName: Full=Low-temperature-responsive protein 4.9; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA91436.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 gb|AAB05812.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 prf||2115353C lipid transfer protein
Length=115

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A PP+ CC   + L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>emb|CAH04988.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A P   CC   R L     +  D+QAAC+C+K+ AA   +
Sbjct  28   SCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPTKCGVSIPYAISSSVDCSKI  114



>gb|AFV30232.1| lipid transfer protein, partial [Triticum aestivum]
Length=110

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV+  + SC+ Y +G  A PP  CC   R L     +  D+QAAC CLK+ A    +
Sbjct  23   SCGQVNSAMASCVSYAKGSGASPPGACCSGVRRLAGVARSTADKQAACRCLKSAAG--GL  80

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                AA +P  CG+   ++IS  + C  +
Sbjct  81   NPGKAASIPSKCGVSIPYSISASVYCSKI  109



>ref|XP_002442774.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
 gb|EES16612.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
Length=123

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 44/89 (49%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV+  I  CL Y +G    P   CC   R L     +  D++ AC CLK+ A R   +
Sbjct  34   CGQVNSAISPCLAYARGTGTAPSAACCSGVRSLNSAASSTADKRTACNCLKSAAGRVSGL  93

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   +TIS  I+C  V
Sbjct  94   NAGNAASIPSKCGVNIPYTISASIDCSRV  122



>gb|AAG27707.1|AF302788_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAS84745.1| lipid transfer protein [Triticum aestivum]
 gb|AAV65513.1| lipid transfer protein [Triticum aestivum]
 gb|EMT15838.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV+  + SC+ Y +G  A PP  CC   R L     +  D+QAAC C+K+ A    +
Sbjct  28   SCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                AA +P  CG+   ++IS  ++C  +
Sbjct  86   NPGKAASIPSKCGVSIPYSISASVDCSKI  114



>sp|Q42842.1|NLT43_HORVU RecName: Full=Non-specific lipid-transfer protein 4.3; Short=LTP 
4.3; Flags: Precursor [Hordeum vulgare]
 emb|CAA91435.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A PP+ CC   + L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
             C QV   + +C+ YL+ G A PP  CC   R L        DRQ AC+CLK A+ + P 
Sbjct  29   TCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLNAAAKTTADRQQACKCLKSASNSIPG  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQN  403
            I  ++AA LP  CG+   + IS  ++C  
Sbjct  89   IDLNLAAGLPGKCGVSIPYKISPSVDCSK  117



>sp|P86137.2|NLTP1_ACTDE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Short=nsLTP1; AltName: Allergen=Act d 10.01 [Actinidia deliciosa]
Length=92

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQ-QDRQAACECLKATAARPD  316
            +C QVD  +  CL YL  G   P   CC   R L   T  +  DRQAAC CLK  AAR  
Sbjct  3    SCGQVDTALTPCLTYLTKG-GTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARYQ  61

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
               D AA L + CG+  S  ISR  +C  +
Sbjct  62   GIKDAAAALSQKCGVQLSVPISRSTDCSKI  91



>ref|XP_006429565.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
 ref|XP_006481181.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42805.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
Length=115

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 44/90 (49%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
             C QV   +  C+ +L+ G   PP PCC   R L        DRQAAC CLK A      
Sbjct  25   TCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRG  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            IK +VAA LP  CG+   + IS   +C  V
Sbjct  85   IKPNVAAGLPSQCGVRIPYKISPSTDCSRV  114



>gb|KHN29511.1| Non-specific lipid-transfer protein [Glycine soja]
Length=122

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C +V + +  C+GYL+G     P  CC+  R + ++     DRQ  C CLK TA + P +
Sbjct  35   CGRVQITVAPCIGYLRGPGGGVPAACCNGVRSINKEAKTTPDRQGVCRCLKTTALSLPGL  94

Query  320  KADVAAVLPRSCGLISSFTISRDINCQN  403
                 A LP  CG+   + IS  I+C  
Sbjct  95   NLATLAALPSKCGVNLPYKISPTIDCNT  122



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI-  319
            C  V+  + SCL Y+ GG    P  CC   ++LL     + DRQ AC CLK+ A   +  
Sbjct  34   CDDVNNNLISCLSYVAGG-GKVPTSCCSGVKNLLSLAKTRNDRQTACSCLKSLAVEANND  92

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            +   A  +P+SC L   F ISRD++C  V
Sbjct  93   QLKRAQTVPKSCSLTIPFPISRDVDCSKV  121



>ref|XP_003595853.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES66104.1| Lipid transfer protein [Medicago truncatula]
Length=115

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CC   + L       +D++AAC C+K+T+    I
Sbjct  26   SCSDVIKDLKPCVSYLVSGSGQPPAACCSGAKALASAVSTSEDKKAACNCIKSTSKSIKI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  L  +CG+ +  TIS D +C  V
Sbjct  86   NSQLAQALAGNCGINTPITISPDADCSKV  114



>ref|XP_009788621.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=115

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 4/87 (5%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            C QVD  +  C+ YL QGG   P   CC+  R L        D++AAC C+KA A R  +
Sbjct  27   CGQVDASLAPCIPYLTQGG--DPGAACCNGVRALKGMAQNTADKRAACNCVKAAANRYAN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            +K D A  LP  CG+    T+S+ +NC
Sbjct  85   LKEDAAQALPTKCGVTLDITVSKSVNC  111



>ref|XP_008244927.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=118

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C +V  Y+  C+ YL+ G A P +PCC+  R L+       DRQA C CL ATA +   I
Sbjct  30   CSRVSQYVGPCISYLKKGGAVP-VPCCNGIRSLIGLAGTTPDRQAVCRCLVATAKSITGI  88

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            + D+ + LPR+C +   +    +++C  +
Sbjct  89   RGDLVSGLPRACSVRLPYPTGPNVDCNRI  117



>gb|EEE65837.1| hypothetical protein OsJ_21599 [Oryza sativa Japonica Group]
Length=123

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 2/82 (2%)
 Frame = +2

Query  164  IDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--PDIKADVAA  337
            +  CLG+LQG   HP   CCD    L+      +DRQAACECLK+  +     ++A  A 
Sbjct  42   VTPCLGFLQGDDDHPSGECCDGLSGLVAAAATTEDRQAACECLKSAVSGQFTAVEAAPAR  101

Query  338  VLPRSCGLISSFTISRDINCQN  403
             LP  CGL   +T S D++C  
Sbjct  102  DLPADCGLSLPYTFSPDVDCSQ  123



>gb|AAA03284.1| CW21=non-specific lipid transfer protein [barley, cv. Bomi, leaves, 
Peptide, 90 aa]
Length=90

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A PP  CC   + L     +  D+QAAC+C+K+ A    +
Sbjct  3    SCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAG--GL  60

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  61   NAGKAAGIPSMCGVSVPYAISASVDCSKI  89



>gb|ABF14723.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIK  322
            C QV+  + SC+ Y +G  A PP  CC   R L     +  D+QAAC C+K+ A    + 
Sbjct  29   CGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAG--GLN  86

Query  323  ADVAAVLPRSCGLISSFTISRDINCQNV  406
               AA +P  CG+   ++IS  ++C  +
Sbjct  87   PGKAASIPSKCGVSIPYSISASVDCSKI  114



>sp|P82007.2|NLTP1_HELAN RecName: Full=Non-specific lipid-transfer protein AP10; Short=Ha-AP10; 
Short=LTP; Short=NsLTP; Flags: Precursor [Helianthus 
annuus]
 gb|AAP47226.1| putative lipid transfer protein [Helianthus annuus]
Length=116

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 1/89 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
             C+ V   +  CL YL+ G    P  CC   + LL  T  Q DR+ AC+C K  A +  +
Sbjct  28   TCNDVTGNLTPCLPYLRSGGKPTPA-CCAGAKKLLGATRTQADRRTACKCAKTAAPQLKV  86

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            + D+A+ LP  CG+ +S  I+ ++NC  +
Sbjct  87   RPDMASSLPGKCGISTSIPINPNVNCNTI  115



>ref|XP_006298841.1| hypothetical protein CARUB_v10014953mg [Capsella rubella]
 gb|EOA31739.1| hypothetical protein CARUB_v10014953mg [Capsella rubella]
Length=117

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CCD  ++L   T A  D++AAC+C+K+ A+   +
Sbjct  28   SCSVVLQDLQPCVSYLTSGSGKPPQTCCDGVQNLAAATTASADKKAACQCIKSVASSVTV  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K ++A  L  +CG       S  ++C  V
Sbjct  88   KPELAQALASNCGASLPVDASSTVDCTTV  116



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   +  C+ Y+ GG A PP  CC+  R++        DRQAAC CLK  + + P +
Sbjct  29   CGQVSNSVAPCIPYVIGGGAVPPA-CCNGIRNVENLAKTTADRQAACNCLKQLSGSIPGV  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP  CG+   + IS   NC  V
Sbjct  88   NPNNAAALPGKCGVNVPYKISISTNCAAV  116



>gb|AFK35133.1| unknown [Medicago truncatula]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CC   + L       +D++AAC C+K+T+    I
Sbjct  26   SCSDVIKDLKPCVSYLVSGSGQPPAACCSGAKALASAVSTSEDKKAACNCIKSTSKSIKI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  L  +CG+ +  TIS D +C  V
Sbjct  86   DSQLAQALAGNCGINTPITISPDADCSKV  114



>emb|CAB53447.1| non-specific lipid transfer protein [Brassica napus]
Length=118

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 49/93 (53%), Gaps = 7/93 (8%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCD---SFRDLLRQTPAQQDRQAACECLKATA-A  307
            +C  V  Y+  C+GYL   +   P  CC    S  +L R TP   DRQ AC CL   A A
Sbjct  28   SCGTVSGYVAPCIGYLAQNAPALPRACCSGVTSLNNLARTTP---DRQQACRCLVGAANA  84

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P I A  AA LP++CG+   + IS+  NC +V
Sbjct  85   LPTINAARAAGLPKACGVNIPYKISKTTNCNSV  117



>gb|EMT30256.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+P   CC   R L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVTSALSPCISYARGNGANPTAACCSGVRSLAGAARSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS +++C  +
Sbjct  86   NAGKAAGIPSKCGVSVPYAISANVDCSKI  114



>gb|ABY54820.1| lipid transfer protein [Arachis diogoi]
Length=116

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 44/90 (49%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARP-D  316
            +C QV+  +  C+ +L  G A  P PCC   R LL       DRQAAC CLKA A     
Sbjct  26   SCGQVNSALAPCITFLTKGGAPSP-PCCSGVRGLLGAAKTTADRQAACNCLKAAAGSVHG  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +    AA LP  CG+   + IS   NC  +
Sbjct  85   LNQGNAAALPGRCGVSIPYKISTSTNCATI  114



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 45/89 (51%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C +VD  +  CLGYLQGG   P   CC   R+L        DRQAAC CLK+ A     +
Sbjct  27   CGRVDTALAPCLGYLQGGPG-PSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A+ AA LP  C +   + IS   NC  +
Sbjct  86   NANNAAALPGKCVVNIPYKISTSTNCATI  114



>ref|XP_006347954.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
tuberosum]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            C QVD  +  C+ +L QGG   P   CC   + L     +  DR+ AC C+KA   R P+
Sbjct  27   CGQVDANLAPCVSFLTQGG--EPGAACCSGVKTLNGNAQSSDDRKTACNCVKAAVNRYPN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +K D A  LP  CG+  +  ISR +NC  +
Sbjct  85   LKDDAAQSLPSKCGISVNVPISRTVNCDTI  114



>ref|XP_007033545.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
 gb|EOY04471.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
Length=119

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV  Y+  C+ YL+G     P  CC   + L       QDR+AAC C+K+ A     
Sbjct  29   SCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIKSAAGSISG  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I   +A+ +P  CG+   + IS +I+C +V
Sbjct  89   INYALASQMPSKCGVSIPYQISPNIDCSSV  118



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPDI  319
            C QV   +  C+G+L+ G   P MPCC+  R L        DRQ AC CLK A  + P++
Sbjct  27   CGQVSGSLAPCIGFLRSGGPIP-MPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP +CG+   + IS   +C  V
Sbjct  86   NLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>gb|AFR43295.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = +2

Query  65   TMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMP-CCDSFRDL  241
            +M+  +A V+ + +++ A     A++C QV   +  C+GY++G +A P  P CC   R L
Sbjct  4    SMSLKLACVVVLCSLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKGIRSL  63

Query  242  LRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
                  + DRQAAC+C+K+ AA   DI   VAA LP  C +   + IS  I+C+ V
Sbjct  64   KSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRV  119



>sp|Q43767.1|NLT41_HORVU RecName: Full=Non-specific lipid-transfer protein 4.1; Short=LTP 
4.1; AltName: Full=CW-21; Short=CW21; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48621.1| Cw-21 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ92944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A PP  CC   + L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>ref|XP_006346674.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
tuberosum]
Length=110

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
            NC QV  YI  CLGYL+G    P   CC   R+L     +  DR+ AC CLK A  A   
Sbjct  22   NCGQVTSYIIPCLGYLRG--TAPLGGCCGGVRNLASAAKSTPDRKTACTCLKSAAGAISG  79

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            I    AA LP +CG+   + IS   +C  V
Sbjct  80   INYSKAAGLPSTCGVNIPYKISPSTDCSKV  109



>ref|XP_008344642.1| PREDICTED: non-specific lipid-transfer protein 8-like [Malus 
domestica]
Length=119

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIK  322
            C  V   +  CL YL  GS  PP  CC     L        D++AAC C+K+ A + +IK
Sbjct  31   CSDVTKDLRPCLSYLVSGSGKPPAACCAGASALASAASTSADKKAACACIKSAAQKINIK  90

Query  323  ADVAAVLPRSCGLISSFTISRDINCQNV  406
            + +A  LP +CG+  SF+IS + +C  +
Sbjct  91   SQLAQALPGNCGINLSFSISPNTDCSKI  118



>ref|NP_001147136.1| LOC100280743 precursor [Zea mays]
 ref|NP_001281242.1| uncharacterized protein LOC100382960 precursor [Zea mays]
 gb|ACG24635.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG25611.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG34347.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG37789.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACL53179.1| unknown [Zea mays]
 gb|AFS50811.1| putative lipid-transfer protein 3 [Zea mays]
 tpg|DAA57056.1| TPA: non-specific lipid-transfer protein [Zea mays]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  CL ++Q G A PP PCC   R LL+Q     DR+  C CLK  A   + 
Sbjct  31   SCSTVYSTLMPCLPFVQMGGAMPPQPCCGGIRSLLQQANNTPDRRTICGCLKNVANGANG  90

Query  320  KADV---AAVLPRSCGLISSFTISRDINCQNV  406
                   AA LP  CG+   + IS ++NC  +
Sbjct  91   SGTYISRAAALPSKCGVALPYKISTNVNCNTI  122



>ref|XP_002458690.1| hypothetical protein SORBIDRAFT_03g038280 [Sorghum bicolor]
 gb|EES03810.1| hypothetical protein SORBIDRAFT_03g038280 [Sorghum bicolor]
Length=123

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKAT---AARP  313
            C  V   +  CL ++Q G A PP PCC   R LL Q     DR+  C CLK     A   
Sbjct  32   CSTVYSTLMPCLPFVQMGGAMPPQPCCGGIRSLLAQANNTPDRRTICGCLKNVANGANGS  91

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            D   + AA LP  CG+   + IS ++NC  +
Sbjct  92   DTYINRAAALPSKCGVSLPYKISTNVNCNTI  122



>ref|XP_003579022.1| PREDICTED: non-specific lipid-transfer protein 1-like [Brachypodium 
distachyon]
Length=116

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIK  322
            C QV+  +  C+ Y++G  A P   CC   R L  Q  +  D++ AC CLK TAAR    
Sbjct  28   CGQVNSAVGPCIAYVRGTGAGPSGACCSGVRSLNSQARSTADKRTACNCLK-TAARGVKG  86

Query  323  ADV--AAVLPRSCGLISSFTISRDINCQNV  406
             DV  A+ +P  CG+   +TIS +I+C  V
Sbjct  87   LDVGKASSIPSKCGVNIPYTISPNIDCSRV  116



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  CL Y +GGS  P   CC   R L        DR+ AC CLK  A     
Sbjct  29   SCGQVNSAVSPCLSYARGGSG-PSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C +V
Sbjct  88   LNAGNAASIPSKCGVTIPYTISPSIDCSSV  117



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--P  313
             C  V   +  CL Y++ G A P M CC+  R+L       QDRQ  C C+K +AAR   
Sbjct  29   TCGTVATDLSPCLDYVRMGGAIPTM-CCNGIRNLFSAASTTQDRQTVCNCMK-SAARVIS  86

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             +  ++AA LP  CG+I  + IS  I+C  V
Sbjct  87   GVNLNLAAALPSKCGVIIPYKISPSIDCAKV  117



>gb|KHN40623.1| Non-specific lipid-transfer protein [Glycine soja]
Length=121

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C +V + +  C+GYL+G     P PCC+  + +  Q     DRQ  C CLK+T  + P +
Sbjct  34   CGRVQITVAPCIGYLRGSGGGVPAPCCNGVKSINNQAKTIPDRQGVCRCLKSTVLSLPGL  93

Query  320  KADVAAVLPRSCGLISSFTISRDINCQN  403
                 + LP  CG+   + I+  I+C  
Sbjct  94   NLATLSALPSKCGINLPYKITPTIDCNT  121



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKA-TAARPDI  319
            C QV   +  C+ Y+ GG A PP  CC+  R++        DRQAAC CLK  + + P +
Sbjct  29   CGQVSSNLAPCIPYVIGGGAVPPA-CCNGIRNVDNLANTTADRQAACNCLKQLSGSIPGV  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP  CG+   + IS   NC  V
Sbjct  88   NPNNAASLPGKCGVNIPYNISSSTNCATV  116



>gb|AFK45186.1| unknown [Lotus japonicus]
Length=114

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (48%), Gaps = 0/113 (0%)
 Frame = +2

Query  68   MNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLR  247
            M P+ A    +  +L       A++C  V   +  C+ YL  GS  PP  CC   + L  
Sbjct  1    MKPSSAFSALVLLMLLVSASEAAISCSDVIKDLKPCVSYLVSGSGKPPGACCSGAKALAS  60

Query  248  QTPAQQDRQAACECLKATAARPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
                 +D++AAC C+K+TA    + + +A  LP +CG+     +S D +C  V
Sbjct  61   AVSTSEDKKAACNCIKSTAKSIKMNSQLAKALPGNCGINVPINVSPDADCSKV  113



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK--ATAARP  313
            C  V   + +C+GY+ QGG    P  CC   ++L        DRQ AC CLK  A A  P
Sbjct  29   CGTVTSNVAACIGYITQGGPV--PGACCSGIKNLNSMARTTPDRQQACRCLKTAANALGP  86

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++ A  AA LP++CG+   F IS   NC +V
Sbjct  87   NLNAGRAAGLPKACGVNVPFPISTSTNCNSV  117



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 50/93 (54%), Gaps = 9/93 (10%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMP--CCDSFRDLLRQTPAQQDRQAACECLK--ATAA  307
            C  V+  +  C+GY+ QGG    P+P  CC     L        DRQ AC CLK  A+A 
Sbjct  29   CGTVNSNVAPCIGYITQGG----PLPRACCTGVSKLNSMARTTPDRQQACRCLKTAASAL  84

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P++ A  AA +P++CG+   F IS + NC NV
Sbjct  85   GPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>prf||2115353B lipid transfer protein
Length=115

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A PP  CC   R L     +  D+QAAC C+K  A    +
Sbjct  28   SCGQVSSALSPCISYARGKGAKPPAACCSGVRSLAGAARSTADKQAACRCIKRAAG--AL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPNKCGVRVPYAISASVDCSKI  114



>gb|EMT04675.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A+P   CC   R L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSSALSPCISYARGNGANPTAACCSGVRSLAGAARSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   TAGKAAGIPSKCGVSVPYAISASVDCSKI  114



>gb|AAM22768.1| lipid transfer protein [Prunus persica]
Length=90

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRD---LLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+ Y++ G A PP  CC+  R+   L R TP   DRQAAC CLK  +A+ 
Sbjct  3    CGQVSSNLAPCIPYVRVGGAVPPA-CCNGIRNVNNLARTTP---DRQAACNCLKQLSASV  58

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P +  + AA LP  CG+   + IS   NC  V
Sbjct  59   PGVNPNNAAALPGKCGVHIPYKISASTNCATV  90



>gb|ABK22458.1| unknown [Picea sitchensis]
 gb|ACN40889.1| unknown [Picea sitchensis]
Length=118

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  CL Y+ G +A+P   CC+  + L        DRQAAC+C+K+ AA    
Sbjct  29   SCSTVISDLVPCLSYVAGSAANPTAACCNGVKALNAAAKTTPDRQAACKCIKSAAASYKY  88

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             +  A  +P  CG+  SF IS  +NC  +
Sbjct  89   NSGKAGKIPGLCGVSVSFPISASVNCNAI  117



>gb|AFR43289.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43290.1| lipid transfer protein precursor [Gossypium barbadense]
 gb|KHG07849.1| Non-specific lipid-transfer 6 [Gossypium arboreum]
Length=120

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 2/116 (2%)
 Frame = +2

Query  65   TMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMP-CCDSFRDL  241
            +M+  +A V+ +  ++ A     A++C QV   +  C+GY++G +A P  P CC   R L
Sbjct  4    SMSLKLACVVVLCLLVGAPLAQGAISCVQVKYSLLPCVGYVRGNNAGPAPPDCCKGIRSL  63

Query  242  LRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
                  + DRQAAC+C+K+ AA   DI   VAA LP  C +   + IS  I+C+ V
Sbjct  64   KSAARRRLDRQAACKCIKSLAADISDINYSVAAGLPGQCKVHIPYKISPSIDCKRV  119



>ref|XP_009372014.1| PREDICTED: non-specific lipid-transfer protein-like [Pyrus x 
bretschneideri]
Length=115

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV   + +C+GY++ G A PP  CC+  R +        DRQ  C CLK+ A     +
Sbjct  27   CGQVTSNLGACIGYVKNGGAVPP-ACCNGIRTVNGLARTTADRQTTCNCLKSLAGSIKGV  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP  CG+   F IS   NC  V
Sbjct  86   NPNNAATLPAKCGVNVPFKISISTNCATV  114



>sp|P83434.1|NLTP1_VIGRR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Short=NS-LTP1 [Vigna radiata var. radiata]
 pdb|1SIY|A Chain A, Nmr Structure Of Mung Bean Non-Specific Lipid Transfer 
Protein 1
Length=91

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPDI  319
            C QV   +  C+G+LQ G   PP  CC   +++L  +    DR+A C CLKA A A   I
Sbjct  3    CGQVQGNLAQCIGFLQKGGVVPP-SCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGI  61

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + A  LP  CG+   + IS   NC ++
Sbjct  62   NPNNAEALPGKCGVNIPYKISTSTNCNSI  90



>gb|ABK21290.1| unknown [Picea sitchensis]
 gb|ABK26772.1| unknown [Picea sitchensis]
Length=118

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  CL Y+ G +A+P   CC+  + L        DRQAAC+C+K+ AA    
Sbjct  29   SCSTVISDLVPCLSYVAGSAANPTAACCNGVKALNAAAKTTPDRQAACKCIKSAAASYKY  88

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             +  A  +P  CG+  SF IS  +NC  +
Sbjct  89   NSGKAGKIPGLCGVSVSFPISASVNCNAI  117



>ref|XP_004135897.1| PREDICTED: non-specific lipid-transfer protein 8-like [Cucumis 
sativus]
 ref|XP_004158800.1| PREDICTED: non-specific lipid-transfer protein 8-like [Cucumis 
sativus]
 gb|KGN45185.1| hypothetical protein Csa_7G430200 [Cucumis sativus]
Length=119

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CCD  + L     +  D++AACEC+K+ A+  + 
Sbjct  30   SCSDVTKDLMPCVSYLMSGSGKPPSACCDGAKALSSAATSSADKKAACECIKSAASNVNY  89

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
               +A  LP +CG+   F+IS  I+C  +
Sbjct  90   NVKLAQDLPSNCGISLPFSISAGIDCSKI  118



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 2/118 (2%)
 Frame = +2

Query  56   IKATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR  235
            + ++M+  +A  + +  V++A     A++C QV   +  C+ YLQ G A P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPA-ACCSGLK  59

Query  236  DLLRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             L        DRQ  C CLK+ A +   I   VAA LP  CG+  S+ IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>emb|CAH69207.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 45/89 (51%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A P   CC   R L     +  D+QA C+C+K+ AA   +
Sbjct  28   SCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAVCKCIKSAAA--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA +P  CG+   + IS  ++C  +
Sbjct  86   NAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



>gb|EAY73049.1| hypothetical protein OsI_00923 [Oryza sativa Indica Group]
 gb|EAZ11061.1| hypothetical protein OsJ_00904 [Oryza sativa Japonica Group]
Length=123

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMP-CCDSFRDLLRQTPAQQDRQAACECLK-ATAARP  313
             C QV   +  C+ YL G     P   CCDS   L R  PA  DR A C C+K A A  P
Sbjct  27   QCGQVMQLMAPCMPYLAGAPGMTPYGICCDSLGVLNRMAPAPADRVAVCNCVKDAAAGFP  86

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             +    A+ LP +CGL  SFTI+ +++C  V
Sbjct  87   AVDFSRASALPAACGLSISFTIAPNMDCNQV  117



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
            +C QV+  +  CL Y +GG A P   CC   R L        DR+ AC CLK A  +   
Sbjct  28   SCGQVNSAVGPCLSYARGG-AGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSISG  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C  V
Sbjct  87   LNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQ-GGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA--AR  310
            +C  V   +  C+ Y+  GG+  PP+PCC   + L  Q  +  DRQA C CLK+ A  A 
Sbjct  28   SCGTVANDLSPCINYVMYGGAGTPPVPCCTGIKTLYNQASSTADRQAVCGCLKSVAGQAS  87

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P I    AA LP  CG+   + IS   +C  V
Sbjct  88   PAI-IGTAAALPGKCGVSIPYEISPSTDCSKV  118



>gb|KHN40180.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=115

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CC   + L       +D++AAC C+K+T+   +I
Sbjct  26   SCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKSLASAATTSEDKKAACNCIKSTSKSINI  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  LP +CG+     IS + +C  V
Sbjct  86   NSQLAQALPGNCGITLPVAISPNADCSKV  114



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
            +C QV+  +  CL Y +GG A P   CC   R L        DR+ AC CLK A  +   
Sbjct  28   SCGQVNSAVGPCLSYARGG-AGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSISG  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C  V
Sbjct  87   LNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>ref|XP_004229752.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=120

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
            +C QVD  +  C+ YL QGG   P   CC   + +     +  +R+ AC CLKA A R  
Sbjct  31   SCGQVDANMAPCISYLTQGG--EPSASCCSGVKTVSGMAQSTDERRTACNCLKAAANRYA  88

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            ++K D A  LP  CG+  +  ISR INC  +
Sbjct  89   NLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>emb|CAA69949.1| lipid transfer protein [Oryza sativa]
 gb|AAB18815.1| lipid transfer protein [Oryza sativa Indica Group]
Length=116

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 45/90 (50%), Gaps = 4/90 (4%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARP--D  316
            C QV+  +  CL Y +GG A P   CC   R L        DR+ AC CLK  AAR    
Sbjct  28   CGQVNSAVGPCLTYARGG-AGPSAACCSGVRSLFAAASTTADRRTACNCLK-NAARGIKG  85

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C  V
Sbjct  86   LNAGNAASIPSKCGVSVPYTISASIDCSRV  115



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR---DLLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+GY++GG A PP  CC+  R   +L R TP   DR+ AC CLK  + + 
Sbjct  3    CGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRRTACNCLKQLSGSI  58

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
              +  + AA LP  CG+   + IS   NC  V
Sbjct  59   SGVNPNNAAALPGKCGVNIPYKISASTNCATV  90



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 2/118 (2%)
 Frame = +2

Query  56   IKATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR  235
            + ++M+  +A  + +  V++A     A+ C QV   +  C+GYLQ G A PP  CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGALPPA-CCSGLK  59

Query  236  DLLRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             L        DRQ  C CLK+ A +   +   +AA LP  CG+   + IS   +C+ V
Sbjct  60   SLNSAAKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTV  117



>ref|NP_001042420.1| Os01g0219500 [Oryza sativa Japonica Group]
 dbj|BAF04334.1| Os01g0219500 [Oryza sativa Japonica Group]
 dbj|BAG97858.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98788.1| unnamed protein product [Oryza sativa Japonica Group]
Length=127

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMP-CCDSFRDLLRQTPAQQDRQAACECLK-ATAARP  313
             C QV   +  C+ YL G     P   CCDS   L R  PA  DR A C C+K A A  P
Sbjct  31   QCGQVMQLMAPCMPYLAGAPGMTPYGICCDSLGVLNRMAPAPADRVAVCNCVKDAAAGFP  90

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             +    A+ LP +CGL  SFTI+ +++C  V
Sbjct  91   AVDFSRASALPAACGLSISFTIAPNMDCNQV  121



>ref|XP_004965551.1| PREDICTED: non-specific lipid-transfer protein 3-like [Setaria 
italica]
Length=116

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +2

Query  164  IDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDIKADVAAVL  343
            ++ CL +LQGG A P   CC   R L        DR+A CECLK    +   +   A  L
Sbjct  35   MEPCLSFLQGGDASPSGQCCAGVRALYAAADTTADRRATCECLKTAYRQVHAQLSAARAL  94

Query  344  PRSCGLISSFTISRDINCQNV  406
            P  CGL  S+ I+ DI+C  +
Sbjct  95   PEECGLSLSYPITPDIDCNTI  115



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 2/118 (2%)
 Frame = +2

Query  56   IKATMNPAMAPVIFITavlaalqlgqalNCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR  235
            + ++M+  +A  + +  V++A     A+ C QV   +  C+GYLQ G A P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  236  DLLRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             L        DRQ  C CLK+ A +   +   +AA LP  CG+  S+ IS   +C+ V
Sbjct  60   SLNSAAATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTV  117



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 8/92 (9%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFR---DLLRQTPAQQDRQAACECLKA-TAAR  310
            C QV   +  C+GY++GG A PP  CC+  R   +L R TP   DR+ AC CLK  + + 
Sbjct  29   CGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTP---DRRTACNCLKQLSGSI  84

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
              +  + AA LP  CG+   + IS   NC  V
Sbjct  85   SGVNPNNAAALPGKCGVNIPYKISASTNCATV  116



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  CL Y +GGS  P   CC   R L        DR+ AC CLK  A     
Sbjct  21   SCGQVNSAVSPCLSYARGGSG-PSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISG  79

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C +V
Sbjct  80   LNAGNAASIPSKCGVSIPYTISPSIDCSSV  109



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  CL Y +GGS  P   CC   R L        DR+ AC CLK  A     
Sbjct  29   SCGQVNSAVSPCLSYARGGSG-PSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C +V
Sbjct  88   LNAGNAASIPSKCGVSIPYTISPSIDCSSV  117



>gb|AFR43294.1| lipid transfer protein precursor [Gossypium raimondii]
Length=120

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMP-CCDSFRDLLRQTPAQQDRQAACECLKATAAR-P  313
            +C QV   +  C+GY++G +A P  P CC   R L      + DRQAAC+C+K+ AA   
Sbjct  29   SCDQVKSSLLPCVGYVRGNNARPAPPNCCKGIRSLKSAARIRLDRQAACKCIKSLAADIS  88

Query  314  DIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            DI   VAA LP  C +   + IS  I+C+ V
Sbjct  89   DINYGVAAGLPGQCNVHIPYKISPSIDCKRV  119



>ref|XP_003546844.1| PREDICTED: LOW QUALITY PROTEIN: non-specific lipid-transfer protein 
8-like [Glycine max]
Length=138

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CC   + L       +D++AAC C+K+T+   +I
Sbjct  49   SCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSINI  108

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  LP +CG+     IS + +C  V
Sbjct  109  NSQLAQALPGNCGITLPVAISPNADCSKV  137



>ref|XP_003623613.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AFK37970.1| unknown [Medicago truncatula]
Length=120

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (49%), Gaps = 1/90 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATA-ARPD  316
            +C Q+ L +  C+GYL+      P PCC+  R +  Q     DRQ  C CLK+T  + P 
Sbjct  29   SCGQIQLTVAPCIGYLRTPGPSVPAPCCNGIRSVYYQAKTTADRQGVCRCLKSTTLSLPG  88

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +     A  P  CG+   + ++  I+C  V
Sbjct  89   LNLPALAGAPAKCGVNVPYKVAPSIDCNTV  118



>ref|XP_006429566.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
 gb|ESR42806.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
Length=122

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 43/88 (49%), Gaps = 1/88 (1%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLK-ATAARPD  316
             C QV   +  C+ +L+ G   PP PCC   R L        DRQAAC CLK A      
Sbjct  25   TCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRG  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQ  400
            IK +VAA LP  CG+   + IS   +C 
Sbjct  85   IKPNVAAGLPSQCGVRIPYKISPSTDCS  112



>ref|XP_008342316.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=117

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 45/89 (51%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECL-KATAARPDI  319
            C Q    +  CL YL  GS  PP+ CC     L + T   +DR+ AC+CL  A     DI
Sbjct  28   CQQAMSSVTPCLQYLTSGSGTPPVACCSGVSGLRQLTQTTEDRRTACQCLMDAANQNQDI  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
            K   A  LP +C +  +  ISR ++C N+
Sbjct  88   KEAAAXGLPAACRVQINVPISRSVDCNNI  116



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C  +   +  C  Y+QGG A P  PCC   R +     +  DR+AAC CLK+ A   P  
Sbjct  27   CGAIASALIPCTAYIQGG-AGPSPPCCAGVRRVNSAASSTADRRAACNCLKSAAGSFPRF  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             A  AA LP  CG+   + IS   NC N+
Sbjct  86   NAGNAASLPGKCGVNIPYKISTSTNCANI  114



>gb|KHN21357.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=139

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CC   + L       +D++AAC C+K+T+   +I
Sbjct  50   SCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSINI  109

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  LP +CG+     IS + +C  V
Sbjct  110  NSQLAQALPGNCGITLPVAISPNADCSKV  138



>gb|AET05733.1| lipid transfer protein isoform d, partial [Pyrus communis]
Length=94

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C QV   + +C+GY++ G   PP  CC+  R +        DRQ  C CLK+ A     +
Sbjct  6    CSQVTSNLGACIGYVKNGGVVPPA-CCNGIRTVNGLARTTADRQTTCNCLKSLAGSIKGV  64

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
              + AA LP  CG+   F IS   NC  V
Sbjct  65   NPNNAATLPGKCGVNVPFKISTSTNCATV  93



>ref|XP_006347955.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=120

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            C QVD  +  C+ YL QGG   P   CC   + +     +  +R+ AC CLKA A R  +
Sbjct  32   CGQVDANMTPCISYLTQGG--EPNAACCSGVKTVNGMAQSADERKTACNCLKAAANRYAN  89

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            +K D A  LP  CG+  +  ISR INC  +
Sbjct  90   LKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>emb|CDX93316.1| BnaC04g45800D [Brassica napus]
Length=118

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR---  310
            C  V+  +  C+GY+ QGG+   P  CC     L        DRQ AC CL+ TAAR   
Sbjct  29   CGTVNSNVAPCIGYITQGGTL--PGACCTGVSKLNSMARTTPDRQQACRCLE-TAARALG  85

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P++ A  AA +P++CG+   F IS + NC NV
Sbjct  86   PNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>prf||2115353A lipid transfer protein
Length=115

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C QV   +  C+ Y +G  A PP  CC   + L     +  D+QAAC+C+K+ A    +
Sbjct  28   SCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAG--GL  85

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             +  AA +P  CG+   + IS  ++C  +
Sbjct  86   NSGKAAGIPSMCGVSVPYAISASVDCSKI  114



>ref|NP_001236847.1| uncharacterized protein LOC100306055 [Glycine max]
 gb|ACU14045.1| unknown [Glycine max]
Length=139

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAARPDI  319
            +C  V   +  C+ YL  GS  PP  CC   + L       +D++AAC C+K+T+   +I
Sbjct  50   SCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSINI  109

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
             + +A  LP +CG+     IS + +C  V
Sbjct  110  NSQLAQALPGNCGITLPVAISPNADCSKV  138



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  CL Y +GGS  P   CC   R L        DR+ AC CLK  A     
Sbjct  28   SCGQVNSAVSPCLSYARGGSG-PSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISG  86

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C +V
Sbjct  87   LNAGNAASIPSKCGVSIPYTISPSIDCSSV  116



>ref|XP_010527037.1| PREDICTED: non-specific lipid-transfer protein 1-like [Tarenaya 
hassleriana]
Length=115

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 5/116 (4%)
 Frame = +2

Query  68   MNPAMAPVIFITavlaalqlgqal-NCHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDL  241
            M  AM P++ I  ++ A+        C  V+  +  C GY+ +GG+  P   CC   + L
Sbjct  1    MKSAMLPLLTIMMLILAISERGNAITCQAVESTLMPCAGYIVKGGT--PSSKCCAGLKSL  58

Query  242  LRQTPAQQDRQAACECLKATAAR-PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
                  + DRQAAC CLK  A+R P +K D A+ LP+ CG+      +R  NC +V
Sbjct  59   KAMARKKADRQAACRCLKDVASRYPGVKDDNASRLPKKCGVDFGVPFTRKTNCNSV  114



>emb|CAH04986.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 42/89 (47%), Gaps = 1/89 (1%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PDI  319
            C  V   I  C+ Y  G ++ P   CC   R L  +     DRQAAC CLK  A     I
Sbjct  28   CSDVTSAIAPCMSYATGQASSPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSFNGI  87

Query  320  KADVAAVLPRSCGLISSFTISRDINCQNV  406
                AA +P  CG+  SF I+  +NC N+
Sbjct  88   SMGNAANIPGKCGVSVSFPINNSVNCNNL  116



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            +C QV+  +  CL Y +GGS  P   CC   R+L        DR+ AC CLK  A     
Sbjct  29   SCGQVNSAVSPCLSYPRGGSG-PSAACCSGVRNLNSAASTTADRRTACNCLKNVAGSISG  87

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C +V
Sbjct  88   LNAGNAASIPSKCGVSIPYTISPSIDCSSV  117



>sp|Q42641.1|NLTPA_BRAOT RecName: Full=Non-specific lipid-transfer protein A; Short=LTP 
A; AltName: Full=Wax-associated protein 9A; Flags: Precursor 
[Brassica oleracea var. italica]
 gb|AAA73945.1| lipid transfer protein [Brassica oleracea var. italica]
Length=118

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR---  310
            C  V+  +  C+GY+ QGG+   P  CC     L        DRQ AC CL+ TAAR   
Sbjct  29   CGTVNSNVAPCIGYITQGGTL--PGACCTGVSKLNSMARTTPDRQQACRCLE-TAARALG  85

Query  311  PDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
            P++ A  AA +P++CG+   F IS + NC NV
Sbjct  86   PNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|AAB33172.1| acyl-binding/lipid-transfer protein isoform I, AB/LTP I [rape, 
seedlings, Peptide, 93 aa]
 prf||2107184C acyl-binding/lipid transfer protein:ISOTYPE=I
Length=93

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 48/93 (52%), Gaps = 7/93 (8%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCD---SFRDLLRQTPAQQDRQAACECLKATA-A  307
            +C  V  Y+  C+GYL   +   P  CC    S  ++ R TP   DRQ AC CL   A A
Sbjct  3    SCGTVSGYVAPCIGYLAQNAPAVPTACCSGVTSLNNMARTTP---DRQQACRCLVGAANA  59

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P I    AA LP++CG+   + IS+  NC +V
Sbjct  60   LPTINVARAAGLPKACGVNIPYKISKTTNCNSV  92



>ref|XP_009607860.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 4/87 (5%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYL-QGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR-PD  316
            C QVD  +  C+ YL QGG  +P   CC+    L        D++AAC C+KA A +  +
Sbjct  27   CGQVDASLAPCIPYLTQGG--NPGAACCNGVNALKGMAQNTADKRAACNCVKAAANKYAN  84

Query  317  IKADVAAVLPRSCGLISSFTISRDINC  397
            +K D A  LP  CG+    T+S+ +NC
Sbjct  85   LKEDAAQALPSKCGVTLDITVSKSVNC  111



>gb|ACJ62381.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--PD  316
            C QV   I  CL Y +G ++ P   CC   R+L        DR+AAC CLK  AAR    
Sbjct  32   CGQVSSAIAPCLSYARGTASGPSTSCCSGVRNLQSAASTAADRRAACNCLK-NAARGVSG  90

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS   +C  V
Sbjct  91   LNAGNAASIPSKCGVSIPYTISTSTDCSRV  120



>gb|ABA91221.2| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=120

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +2

Query  143  CHQVDLYIDSCLGYLQGGSAHPPMPCCDSFRDLLRQTPAQQDRQAACECLKATAAR--PD  316
            C QV+  +  CL Y +GG A P   CC   R L     +  DR+ AC CLK  AAR    
Sbjct  32   CGQVNSAVGPCLTYARGG-AGPSAACCSGVRSLKAAASSTADRRTACNCLK-NAARGIKG  89

Query  317  IKADVAAVLPRSCGLISSFTISRDINCQNV  406
            + A  AA +P  CG+   +TIS  I+C  V
Sbjct  90   LNAGNAASIPSKCGVSVPYTISASIDCSRV  119



>sp|Q43304.1|NLTPD_BRAOT RecName: Full=Non-specific lipid-transfer protein D; Short=LTP 
D; AltName: Full=Wax-associated protein 9D; Flags: Precursor 
[Brassica oleracea var. italica]
 gb|AAA32995.1| lipid transfer protein [Brassica oleracea]
 gb|AAA73948.1| lipid transfer protein [Brassica oleracea var. italica]
Length=118

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 48/93 (52%), Gaps = 7/93 (8%)
 Frame = +2

Query  140  NCHQVDLYIDSCLGYLQGGSAHPPMPCCD---SFRDLLRQTPAQQDRQAACECLKATA-A  307
            +C  V  Y+  C+GYL   +   P  CC    S  ++ R TP   DRQ AC CL   A A
Sbjct  28   SCGTVSGYVAPCIGYLAQNAPAVPTACCSGVTSLNNMARTTP---DRQQACRCLVGAANA  84

Query  308  RPDIKADVAAVLPRSCGLISSFTISRDINCQNV  406
             P I    AA LP++CG+   + IS+  NC +V
Sbjct  85   LPTINVARAAGLPKACGVNIPYKISKTTNCNSV  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507948461360