BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24691_g1_i3 len=614 path=[2134:0-77 3903:78-200 1064:201-248
2379:249-274 3810:275-279 2409:280-302 2432:303-332 3984:333-336
1481:337-337 1482:338-426 3649:427-450 3064:451-483 2602:484-504
4043:505-516 652:517-542 2658:543-547 1393:548-613]

Length=614
                                                                      Score     E

ref|XP_009785298.1|  PREDICTED: non-specific lipid-transfer prote...    100   2e-23   
ref|XP_009623063.1|  PREDICTED: non-specific lipid-transfer prote...  99.4    8e-23   
ref|XP_004233683.1|  PREDICTED: non-specific lipid-transfer prote...  98.6    1e-22   
ref|XP_006338457.1|  PREDICTED: non-specific lipid-transfer prote...  96.3    9e-22   
ref|XP_006437592.1|  hypothetical protein CICLE_v10033516mg           92.0    5e-20   
ref|XP_006451724.1|  hypothetical protein CICLE_v10010357mg           91.7    5e-20   
ref|XP_006485829.1|  PREDICTED: non-specific lipid-transfer prote...  91.3    9e-20   
ref|XP_006484285.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    2e-19   
ref|XP_006437824.1|  hypothetical protein CICLE_v10033852mg           90.1    2e-19   
ref|XP_002511594.1|  Nonspecific lipid-transfer protein A, putative   89.0    6e-19   Ricinus communis
ref|XP_002511596.1|  Nonspecific lipid-transfer protein A, putative   88.6    7e-19   Ricinus communis
ref|XP_006484581.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    8e-19   
gb|KDO70214.1|  hypothetical protein CISIN_1g043414mg                 87.0    3e-18   
ref|XP_006437630.1|  hypothetical protein CICLE_v10033367mg           85.5    1e-17   
ref|XP_002527125.1|  Nonspecific lipid-transfer protein B, putative   84.3    3e-17   Ricinus communis
sp|P10973.1|NLTPA_RICCO  RecName: Full=Non-specific lipid-transfe...  80.9    3e-16   Ricinus communis
ref|XP_002527124.1|  Nonspecific lipid-transfer protein B, putative   81.3    4e-16   Ricinus communis
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              80.5    9e-16   
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
ref|XP_010540223.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
ref|XP_011031945.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
ref|XP_002283359.2|  PREDICTED: non-specific lipid-transfer prote...  79.7    1e-15   Vitis vinifera
ref|XP_010527034.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    1e-15   
gb|AAM00273.1|AF363506_1  lipid transfer protein 2                    79.7    2e-15   Euphorbia lagascae
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
ref|XP_006375125.1|  hypothetical protein POPTR_0014s04590g           79.0    3e-15   
gb|KDP34869.1|  hypothetical protein JCGZ_09157                       78.6    4e-15   
ref|XP_010106165.1|  Auxin response factor 6                          84.0    5e-15   
ref|XP_010527037.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
emb|CAN72931.1|  hypothetical protein VITISV_020613                   78.2    6e-15   Vitis vinifera
ref|XP_011031956.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    7e-15   
gb|KDP28851.1|  hypothetical protein JCGZ_14622                       77.4    1e-14   
ref|XP_010523199.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_009773021.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|NP_001241103.1|  uncharacterized protein LOC100798112 precursor   76.6    2e-14   
gb|KEH22495.1|  Nodule Cysteine-Rich (NCR) secreted peptide           75.9    2e-14   
emb|CDY68862.1|  BnaCnng60800D                                        77.0    3e-14   
gb|KDP28819.1|  hypothetical protein JCGZ_14590                       75.9    3e-14   
emb|CDP14198.1|  unnamed protein product                              75.9    4e-14   
ref|XP_010447248.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    4e-14   
sp|P82007.2|NLTP1_HELAN  RecName: Full=Non-specific lipid-transfe...  75.9    4e-14   Helianthus annuus
emb|CDP15101.1|  unnamed protein product                              75.9    4e-14   
ref|XP_004229753.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    6e-14   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    74.7    1e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010437771.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    1e-13   
ref|NP_680758.3|  pathogenesis-related lipid-transfer family protein  74.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  74.3    1e-13   Triticum aestivum [Canadian hard winter wheat]
sp|P10974.1|NLTPB_RICCO  RecName: Full=Non-specific lipid-transfe...  73.9    1e-13   Ricinus communis
ref|XP_006468966.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    2e-13   
gb|KHG04165.1|  Non-specific lipid-transfer A                         74.3    2e-13   
ref|XP_002282792.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   Vitis vinifera
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
emb|CDP14199.1|  unnamed protein product                              73.9    2e-13   
ref|XP_007141467.1|  hypothetical protein PHAVU_008G198300g           73.9    2e-13   
ref|XP_007141461.1|  hypothetical protein PHAVU_008G197700g           73.9    2e-13   
ref|NP_001031782.1|  pathogenesis-related lipid-transfer family p...  73.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 73.6    3e-13   
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  73.2    4e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009796551.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    4e-13   
ref|XP_002869218.1|  predicted protein                                72.8    5e-13   
ref|XP_007140136.1|  hypothetical protein PHAVU_008G087000g           72.8    5e-13   
ref|XP_009591276.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    6e-13   
ref|XP_008229617.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    6e-13   
ref|XP_009788621.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    7e-13   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    7e-13   
ref|XP_002305878.2|  lipid transfer family protein                    72.4    7e-13   Populus trichocarpa [western balsam poplar]
emb|CDX72398.1|  BnaC07g44200D                                        72.0    1e-12   
ref|XP_010432572.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    1e-12   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        72.0    1e-12   Vitis cinerea var. helleri x Vitis vinifera
ref|XP_006446845.1|  hypothetical protein CICLE_v10017229mg           72.0    1e-12   
ref|XP_007161356.1|  hypothetical protein PHAVU_001G062300g           72.0    1e-12   
ref|XP_009607859.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
ref|XP_007141469.1|  hypothetical protein PHAVU_008G198500g           72.0    1e-12   
gb|AGW21344.1|  lipid transfer protein                                71.6    1e-12   
gb|ABK96515.1|  unknown                                               71.6    1e-12   Populus trichocarpa x Populus deltoides
gb|ADR66953.1|  non-specific lipid transfer protein                   71.2    2e-12   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         71.2    2e-12   Retama raetam [retem]
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  71.2    2e-12   Prunus avium [gean]
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       71.2    2e-12   
ref|XP_006412367.1|  hypothetical protein EUTSA_v10026585mg           71.2    2e-12   
gb|ADR66942.1|  non-specific lipid transfer protein                   70.9    2e-12   
emb|CDY68127.1|  BnaC03g71570D                                        71.2    2e-12   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  70.9    2e-12   Prunus dulcis [sweet almond]
emb|CDY46122.1|  BnaA03g52460D                                        70.9    2e-12   
gb|AGH27866.1|  lipid transfer protein precursor                      70.9    3e-12   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 70.9    3e-12   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 70.9    3e-12   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
gb|ADR66950.1|  non-specific lipid transfer protein                   70.5    3e-12   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       70.5    4e-12   Artemisia vulgaris [common wormwood]
ref|XP_009138182.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
gb|ADR66943.1|  non-specific lipid transfer protein                   70.1    4e-12   
ref|XP_007141462.1|  hypothetical protein PHAVU_008G197800g           70.1    4e-12   
gb|ABG54494.1|  putative allergen Rub i 3                             70.1    4e-12   Rubus idaeus [European raspberry]
ref|XP_009108805.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
gb|AGW21333.1|  lipid transfer protein                                70.1    4e-12   
ref|XP_004970395.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
emb|CDX88695.1|  BnaA03g09540D                                        70.1    5e-12   
gb|AGH27864.1|  lipid transfer protein precursor                      70.1    5e-12   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           70.1    5e-12   
ref|XP_009607860.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
gb|AGH27863.1|  lipid transfer protein precursor                      69.7    5e-12   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
gb|AFM35695.1|  nonspecific lipid transfer protein                    69.7    6e-12   
gb|ACE07186.1|  Art v 3.0201 allergen precursor                       69.7    7e-12   Artemisia vulgaris [common wormwood]
ref|XP_009607858.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    7e-12   
gb|ABK94706.1|  unknown                                               69.3    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009607862.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    7e-12   
ref|XP_007217372.1|  hypothetical protein PRUPE_ppa021924mg           69.3    8e-12   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 69.3    8e-12   
gb|ADR66949.1|  non-specific lipid transfer protein                   69.3    8e-12   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        69.3    8e-12   
gb|KHG13955.1|  Non-specific lipid-transfer 1                         68.9    9e-12   
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  69.3    9e-12   
gb|ACE07189.1|  Art v 3 allergen precursor                            68.9    1e-11   Artemisia vulgaris [common wormwood]
emb|CDY45038.1|  BnaA08g11810D                                        69.7    1e-11   
pdb|1BWO|A  Chain A, The Crystal Structure Of Wheat Non-Specific ...  68.2    1e-11   
gb|ABK41612.1|  lipid transfer protein                                68.9    1e-11   Lilium longiflorum [Easter lily]
ref|XP_006347954.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            69.3    1e-11   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               68.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           68.9    1e-11   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  68.6    1e-11   Ricinus communis
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|ACM78614.1|  lipid transfer protein 2                              68.6    2e-11   Tamarix hispida
gb|EMT21909.1|  Non-specific lipid-transfer protein 4.1               69.3    2e-11   
gb|KFK29949.1|  hypothetical protein AALP_AA7G198800                  68.6    2e-11   
ref|XP_006285119.1|  hypothetical protein CARUB_v10006452mg           68.6    2e-11   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           68.6    2e-11   
ref|XP_009798115.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_003560704.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 68.6    2e-11   
ref|XP_009607362.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    68.2    2e-11   Prunus persica
gb|AAC63372.1|  lipid transfer protein                                68.2    2e-11   Brassica oleracea
gb|EYU34081.1|  hypothetical protein MIMGU_mgv1a024111mg              67.8    2e-11   
dbj|BAB09776.1|  lipid transfer protein-like                          67.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492552.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    3e-11   
gb|AFI61838.1|  harmalin                                              67.8    3e-11   
ref|XP_007141468.1|  hypothetical protein PHAVU_008G198400g           67.8    3e-11   
ref|XP_003595853.1|  Non-specific lipid-transfer protein              67.4    3e-11   
gb|ACE07187.1|  Art v 3 allergen precursor                            67.4    4e-11   Artemisia vulgaris [common wormwood]
sp|P86137.2|NLTP1_ACTDE  RecName: Full=Non-specific lipid-transfe...  67.0    4e-11   Actinidia deliciosa [Chinese gooseberry]
emb|CAC86258.1|  lipid transfer protein                               67.4    4e-11   Fragaria x ananassa
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            67.4    4e-11   
gb|AAT80649.1|  lipid transfer protein precursor                      67.4    4e-11   Malus domestica [apple tree]
pdb|1CZ2|A  Chain A, Solution Structure Of Wheat Ns-Ltp Complexed...  66.6    4e-11   
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  67.4    4e-11   Brassica oleracea var. italica [asparagus broccoli]
gb|AAL27855.1|  lipid transfer protein precursor                      67.4    5e-11   Davidia involucrata
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
gb|AEG79730.2|  lipid transfer protein precursor                      67.4    5e-11   
gb|AFK35133.1|  unknown                                               67.0    5e-11   
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  67.0    5e-11   Cicer arietinum [garbanzo]
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
gb|KDP35110.1|  hypothetical protein JCGZ_10952                       67.0    5e-11   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    66.6    6e-11   
dbj|BAD54259.1|  hypothetical protein                                 67.0    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAY84146.1|  lipid transfer protein                                66.6    7e-11   Catharanthus roseus [chatas]
gb|ABX56711.1|  LTP isoallergen 1 precursor                           66.6    7e-11   Arachis hypogaea [goober]
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    7e-11   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    8e-11   
emb|CDX93316.1|  BnaC04g45800D                                        66.6    8e-11   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           66.6    8e-11   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         66.2    8e-11   Malus domestica [apple tree]
gb|AII99867.1|  protease inhibitor/seed storage/ltp family            66.6    9e-11   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         66.2    9e-11   Fragaria x ananassa
ref|NP_001275802.1|  lipid-transfer protein precursor                 66.2    9e-11   
emb|CDP07650.1|  unnamed protein product                              66.2    9e-11   
ref|XP_006400973.1|  hypothetical protein EUTSA_v10015064mg           66.2    9e-11   
gb|AGC08425.1|  lipid transfer protein                                66.6    9e-11   
gb|AFM39014.1|  lipid transfer protein                                66.2    1e-10   
gb|AAB33171.1|  acyl-binding/lipid-transfer protein isoform II, A...  65.5    1e-10   
ref|XP_004492553.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
ref|XP_004229752.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
gb|AFK45186.1|  unknown                                               65.9    1e-10   
emb|CDM80997.1|  unnamed protein product                              65.9    1e-10   
gb|AAR22488.1|  allergen Mal d 3                                      65.9    1e-10   Malus domestica [apple tree]
sp|P85206.1|NLTP2_ACTDE  RecName: Full=Non-specific lipid-transfe...  65.5    1e-10   
gb|ADR66946.1|  non-specific lipid transfer protein                   65.9    1e-10   
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AEC04836.1|  lipid transfer protein                                65.9    1e-10   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  66.6    1e-10   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  65.9    1e-10   
ref|NP_001159077.1|  nonspecific lipid-transfer protein 3 precursor   65.9    2e-10   Zea mays [maize]
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_011089509.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
gb|ADR66947.1|  non-specific lipid transfer protein                   65.5    2e-10   
emb|CDM80964.1|  unnamed protein product                              65.5    2e-10   
ref|XP_009112488.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_011089499.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
gb|AAQ54611.1|  Gly d Mal d 3-like protein                            65.5    2e-10   Glycyphagus domesticus
ref|XP_006347955.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             65.5    2e-10   Populus trichocarpa [western balsam poplar]
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  65.5    2e-10   Hordeum vulgare [barley]
ref|XP_006400974.1|  hypothetical protein EUTSA_v10014841mg           66.2    2e-10   
emb|CAB53447.1|  non-specific lipid transfer protein                  65.5    2e-10   Brassica napus [oilseed rape]
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
emb|CDY32650.1|  BnaA02g07120D                                        65.1    2e-10   
emb|CDP09436.1|  unnamed protein product                              65.1    2e-10   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 65.1    2e-10   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
gb|ACI47547.1|  nonspecific lipid transfer protein                    65.1    2e-10   Juglans regia
ref|XP_006298841.1|  hypothetical protein CARUB_v10014953mg           65.1    3e-10   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         65.1    3e-10   Fragaria x ananassa
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
gb|KFK40228.1|  hypothetical protein AALP_AA3G347300                  65.1    3e-10   
ref|XP_009788622.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
ref|XP_007141470.1|  hypothetical protein PHAVU_008G198600g           64.7    3e-10   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  65.1    3e-10   Gerbera hybrid cultivar
gb|KEH29195.1|  Lipid transfer protein                                65.9    3e-10   
gb|ACE80968.1|  putative allergen Pru du 3.03                         65.1    3e-10   Prunus dulcis x Prunus persica
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           66.2    3e-10   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  64.7    3e-10   Hordeum vulgare [barley]
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  64.7    3e-10   Hordeum vulgare [barley]
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 65.1    3e-10   
gb|AHG99490.1|  lipid-transfer protein                                64.7    3e-10   
gb|ACE80969.1|  putative allergen Pru p 3.03                          64.7    3e-10   Prunus dulcis x Prunus persica
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           64.7    3e-10   
ref|XP_002884130.1|  protease inhibitor/seed storage/lipid transf...  64.7    3e-10   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             65.1    3e-10   
gb|EYU42244.1|  hypothetical protein MIMGU_mgv1a024175mg              64.7    3e-10   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_011094394.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_006409161.1|  hypothetical protein EUTSA_v10022915mg           64.7    3e-10   
gb|AAL25839.1|  lipid transfer precursor protein                      64.7    4e-10   Hevea brasiliensis [Para rubber tree]
ref|XP_003605266.1|  Non-specific lipid-transfer protein              64.7    4e-10   
ref|XP_007141473.1|  hypothetical protein PHAVU_008G198900g           64.7    4e-10   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  65.1    4e-10   
emb|CBW38504.1|  lipid transfer protein                               64.3    4e-10   
ref|XP_009126703.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              64.7    4e-10   
ref|XP_011089414.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
emb|CDY18379.1|  BnaA04g22080D                                        64.3    4e-10   
gb|KDP28820.1|  hypothetical protein JCGZ_14591                       64.3    4e-10   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         64.3    4e-10   Fragaria x ananassa
gb|ADV02773.1|  lipid transfer protein 1b                             63.9    4e-10   
gb|EYU37388.1|  hypothetical protein MIMGU_mgv1a018287mg              64.3    4e-10   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  64.3    5e-10   Hordeum vulgare [barley]
emb|CDY60288.1|  BnaA09g52860D                                        64.3    5e-10   
dbj|BAK05317.1|  predicted protein                                    64.3    5e-10   
emb|CBW38503.1|  lipid transfer protein                               63.9    5e-10   
gb|ADR66948.1|  non-specific lipid transfer protein                   64.3    5e-10   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           64.7    5e-10   
emb|CAA42832.1|  LTP 1                                                64.3    7e-10   Hordeum vulgare [barley]
ref|NP_179428.1|  non-specific lipid-transfer protein 8               63.9    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    7e-10   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  63.2    7e-10   
emb|CBW38499.1|  lipid transfer protein                               63.5    7e-10   
ref|XP_006842465.1|  hypothetical protein AMTR_s00077p00067510        63.9    7e-10   
gb|KDP28846.1|  hypothetical protein JCGZ_14617                       63.2    7e-10   
emb|CAB96876.2|  pru p 1                                              63.2    7e-10   Prunus persica
gb|AGC08421.1|  lipid transfer protein                                64.3    7e-10   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               63.5    8e-10   
gb|AFK46170.1|  unknown                                               63.9    8e-10   
prf||2115353A  lipid transfer protein                                 63.5    8e-10
sp|Q43304.1|NLTPD_BRAOT  RecName: Full=Non-specific lipid-transfe...  63.5    8e-10   Brassica oleracea var. italica [asparagus broccoli]
gb|AES87466.2|  Lipid transfer protein                                63.9    8e-10   
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           63.5    8e-10   
sp|P83434.1|NLTP1_VIGRR  RecName: Full=Non-specific lipid-transfe...  63.2    8e-10   Vigna radiata var. radiata [golden gram]
gb|AAQ74627.1|  lipid transfer protein I                              63.5    8e-10   Vigna radiata [mung bean]
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    8e-10   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    8e-10   
ref|XP_009616321.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    8e-10   
gb|ABB90546.1|  lipid transfer protein                                63.5    9e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CBW38497.1|  lipid transfer protein                               63.2    9e-10   
ref|NP_001067782.1|  Os11g0427800                                     63.5    9e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AFK44274.1|  unknown                                               63.5    9e-10   
gb|AEI70829.1|  non-specific lipid-transfer protein                   63.5    9e-10   
gb|AFK41091.1|  unknown                                               63.9    9e-10   
gb|ABY54820.1|  lipid transfer protein                                63.5    9e-10   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  63.5    9e-10   Hordeum vulgare [barley]
gb|AEI70827.1|  non-specific lipid-transfer protein                   63.5    9e-10   
ref|XP_002864627.1|  predicted protein                                63.2    1e-09   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           63.2    1e-09   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           63.2    1e-09   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  62.8    1e-09   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  63.2    1e-09   
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
gb|ABF06565.1|  non-specific lipid transfer-like protein              63.2    1e-09   
ref|XP_008342316.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   62.8    1e-09   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
gb|EEE65837.1|  hypothetical protein OsJ_21599                        63.2    1e-09   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   
ref|XP_011069906.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-09   
gb|AAB33172.1|  acyl-binding/lipid-transfer protein isoform I, AB...  62.4    2e-09   
emb|CDM80963.1|  unnamed protein product                              62.8    2e-09   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  62.8    2e-09   
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    62.8    2e-09   
gb|ABA29446.1|  non-specific lipid transfer protein                   62.8    2e-09   
ref|NP_001232879.1|  nonspecific lipid-transfer protein 3 precursor   62.8    2e-09   
gb|AAB70539.1|  lipid transfer protein LPT II                         62.8    2e-09   
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            62.8    2e-09   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              62.4    2e-09   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   62.8    2e-09   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           62.4    2e-09   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-09   
gb|AAQ96338.1|  lipid transfer protein                                62.8    2e-09   
emb|CDY60751.1|  BnaA05g34760D                                        62.8    2e-09   
gb|ACG31565.1|  nonspecific lipid-transfer protein 3 precursor        62.4    2e-09   
ref|XP_006482792.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-09   
ref|XP_002877812.1|  hypothetical protein ARALYDRAFT_485511           62.4    2e-09   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    62.4    2e-09   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  62.4    2e-09   
gb|KFK36763.1|  lipid transfer protein                                62.4    2e-09   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  62.4    2e-09   
ref|XP_003623615.1|  Non-specific lipid-transfer protein              62.4    2e-09   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
gb|ABF74563.1|  lipid transfer protein                                62.4    2e-09   
ref|XP_009126702.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
ref|XP_003522131.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    3e-09   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               62.0    3e-09   
ref|NP_568905.1|  non-specific lipid-transfer protein 3               62.0    3e-09   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           62.4    3e-09   
ref|NP_001147136.1|  LOC100280743 precursor                           62.4    3e-09   
ref|XP_009132605.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
gb|ADP37976.1|  lipid transfer protein                                62.0    3e-09   
emb|CDX91474.1|  BnaC04g06760D                                        62.4    3e-09   
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       62.0    3e-09   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         62.0    3e-09   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           62.4    3e-09   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
gb|AAM22768.1|  lipid transfer protein                                61.2    3e-09   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  61.6    3e-09   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
ref|XP_003605269.1|  Non-specific lipid-transfer protein              62.8    3e-09   
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|NP_001238031.1|  uncharacterized protein LOC100500178 precursor   62.0    3e-09   
gb|ACG25505.1|  nonspecific lipid-transfer protein 3 precursor        62.0    3e-09   
gb|ACG45901.1|  nonspecific lipid-transfer protein 3 precursor        62.4    4e-09   
emb|CDP12680.1|  unnamed protein product                              62.0    4e-09   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
gb|ACP43542.1|  lipid transfer protein                                61.6    4e-09   
gb|AEN70936.1|  lipid transfer protein                                61.6    4e-09   
gb|EYU42349.1|  hypothetical protein MIMGU_mgv1a016557mg              61.6    4e-09   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
gb|AET05733.1|  lipid transfer protein isoform d                      61.2    4e-09   
sp|Q42614.1|NLTP1_BRANA  RecName: Full=Non-specific lipid-transfe...  61.6    4e-09   
gb|ADK60918.1|  lipid transfer protein                                61.6    4e-09   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   61.6    4e-09   
gb|AFW86765.1|  non-specific lipid-transfer protein                   61.6    4e-09   
gb|ABK22458.1|  unknown                                               61.6    4e-09   
gb|AGH13363.1|  lipid transfer protein                                61.2    4e-09   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
ref|XP_010690794.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
gb|AES79814.2|  Lipid transfer protein                                62.0    5e-09   
gb|ACL01093.1|  lipid transfer protein                                61.6    5e-09   
gb|EYU42353.1|  hypothetical protein MIMGU_mgv1a016579mg              61.6    5e-09   
gb|ABK21290.1|  unknown                                               61.6    5e-09   
ref|XP_009359208.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-09   
ref|NP_001148872.1|  nonspecific lipid-transfer protein 3 precursor   62.0    5e-09   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  61.2    5e-09   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         61.2    5e-09   
gb|AFR43276.1|  lipid transfer protein precursor                      61.2    5e-09   
ref|XP_003533715.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-09   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              65.1    5e-09   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        61.2    5e-09   
ref|XP_010517149.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-09   
gb|AGH32496.1|  non-specific lipid transfer protein                   61.2    5e-09   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               61.2    5e-09   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-09   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              61.2    5e-09   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            61.2    6e-09   
gb|AAC49860.1|  non-specific lipid transfer protein PvLTP-24          61.2    6e-09   
gb|KEH29225.1|  Lipid transfer protein                                61.2    6e-09   
emb|CDY51220.1|  BnaC09g09750D                                        61.2    6e-09   
ref|XP_010467649.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
sp|Q42615.1|NLTP2_BRANA  RecName: Full=Non-specific lipid-transfe...  61.2    6e-09   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  60.8    6e-09   
emb|CBW38502.1|  lipid transfer protein                               60.8    6e-09   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  60.5    6e-09   
gb|AEI70828.1|  non-specific lipid-transfer protein                   61.2    6e-09   
ref|XP_010414245.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
ref|XP_009396870.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             61.2    6e-09   
ref|XP_010553199.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   61.2    6e-09   
ref|XP_006403901.1|  hypothetical protein EUTSA_v10010826mg           61.2    6e-09   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   60.8    6e-09   
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    6e-09   
gb|ABO28527.1|  lipid transfer protein                                60.8    7e-09   
gb|ACN31691.1|  unknown                                               62.8    7e-09   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  60.5    7e-09   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
ref|NP_001176316.1|  Os11g0115466                                     60.8    7e-09   
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           60.8    7e-09   
gb|KDP22770.1|  hypothetical protein JCGZ_00357                       60.8    7e-09   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  60.8    7e-09   
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  60.8    8e-09   
sp|Q42616.1|NLTP3_BRANA  RecName: Full=Non-specific lipid-transfe...  60.8    8e-09   
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   60.8    8e-09   
ref|XP_008244927.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    8e-09   
emb|CBW38501.1|  lipid transfer protein                               60.5    8e-09   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       60.8    8e-09   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    8e-09   
ref|NP_001065986.1|  Os12g0115000                                     60.5    8e-09   
dbj|BAO51648.1|  lipid transfer protein                               60.8    8e-09   
ref|XP_009141748.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    8e-09   
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  60.8    8e-09   
gb|KHG09722.1|  Non-specific lipid-transfer                           60.8    9e-09   
ref|XP_009141746.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    9e-09   
gb|AER92599.1|  putative lipid transfer protein                       60.8    9e-09   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   60.5    9e-09   
emb|CDY38865.1|  BnaA03g13140D                                        60.5    9e-09   
gb|AAA03284.1|  CW21=non-specific lipid transfer protein              60.1    1e-08   
gb|AFR43289.1|  lipid transfer protein precursor                      60.5    1e-08   
gb|AAB33170.1|  acyl-binding/lipid-transfer protein isoform III, ...  60.1    1e-08   
sp|Q42642.1|NLTPB_BRAOT  RecName: Full=Non-specific lipid-transfe...  60.5    1e-08   
gb|AFR43295.1|  lipid transfer protein precursor                      60.5    1e-08   
gb|AEN70935.1|  lipid transfer protein                                60.5    1e-08   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            60.5    1e-08   
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    60.5    1e-08   
gb|ACQ42221.1|  lipid transfer protein                                60.5    1e-08   
gb|ACP30545.1|  lipid transfer protein precursor                      60.5    1e-08   
gb|AAA74624.1|  lipid transfer protein precursor                      60.5    1e-08   
gb|AFR43288.1|  lipid transfer protein precursor                      60.5    1e-08   
emb|CDY02883.1|  BnaC02g10060D                                        60.1    1e-08   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
gb|AFV30232.1|  lipid transfer protein                                60.1    1e-08   
gb|KHN12008.1|  Non-specific lipid-transfer protein A                 60.1    1e-08   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    60.1    1e-08   
emb|CAA69949.1|  lipid transfer protein                               60.1    1e-08   
prf||2115353B  lipid transfer protein                                 60.1    1e-08
gb|AEV23220.1|  stigma/stylar cysteine-rich adhesin                   60.1    1e-08   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  60.1    1e-08   
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    60.1    1e-08   
ref|NP_001236359.1|  uncharacterized protein LOC100306531 precursor   60.1    1e-08   
gb|AAB70538.1|  lipid transfer protein                                60.1    1e-08   
gb|EYU42354.1|  hypothetical protein MIMGU_mgv1a016560mg              60.1    1e-08   
gb|KDP21875.1|  hypothetical protein JCGZ_00662                       60.1    1e-08   
gb|AEN70917.1|  lipid transfer protein                                60.1    1e-08   
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    60.1    2e-08   
gb|AAT80650.1|  lipid transfer protein precursor                      59.7    2e-08   
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-08   
gb|AAM64220.1|AF517548_1  lipid transfer protein                      59.3    2e-08   
gb|AFR43285.1|  lipid transfer protein precursor                      60.1    2e-08   
ref|XP_004972928.1|  PREDICTED: probable non-specific lipid-trans...  60.1    2e-08   
gb|AAB80805.1|  PrLTP1                                                60.1    2e-08   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  59.7    2e-08   
gb|AAT80652.1|  lipid transfer protein precursor                      59.7    2e-08   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  59.7    2e-08   
ref|XP_006836299.1|  hypothetical protein AMTR_s00092p00020690        59.7    2e-08   
gb|ADV02772.1|  lipid transfer protein 1a                             59.7    2e-08   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           59.7    2e-08   
ref|XP_007052300.1|  Bifunctional inhibitor/lipid-transfer protei...  60.5    2e-08   
gb|ADE77948.1|  unknown                                               60.1    2e-08   
gb|KHN33234.1|  Non-specific lipid-transfer protein                   60.8    2e-08   
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            59.7    2e-08   
gb|ABI26087.1|  lipid transfer protein precursor                      59.7    2e-08   
ref|XP_009396875.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
gb|ADR66945.1|  non-specific lipid transfer protein                   59.7    2e-08   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
ref|NP_001268120.1|  lipid transfer protein precursor                 59.7    2e-08   
gb|ACJ62320.1|  lipid-transfer protein                                59.7    2e-08   
ref|XP_003623596.1|  Non-specific lipid-transfer protein              60.8    2e-08   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  59.7    2e-08   
emb|CAN76145.1|  hypothetical protein VITISV_034315                   60.1    2e-08   
ref|XP_011089487.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
gb|AAD09107.1|  nonspecific lipid-transfer protein precursor          59.3    2e-08   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
gb|KHG09723.1|  Non-specific lipid-transfer                           59.7    2e-08   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           59.7    2e-08   
gb|AEI70830.1|  non-specific lipid-transfer protein                   59.3    2e-08   
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  58.9    2e-08   
gb|EYU42017.1|  hypothetical protein MIMGU_mgv1a016521mg              59.3    2e-08   
gb|ACJ62316.1|  lipid-transfer protein                                59.3    2e-08   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  59.3    3e-08   
emb|CAB96874.1|  mal d 3                                              58.9    3e-08   
gb|KFK36744.1|  hypothetical protein AALP_AA4G164000                  59.3    3e-08   
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    3e-08   
ref|XP_003623613.1|  Non-specific lipid-transfer protein              59.3    3e-08   
ref|XP_006295252.1|  hypothetical protein CARUB_v10024340mg           59.3    3e-08   
ref|XP_004965551.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    3e-08   
emb|CDX90643.1|  BnaA03g41380D                                        59.7    3e-08   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  59.3    3e-08   
ref|XP_003516420.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    3e-08   
ref|XP_010109652.1|  Non-specific lipid-transfer protein              59.7    3e-08   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  59.3    3e-08   
ref|XP_010690792.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    3e-08   
gb|EYU42355.1|  hypothetical protein MIMGU_mgv1a021081mg              58.9    3e-08   
ref|XP_007206161.1|  hypothetical protein PRUPE_ppa013565mg           59.3    3e-08   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    3e-08   



>ref|XP_009785298.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=112

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+ +  VLA V+LG+AI+C  VD  +  C+ YL +GG +P   CCD  + L+  TPTQQD
Sbjct  6    VVTLLMVLALVKLGEAINCGQVDATLVPCVPYLTQGG-NPTGPCCDGVKRLIAMTPTQQD  64

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ+ACEC+K  AAR  ++K D A+ LP  CG+ ++I IS   NC+++
Sbjct  65   RQDACECMKTAAARYTNLKPDAATNLPSRCGVTTNIPISPTTNCKSI  111



>ref|XP_009623063.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=112

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 2/109 (2%)
 Frame = +2

Query  86   APVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
            A V+ +  VLA V+LG+AI+C  VD  +  C+ YL +GG  P   CCD  + ++  TPTQ
Sbjct  4    AAVVTLLMVLAVVKLGEAINCGQVDATLVPCVPYLTQGG-DPTGPCCDGVKRVIAMTPTQ  62

Query  266  QDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            QDRQ+ACEC+K  AAR  ++K D A+ LP  CG+ ++I IS   NC+++
Sbjct  63   QDRQDACECVKTAAARYTNLKPDAATNLPSRCGVTTNIPISATTNCKSI  111



>ref|XP_004233683.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=112

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V     ++  V+LG++I+C  V   ++ C+ YL +GG  P + CCD  + ++  TPTQQD
Sbjct  6    VSLFMLLVVVVQLGESINCGEVGGALAPCVPYLTQGG-DPSVSCCDGVKKVVETTPTQQD  64

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ ACEC+K+ AAR P++K D AS LP  CGL + I IS  INC++V
Sbjct  65   RQVACECMKSAAARYPNVKPDAASNLPSRCGLTTPIPISPTINCKSV  111



>ref|XP_006338457.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Solanum 
tuberosum]
Length=111

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 71/106 (67%), Gaps = 2/106 (2%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDR  274
            + ++  +  V+LG+AI+C  V   ++ C+ YL +GG  P   CCD  + +++ TPTQQDR
Sbjct  6    VLVSLFMLVVQLGEAINCGEVGGAVAPCVPYLTQGG-DPSGSCCDGVKKVVQLTPTQQDR  64

Query  275  QEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            Q+ACEC+KA AAR  ++K D AS LP  CG+ ++I IS   NC++V
Sbjct  65   QDACECMKAAAARYSNLKPDAASNLPSRCGITTAIPISPTTNCKSV  110



>ref|XP_006437592.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
 gb|ESR50832.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
Length=119

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGT  256
            +M  V+F    L   + G+A I C  VD  ++SC+ YL  GG +P   CCD  +NL   T
Sbjct  9    SMLVVVFAMVQLLVAKPGEAAITCGQVDSSLASCIPYLMGGGNNPAAACCDGLKNLKAIT  68

Query  257  PTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            PT  DR+ AC+C+KA AAR P+IK D AS LP  CG+   I IS+  NC
Sbjct  69   PTTADRRAACDCVKAAAARYPNIKEDAASSLPTKCGVQIGIPISKTTNC  117



>ref|XP_006451724.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|ESR64964.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|KDO48328.1| hypothetical protein CISIN_1g047252mg [Citrus sinensis]
Length=105

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +A V   V+ G+A+ C  VD  ++SC+ YL  GG+ P   CCD  +NL   TP   D
Sbjct  1    MLVVALVQIMVKPGEAVTCGQVDASLASCISYLTAGGS-PSAVCCDGLKNLKTITPPTAD  59

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            R+ AC+C+KA AAR P+IK D AS LP  CG+  +I ISR  NC
Sbjct  60   RRAACDCVKAAAARYPNIKEDAASSLPTKCGVQMNIPISRSTNC  103



>ref|XP_006485829.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=113

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   VIFIAAV----LAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            VIF+  V       V+ G+A+ C  VD  ++SC+ YL  GG+ P   CCD  +NL   TP
Sbjct  5    VIFVLVVAMFQFIMVKPGEAVTCGQVDASLASCISYLTAGGS-PSAVCCDGLKNLKTITP  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
               DR+ AC+C+KA AAR P+IK D AS LP  CG+  +I ISR  NC
Sbjct  64   PTADRRAACDCVKAAAARYPNIKEDAASSLPTKCGVQMNIPISRSTNC  111



>ref|XP_006484285.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=115

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +A +   V  G+AI C  VD  ++SC+ YL  GG +P   CCD  +NL   TP   D
Sbjct  9    LVLVALMQMIVTPGEAITCGQVDASLASCIPYLIAGG-NPDAACCDGVKNLKSITPATAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             + ACEC+KA AAR P+IK D AS LP  CG+  +I IS+  NC N+
Sbjct  68   GRAACECVKAAAARYPNIKEDAASSLPQKCGVQMNIPISKTTNCANI  114



>ref|XP_006437824.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
 gb|ESR51064.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
Length=113

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +A +   V  G+AI C  VD  ++SC+ YL  GG +P   CCD  +NL   TP   D
Sbjct  9    LVLVALMQMIVTPGEAITCGQVDASLASCIPYLIAGG-NPDAACCDGVKNLKSITPATAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            R+ ACEC+KA AAR P+IK D AS LP  CG+  +I IS+  NC
Sbjct  68   RRAACECVKAAAARYPNIKEDAASSLPQKCGVQMNIPISKTTNC  111



>ref|XP_002511594.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50263.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=113

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%), Gaps = 4/108 (4%)
 Frame = +2

Query  92   VIFIAAVLAAVRL---GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            VI +  VLA V+    G+A+DC  V+  ++SC+ +L  G A P   CC   +NL    PT
Sbjct  5    VISMLVVLAIVQFVMPGEAVDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPT  64

Query  263  QQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
              DR+ ACEC+KA AAR P IK D AS LP  CG+  +I IS+  NCQ
Sbjct  65   SADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQ  112



>ref|XP_002511596.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50265.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=115

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLR  250
            M  A+  ++ + A++  V  G+A+DC  V+  ++SC+ +L  G A P   CC   +NL  
Sbjct  1    MKGAVISMLVVLAIVQFVMPGEAVDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKT  60

Query  251  GTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              PT  DR+ AC+C+KA AAR P IK D AS LP  CG+  +I IS+  NCQ +
Sbjct  61   LAPTTADRRAACDCIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAI  114



>ref|XP_006484581.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=119

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 3/108 (3%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQ  268
            V+F    L A + G+A I C   D  ++SC+ YL  GG +P   CCD  +NL   TPT  
Sbjct  12   VVFAMVQLLAAKPGEAAITCGQEDSSLASCIPYLM-GGGNPAAACCDGLKNLKAITPTTA  70

Query  269  DRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            DR+ AC+C+KA AAR P+IK + AS LP  CG+   I IS+  NC N+
Sbjct  71   DRRAACDCVKAAAARNPNIKENAASSLPSKCGVQIDIPISKTTNCANI  118



>gb|KDO70214.1| hypothetical protein CISIN_1g043414mg [Citrus sinensis]
Length=113

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +A +   V  G+AI C  VD  ++SC+ YL  GG +P   CCD  +NL   TP   D
Sbjct  9    LVLVALMQMIVTPGEAITCGQVDASLASCIPYLIAGG-NPDAACCDGVKNLKSITPATAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
             + ACEC+KA AAR P+IK D AS LP  CG+  +I IS+  NC
Sbjct  68   GRAACECVKAAAARYPNIKEDAASSLPQKCGVQMNIPISKTTNC  111



>ref|XP_006437630.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
 gb|ESR50870.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
Length=117

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQ  268
            V+F    L A + G+A I C   D  ++SC+ YL  GG +P   CCD  +NL   TPT  
Sbjct  12   VVFAMVQLLAAKPGEAAITCGQEDSSLASCIPYLM-GGGNPAAACCDGLKNLKAITPTTA  70

Query  269  DRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            DR+ AC+C+KA AAR P+IK + AS LP  CG+   I IS+  NC
Sbjct  71   DRRAACDCVKAAAARNPNIKENAASSLPSKCGVQIDIPISKTTNC  115



>ref|XP_002527125.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35288.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G AIDC  V+L++ +C+ YL    + P + CC   RNL R  PT  DR+ AC+C+KA AA
Sbjct  23   GVAIDCAQVNLLLGTCMPYLIGFDSSPSLACCAGVRNLKRLAPTTADRRVACDCVKAAAA  82

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            R P+I+ D AS LP  CG+  +I +S    CQ
Sbjct  83   RHPNIRDDAASTLPNKCGVDFNIPVSNTTKCQ  114



>sp|P10973.1|NLTPA_RICCO RecName: Full=Non-specific lipid-transfer protein A; Short=NS-LTP 
A; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
 prf||1204170A protein,nonspecific lipid transfer
Length=92

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-P  316
            +DC  V+  ++SC+ +L  G A P   CC   +NL    PT  DR+ ACEC+KA AAR P
Sbjct  1    VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFP  60

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             IK D AS LP  CG+  +I IS+  NCQ +
Sbjct  61   TIKQDAASSLPKKCGVDINIPISKTTNCQAI  91



>ref|XP_002527124.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35287.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 2/113 (2%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRL-GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            M  A+  V+  A +L A+ + G+A++C  V+  +SSC+ +L      P + CC     L 
Sbjct  2    MKGAVISVLAAAIILQAMAMQGEAVNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELK  61

Query  248  RGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            R  PT +D++ ACEC+K  AAR P+I+ D AS LP+ CG+  ++ IS+  NC 
Sbjct  62   RLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCH  114



>gb|EYU34080.1| hypothetical protein MIMGU_mgv1a026469mg, partial [Erythranthe 
guttata]
Length=112

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+A+ C  +   +S CL YLQ GG  P   CC   R++     + QDRQ AC CLK
Sbjct  18   AASPGEAVSCGELQSSLSPCLSYLQAGGGEPSESCCGGVRSVTGSIQSTQDRQTACNCLK  77

Query  299  ATAARPDIKADVASVLPWSCGLASSITISRDINC  400
            + A+  +++ DVA+ LP  CG +  +TIS +++C
Sbjct  78   SAASSYNVRTDVAANLPGKCGASIGMTISPNVDC  111



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            +IFI  ++ A    QA+ C  V  ++  CLGYL+ GG+ P   CC   +NL     T+ D
Sbjct  13   LIFITMLVVAPHAAQALTCGQVLNMVMPCLGYLKNGGSIP-ATCCGGVKNLASSAKTKPD  71

Query  272  RQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ+AC+CLK  A    I  D A+ LP +CG+   I IS  I+C  V
Sbjct  72   RQQACKCLKPAAKSYGINYDRANKLPSACGVDYKINISPTIDCSTV  117



>ref|XP_010540223.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=119

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            AI C  VD  +  C+ YLQ GG+ P   CC   RN+   TPT  DRQ ACECLK  A   
Sbjct  28   AITCGEVDRSLVPCIVYLQNGGS-PSAACCAGVRNIEAITPTTTDRQVACECLKLAAQNY  86

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            P+ K D AS LP  CG+  +I IS+  NC+++
Sbjct  87   PNFKEDAASTLPAKCGVTFNIPISKATNCKSI  118



>ref|XP_011031945.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=118

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQ-EGGAHPPMECCDSFRNLLRGTPTQQ  268
            ++ +A V  +V+ G+AI C  V+  +++C+ YL  +GG  PP +CC     L     +  
Sbjct  10   LVVVAMVQFSVKPGEAITCGEVNSDLAACVSYLTGKGGDFPPPQCCAGVIKLKESAVSIA  69

Query  269  DRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            D+Q ACEC+KA AAR PDIK + AS LP  C + +   IS++ NC ++
Sbjct  70   DKQAACECVKAAAARIPDIKDEAASSLPAKCKVQADFPISKNFNCADI  117



>ref|XP_002283359.2| PREDICTED: non-specific lipid-transfer protein 1-like [Vitis 
vinifera]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 6/111 (5%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            VI +   LA V       +AI C  V+  ++ C+ YL  GGA P   CCD  R L   +P
Sbjct  5    VIALLVALAMVHFMAEPARAITCSDVNKALAPCVSYLTGGGA-PTSACCDGVRTLKSLSP  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DRQ AC+C K  A+R P+I+ D A+ LP  CG+ + I ISR  +C  V
Sbjct  64   TTSDRQTACQCAKDAASRNPNIREDAAAALPNKCGVQTDIPISRSTDCSTV  114



>ref|XP_010527034.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
 ref|XP_010527036.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+AI C   +L ++ CL YL  GG +P   CC   +NL + TP + DRQ  C CLK TA 
Sbjct  22   GKAITCSQANLSMAPCLSYLMNGG-NPSALCCKGMKNLKKATPEKDDRQTVCRCLKDTAT  80

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            + P IK D AS LP  CG+   +  S   NC +V
Sbjct  81   KNPKIKDDNASQLPGKCGVDFGVPFSTGTNCDSV  114



>gb|AAM00273.1|AF363506_1 lipid transfer protein 2 [Euphorbia lagascae]
Length=116

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+A+DC+ V+  +++C+ YL      PP  CCD  +NL +   T  DR+ ACEC+KA A+
Sbjct  23   GEAVDCKDVNSNLATCIPYLTGKDTAPPTTCCDGVKNLPKIAQTTADRRAACECVKAAAS  82

Query  311  RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
               I    AS LP  CG   +I IS+  NCQ +
Sbjct  83   HYTINEKAASSLPKDCGAVINIPISKTTNCQQI  115



>ref|XP_011098616.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Sesamum 
indicum]
Length=114

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+AI C  V   ++ CL YL  GG  P   CC   R+L     +QQDRQ AC C+K+ A+
Sbjct  22   GEAISCGDVQGSLAPCLAYL-TGGGEPSSSCCGGVRSLAGSLQSQQDRQTACYCMKSAAS  80

Query  311  RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
              ++++D AS LP  CG++  +T++ DI+C  V
Sbjct  81   SFNVRSDAASNLPGKCGVSIGMTVTPDIDCSKV  113



>ref|XP_006375125.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
 gb|ERP52922.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
Length=115

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQ-EGGAHPPMECCDSFRNLLRGTPTQQ  268
            ++ +A V   V+ G+AI C  V+  +S+C+ YL  +GG  PP +CC     L     +  
Sbjct  9    LVAVAMVQFMVKPGEAITCGDVNSDLSACVSYLTGKGGDFPPPQCCAGVNKLKESAVSIA  68

Query  269  DRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            D+Q ACEC+KA AAR PD+K + AS LP  C +   + IS++ NC
Sbjct  69   DKQAACECVKAAAARIPDMKDEAASSLPAKCKVQVDVPISKNFNC  113



>gb|KDP34869.1| hypothetical protein JCGZ_09157 [Jatropha curcas]
Length=114

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+A+DC  V+  ++ C+ +L  G   P   CC   +NL    PT  DR+ AC+C+KA A+
Sbjct  22   GEAVDCGQVNSSLAPCIPFLTGGDTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAAS  81

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQ  403
              P+I  D AS LP  CG+  +I IS++ NCQ
Sbjct  82   HYPNINEDSASSLPKKCGVEVTIPISKNTNCQ  113



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK-ATA  307
            GQAI C  VD+ +  CL YL+     PP+ECC+   ++ + TPT+ DRQ AC+C+K A  
Sbjct  25   GQAITCAQVDIALRPCLDYLKGTTGQPPVECCNGVASIKQNTPTKADRQAACQCVKRAAE  84

Query  308  ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +   +  D A  LP  C +  S+ ISR++NC  +
Sbjct  85   SLAGLSDDAAKNLPVRCNVQISVPISRNVNCNKM  118



>ref|XP_010527037.1| PREDICTED: non-specific lipid-transfer protein 1-like [Tarenaya 
hassleriana]
Length=115

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAV-RLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            M  AM P++ I  ++ A+   G AI CQ V+  +  C GY+ +GG  P  +CC   ++L 
Sbjct  1    MKSAMLPLLTIMMLILAISERGNAITCQAVESTLMPCAGYIVKGGT-PSSKCCAGLKSLK  59

Query  248  RGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 + DRQ AC CLK  A+R P +K D AS LP  CG+   +  +R  NC +V
Sbjct  60   AMARKKADRQAACRCLKDVASRYPGVKDDNASRLPKKCGVDFGVPFTRKTNCNSV  114



>emb|CAN72931.1| hypothetical protein VITISV_020613 [Vitis vinifera]
Length=113

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 60/109 (55%), Gaps = 6/109 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            VI +   LA V       +AI C  V+  ++ C+ YL  GGA P   CCD  R L   +P
Sbjct  5    VIALLVALAMVHFMAEPARAITCSDVNKALAPCVSYLTGGGA-PTSACCDGVRTLKSLSP  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            T  DRQ AC+C K  A+R P+I+ D A+ LP  CG+ + I ISR  +C 
Sbjct  64   TTSDRQTACQCAKDAASRNPNIREDAAAALPNKCGVQTDIPISRSTDCS  112



>ref|XP_011031956.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=117

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 2/108 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQ-EGGAHPPMECCDSFRNLLRGTPTQQ  268
            ++ +A V   V  G+AI C  V+  +++C+ YL  +GG  PP ECC     L     +  
Sbjct  9    LVAVAMVQFMVNPGEAITCGDVNSDLAACVSYLTGKGGDFPPPECCAGGIKLKESAVSIA  68

Query  269  DRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            D+Q ACEC+KA AAR PDIK + AS LP  C + +   IS++ NC ++
Sbjct  69   DKQAACECVKAAAARIPDIKDEAASSLPAKCKVQADFPISKNFNCADI  116



>ref|XP_010547844.1| PREDICTED: non-specific lipid-transfer protein 1 [Tarenaya hassleriana]
Length=115

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
             +F+      V    AI C  VD  +  CL YL  GGA P  +CCD  R+L   TPT  D
Sbjct  9    TLFLVLSTLLVDQSHAITCGEVDSSLRPCLPYLMAGGA-PTSKCCDGVRDLKMMTPTTAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC C+K  A+R  +IKA+ A+ LP  C +   + ISR+++C  +
Sbjct  68   RQTACRCMKDDASRFREIKAEAAAQLPSKCSVEFGVPISREVDCDRI  114



>ref|XP_009613304.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
tomentosiformis]
Length=111

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 59/110 (54%), Gaps = 1/110 (1%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRLGQ-AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            MA + F+  +L      + AI C TV   I  CL YLQ  G  PP  CC + ++L   T 
Sbjct  1    MALISFMLLILLLAPASESAITCGTVISTIRPCLSYLQGTGGKPPQPCCTACQSLASATS  60

Query  260  TQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DRQ AC CLK  A + +I A +A  LP SCG++ S  IS  ++C  +
Sbjct  61   TTPDRQAACTCLKNAAQKININAQLAQGLPQSCGISLSFPISTSVDCTKI  110



>gb|KDP28851.1| hypothetical protein JCGZ_14622 [Jatropha curcas]
Length=114

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+A+DC  V+  ++ C+ +L      P   CC   +NL    PT  DR+ AC+C+KA ++
Sbjct  22   GEAVDCGQVNAALAPCIPFLTGADTAPSAACCGGVKNLKVLAPTTADRRAACDCVKAASS  81

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQ  403
              P+I  D AS LP  CG+  +I IS++INCQ
Sbjct  82   HYPNINEDSASSLPKKCGVEVNIPISKNINCQ  113



>ref|XP_010523199.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=111

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            A++C  VD  +  C+ YLQ GG+ P   CC   +++   TPT  DRQ+ACECLK  A   
Sbjct  22   AVNCGEVDRSLVPCIIYLQNGGS-PSASCCGGVKHIEAITPTTTDRQDACECLKQAAQNY  80

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQ  403
            P++K + AS LP  CG++ +I IS+  NC+
Sbjct  81   PNLKEEAASTLPAKCGVSFNIPISKATNCK  110



>ref|XP_009773021.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
sylvestris]
Length=111

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C TV   I  C  YLQ  G  PP  CC + ++L   T T  DRQ AC CLK  A + 
Sbjct  20   AISCGTVISTIKPCFSYLQGTGGKPPQPCCTACQSLQSATSTTPDRQAACTCLKNAAQKV  79

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I A +A  LP SCG++ S  IS  ++C  +
Sbjct  80   NINAQLAKGLPQSCGISLSFPISTSVDCTKI  110



>ref|NP_001241103.1| uncharacterized protein LOC100798112 precursor [Glycine max]
 gb|ACU13757.1| unknown [Glycine max]
 gb|KHN40656.1| Non-specific lipid-transfer protein [Glycine soja]
Length=117

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 1/115 (1%)
 Frame = +2

Query  65   ATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNL  244
            A+M      VI   AV+ A  + QA+ C  V + ++ CL YL +GG  P   CC   +N+
Sbjct  2    ASMKVTWVVVIMCMAVVGAPMMAQAMTCNDVTVNMAQCLSYLMQGGT-PSTLCCSGVKNI  60

Query  245  LRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L    T  D+Q  C CLKA AAR +I    A  LP  C +     ISR  NC ++
Sbjct  61   LGSAVTTVDKQTVCNCLKADAARYNINDQYAQALPGFCKVNVPYKISRSTNCASI  115



>gb|KEH22495.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=99

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = +2

Query  128  LGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATA  307
            +G A DC+     I  C+GYL     HP + CC+  ++L    PT+ DR +ACECLK T+
Sbjct  4    VGYAFDCEEAKTSILPCIGYLIGEDDHPSIACCNGVKDLKSSVPTKGDRHKACECLKKTS  63

Query  308  AR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +   +I+ D+ ++LP  CG+  + TI++ I C  +
Sbjct  64   SHFHNIRDDLNALLPKRCGVDLNFTINKSIKCDQI  98



>emb|CDY68862.1| BnaCnng60800D [Brassica napus]
Length=162

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = +2

Query  68   TMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            T N+ M  ++F   ++ A   G+AI C  + + ++ CL Y+ +GG +PP  CC    NL 
Sbjct  5    TKNQTMLLLVFTLLMVIAYHEGEAIQCSQITMYLAPCLSYV-KGGGNPPPPCCAGLNNLK  63

Query  248  RGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQ  403
               P + D+Q AC+CLK  A A      D A  LP  CG++  +  S+ ++C 
Sbjct  64   ASAPGKPDKQAACQCLKNVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDCN  116



>gb|KDP28819.1| hypothetical protein JCGZ_14590 [Jatropha curcas]
Length=114

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+A+DC  V+  ++SC+ +L      P   CC   +NL    PT  DR+ AC+C+KA A+
Sbjct  22   GEAVDCGQVNSALASCIPFLTGADTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAAS  81

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQ  403
              P+I  D AS LP  C +  +I IS++ NCQ
Sbjct  82   HYPNINEDSASSLPKKCAVEVNIPISKNTNCQ  113



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 3/107 (3%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            VI   AVL  V   +AI C  V   ++ C+ Y++ GG  PP  CC   R L+    T  D
Sbjct  13   VILCMAVLV-VPHAEAITCGQVSGAVAPCINYVRSGGVVPP-SCCGGIRGLVGAAKTTAD  70

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            R+ AC CLK+ A R P +K  +A+ LP  CG++    IS  +NC  V
Sbjct  71   RRTACNCLKSAAGRIPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>ref|XP_010447248.1| PREDICTED: non-specific lipid-transfer protein 11 [Camelina sativa]
Length=119

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ I  ++A    G+AI C  V++ ++ CL YL+ GG   PM CC+   +L    P + D
Sbjct  13   LLVITIIMAIAYHGEAIACPQVNMYLAQCLPYLKAGGTPSPM-CCNGLNSLKAAAPAKAD  71

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLK+ A   P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  72   RQVACNCLKSVANTIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>sp|P82007.2|NLTP1_HELAN RecName: Full=Non-specific lipid-transfer protein AP10; Short=Ha-AP10; 
Short=LTP; Short=NsLTP; Flags: Precursor [Helianthus 
annuus]
 gb|AAP47226.1| putative lipid transfer protein [Helianthus annuus]
Length=116

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 8/108 (7%)
 Frame = +2

Query  107  AVLAAVRLGQ-------AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
            A+LA + + Q       AI C  V   ++ CL YL+ GG   P  CC   + LL  T TQ
Sbjct  9    AILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTP-ACCAGAKKLLGATRTQ  67

Query  266  QDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             DR+ AC+C K  A +  ++ D+AS LP  CG+++SI I+ ++NC  +
Sbjct  68   ADRRTACKCAKTAAPQLKVRPDMASSLPGKCGISTSIPINPNVNCNTI  115



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 4/123 (3%)
 Frame = +2

Query  41   LKLYTKIKATMNRAMAPVIFIAA-VLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPP  214
            +   T  KA+  + +  V+F++  +++  R GQA I C TV   +S C+G++  GG  PP
Sbjct  1    MAFTTMAKASSLKPLVFVLFVSMLIMSFFRSGQAQISCDTVKNDLSPCIGFIMNGGKVPP  60

Query  215  MECCDSFRNLLRGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRD  391
              CC     LL    T+ DRQ AC CLK+ A +  D +   A+ +P SCG+     ISRD
Sbjct  61   -ACCSGLNTLLSLAKTRTDRQSACSCLKSVAESATDDQLKNAAQIPHSCGVNLPFKISRD  119

Query  392  INC  400
            ++C
Sbjct  120  VDC  122



>ref|XP_004229753.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=115

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQ----AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            I +  VLA  +L      AI C  VD  ++ C+ +L +GG  P   CC   R L   T +
Sbjct  6    ILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGG-EPGAACCSGVRTLNGNTQS  64

Query  263  QQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              DR+ AC C+KA A R P++K D A  LP  CG++ ++ ISR +NC  +
Sbjct  65   SDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI  114



>ref|XP_006359128.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C TV   I  CL YLQ  G  PP  CCD  ++L+    T  D+Q AC CLK  + + 
Sbjct  30   AITCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLVSAATTVPDKQAACTCLKNASQKI  89

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I + +A  LP SCG++ S  IS  ++C  +
Sbjct  90   NINSQLAGSLPKSCGISLSFPISSTVDCTKI  120



>gb|AAN75627.1| lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CAH69187.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 62/117 (53%), Gaps = 5/117 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVL---AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M RA   ++ +A VL   A  R   AIDC  VD ++  CL Y+Q GG  P  +CCD  +N
Sbjct  1    MARAQVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKN  59

Query  242  LLRGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +Q DRQ AC CLK  A    ++  D A  +P  CG+    TIS +I+C  V
Sbjct  60   LHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  116



>ref|XP_010437771.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+AI C  V++ ++ CL YL+ GG  PP  CC+   +L    P + DRQ AC CLK+ A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGT-PPAMCCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  85   TIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>ref|NP_680758.3| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 sp|Q2V3C1.1|NLTPB_ARATH RecName: Full=Non-specific lipid-transfer protein 11; Short=LTP 
11; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86211.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=119

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +2

Query  68   TMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            T  R M  ++ I  +L     G+AI C  V++ ++ CL YL+ GG   PM CC+   +L 
Sbjct  6    TTTRKML-LLVITILLGIAYHGEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLK  63

Query  248  RGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
               P + DRQ AC CLK+ A   P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  64   AAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSI  118



>sp|P24296.2|NLTP1_WHEAT RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Full=ns-LTP1; Flags: Precursor, partial [Triticum aestivum]
 pir||S22528 lipid transfer protein precursor - durum wheat (fragment)
 emb|CAA45210.1| lipid transfer protein [Triticum turgidum subsp. durum]
Length=113

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +2

Query  68   TMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
             M  A+A V+ +AAV    R   AIDC  VD ++  CL Y+Q GG  P  +CCD  +NL 
Sbjct  3    VMLMAVALVLMLAAV---PRAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLH  58

Query  248  RGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                +Q DRQ AC CLK  A    ++  D A  +P  CG+    TIS +I+C  V
Sbjct  59   NQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  113



>sp|P10974.1|NLTPB_RICCO RecName: Full=Non-specific lipid-transfer protein B; Short=NS-LTP 
B; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
Length=92

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-P  316
            ++C  V+  +SSC+ +L      P + CC     L R  PT +D++ ACEC+K  AAR P
Sbjct  1    VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYP  60

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I+ D AS LP+ CG+  ++ IS+  NC  +
Sbjct  61   NIREDAASSLPYKCGVVINVPISKTTNCHEI  91



>ref|XP_006468966.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
Length=115

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            VI +AA++   R   AI C  VD  ++ CL YL  G A P   CC     L   TPT  D
Sbjct  9    VILMAAIVMVERGQAAITCGQVDSFLAPCLAYLT-GEAKPSRACCTGVEYLKDNTPTTAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC+C+K  A R   IK D A  LP  CG+   + I+ DI+C  +
Sbjct  68   RQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>gb|KHG04165.1| Non-specific lipid-transfer A [Gossypium arboreum]
Length=117

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLA-AVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNL  244
            M RA+  V  + A+    V+ GQA + C+ VD  +++C+ YL  GG  P   CC+    L
Sbjct  2    MKRAVISVFVMLAMFQFVVKQGQAAVTCKQVDDALAACVPYLTNGGV-PSTPCCNGVGEL  60

Query  245  LRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 T  DRQ AC C+K  AAR P IK D A+ LP  C +     IS++ NC+++
Sbjct  61   RNSAETTADRQAACNCVKQAAARIPTIKEDDAATLPAKCHVQVDFPISKNTNCEDI  116



>ref|XP_002282792.1| PREDICTED: non-specific lipid-transfer protein A-like [Vitis 
vinifera]
Length=116

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G A+ C  V+  ++ C+ YL  GG +P   CC+  +NL   TPT  DR++AC C+KA A+
Sbjct  23   GYAVTCGQVETSLAPCMPYL-TGGGNPAAPCCNGVQNLKLLTPTTTDRRDACRCVKAAAS  81

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +  +IK D AS LP  CG+   I IS   NC  +
Sbjct  82   KFQNIKEDAASALPTKCGVQIGIPISMTTNCDQI  115



>ref|XP_004229551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=121

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C TV   I  CL YLQ  G  PP  CCD  ++L     T  DRQ AC CLK  + + 
Sbjct  30   AITCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLASAATTVPDRQAACTCLKNASQKI  89

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             I + +A  LP SCG++ S  IS  ++C  +
Sbjct  90   KINSQLAGSLPKSCGISLSFPISPTVDCTKI  120



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQA---IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            V+FIAA++ A+    A   + C TV   +S CL Y++ GGA P M CC+  RNL     T
Sbjct  9    VMFIAAMVIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTM-CCNGIRNLFSAAST  67

Query  263  QQDRQEACECLKATAAR--PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             QDRQ  C C+K +AAR    +  ++A+ LP  CG+     IS  I+C  V
Sbjct  68   TQDRQTVCNCMK-SAARVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKV  117



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +2

Query  95   IFIAAVLAAVRLG---QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
            + +  +L AV L    +AI C TV   + +CLGYLQ+GGA P   CC   R+L     T 
Sbjct  10   LVLMCMLVAVSLAPHAEAITCNTVAGDLGACLGYLQKGGAVPA-GCCTGIRSLNSQAKTT  68

Query  266  QDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             DR+ AC CLK+ A R  +   +A+ LP  CG+     IS   NC +V
Sbjct  69   VDRRTACSCLKSLAGRVRVNQGLAAGLPGKCGVNVGYPISTSTNCNSV  116



>ref|XP_007141467.1| hypothetical protein PHAVU_008G198300g [Phaseolus vulgaris]
 gb|ESW13461.1| hypothetical protein PHAVU_008G198300g [Phaseolus vulgaris]
Length=121

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 63/119 (53%), Gaps = 5/119 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVL----AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            M     P + + AVL    AA    +A+ C+    +++ CL +L +    PP  CC+   
Sbjct  1    MKSLYVPFLSLVAVLVLTVAATEPPKALTCEETKSLVTPCLDFLTDKTNTPPTPCCEGLN  60

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNVL  412
             L+  TPT++++  AC+CLK  A+  P+      + LP  C +  + +IS+D +C+N++
Sbjct  61   KLIVSTPTKEEKLAACKCLKEAASHIPNFDVGRVNNLPKVCNINVNFSISKDFDCENII  119



>ref|XP_007141461.1| hypothetical protein PHAVU_008G197700g [Phaseolus vulgaris]
 gb|ESW13455.1| hypothetical protein PHAVU_008G197700g [Phaseolus vulgaris]
Length=123

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+ +A  +AA +  +A+ C+    +++ CL YL +  + P   CC     L+  TPT+++
Sbjct  12   VVVLALTVAATKPPKALTCEQTKSLVTPCLDYLTKKTSTPSTPCCQGLNKLIASTPTKKE  71

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNVL  412
            +  AC+CLK  A+  P++  D A+ LP  C +     IS+D +C+ ++
Sbjct  72   KCAACKCLKKEASHIPNLDVDRANKLPKVCNINVDYPISKDFDCEKII  119



>ref|NP_001031782.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 gb|AAS47601.1| At4g33355 [Arabidopsis thaliana]
 gb|AAS76723.1| At4g33355 [Arabidopsis thaliana]
 gb|AEE86212.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=117

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 3/113 (3%)
 Frame = +2

Query  68   TMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            T  R M  ++ I  +L     G+AI C  V++ ++ CL YL+ GG   PM CC+   +L 
Sbjct  6    TTTRKML-LLVITILLGIAYHGEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLK  63

Query  248  RGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
               P + DRQ AC CLK+ A   P I  D A  LP  CG+   +  S+ ++C 
Sbjct  64   AAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCN  116



>gb|KDO63444.1| hypothetical protein CISIN_1g044686mg, partial [Citrus sinensis]
Length=130

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 55/104 (53%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            VI +AA++   R   AI C  VD  ++ CL YL  G A P   CC     L   TPT  D
Sbjct  26   VILMAAIVMVERGQAAITCGQVDSFLAPCLAYLT-GEAKPSRACCTGVEYLKDNTPTTAD  84

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            RQ AC+C+K  A R   IK D A  LP  CG+   + I+ DI+C
Sbjct  85   RQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDC  128



>emb|CAH04989.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVL---AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M RA   ++ +A VL   A  R   AIDC  VD ++  CL Y+Q GG  P  +CCD  +N
Sbjct  1    MARAQVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKN  59

Query  242  LLRGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +Q DRQ AC CL+  A    ++  D A   P  CG+    TIS +I+C  V
Sbjct  60   LHNQARSQSDRQSACNCLRGIARGIHNLNEDNARGTPLKCGVNLPYTISLNIDCSRV  116



>ref|XP_009796551.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=114

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR  313
            QAI C  VD  ++ C+ YL +GG  P   CC   +NL R   T  DR+ AC C+KA A R
Sbjct  21   QAITCGQVDAALAPCVPYLTQGG-EPGAACCSGVKNLKRMAATTDDRRTACNCVKAAANR  79

Query  314  -PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              ++K D A  L   CG+A  + +S+ INC  +
Sbjct  80   YTNLKDDAAQALASKCGVAMDVPVSKTINCDTI  112



>ref|XP_002869218.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45477.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=119

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+AI C  V++ ++ CL YL+ GG   PM CC+   +L    P + DRQ AC CLK+ A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPTPM-CCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  85   TIPGINDDYAKQLPAKCGVNIGVPFSKTVDCNSI  118



>ref|XP_007140136.1| hypothetical protein PHAVU_008G087000g [Phaseolus vulgaris]
 gb|ESW12130.1| hypothetical protein PHAVU_008G087000g [Phaseolus vulgaris]
Length=116

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 1/106 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+   AV++A  + QA+ C  V + ++ CL YL  GG      CC   RNLL    T  D
Sbjct  10   VVMFMAVVSAPMMVQAVTCNDVIMQLTPCLPYLMNGGGASA-GCCSGVRNLLGAAGTTAD  68

Query  272  RQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +Q  C CLK  A R +I    A  LP  C +     ISR  NC N+
Sbjct  69   KQTVCNCLKNAAGRFNINDQYAQALPGVCHVNVPYKISRSTNCANI  114



>ref|XP_009591276.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +I + A+LA ++L    GQA+ C  VD  ++ C+ YL +GG  P   CC   ++L     
Sbjct  5    IISVIAMLAMIQLMFEPGQALTCGQVDASLAPCIPYLTQGG-DPSSACCSGVKSLKGLAQ  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            T  D++ AC C+KA A R  ++K D A  LP  CG+   I +SR++NC
Sbjct  64   TIADKRAACNCVKAAANRYANLKDDAAQALPTKCGVTMDIPVSRNVNC  111



>ref|XP_008229617.1| PREDICTED: non-specific lipid-transfer protein A-like [Prunus 
mume]
Length=117

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +2

Query  125  RLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKA  301
            +LGQA + CQ V   ++ C+ YL  G   PP  CC+    L +   T +DR+ AC+CLK 
Sbjct  20   KLGQATVTCQQVASSVAPCVPYLTSGTGSPPTACCNGVSGLKQLASTTKDRRAACQCLKD  79

Query  302  TAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             A    +IK DVA+ LP +C +  ++ ISR +NC +V
Sbjct  80   AADHYQNIKEDVAAGLPTACKVQINVPISRSVNCNDV  116



>ref|XP_009788621.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=115

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +I   AVLA ++     GQA+ C  VD  ++ C+ YL +GG  P   CC+  R L     
Sbjct  5    IISAIAVLAMIQFMVEPGQALTCGQVDASLAPCIPYLTQGG-DPGAACCNGVRALKGMAQ  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
               D++ AC C+KA A R  ++K D A  LP  CG+   IT+S+ +NC
Sbjct  64   NTADKRAACNCVKAAANRYANLKEDAAQALPTKCGVTLDITVSKSVNC  111



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATA-AR  313
            AI C  V   I+ CL YLQ+GGA PP  CC   ++L     T  DRQ AC CLK+ A + 
Sbjct  28   AITCGQVVSSIAPCLNYLQKGGAVPP-ACCSGVKSLNSAAKTTPDRQTACNCLKSAAVSN  86

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            P I+A +AS LP  CG+     IS   +C  V
Sbjct  87   PSIQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            + ++M   +   + IA V++A     AI C  V   ++ C+GYLQ+GGA P   CC   +
Sbjct  1    MASSMGLKLTYAMLIAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             L     T  DRQ  C CLK+ A +   I   VA+ LP  CG++ S  IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>emb|CDX72398.1| BnaC07g44200D [Brassica napus]
Length=118

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +2

Query  77   RAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGT  256
            + M   +    V+ A   G+AI C  V++ ++ CL YL+ GG +P   CC    +L    
Sbjct  7    KTMLLFVITLLVVIAYHEGEAISCSQVNMFLAPCLSYLR-GGGNPSQPCCAGLNSLKAAA  65

Query  257  PTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            P + +RQ AC+CLK+ +   P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  66   PGKAERQTACQCLKSVSNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  117



>ref|XP_010432572.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 57/107 (53%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ I  ++     G+AI C  V++ ++ CL YL+ GG  P   CC+   +L    P + D
Sbjct  13   LLVITILMVTAYHGEAIACPQVNMYLAQCLPYLKAGGT-PSAMCCNGLNSLKAAAPAKSD  71

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLK+ A   P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  72   RQVACNCLKSVANTIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKA-TAARP  316
            I C  V   +SSCLGYL+ GGA PP  CC   +NL     T  DRQ AC+CLK  + + P
Sbjct  29   ITCGQVSSALSSCLGYLKNGGAVPP-GCCSGIKNLNSAAQTTADRQAACKCLKTFSNSIP  87

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             I   +AS LP  CG++    IS   +C  V
Sbjct  88   GINLGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_006446845.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
 gb|ESR60085.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
Length=115

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 55/107 (51%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+ +AA++   R   AI C  VD  ++ CL YL  G   P   CC     L   TPT  D
Sbjct  9    VMLLAAIVMVERGQAAITCGQVDSFLAPCLAYLT-GEGKPSRACCTGVEYLKDNTPTTAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC+C+K  A R   IK D A  LP  CG+   + I+ DI+C  +
Sbjct  68   RQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>ref|XP_007161356.1| hypothetical protein PHAVU_001G062300g [Phaseolus vulgaris]
 gb|ESW33350.1| hypothetical protein PHAVU_001G062300g [Phaseolus vulgaris]
Length=121

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVL----AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            M     P + + AVL    AA    +A+ C+    +++ CL +L +    PP  CC    
Sbjct  1    MKSVYVPFLSLVAVLVLTVAATEPPKALTCEETKSLVTPCLDFLTDKTNTPPTPCCQGLN  60

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNVL  412
             L+  TPT++++  AC+CLK  A+  P+      + LP  C +  +  IS+D +C+N++
Sbjct  61   KLIVSTPTKEEKLAACKCLKEAASHIPNFDVGRVNNLPKVCNINVNYPISKDFDCENII  119



>ref|XP_009607859.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=113

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +I +  VL  ++L    GQA+ C  VD  ++ C+ YL +GG  P   CC+  ++L     
Sbjct  5    IISVITVLVMIQLMVEPGQALTCGQVDASLAPCVPYLTQGG-EPGTACCNGVKDLKVMAQ  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            +  DR+ AC C+KA A R  ++K D A  LP  CG+   I +SR INC
Sbjct  64   SIADRRTACNCVKAAANRYANLKDDAAQALPSKCGVTMDIPVSRTINC  111



>ref|XP_007141469.1| hypothetical protein PHAVU_008G198500g [Phaseolus vulgaris]
 gb|ESW13463.1| hypothetical protein PHAVU_008G198500g [Phaseolus vulgaris]
Length=121

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVL----AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            M     P + + AVL    AA    +A+ C+    +++ CL +L +    PP  CC    
Sbjct  1    MKSVYVPFLSLVAVLVLTVAATEPPKALTCEETKSLVTPCLDFLTDKTNTPPTPCCQGLN  60

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNVL  412
             L+  TPT++++  AC+CLK  A++ P+      + LP  C +  +  IS+D +C N++
Sbjct  61   KLIVSTPTKEEKLTACKCLKEAASQIPNFDVSRVNNLPKVCNINVNYPISKDFDCDNII  119



>gb|AGW21344.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+VLP  CG++    IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAVLPGKCGVSIPYKISASTNCATV  116



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            + ++M+  +A  + +A V++A     AI C  V   ++ C+GYLQ+GGA P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             L     T  DRQ  C CLK+ A +   I   +A+ LP  CG++ S  IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGVSISYKISPSTDCKSV  117



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVKGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG+     IS   NC NV
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 60/111 (54%), Gaps = 3/111 (3%)
 Frame = +2

Query  83   MAPVIFIAAVL-AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +A V+ I  V+  A  + QAI C  V   ++ C+ YLQ GGA P  +CC+  + L+    
Sbjct  6    VACVVLICMVMVGAAPIAQAITCGQVVSNLTPCITYLQRGGAVP-GQCCNGVKTLVSSAQ  64

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  D+Q AC CLK+TAA  P+I    A  LP  CG+     IS   NC ++
Sbjct  65   TTADKQTACNCLKSTAATIPNINFGNAGSLPGKCGVNLPYKISPSTNCASI  115



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QA+ C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P + A+ A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = +2

Query  68   TMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            +M   +A V+ +  V+ A     AI C  V   +S+C+ YL++G A PP  CC   R+L 
Sbjct  4    SMATKLACVLVMCMVVGAPLAEAAITCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLN  63

Query  248  RGTPTQQDRQEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQN  406
                T  DRQ+AC+CLK A+ + P I  ++A+ LP  CG++    IS  ++C  
Sbjct  64   AAAKTTADRQQACKCLKSASNSIPGIDLNLAAGLPGKCGVSIPYKISPSVDCSK  117



>ref|XP_006412367.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
 gb|ESQ53820.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
Length=120

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+AI C  V++ ++ CL YL+ GG +P + CC    +L    P + D+Q AC+CLK
Sbjct  23   AYHEGEAIQCSQVNMYLAPCLPYLRAGG-NPSVPCCGGLNSLKAAAPGKPDKQAACQCLK  81

Query  299  ATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
              A A P I  D A  LP  CG+   +  SR ++C ++
Sbjct  82   NVANAIPGIIDDNAKQLPAKCGVNLGVPFSRSVDCNSI  119



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QA+ C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P + A+ A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>emb|CDY68127.1| BnaC03g71570D [Brassica napus]
Length=123

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
             + AV     +  AI C TV   +  C  YL++GG  PP  CC   RNL     T  DRQ
Sbjct  11   LVLAVCIVASVDAAISCDTVVSSLGPCYFYLRQGGIVPP-SCCGGVRNLNGMAQTTPDRQ  69

Query  278  EACECLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +AC+C+++ T + P    ++AS LP  CG++    IS  +NC NV
Sbjct  70   QACKCVQSFTKSVPGFNQNIASGLPGKCGVSLPYPISNSMNCDNV  114



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG+     IS   NC NV
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>emb|CDY46122.1| BnaA03g52460D [Brassica napus]
Length=120

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = +2

Query  92   VIFIAAVLAAVRL--GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
            ++F+  +L  +    G+AI C  V++ ++ CL YL+ GG +P   CC    +L    P +
Sbjct  12   LLFVITLLMVIAYHEGEAISCSQVNMFLAPCLSYLR-GGGNPSQPCCAGLNSLKAAAPGK  70

Query  266  QDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             +RQ AC+CLK+ +   P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  71   AERQTACQCLKSVSNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIAYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG++    IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            +L    +  AI C  V   ++ C+ +L+ GG  PP  CC+  R+L     T  DRQ AC 
Sbjct  14   ILVTAPVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACN  73

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNVL  412
            CLK A  + P I A+VA+ LP  CG++    IS + +C  +L
Sbjct  74   CLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRIL  115



>gb|KHN29530.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 55/106 (52%), Gaps = 1/106 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+   AV++A  + QA+ C  V + ++ CL YL +GG   P  CC   RN+L    T  D
Sbjct  10   VLMCMAVMSAPMMVQAVSCNDVSVNLAPCLSYLMQGG-DVPESCCSGVRNILGSASTTFD  68

Query  272  RQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +Q  C+CL+  A    I  + A  LP  C ++    ISR  NC ++
Sbjct  69   KQTVCKCLQQAANNYGINDEYAQALPARCNVSVPYKISRSTNCDSI  114



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            + ++M+  +A  + +A V++A     AI C  V   ++ C+GYLQ+GGA PP  CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGALPP-ACCSGLK  59

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +L     T  DRQ  C CLK+ A +   +   +A+ LP  CG++    IS   +C+ V
Sbjct  60   SLNSAAKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTV  117



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  65   ATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNL  244
            A M  A+  +I I   + AV + QAI C  V   ++ C  Y++ GGA P   CC+  R+L
Sbjct  4    AVMKLALVALICI---VVAVPVAQAITCGQVTQNVAPCFNYVKSGGAVP-AACCNGIRSL  59

Query  245  LRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 T  DR++ C CLK+ A     + A++A+ LP  CG+     IS   NC NV
Sbjct  60   NSAAKTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNV  115



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+VLP  CG+     IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>gb|ACE07188.1| Art v 3.0301 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +  V++      A+ C  V   IS CL YL++GG   P +CC   + L   T T  D
Sbjct  11   IMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGG-EVPADCCTGVKGLNDATKTTPD  69

Query  272  RQEACECLKAT-AARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLKA+  +  D+K+D A  LP  CGL     +S + +C  V
Sbjct  70   RQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116



>ref|XP_009138182.1| PREDICTED: non-specific lipid-transfer protein 11 [Brassica rapa]
Length=120

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = +2

Query  92   VIFIAAVLAAVRL--GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
            ++F+  +L  +    G+AI C  +++ ++ CL YL+ GG +P   CC    +L    P +
Sbjct  12   LLFVITLLMVIAYHEGEAISCSQINMFLAPCLSYLR-GGGNPSQPCCAGLNSLKAAAPGK  70

Query  266  QDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             +RQ AC+CLK+ +   P I  D A  LP  CG+   +  S+ ++C ++
Sbjct  71   AERQTACQCLKSVSNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QA+ C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQALTCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P + A+ A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_007141462.1| hypothetical protein PHAVU_008G197800g [Phaseolus vulgaris]
 gb|ESW13456.1| hypothetical protein PHAVU_008G197800g [Phaseolus vulgaris]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 58/106 (55%), Gaps = 1/106 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+ +   +AA +  +A+ C+    +++ CL YL +  + P   CC      +  TPT+++
Sbjct  12   VVVLGLTVAATKPPKALTCEQTKSLVTPCLDYLTKKTSTPSTPCCQGLNKFIASTPTKKE  71

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQN  406
            +  AC+CLK  A+  P++  D A+ LP  C ++    IS+D +C+ 
Sbjct  72   KCAACKCLKKEASHIPNLDVDRANKLPKVCNISVDYPISKDFDCEK  117



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +  ++ AV + QAI C  V   ++ C  Y++ GGA P   CC+  RNL     T  D
Sbjct  11   LVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP-AACCNGVRNLNSQAKTTAD  69

Query  272  RQEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ+ C CLK A  + P +   +A+ LP  CG++    IS   NC  V
Sbjct  70   RQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATV  116



>ref|XP_009108805.1| PREDICTED: non-specific lipid-transfer protein 11-like [Brassica 
rapa]
Length=119

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+AI C  + + ++ CL Y++ GG +PP  CC    NL    P + D+Q AC+CLK
Sbjct  22   AYHEGEAIQCSQITMYLAPCLSYVK-GGGNPPPPCCAGLNNLKSSAPGRPDKQAACQCLK  80

Query  299  ATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
              A A      D A  LP  CG++  +  S+ ++C ++
Sbjct  81   NVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDCNSI  118



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 5/110 (5%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQA---IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            V+ IAA+L A+    A   + C TV   +S CL Y++ GGA P M CC+  R+L     T
Sbjct  9    VVCIAAMLIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPAM-CCNGIRSLFSAAST  67

Query  263  QQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             QDRQ  C C+K+ A A   +  ++A+ LP  CG+     IS  I+C  V
Sbjct  68   TQDRQTVCNCMKSAAGAISGVNLNLAAALPNKCGVNIPYKISPSIDCAKV  117



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG+     IS   NC NV
Sbjct  76   CLKQLSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>ref|XP_004970395.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Setaria 
italica]
Length=124

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK----ATA  307
            + C TV   +  CL ++Q GGA PP  CCD  RNLLR      DR+  C CLK    + A
Sbjct  30   MSCTTVYNTLMPCLPFVQMGGAMPPQPCCDGIRNLLRQASNTPDRRTICGCLKNVANSAA  89

Query  308  ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                   D A+VLP  CG++    IS  +NC  +
Sbjct  90   GGSGTYIDRAAVLPSKCGVSLPYKISTSVNCNTI  123



>emb|CDX88695.1| BnaA03g09540D [Brassica napus]
Length=123

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
             + AV     +  AI C TV   + +C  YL++GG  PP  CC   RNL     T  DRQ
Sbjct  11   LVLAVCIVASVDAAISCNTVVGSLGTCYVYLRQGGIVPP-SCCRGVRNLNGMAQTTPDRQ  69

Query  278  EACECLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +AC+C+++ T + P +  ++AS LP  CG++    IS  +NC NV
Sbjct  70   QACKCVQSFTKSVPGLNQNLASGLPGKCGVSLPYPISISMNCDNV  114



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG+     IS   NC NV
Sbjct  76   CLKQLSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG++    IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_009607860.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +I   AVLA ++     GQA+ C  VD  ++ C+ YL +GG +P   CC+    L     
Sbjct  5    IISAIAVLAMIQFMVEPGQALTCGQVDASLAPCIPYLTQGG-NPGAACCNGVNALKGMAQ  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
               D++ AC C+KA A +  ++K D A  LP  CG+   IT+S+ +NC
Sbjct  64   NTADKRAACNCVKAAANKYANLKEDAAQALPSKCGVTLDITVSKSVNC  111



>gb|AGH27863.1| lipid transfer protein precursor [Prunus mira]
 gb|AGW21339.1| lipid transfer protein [Prunus mira]
Length=117

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-TCCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG++    IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 4/107 (4%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDR  274
            + I  VL+  +    I C TV   +  CL Y+  GG + P ECC+  ++L+    T +DR
Sbjct  14   LLICLVLSPPQTRAVITCDTVFSDLKPCLSYVLVGG-NVPTECCNGLKSLITNATTTEDR  72

Query  275  QEACECLK--ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            Q AC C+K  ATAA  D + D A+ LP  CG+     ISRD++C  V
Sbjct  73   QMACSCVKNLATAAT-DEQVDRAASLPGKCGVNVPFKISRDVDCTKV  118



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            + ++M+  +A  + +A V++A     AI C  V   ++ C+GYLQ+GGA P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +L     T  DRQ  C CLK+ A +   +   +A+ LP  CG++ S  IS   +C+ V
Sbjct  60   SLNSAAATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTV  117



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            +  + AV A+V    AI C  V   +S CL YL+ GG  PP  CC   +NL     T  D
Sbjct  15   ICMVVAVPASVE--AAITCGQVTSSLSPCLNYLKSGGPVPP-GCCSGIKNLNSAAQTTAD  71

Query  272  RQEACECLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC+CLK+ + + P I   +AS LP  CG++    IS   +C  V
Sbjct  72   RQTACKCLKSLSGSIPGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|ACE07186.1| Art v 3.0201 allergen precursor [Artemisia vulgaris]
Length=114

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 55/109 (50%), Gaps = 5/109 (5%)
 Frame = +2

Query  95   IFIAAVLAAV---RLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
             F A V+  V      +A+ C  V   IS+CL YL++GG   P +CC   + L     T 
Sbjct  6    FFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGG-EVPADCCTGVKGLNDAAKTT  64

Query  266  QDRQEACECLKAT-AARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             DRQ AC CLK T  +  D K+D A+ LP  CG+     IS + +C  V
Sbjct  65   PDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV  113



>ref|XP_009607858.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=142

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 6/108 (6%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +I   AVLA ++     GQA+ C  VD  ++ C+ YL +GG  P   CC     L     
Sbjct  34   IISAIAVLAMIQFMVEPGQALTCGQVDASLAPCIPYLTQGG-DPSAACCIGVTALKGMAQ  92

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
               D++ AC C+KATA R  ++K D A  LP  CG+   IT+S+ +NC
Sbjct  93   NTADKRAACNCVKATANRYANLKEDAAQALPNKCGVTLDITVSKSVNC  140



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR  238
            + ++M+  +A  + +A V++A     AI C  V   ++ C+ YLQ+GGA P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             L     T  DRQ  C CLK+ A +   I   VA+ LP  CG++ S  IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>ref|XP_009607862.1| PREDICTED: non-specific lipid-transfer protein A-like, partial 
[Nicotiana tomentosiformis]
Length=155

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLR  250
            M  +I   AVLA ++L    GQA+ C  VD  ++ C+ YL +GG  P   CC   ++L  
Sbjct  1    MKGIIIAIAVLAMIQLMFEPGQALTCGQVDASLAPCIPYLTQGG-DPSSACCSGVKSLKE  59

Query  251  GTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDIN  397
               T  D++ AC C+KA A R  ++K D A  LP  CG+     +SR +N
Sbjct  60   LAQTTADKRTACNCVKAAANRYANLKDDAAQALPTKCGVTMDTPVSRTVN  109



>ref|XP_007217372.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
 gb|EMJ18571.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
Length=116

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = +2

Query  125  RLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKA  301
            + GQA + CQ V   ++ C+ YL  G   PP  CC+    L +   T +DR+ AC+CLK 
Sbjct  21   KPGQATVTCQQVVSSVAPCIPYLTSGTGSPPTACCNGVSGLNQLASTTKDRRAACQCLKD  80

Query  302  TAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            TA    +IK DVA+ LP +C +  ++ ISR +NC 
Sbjct  81   TADHYQNIKEDVAAGLPTACKVQINVPISRSVNCN  115



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 1/101 (1%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            +L    +  AI C  V   ++ C+ +L+ GG  PP  CC+  R+L     T  DRQ AC 
Sbjct  14   ILVTAPVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACN  73

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK A  + P I A+VA+ LP  CG++    IS + +C  V
Sbjct  74   CLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRV  114



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFR---NLLRGTPTQQDRQE  280
            ++ +V + QAI C  V   ++ C+ Y++ GGA PP  CC+  R   NL R TP   DRQ 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRDVNNLARTTP---DRQA  72

Query  281  ACECLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            AC CLK  +A+ P +  + A+VLP  CG+     IS   NC  V
Sbjct  73   ACNCLKQLSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>gb|KHG09865.1| Non-specific lipid-transfer P3 [Gossypium arboreum]
Length=116

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            A+ C  V     SC+ YLQ GG +PP  CC+  RNL R   T +DRQ AC CL+ TAAR 
Sbjct  25   ALTCGQVASQTGSCIRYLQRGG-NPPAACCNGVRNLNRQARTTRDRQTACRCLQ-TAART  82

Query  314  -PDIKADVASVLPWSCGLASSITISRDINCQNV  409
               I A +A+ LP  CG+     IS   NC  V
Sbjct  83   ISGINAKLAAGLPAKCGVKIPYKISPSTNCNRV  115



>gb|KHG13955.1| Non-specific lipid-transfer 1 [Gossypium arboreum]
Length=114

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 47/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   ++ CL YLQ GG + P  CCD  R+L     T  DRQ  C CL+A A   
Sbjct  24   AITCGDVTSKVAGCLSYLQNGG-NVPKACCDGIRSLNNMARTTPDRQTVCGCLQAAAKAV  82

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             IK ++A  LP  C +     IS   NC+NV
Sbjct  83   KIKGNLAETLPAKCSVNIPYKISTSTNCKNV  113



>gb|KFK36745.1| hypothetical protein AALP_AA4G164400 [Arabis alpina]
Length=118

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 61/112 (54%), Gaps = 4/112 (4%)
 Frame = +2

Query  83   MAPVIFIAAVLAA-VRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +A ++F   ++A  +    A+ C  V+  ++ C+GY+ +GGA  P  CC+  R L     
Sbjct  7    LACLVFACMIVAGPITSNAALGCGQVNSAVAPCIGYILQGGAVTP-GCCNGIRRLNGAAR  65

Query  260  TQQDRQEACECLKATAA--RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DR+ AC+CLK  AA   P + A  A+ LP +CG++    IS   NC NV
Sbjct  66   TTPDRKAACQCLKNAAAALGPGLNAGRAAGLPRACGVSVPFPISTSTNCNNV  117



>gb|ACE07189.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKAT-AAR  313
            A+ C  V   IS CL YL++GG   P +CC   + L   T T  DRQ AC CLKA+  + 
Sbjct  26   ALTCSDVSTKISPCLNYLKKGG-EVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSN  84

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             D+K+D A  LP  CGL     +S + +C  V
Sbjct  85   KDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116



>emb|CDY45038.1| BnaA08g11810D [Brassica napus]
Length=162

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+AI C  + + ++ CL Y+ +GG +PP  CC    NL    P + D+Q AC+CLK
Sbjct  22   AYHEGEAIQCSQITMYLAPCLSYV-KGGGNPPPPCCAGLNNLKSSAPGRPDKQAACQCLK  80

Query  299  ATA-ARPDIKADVASVLPWSCGLASSITISRDINCQ  403
              A A      D A  LP  CG++  +  S+ ++C 
Sbjct  81   NVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDCN  116



>pdb|1BWO|A Chain A, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1BWO|B Chain B, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1GH1|A Chain A, Nmr Structures Of Wheat Nonspecific Lipid Transfer Protein
 gb|AAB22334.1| non-specific phospholipid transfer protein, nsPLTP [Tricum aestivum=wheat, 
var. Camp Remy, seeds, Peptide, 90 aa]
 prf||1814270A phospholipid transfer protein
Length=90

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATA-ARP  316
            IDC  VD ++  CL Y+Q GG  P  +CCD  +NL     +Q DRQ AC CLK  A    
Sbjct  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH  59

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            ++  D A  +P  CG+    TIS +I+C  V
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|ABK41612.1| lipid transfer protein [Lilium longiflorum]
Length=109

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI CQ V + ++ C+GY + GG  PP +CC+  RNL        DRQ+AC CLK  ++ P
Sbjct  19   AITCQQVTVAVTPCIGYARTGGTMPP-DCCNGVRNLNSAAKNTPDRQQACICLKQMSSIP  77

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             I   + S +P  C +     I+   +C  V
Sbjct  78   GINMSIVSEIPAKCNVNIGYPIAMSTDCSKV  108



>ref|XP_006347954.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
tuberosum]
Length=115

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            AI C  VD  ++ C+ +L +GG  P   CC   + L     +  DR+ AC C+KA   R 
Sbjct  24   AITCGQVDANLAPCVSFLTQGG-EPGAACCSGVKTLNGNAQSSDDRKTACNCVKAAVNRY  82

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            P++K D A  LP  CG++ ++ ISR +NC  +
Sbjct  83   PNLKDDAAQSLPSKCGISVNVPISRTVNCDTI  114



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 55/116 (47%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V  I  ++ A     AI C  V   ++ CLGYLQ GG  P  +CC   RNL     T  D
Sbjct  9    VALIMCIVIAPMAESAITCGRVSAALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNVL*S*RLYRT  436
            RQ AC CLK+ A     + A+ A+ LP  CG+     IS   NC       ++ RT
Sbjct  68   RQAACNCLKSAAGSISRLNANNAAALPGKCGVNIPYKISTSTNCATYHQGLKMLRT  123



>ref|NP_568904.1| non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
 sp|Q9LLR6.1|NLTP4_ARATH RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76930.1| lipid transfer protein 4 [Arabidopsis thaliana]
 gb|AAK59520.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAK74002.1| AT5g59310/mnc17_200 [Arabidopsis thaliana]
 gb|AAL15407.1| AT5g59310/mnc17_200 [Arabidopsis thaliana]
 gb|AAL15187.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM65751.1| nonspecific lipid-transfer protein precursor-like [Arabidopsis 
thaliana]
 gb|AAO00757.1| nonspecific lipid-transfer protein precursor - like [Arabidopsis 
thaliana]
 gb|AAP21322.1| At5g59310 [Arabidopsis thaliana]
 gb|AED97170.1| non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
Length=112

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 52/104 (50%), Gaps = 3/104 (3%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
            F+  V     +  AI C TV   +S CLGYL +GG  PP  CC   + L     T  DRQ
Sbjct  11   FVLTVFIVASVDAAITCGTVASSLSPCLGYLSKGGVVPP-PCCAGVKKLNGMAQTTPDRQ  69

Query  278  EACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +AC CL++ A    +   +AS LP  CG++    IS   NC  +
Sbjct  70   QACRCLQSAAK--GVNPSLASGLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK--ATAA  310
            A+ C TV   +++C+GY+ +GG  P   CC   +NL     T  DRQ+AC CLK  A A 
Sbjct  26   ALTCGTVTSNVAACIGYITQGGPVP-GACCSGIKNLNSMARTTPDRQQACRCLKTAANAL  84

Query  311  RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             P++ A  A+ LP +CG+     IS   NC +V
Sbjct  85   GPNLNAGRAAGLPKACGVNVPFPISTSTNCNSV  117



>ref|XP_002528683.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF33672.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=114

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = +2

Query  65   ATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNL  244
            AT+   +   + +  V+A     +AI C  V   +SSCL YL+ GGA PP  CC+  R L
Sbjct  2    ATITVKLISFLVLCLVVAMPMTTEAITCGQVVSGLSSCLSYLRSGGAVPP-ACCNGVRGL  60

Query  245  LRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 T  DRQ+ CECLK+ AA   I    AS LP  C +     IS   +C+++
Sbjct  61   NSAAKTTADRQQVCECLKSAAA--GINLSNASSLPGKCNVNIPYKISPSTDCKSI  113



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V  I  ++ A     AI C  V   ++ CLGYLQ GG  P  +CC   RNL     T  D
Sbjct  9    VALIMCIVIAPMAESAITCGRVSAALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLK+ A     + A+ A+ LP  CG+     IS   NC  +
Sbjct  68   RQAACNCLKSAAGSISRLNANNAAALPGKCGVNIPYKISTSTNCATI  114



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C TV   ++ CLG+L+ GG+ PP  CC   RNL     +  DRQ AC CLK+ +A  
Sbjct  28   AISCGTVVSKLAPCLGFLRGGGSPPP-ACCSGIRNLQSMARSTPDRQAACGCLKSASAGV  86

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +++   A+ LP  CG+     ISR ++C  V
Sbjct  87   NMRN--AAALPGKCGVNIGYPISRSVDCSRV  115



>gb|EMT21909.1| Non-specific lipid-transfer protein 4.1 [Aegilops tauschii]
Length=155

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            ++ C  +   +S CLG+LQ    +P  +CCD   +L+    T  DRQEACECLK+ A   
Sbjct  31   SMSCSGMLTDLSPCLGFLQGEEDYPSADCCDGASSLVAAAATTADRQEACECLKSAAGEG  90

Query  317  DIKADVASVLPWSCGLASSITISRDINCQN  406
              +   +  LP  CGL+   TIS D++C  
Sbjct  91   SAEVTASRDLPADCGLSLPFTISPDVDCSQ  120



>gb|KFK29949.1| hypothetical protein AALP_AA7G198800 [Arabis alpina]
Length=113

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+AI C  V++ ++ CL YL+ GGA P + CC    +L    P   D+Q AC CLK
Sbjct  16   AYHEGEAIVCSQVNMFLAPCLTYLKAGGA-PSVPCCGGLNSLKNAAPGIADKQAACNCLK  74

Query  299  ATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              A+  P I  D A  LP  CG+   +  ++ ++C ++
Sbjct  75   NVASTIPGINDDNAKQLPAKCGVDLGVPFTKTVDCNSI  112



>ref|XP_006285119.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
 gb|EOA18017.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
Length=117

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G AI C  V++ ++ CL YL+ GG  P   CC+   +L    P + DRQ AC CLK+ A 
Sbjct  26   GDAIACPQVNMYLAQCLPYLKAGGT-PSAMCCNGLNSLKAAAPAKPDRQVACNCLKSVAN  84

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQ  403
              P I  D A  LP  CG+   +  S+ ++C 
Sbjct  85   TIPGINDDYAKQLPSKCGVNLGVPFSKTVDCN  116



>ref|XP_007206674.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
 gb|EMJ07873.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
Length=118

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  +   ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  18   MVVSVPIAQAITCGQLFSNLAPCIPYVRGGGAVPP-ACCNGIRNVNNLAKTTPDRQAACN  76

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG++    IS   NC+ V
Sbjct  77   CLKQLSASIPGVNPNNAAALPGKCGVSIPYKISASTNCKTV  117



>ref|XP_009798115.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=116

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR  313
             AI C  VD  ++ C+ YL +GG  P   CC   +NL     T  DR+ AC C+KA A R
Sbjct  23   HAITCGQVDAALAPCVPYLTQGG-EPGAACCSGVKNLKGMAATTDDRRTACNCVKAAANR  81

Query  314  -PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              ++K D A  L   CG+A  + +S+ INC  +
Sbjct  82   YTNLKDDAAQALASKCGVAMDVPVSKTINCDTI  114



>ref|XP_003560704.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Brachypodium 
distachyon]
Length=123

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARPD  319
            + C  V    S CLG+LQ    +P  +CC+   +L+    T  DRQ+ACECLK+ A    
Sbjct  33   MSCSDVVSGASPCLGFLQGEEDYPSSDCCEGVSSLVAAAATTADRQQACECLKSAAGDGS  92

Query  320  IKADVASVLPWSCGLASSITISRDINCQNV  409
             +A  A  LP  CGL+   TIS D++C  +
Sbjct  93   AEASAARDLPADCGLSLPFTISPDVDCSQI  122



>gb|KDO49686.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=126

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            +L    +  AI C  V   ++ C+ +L+ GG  PP  CC+  R+L     T  DRQ AC 
Sbjct  14   ILVTAPVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACN  73

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINC  400
            CLK A  + P I A+VA+ LP  CG++    IS + +C
Sbjct  74   CLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDC  111



>ref|XP_009607362.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=116

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR  313
            QAI C  VD  ++ C+ YL +GG  P   CC   +NL     T  DR+ AC C+KA A R
Sbjct  23   QAITCGQVDAALAPCVPYLTQGG-EPGAACCSGVKNLKGMAATTDDRRTACNCVKAAANR  81

Query  314  -PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              ++K D A  L   CG+A  + +S+ I+C  +
Sbjct  82   YTNLKDDAAQALASKCGVAMDVPVSKTIDCDTI  114



>gb|AAV40850.1| lipid transfer protein 1 precursor [Prunus persica]
Length=117

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C      ++ C+ Y++ GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQASSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  +A+ P +  + A+ LP  CG++    IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            V   +    A+ C TV+  ++ C+GY+ +GG  P   CC     L     T  DRQ+AC 
Sbjct  17   VAGPITANAALTCGTVNSNVAPCIGYITQGGPLP-RACCTGVSKLNSMARTTPDRQQACR  75

Query  290  CLK--ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  A+A  P++ A  A+ +P +CG++    IS + NC NV
Sbjct  76   CLKTAASALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|EYU34081.1| hypothetical protein MIMGU_mgv1a024111mg, partial [Erythranthe 
guttata]
Length=109

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+A+ C  +   ++ CL YL  GG  P   CC   R+      + QDRQ AC C+K
Sbjct  16   AATPGEAVSCGELQSSLAPCLSYLT-GGGEPSESCCGGLRSASGSIQSTQDRQTACYCMK  74

Query  299  ATAARPDIKADVASVLPWSCGLASSITISRDINC  400
            + A+  ++  D A+ LP  CG++  +T+S +++C
Sbjct  75   SAASTYNVPTDAAASLPGKCGVSVGMTVSPNVDC  108



>dbj|BAB09776.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=110

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 51/101 (50%), Gaps = 3/101 (3%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
            F+  V     +  AI C TV   +S CLGYL +GG  PP  CC   + L     T  DRQ
Sbjct  11   FVLTVFIVASVDAAITCGTVASSLSPCLGYLSKGGVVPP-PCCAGVKKLNGMAQTTPDRQ  69

Query  278  EACECLKATAARPDIKADVASVLPWSCGLASSITISRDINC  400
            +AC CL++ A    +   +AS LP  CG++    IS   NC
Sbjct  70   QACRCLQSAAK--GVNPSLASGLPGKCGVSIPYPISTSTNC  108



>ref|XP_004492552.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=122

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 3/109 (3%)
 Frame = +2

Query  92   VIFIAAVLAAV--RLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
            ++ I  VL +   +   A+ C  V L ++SC+GYL+  G   P  CC+  R +   + T 
Sbjct  12   MVMICLVLGSCVPKANGALPCGQVQLYVASCIGYLRSPGPSVPAPCCNGIRTVNSQSKTT  71

Query  266  QDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             DRQ  C+CLK T+ + P +     + LP  CG+    T++  INC  +
Sbjct  72   SDRQSVCKCLKTTSLSLPGLNLPALAALPAKCGVNLPYTVTPSINCNTI  120



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = +2

Query  98   FIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDR  274
             +A +L A  L +A I C TV   +S C+GYL+ GG+ PP+ CC+  R L     T  DR
Sbjct  10   LVACMLVAAPLTEAAIACGTVVSALSPCIGYLRAGGS-PPLACCNGVRALNNAARTTPDR  68

Query  275  QEACECLKATAARP--DIKADVASVLPWSCGLASSITISRDINCQNV  409
            QEAC CL+  AAR    +    A  LP  CG+     IS   NC  V
Sbjct  69   QEACRCLQ-NAARSMGGLNEANAGSLPGKCGVNIPYKISTSTNCSTV  114



>ref|XP_007141468.1| hypothetical protein PHAVU_008G198400g [Phaseolus vulgaris]
 gb|ESW13462.1| hypothetical protein PHAVU_008G198400g [Phaseolus vulgaris]
Length=117

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
             LAA    +A++C+    ++S CL YL +  + P   CC     L+  TPT++++  AC+
Sbjct  18   TLAATEPPKALNCEQTKSLMSPCLDYLTKKTSTPSTPCCLGLNKLIVSTPTKEEKCAACK  77

Query  290  CLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            CLK  A+  P++  D A+ LP  C +     IS+D +C+
Sbjct  78   CLKGEASHIPNLDVDRANSLPKVCKINVDYPISKDFDCE  116



>ref|XP_003595853.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES66104.1| Lipid transfer protein [Medicago truncatula]
Length=115

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 5/111 (5%)
 Frame = +2

Query  77   RAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGT  256
             A+  +IF+A+   A     AI C  V   +  C+ YL  G   PP  CC   + L    
Sbjct  9    SALVLLIFVASNSEA-----AISCSDVIKDLKPCVSYLVSGSGQPPAACCSGAKALASAV  63

Query  257  PTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             T +D++ AC C+K+T+    I + +A  L  +CG+ + ITIS D +C  V
Sbjct  64   STSEDKKAACNCIKSTSKSIKINSQLAQALAGNCGINTPITISPDADCSKV  114



>gb|ACE07187.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=116

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            AM  + F  A++  + L     +A+ C  V   I+ CL YL++GG   P +CC   + L 
Sbjct  2    AMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGG-EVPADCCTGVKGLN  60

Query  248  RGTPTQQDRQEACECLKAT-AARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                T  DRQ AC CLK +  +  D+K+D A+ LP  CG+     IS + +C  V
Sbjct  61   DAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV  115



>sp|P86137.2|NLTP1_ACTDE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Short=nsLTP1; AltName: Allergen=Act d 10.01 [Actinidia deliciosa]
Length=92

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ-QDRQEACECLKATAAR  313
            A+ C  VD  ++ CL YL +GG  P  +CC   R+L   T T+  DRQ AC CLK  AAR
Sbjct  1    AVSCGQVDTALTPCLTYLTKGGT-PSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAAR  59

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 D A+ L   CG+  S+ ISR  +C  +
Sbjct  60   YQGIKDAAAALSQKCGVQLSVPISRSTDCSKI  91



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +  ++ A+ + QAI C  V   IS CL Y++ GGA P   CC   RNL     T  D
Sbjct  11   LVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP-AACCSGIRNLNGMAKTTAD  69

Query  272  RQEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLK A      +  ++A+ LP  CG++    IS   NC  V
Sbjct  70   RQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = +2

Query  107  AVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEAC  286
            AV+    L +AI C  V   ++ C+ YL+ GGA P   CC+  R+L     T  DRQ AC
Sbjct  14   AVVVGAPLAEAITCGQVSSSVAPCINYLKVGGAVP-AACCNGVRSLNSAAKTTADRQAAC  72

Query  287  ECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQ  403
             CLK A+A+   I   +A+ LP  CG++    IS   NC 
Sbjct  73   NCLKTASASIKGINLSLAAGLPGKCGVSVPYKISPSTNCN  112



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            A+  +  + A+  AV +  AI C  V   ++ C+GY++ GGA PP  CC+  R +     
Sbjct  5    AVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRNGGAVPP-ACCNGIRTINSLAR  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DRQ AC CLK  A     +  + A+ LP  CG+     IS   NC  V
Sbjct  64   TTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>pdb|1CZ2|A Chain A, Solution Structure Of Wheat Ns-Ltp Complexed With Prostaglandin 
B2.
Length=90

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  143  DCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATA-ARPD  319
            DC  VD ++  CL Y+Q GG  P  +CCD  +NL     +Q DRQ AC CLK  A    +
Sbjct  2    DCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  60

Query  320  IKADVASVLPWSCGLASSITISRDINCQNV  409
            +  D A  +P  CG+    TIS +I+C  V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>sp|Q42641.1|NLTPA_BRAOT RecName: Full=Non-specific lipid-transfer protein A; Short=LTP 
A; AltName: Full=Wax-associated protein 9A; Flags: Precursor 
[Brassica oleracea var. italica]
 gb|AAA73945.1| lipid transfer protein [Brassica oleracea var. italica]
Length=118

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 5/103 (5%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            V   +   +A+ C TV+  ++ C+GY+ +GG   P  CC     L     T  DRQ+AC 
Sbjct  17   VAGPITANRALTCGTVNSNVAPCIGYITQGGTL-PGACCTGVSKLNSMARTTPDRQQACR  75

Query  290  CLKATAAR---PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CL+ TAAR   P++ A  A+ +P +CG++    IS + NC NV
Sbjct  76   CLE-TAARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 55/106 (52%), Gaps = 2/106 (2%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDR  274
            + +  V++A     AI C TV + ++ CL YL++GG  PP  CC+  ++L     T  DR
Sbjct  15   VLMCMVVSAPHAEAAITCGTVTVSLAPCLNYLKKGGPVPP-ACCNGIKSLNAAAKTTADR  73

Query  275  QEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            Q AC CLK A+ +   I    AS LP  CG+     IS   +C  V
Sbjct  74   QAACNCLKTASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKV  119



>ref|XP_009372014.1| PREDICTED: non-specific lipid-transfer protein-like [Pyrus x 
bretschneideri]
Length=115

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 55/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            A+  +  + A+  AV +  AI C  V   + +C+GY++ GGA PP  CC+  R +     
Sbjct  5    AVTKLALVVALCMAVSVAHAITCGQVTSNLGACIGYVKNGGAVPP-ACCNGIRTVNGLAR  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DRQ  C CLK+ A     +  + A+ LP  CG+     IS   NC  V
Sbjct  64   TTADRQTTCNCLKSLAGSIKGVNPNNAATLPAKCGVNVPFKISISTNCATV  114



>gb|AEG79730.2| lipid transfer protein precursor [Anethum graveolens]
Length=122

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  VRLGQAIDCQTVDLIISSCLGYLQEGGAHP-PMECCDSFRNLLRGTPTQQDRQEACECLK  298
            V+L +A+ C  V   ++ CLGYL+  G+ P P+ CC+  R L     T  DR+ AC CLK
Sbjct  24   VKLAEALTCGQVTGALAPCLGYLRTAGSVPVPLTCCNGVRGLNNAARTTIDRRTACNCLK  83

Query  299  ATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNVL  412
             TA A  D+  + A+ LP  CG+     IS   +C  V+
Sbjct  84   QTANAIADLNLNAAAGLPAKCGVNIPYKISPSTDCNRVV  122



>gb|AFK35133.1| unknown [Medicago truncatula]
Length=115

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 5/111 (5%)
 Frame = +2

Query  77   RAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGT  256
             A+  +IF+A+   A     AI C  V   +  C+ YL  G   PP  CC   + L    
Sbjct  9    SALVLLIFVASNSEA-----AISCSDVIKDLKPCVSYLVSGSGQPPAACCSGAKALASAV  63

Query  257  PTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             T +D++ AC C+K+T+    I + +A  L  +CG+ + ITIS D +C  V
Sbjct  64   STSEDKKAACNCIKSTSKSIKIDSQLAQALAGNCGINTPITISPDADCSKV  114



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V  I  ++ A     AI C  VD  ++ CLGYLQ GG  P  +CC   RNL     T  D
Sbjct  9    VALIMCIVIAPMAESAITCGRVDTALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLK+ A     + A+ A+ LP  C +     IS   NC  +
Sbjct  68   RQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATI  114



>ref|XP_004488587.1| PREDICTED: non-specific lipid-transfer protein 8-like [Cicer 
arietinum]
Length=115

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  CL YL  G   PP  CC   + L     T +D++  C C+K+TA   
Sbjct  24   AITCSDVIKDLKPCLSYLVSGSGQPPSACCSGAKALASVVSTSEDKKATCNCIKSTAKSV  83

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             I + +A  LP +CG+ + I++S D +C  +
Sbjct  84   KINSQLAKALPGNCGINTPISVSPDADCSKI  114



>gb|KDP35110.1| hypothetical protein JCGZ_10952 [Jatropha curcas]
Length=114

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAA  310
            G+A+ C  V+  ++ C+  L   G  P   CC   +N+    PT  DR+ A +C+KA A+
Sbjct  22   GEAVGCGQVNSALAPCIPCLTGAGTAPSAACCGGAKNVKALAPTTADRRAAGDCVKAAAS  81

Query  311  R-PDIKADVASVLPWSCGLASSITISRDINCQ  403
              P+I  D AS LP  CG+  +I IS++ NC 
Sbjct  82   HYPNINEDSASSLPKKCGVEVTIPISKNTNCH  113



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            A+  +  + A+  AV +  AI C  V   ++ C+GY++ GGA PP  CC+  R +     
Sbjct  5    AVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLAR  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DRQ AC CLK  A     +  + A+ LP  CG+     IS   NC  V
Sbjct  64   TTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>dbj|BAD54259.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEC80769.1| hypothetical protein OsI_23278 [Oryza sativa Indica Group]
Length=123

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            ++ C  V   ++ CLG+LQ    HP  ECCD    L+    T +DRQ ACECLK+  +  
Sbjct  32   SVSCSDVVADVTPCLGFLQGDDDHPSGECCDGLSGLVAAAATTEDRQAACECLKSAVSGQ  91

Query  314  -PDIKADVASVLPWSCGLASSITISRDINC  400
               ++A  A  LP  CGL+   T S D++C
Sbjct  92   FTAVEAAPARDLPADCGLSLPYTFSPDVDC  121



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 54/107 (50%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            VI I  +    R  +A+ C  V+  + SCL Y+  GG   P  CC   +NLL    T+ D
Sbjct  16   VILIWMLAYNPRPSEALTCDDVNNNLISCLSYV-AGGGKVPTSCCSGVKNLLSLAKTRND  74

Query  272  RQEACECLKATAARPDI-KADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLK+ A   +  +   A  +P SC L     ISRD++C  V
Sbjct  75   RQTACSCLKSLAVEANNDQLKRAQTVPKSCSLTIPFPISRDVDCSKV  121



>gb|ABX56711.1| LTP isoallergen 1 precursor [Arachis hypogaea]
Length=116

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+ +   +    +  AI C  V+  ++ C+ +L +GGA PP  CC   R LL    T  D
Sbjct  9    VMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPP-ACCSGVRGLLGALRTTAD  67

Query  272  RQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC CLKA A     +    A+ LP  CG++    IS   NC  +
Sbjct  68   RQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATI  114



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 59/109 (54%), Gaps = 5/109 (5%)
 Frame = +2

Query  95   IFIAAVLAA--VRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQ  268
            +F+A ++ A  +    A+ C  V   ++ C+GY+ +GGA PP  CC+  RNL     T  
Sbjct  10   LFLACMIVAGPITANAALSCGAVSSNLAPCIGYVMQGGAIPP-ACCNGVRNLNSMARTTP  68

Query  269  DRQEACECLKATAAR--PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            DRQ+AC C+++ A      + A  A+ +P SCG+     IS   NC+ V
Sbjct  69   DRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTV  117



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ A+ + QAI C  V   IS C+ Y++ GGA  P  CC+  R+L     T  DRQ  C 
Sbjct  17   IVVALPIAQAITCGQVASSISPCVNYVKSGGAV-PAACCNGIRSLNSAAKTTADRQATCN  75

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK A+ A   +   +A+ LP  CG++    IS   NC  V
Sbjct  76   CLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAV  116



>emb|CDX93316.1| BnaC04g45800D [Brassica napus]
Length=118

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 5/94 (5%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            A+ C TV+  ++ C+GY+ +GG  P   CC     L     T  DRQ+AC CL+ TAAR 
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGTLP-GACCTGVSKLNSMARTTPDRQQACRCLE-TAARA  83

Query  314  --PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              P++ A  A+ +P +CG++    IS + NC NV
Sbjct  84   LGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>ref|XP_007149145.1| hypothetical protein PHAVU_005G045100g [Phaseolus vulgaris]
 gb|ESW21139.1| hypothetical protein PHAVU_005G045100g [Phaseolus vulgaris]
Length=115

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 1/108 (1%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            A+ P + I  +L +   G AI C  V   +  C+ YL  G   PP  CC   + L     
Sbjct  6    ALFPALVILILLVSTSEG-AISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAAS  64

Query  260  TQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQ  403
            T +D++ AC C+K+T+   +I + +A  LP +CG+   + IS + +C 
Sbjct  65   TTEDKKAACNCIKSTSKSININSQLAQALPGNCGITLPVAISPNADCS  112



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  80   AMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            A+  +  + A+  AV +  AI C  V   ++ C+GY++ GGA PP  CC+  R +     
Sbjct  5    AVTNLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLAR  63

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  DRQ AC CLK  A     +  + A+ LP  CG+     IS   NC  V
Sbjct  64   TTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|AII99867.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=131

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 2/117 (2%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            MA + F+    + ++    I C  V L ++SC+GYL+  G   P  CC+  R +   + T
Sbjct  12   MAMICFVMGS-SIMKANGEIPCGQVQLYVASCVGYLRSPGPSVPEPCCNGIRTVNSQSKT  70

Query  263  QQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNVL*S*RLY  430
              DRQ  C CLK+TA + P +     + LP +CG+     IS  I+C   + +  LY
Sbjct  71   TADRQSVCNCLKSTALSFPGLNPQALAALPANCGVNLPYKISTSIDCNTYVLTTPLY  127



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ A+ + QAI C  V   IS C+ Y++ GGA  P  CC+  R+L     T  DRQ  C 
Sbjct  17   IVVALPIAQAITCGQVASSISPCVNYVKSGGAV-PAACCNGIRSLNSAAKTTADRQTTCN  75

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK A+ A   +  ++A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK-ATAA  310
            QAI C  V   ++ C+G+L+ GG  P M CC+  R+L     T  DRQ AC CLK A  +
Sbjct  23   QAITCGQVSGSLAPCIGFLRSGGPIP-MPCCNGVRSLNAAARTTPDRQTACNCLKQAAGS  81

Query  311  RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             P++  + A+ LP +CG++    IS   +C  V
Sbjct  82   IPNLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>emb|CDP07650.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 0/104 (0%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
            F+   L A     A+ C  V   I+ C+ YL+ G   PP  CC   + L     T  D+Q
Sbjct  15   FLVLFLIAPASDAAVTCGDVAKKIAPCVDYLRSGSGAPPPPCCGGVKALAASATTTPDKQ  74

Query  278  EACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             AC CLK  +   +IK ++A  LP +CG++    IS + +C  +
Sbjct  75   AACACLKTQSKNLNIKPELAQALPGNCGVSLPYPISPNFDCTTI  118



>ref|XP_006400973.1| hypothetical protein EUTSA_v10015064mg [Eutrema salsugineum]
 gb|AAM19702.1|AF499715_1 lipid transfer protein 4-like protein [Eutrema halophilum]
 gb|ESQ42426.1| hypothetical protein EUTSA_v10015064mg [Eutrema salsugineum]
Length=112

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C TV   ++ C GYL +GGA P   CC     L     T  DRQ+AC+CLKA A   
Sbjct  24   AISCGTVASSLAPCAGYLTKGGAVP-APCCAGVSKLNGMAKTTPDRQQACKCLKAAAQ--  80

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             I   +AS LP  CG++    IS   NC NV
Sbjct  81   SINPSLASGLPGKCGVSIPYPISMSTNCDNV  111



>gb|AGC08425.1| lipid transfer protein [Gossypium hirsutum]
Length=129

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-  313
            A+ C  V     SC+ YLQ GG +PP  CC+  RNL R   T +DRQ AC CL+ TAAR 
Sbjct  25   ALTCGQVASQTGSCIRYLQRGG-NPPAACCNGVRNLNRQARTTRDRQTACRCLQ-TAART  82

Query  314  -PDIKADVASVLPWSCGLASSITISRDINCQ  403
               I   +A+ LP  CG+     IS   NC 
Sbjct  83   ISGINTKLAAGLPAKCGVKIPYKISPSTNCN  113



>gb|AFM39014.1| lipid transfer protein [Sinapis alba]
 gb|AGU28434.1| lipid transfer protein 1 [Sinapis alba]
Length=118

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 51/95 (54%), Gaps = 7/95 (7%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCD---SFRNLLRGTPTQQDRQEACECLKATA  307
            A+ C TV   ++ C+GYL +G    P  CC    S  NL R TP   DRQ+AC CL   A
Sbjct  26   ALSCGTVSGYVAPCIGYLAQGAPALPGACCSGVTSLNNLARSTP---DRQQACRCLVGAA  82

Query  308  -ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             A P + A  A+ LP +CG+     IS+  NC +V
Sbjct  83   NAFPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>gb|AAB33171.1| acyl-binding/lipid-transfer protein isoform II, AB/LTP II [rape, 
seedlings, Peptide, 93 aa]
 prf||2107184B acyl-binding/lipid transfer protein:ISOTYPE=II
Length=93

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 51/95 (54%), Gaps = 7/95 (7%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCD---SFRNLLRGTPTQQDRQEACECLKATA  307
            A+ C TV   ++ C+GYL +G    P  CC    S  NL R TP   DRQ+AC CL   A
Sbjct  1    ALSCGTVSGYVAPCIGYLAQGAPALPRACCSGVTSLNNLARTTP---DRQQACRCLVGAA  57

Query  308  -ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             A P + A  A+ LP +CG+     IS+  NC +V
Sbjct  58   NAFPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  92



>ref|XP_004492553.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=122

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 56/110 (51%), Gaps = 2/110 (2%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            MA + F+    + ++    I C  V L ++SC+GYL+  G   P  CC+  R +   + T
Sbjct  12   MAMICFVMGS-SIMKANGEIPCGQVQLYVASCVGYLRSPGPSVPEPCCNGIRTVNSQSKT  70

Query  263  QQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
              DRQ  C CLK+TA + P +     + LP +CG+     IS  I+C  +
Sbjct  71   TADRQSVCNCLKSTALSFPGLNPQALAALPANCGVNLPYKISTSIDCNTI  120



>ref|XP_004229752.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=120

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query  119  AVRLGQ--AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACEC  292
            A RL Q   + C  VD  ++ C+ YL +GG  P   CC   + +     +  +R+ AC C
Sbjct  21   AGRLEQQGGVSCGQVDANMAPCISYLTQGG-EPSASCCSGVKTVSGMAQSTDERRTACNC  79

Query  293  LKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            LKA A R  ++K D A  LP  CG++ +I ISR INC  +
Sbjct  80   LKAAANRYANLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>gb|AFK45186.1| unknown [Lotus japonicus]
Length=114

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  C+ YL  G   PP  CC   + L     T +D++ AC C+K+TA   
Sbjct  23   AISCSDVIKDLKPCVSYLVSGSGKPPGACCSGAKALASAVSTSEDKKAACNCIKSTAKSI  82

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             + + +A  LP +CG+   I +S D +C  V
Sbjct  83   KMNSQLAKALPGNCGINVPINVSPDADCSKV  113



>emb|CDM80997.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRL---GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M R  A  + + A++AA+ L     AI C  V   +S C+ Y +  GA+PP  CC   R+
Sbjct  1    MARGAATQLVLVAMVAAMLLVASDAAISCGQVTSALSPCISYARGNGANPPAACCSGVRS  60

Query  242  LLRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +  D+Q AC+C+K+ A    + A  A+ +P  CG++    IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
             + A+  AV +  AI C  V   ++ C+GY++ GGA PP  CC+  R +     T  DRQ
Sbjct  11   LVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQ  69

Query  278  EACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             AC CLK  A     +  + A+ LP  CG+     IS   NC  V
Sbjct  70   TACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>sp|P85206.1|NLTP2_ACTDE RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
AltName: Allergen=Act d 10.02 [Actinidia deliciosa]
Length=92

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ-QDRQEACECLKATAARP  316
            + C  VD  ++ CL YL +GG  P  +CC   R+L   T T+  DRQ AC CLK  AAR 
Sbjct  2    VSCGQVDTALTPCLTYLTKGGT-PSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARY  60

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
                D A+ L   CG+  S+ ISR  +C  +
Sbjct  61   QGIKDAAAALSQKCGVQLSVPISRSTDCSKI  91



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y+  GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSNSVAPCIPYVIGGGAVPP-ACCNGIRNVENLAKTTADRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  + + P +  + A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISISTNCAAV  116



>ref|XP_009143379.1| PREDICTED: non-specific lipid-transfer protein D [Brassica rapa]
 gb|ABM69132.1| lipid transfer protein precursor [Brassica rapa subsp. pekinensis]
 emb|CDY68529.1| BnaAnng27610D [Brassica napus]
Length=118

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 51/95 (54%), Gaps = 7/95 (7%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCD---SFRNLLRGTPTQQDRQEACECLKATA  307
            A+ C TV   ++ C+GYL +G    P  CC    S  NL R TP   DRQ+AC CL   A
Sbjct  26   ALSCGTVSGYVAPCIGYLAQGAPALPRACCSGVTSLNNLARTTP---DRQQACRCLVGAA  82

Query  308  -ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             A P + A  A+ LP +CG+     IS+  NC +V
Sbjct  83   NAFPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  98   FIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDR  274
             +A +L    + QA I C  V   ++ C+ YL+ GG+ PP  CC+  ++L     T  DR
Sbjct  10   LVACMLVVSPVAQAAITCGQVTSSVAPCIQYLRSGGSVPP-PCCNGIKSLNNAARTTPDR  68

Query  275  QEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            Q+AC CL+ A  A P I  ++A+ LP  CG+     IS   NC +V
Sbjct  69   QQACRCLQNAAKAIPGINTNLAAGLPGKCGVNIPYKISTSTNCASV  114



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = +2

Query  77   RAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGT  256
            + +   + I  VL+  +    I C TV   +  CL Y+  GG + P ECC+  ++L+   
Sbjct  47   KFLLSFLLICLVLSPPQARAVITCDTVFNDLKPCLNYVLVGG-NVPAECCNGLKSLIVKA  105

Query  257  PTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
             T  DRQ  C CLK+ A    D + D A+ LP  CG+     ISRD++C  V
Sbjct  106  ITTADRQSICSCLKSLATTATDEQVDRAASLPGKCGVKVPFKISRDVDCTKV  157



>gb|AFR54362.1| nonspecific lipid transfer protein 5 [Triticum aestivum]
 emb|CDM80962.1| unnamed protein product [Triticum aestivum]
 emb|CDM80969.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRL---GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M R  A  + + A++AA+ L     AI C  V   +S C+ Y +  GA+PP  CC   R+
Sbjct  1    MARGAATQLVLVAMVAAMLLVACDAAISCGQVTSALSPCISYARGNGANPPAACCSGVRS  60

Query  242  LLRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +  D+Q AC+C+K+ A    + A  A+ +P  CG++    IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>ref|NP_001159077.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
 gb|ACG45897.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
Length=123

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 52/110 (47%), Gaps = 3/110 (3%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPM---ECCDSFRNLLRGTPT  262
            V+ + A+LA       I C  V   +S CL +LQ   A P     +CCD  R L     T
Sbjct  10   VVLLVAMLAVQSAVADISCSDVLNDLSPCLPFLQGKAAKPSESNNQCCDGVRTLYAAADT  69

Query  263  QQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNVL  412
            + DRQ  C CLKA   +       A  LP  CGL+ S  I+ DI+C N L
Sbjct  70   RPDRQATCRCLKAAYVQVHAVLSAAQELPGDCGLSLSYNITPDIDCDNFL  119



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+ Y+  GGA PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVIGGGAVPP-ACCNGIRNVDNLANTTADRQAACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  + + P +  + A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQLSGSIPGVNPNNAASLPGKCGVNIPYNISSSTNCATV  116



>ref|XP_011089509.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 55/115 (48%), Gaps = 2/115 (2%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAV-RLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            M   +  VI I A  A V + GQA+ C  VD  +  C+ YL   G  P   CC   + + 
Sbjct  1    MKGGVVAVITILAFFAVVVKPGQAVTCGQVDAALVPCISYLTGQGDSPSAACCSGVKAVK  60

Query  248  RGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
                T  D++  C C+KA A +  D+K   A  LP  CG+   I ISR ++C  +
Sbjct  61   GMAQTTADKRACCNCVKAAANKYADLKDAAAQSLPTKCGVQMDIPISRSVDCDKI  115



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = +2

Query  80   AMAPVIFIAAV--LAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRG  253
            AM  +  + A+  + +V + QAI C  V   ++ C+GY++ GGA PP  CC+  RN+   
Sbjct  5    AMTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNL  63

Query  254  TPTQQDRQEACECLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
              T  DR+ AC CLK  + +   +  + A+ LP  CG+     IS   NC  V
Sbjct  64   ARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATV  116



>emb|CDM80964.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26653.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRL---GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M R  A  + + A++AA+ L     AI C  V   +S C+ Y +  GA+PP  CC   R+
Sbjct  1    MARGAATQLVLVAMVAAMLLIATDAAISCGQVSPALSPCISYARGNGANPPAACCSGVRS  60

Query  242  LLRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +  D+Q AC+C+K+ A    + A  A+ +P  CG++    IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSVPYAISATVDCSKI  114



>ref|XP_009112488.1| PREDICTED: non-specific lipid-transfer protein 8 [Brassica rapa]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 1/106 (1%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQ-AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            IF+  +    R  + AI C  V   +  C+ YL  G   PP  CCD  R+L   T T  D
Sbjct  10   IFVLGIFLTPRYSESAISCSVVLSDLQPCVSYLTSGSGQPPETCCDGVRSLDAATTTSAD  69

Query  272  RQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            ++ AC+C+K+ A    +K ++A  L  +C  +  +  S  ++C  V
Sbjct  70   KKAACQCIKSVANSVTVKPELAKALASNCNASLPVDASSTVDCNTV  115



>ref|XP_011089499.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (49%), Gaps = 2/115 (2%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLA-AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
            M   +  VI + A+ A  V+ GQA+ C  VD  +  C+ YL   G  P   CC   + + 
Sbjct  1    MKGGVVAVIAVLAIFALVVKPGQAVTCGQVDAALVPCISYLTGNGDSPSPACCSGVKAVK  60

Query  248  RGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
                T  D++  C C+KA A +  D+K   A  LP  CG+   I ISR ++C  +
Sbjct  61   GMAQTLADKRACCSCVKAAANKYADLKDAAAQSLPTKCGVQMDIPISRSVDCDKI  115



>gb|AAQ54611.1| Gly d Mal d 3-like protein [Glycyphagus domesticus]
 gb|EMT27039.1| putative Non-specific lipid-transfer protein [Aegilops tauschii]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +2

Query  68   TMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLL  247
             M  A+A V+ +AAV    R   AIDC  VD ++  CL Y+Q GG  P  +CC   ++L 
Sbjct  6    VMLMAVALVLMLAAV---PRAAVAIDCGHVDSLVRPCLSYVQ-GGPSPSGQCCGGVQSLH  61

Query  248  RGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                ++ DRQ AC CLK  A    ++  D A  L   CG+     IS DI+C +V
Sbjct  62   NQAQSKSDRQAACNCLKGIARGIHNLNEDNARSLAPKCGVNLPYHISLDIDCNSV  116



>ref|XP_006347955.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=120

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = +2

Query  119  AVRLGQ--AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACEC  292
            A RL Q   + C  VD  ++ C+ YL +GG  P   CC   + +     +  +R+ AC C
Sbjct  21   AGRLEQQGGVTCGQVDANMTPCISYLTQGG-EPNAACCSGVKTVNGMAQSADERKTACNC  79

Query  293  LKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            LKA A R  ++K D A  LP  CG++ +I ISR INC  +
Sbjct  80   LKAAANRYANLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>ref|XP_002323069.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
 gb|ABK95798.1| unknown [Populus trichocarpa]
 gb|EEF04830.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 3/108 (3%)
 Frame = +2

Query  92   VIFIAAVLAAVRLG-QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQ  268
            V+ +  VL+A  L  +A+ C  V   ++ CL YL+ GGA PP  CC     L     T Q
Sbjct  9    VLLLCMVLSAPMLNVEALSCSVVASNLAQCLTYLRNGGAVPP-ACCKGVGTLNNAAKTTQ  67

Query  269  DRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            DR++AC C+K TAA+   + ++ A+ LP  C +     IS   NC ++
Sbjct  68   DRRDACNCIKTTAAQLGGVNSNYAAALPGLCHVNIPYKISTSTNCASI  115



>sp|Q42842.1|NLT43_HORVU RecName: Full=Non-specific lipid-transfer protein 4.3; Short=LTP 
4.3; Flags: Precursor [Hordeum vulgare]
 emb|CAA91435.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRL---GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M RA A  + + A++AA+ L     AI C  V   +S C+ Y +  GA PP+ CC   + 
Sbjct  1    MARAAATQLVLVAMVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKR  60

Query  242  LLRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +  D+Q AC+C+K+ A    + A  A+ +P  CG++    IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIKSAAG--GLNAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>ref|XP_006400974.1| hypothetical protein EUTSA_v10014841mg [Eutrema salsugineum]
 gb|ESQ42427.1| hypothetical protein EUTSA_v10014841mg [Eutrema salsugineum]
Length=170

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C TV   ++ C GYL +GGA P   CC     L     T  DRQ+AC+CLKA A   
Sbjct  82   AISCGTVASSLAPCAGYLTKGGAVP-APCCAGVSKLNGMAKTTPDRQQACKCLKAAAQ--  138

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             I   +AS LP  CG++    IS   NC NV
Sbjct  139  SINPSLASGLPGKCGVSIPYPISMSTNCDNV  169



>emb|CAB53447.1| non-specific lipid transfer protein [Brassica napus]
Length=118

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 8/114 (7%)
 Frame = +2

Query  83   MAPVIFIAAVLAA-VRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCD---SFRNLLR  250
            +A +IF   ++A  +    A+ C TV   ++ C+GYL +     P  CC    S  NL R
Sbjct  7    LACLIFACMIVAGPITSNAALSCGTVSGYVAPCIGYLAQNAPALPRACCSGVTSLNNLAR  66

Query  251  GTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             TP   DRQ+AC CL   A A P I A  A+ LP +CG+     IS+  NC +V
Sbjct  67   TTP---DRQQACRCLVGAANALPTINAARAAGLPKACGVNIPYKISKTTNCNSV  117



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR  313
             AI C  V   +S C+ Y++ GG+ P   CC   R+L     T  DR+  C CLK+TAAR
Sbjct  26   NAITCGQVASSVSGCISYVRSGGSIP-ASCCSGVRSLAGSAKTTADRRTVCNCLKSTAAR  84

Query  314  -PDIKADVASVLPWSCGLASSITISRDINCQNV  409
               IK  +A+ LP  CG+    TIS   +C  V
Sbjct  85   ISGIKPALAAGLPSKCGVRIPFTISPSTDCSKV  117



>emb|CDY32650.1| BnaA02g07120D [Brassica napus]
Length=113

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 51/104 (49%), Gaps = 2/104 (2%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
             +  V  A  +  A+ C TV   ++ C  YL +GGA  P  CC   + L     T  DRQ
Sbjct  11   LVLTVYIAASVDAALTCGTVTSSLAPCATYLSKGGAVVPGPCCAGVKKLNDMAQTTPDRQ  70

Query  278  EACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +AC+CLKA A    I   +AS LP  C ++    IS   NC NV
Sbjct  71   QACKCLKAAAK--SINPSLASGLPGKCSVSIPYPISMSTNCDNV  112



>emb|CDP09436.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAID---CQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            +  +A+VL  V+ G+A+    C  VD +++ C+ YL  GG  P  ECC+  R+       
Sbjct  9    LFMVASVLIMVQAGRAMSRLTCGQVDTLLAPCIPYLTHGG-EPGPECCNGVRSTKALAQN  67

Query  263  QQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
            ++D+++ C C+K  A R  +++ D    LP  CG+   I +SR INC
Sbjct  68   REDKRQVCICVKEAANRYANLEDDAVQALPVKCGVDVDIPVSRKINC  114



>gb|KHN40180.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=115

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  C+ YL  G   PP  CC   ++L     T +D++ AC C+K+T+   
Sbjct  24   AISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKSLASAATTSEDKKAACNCIKSTSKSI  83

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I + +A  LP +CG+   + IS + +C  V
Sbjct  84   NINSQLAQALPGNCGITLPVAISPNADCSKV  114



>ref|XP_010025406.1| PREDICTED: non-specific lipid-transfer protein 8-like [Eucalyptus 
grandis]
 gb|KCW62060.1| hypothetical protein EUGRSUZ_H04731 [Eucalyptus grandis]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 53/108 (49%), Gaps = 3/108 (3%)
 Frame = +2

Query  95   IFIAAVLAAVRLG---QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQ  265
             FIA  L + R+     AI C  V   +  C+ YL+ G  +PP  CC    +L     + 
Sbjct  11   FFIALFLLSTRVPVSESAISCSDVVKDLRPCVSYLKSGSGNPPAACCAGVTSLANAATSS  70

Query  266  QDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             D++ AC CLK  A + +  A +A  LP  CG+   + +S +++C  +
Sbjct  71   ADKKAACACLKNAAQKMNPNAQLAQALPSKCGVTLPVAVSPNVDCSKI  118



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR-P  316
            I C  V   + SC+GYL+      P  CC+  ++L +   T  DRQ ACECLK T+   P
Sbjct  28   ITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIP  87

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             +   +A+ LP  CG++    IS   NC+ V
Sbjct  88   GLNPGLAAGLPGKCGVSVPYKISTSTNCKAV  118



>ref|XP_006298841.1| hypothetical protein CARUB_v10014953mg [Capsella rubella]
 gb|EOA31739.1| hypothetical protein CARUB_v10014953mg [Capsella rubella]
Length=117

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  C+ YL  G   PP  CCD  +NL   T    D++ AC+C+K+ A+  
Sbjct  26   AISCSVVLQDLQPCVSYLTSGSGKPPQTCCDGVQNLAAATTASADKKAACQCIKSVASSV  85

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
             +K ++A  L  +CG +  +  S  ++C  V
Sbjct  86   TVKPELAQALASNCGASLPVDASSTVDCTTV  116



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ A+ + QAI C  V   I+ C+ Y++ GGA P   CC+  R+L     T  DRQ  C 
Sbjct  17   IVVALPIAQAITCGQVASSIAPCVNYVKSGGAVP-AACCNGVRSLNSAAKTTADRQTTCN  75

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK A+ A   +  ++A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>ref|XP_010509136.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010509137.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Camelina sativa]
Length=118

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 5/109 (5%)
 Frame = +2

Query  95   IFIAAVLAA--VRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQ  268
            +F+A ++ A  +    A+ C  V   ++ C+GY+ +GG  PP  CC+  RNL     T  
Sbjct  10   LFLACMIVAGPITANAALSCGAVSSNLAPCIGYVMQGGVIPP-ACCNGVRNLNSMARTTP  68

Query  269  DRQEACECLKATAAR--PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            DRQ+AC C+++ A      + A  A+ +P SCG+     IS   NC+ V
Sbjct  69   DRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTV  117



>gb|KFK40228.1| hypothetical protein AALP_AA3G347300 [Arabis alpina]
Length=116

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARPD  319
            I C TV   +  C+ YL  G  +PP  CC   +NL   T T  D++ AC+C+K+ A    
Sbjct  26   ISCSTVTQDLQPCVSYLTSGSGNPPDTCCKGVQNLAAATTTSADKKAACQCIKSLANSVT  85

Query  320  IKADVASVLPWSCGLASSITISRDINCQNV  409
            +K ++A  L  +CG +  +  S  ++C+ V
Sbjct  86   VKTELAQALATNCGASLPVDASPTVDCKTV  115



>ref|XP_009788622.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=115

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  122  VRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKA  301
            V  G A+ C  VD  ++SC+ YL +GG  P   CC     L        D++ AC C+KA
Sbjct  19   VEPGLALTCGQVDASLASCIPYLTQGG-DPNAACCIGVTALKGMAQNTADKRAACNCVKA  77

Query  302  TAAR-PDIKADVASVLPWSCGLASSITISRDINC  400
             A R  ++K D A  LP  CG+   IT+S+ +NC
Sbjct  78   AANRYANLKEDAAQALPTKCGVTLDITVSKSVNC  111



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK--ATAA  310
            A+ C TV+  ++ C+GY+ +GG  P   CC     L     T  DRQ+AC CLK  A+A 
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGPLP-GACCTGVSKLNSMARTTPDRQQACRCLKTAASAL  84

Query  311  RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             P + A  A+ +P +CG++    IS + NC +V
Sbjct  85   GPSLNAGRAAGIPKACGVSVPFPISTNTNCNSV  117



>ref|XP_007141470.1| hypothetical protein PHAVU_008G198600g, partial [Phaseolus vulgaris]
 gb|ESW13464.1| hypothetical protein PHAVU_008G198600g, partial [Phaseolus vulgaris]
Length=96

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +2

Query  125  RLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKAT  304
            R  +A+ C+    ++S CL YL +  + P   CC     L+  TPT++++  AC+CLK  
Sbjct  2    RATKALTCEQTKSLMSPCLDYLTKKTSTPSTPCCQGLNKLIVSTPTKEEKCAACKCLKGE  61

Query  305  AAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            A+  P++  D A+ LP  C +     IS+D +C+
Sbjct  62   ASHIPNLDVDRANGLPKVCKINVDYPISKDFDCE  95



>sp|Q39794.1|NLTP_GERHY RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gerbera hybrid cultivar]
 emb|CAA83459.1| lipid transfer protein [Gerbera hybrid cultivar]
Length=116

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 52/106 (49%), Gaps = 2/106 (2%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDR  274
            + +A ++ +     AI C  V   +  C GYL  GG  PP  CC+  R L     T  DR
Sbjct  11   VAVACMVFSASYADAISCGQVTSGLVPCFGYLAAGGPVPP-ACCNGVRGLNNAAKTTPDR  69

Query  275  QEACECLKAT-AARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            Q AC CLK   AA   I  + A+ LP  CG++    I+ +I+C  +
Sbjct  70   QTACGCLKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI  115



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 62/127 (49%), Gaps = 4/127 (3%)
 Frame = +2

Query  32   QAKLKLYTKIKATMNRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHP  211
            +    L   I A+M   +A V+ +  ++ A     AI C TV   ++ C+GYL +GG+ P
Sbjct  48   KTHFSLQRNIMASMK--VACVLLMMCIIVAPMAEAAITCGTVTGSLAPCIGYL-KGGSGP  104

Query  212  PMECCDSFRNLLRGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISR  388
               CC   + L     T  DRQ AC CLK+ A A   +  ++A+ LP  CG+     IS 
Sbjct  105  SAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAISGLNPNIAAGLPGKCGVNIPYKIST  164

Query  389  DINCQNV  409
              NC  +
Sbjct  165  STNCATI  171



>gb|ACE80968.1| putative allergen Pru du 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            +F+  V+AA  + +A + C  +   ++ CLGYLQ GG  P   CC   + L+    T  D
Sbjct  10   LFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRGGV-PAGGCCPGIKRLVGSATTTAD  68

Query  272  RQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC+CLK  A A   I    A+ LP  CG+     IS   NC +V
Sbjct  69   RQNACKCLKTVAGAVKGINTGYAAALPSLCGVKIPYKISASTNCNSV  115



>ref|XP_007140137.1| hypothetical protein PHAVU_008G087100g [Phaseolus vulgaris]
 gb|ESW12131.1| hypothetical protein PHAVU_008G087100g [Phaseolus vulgaris]
Length=212

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 50/106 (47%), Gaps = 1/106 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            V+    V+ A  + QAI C  V   ++ CL YL  GG      CC+  R++L    T  +
Sbjct  106  VVLCMGVVGAPMMAQAISCGDVTTDLAPCLSYLMNGGTASD-ACCEGVRSILGAAGTTSE  164

Query  272  RQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +Q  C CLK  A    I  + A  LP  C ++    ISR  NC N+
Sbjct  165  KQTVCNCLKDAANNFGINDNYAQALPGLCNVSVPYKISRSTNCANI  210



>sp|Q43767.1|NLT41_HORVU RecName: Full=Non-specific lipid-transfer protein 4.1; Short=LTP 
4.1; AltName: Full=CW-21; Short=CW21; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48621.1| Cw-21 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ92944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAAVRL---GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M RA A  + + A++AA+ L     AI C  V   +S C+ Y +  GA PP  CC   + 
Sbjct  1    MARAAASQLVLVALVAAMLLVAADAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKR  60

Query  242  LLRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +  D+Q AC+C+K+ A    + A  A+ +P  CG++    IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIKSAAG--GLNAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>sp|Q43875.1|NLT42_HORVU RecName: Full=Non-specific lipid-transfer protein 4.2; Short=LTP 
4.2; AltName: Full=Low-temperature-responsive protein 4.9; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA91436.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 gb|AAB05812.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 prf||2115353C lipid transfer protein
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAA---VRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRN  241
            M RA A  + + A++AA   V    AI C  V   +S C+ Y +  GA PP+ CC   + 
Sbjct  1    MARAAATQLVLVAMVAAMLIVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKR  60

Query  242  LLRGTPTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            L     +  D+Q AC+C+K+ A    + A  A+ +P  CG++    IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIKSAAG--GLNAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>gb|KHN21357.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=139

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  C+ YL  G   PP  CC   + L     T +D++ AC C+K+T+   
Sbjct  48   AISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSI  107

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I + +A  LP +CG+   + IS + +C  V
Sbjct  108  NINSQLAQALPGNCGITLPVAISPNADCSKV  138



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR  313
            QAI C  V   ++ C+G+L+ GG  P M CC+  R+L     T  DRQ AC CLK  AAR
Sbjct  23   QAITCGQVSGSLAPCIGFLRSGGPIP-MPCCNGVRSLNAAARTTPDRQTACNCLK-QAAR  80

Query  314  --PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              P +  + A+ LP +CG++    IS   +C  V
Sbjct  81   SIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>gb|ACE80969.1| putative allergen Pru p 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            +F+  V+AA  + +A + C  +   ++ CLGYLQ GG  P   CC   + L+    T  D
Sbjct  10   LFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRGGV-PAGGCCPGIKRLVGSATTTAD  68

Query  272  RQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC+CLK  A A   I    A+ LP  CG+     IS   NC +V
Sbjct  69   RQNACKCLKTVAGAVKGINPGYAAALPSLCGVKIPYKISASTNCNSV  115



>ref|XP_007206160.1| hypothetical protein PRUPE_ppa013558mg [Prunus persica]
 gb|EMJ07359.1| hypothetical protein PRUPE_ppa013558mg [Prunus persica]
Length=116

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQA-IDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            +F+  V+AA  + +A + C  +   ++ CLGYLQ GG  P   CC   + L+    T  D
Sbjct  10   LFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRGGV-PAGGCCPGIKRLVGSATTTAD  68

Query  272  RQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ AC+CLK  A A   I    A+ LP  CG+     IS   NC +V
Sbjct  69   RQNACKCLKTVAGAVKGINPGYAAALPSLCGVKIPYKISASTNCNSV  115



>ref|XP_002884130.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60389.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAAR  313
             AI C  V   +  C+ YL  G  +PP  CCD  ++L   T T  D++ AC+C+K+ A  
Sbjct  24   SAISCSVVIQDLQPCVSYLTSGSGNPPKTCCDGVKSLAAATTTSADKKAACQCIKSVANS  83

Query  314  PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              +K ++A  L  +CG +  +  S  ++C  V
Sbjct  84   VTVKPELAQALASNCGASLPVDASPTVDCTTV  115



>ref|NP_001236847.1| uncharacterized protein LOC100306055 [Glycine max]
 gb|ACU14045.1| unknown [Glycine max]
Length=139

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  C+ YL  G   PP  CC   + L     T +D++ AC C+K+T+   
Sbjct  48   AISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSI  107

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I + +A  LP +CG+   + IS + +C  V
Sbjct  108  NINSQLAQALPGNCGITLPVAISPNADCSKV  138



>gb|EYU42244.1| hypothetical protein MIMGU_mgv1a024175mg [Erythranthe guttata]
Length=119

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 52/109 (48%), Gaps = 3/109 (3%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQ--EGGAHPPMECCDSFRNLLRGT  256
            +A VIF   V  A     +I C  V   +  C+ YL+   G A PP  CC    NL    
Sbjct  11   LASVIF-GLVFFAAPSSSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLATSA  69

Query  257  PTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQ  403
             T  D+Q AC CLK  A   ++  D+A  LP  CG++ S  IS  ++C 
Sbjct  70   TTTADKQTACACLKNAATNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>ref|XP_010443683.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 57/111 (51%), Gaps = 5/111 (5%)
 Frame = +2

Query  77   RAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGT  256
            R  A ++    ++A+V    AI C TV   ++ C GYL +GGA PP  CC   + L    
Sbjct  6    RFFACLVLTVCIVASVD--AAITCGTVASSLAPCGGYLAKGGAVPP-PCCAGVKKLNGMA  62

Query  257  PTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
             T  DRQ+AC CL++ A    I   +AS LP  CG++    IS   NC  +
Sbjct  63   QTTPDRQQACRCLQSAAK--GINPSLASSLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_011094394.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 57/115 (50%), Gaps = 3/115 (3%)
 Frame = +2

Query  71   MNRAMAPVIFIAAVLAA-VRLGQAIDCQTVDLIISSCLGYLQ-EGGAHPPMECCDSFRNL  244
            M  A+  VI I AV+A   + GQA+ C  VD  +  C+ YL   GG  P   CC   + +
Sbjct  1    MKAAVVAVIAILAVIAVFAQPGQAVSCGQVDAALVPCISYLTGRGGDSPSPACCSGVKAV  60

Query  245  LRGTPTQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQN  406
                 T  D++  C C+KA A R  D+K   A  LP  CG+   I +SR ++C  
Sbjct  61   KDMAQTTADKRGCCSCIKAAANRYADLKDAAAQSLPTKCGVQMDIPVSRTVDCDK  115



>ref|XP_006409161.1| hypothetical protein EUTSA_v10022915mg [Eutrema salsugineum]
 gb|ESQ50614.1| hypothetical protein EUTSA_v10022915mg [Eutrema salsugineum]
Length=116

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 1/107 (1%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQ-AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQ  268
            +I +  +L   R  + AI C  V   +  C+ YL  G   PP  CCD  ++L   T T  
Sbjct  9    IISVLGILFIPRYSESAISCSVVIQDLQPCVSYLTSGSGQPPATCCDGVKSLAAATTTSA  68

Query  269  DRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            D++ AC+C+K+ A    +K ++A  L  +CG +  +  S  ++C  V
Sbjct  69   DKKAACQCIKSVANSVTVKPELAQALASNCGASLPVDKSSTVDCTTV  115



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 50/110 (45%), Gaps = 1/110 (1%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPT  262
            M   + +  ++AA    QAI C  V   +  CL YL+  G  PP  CC+  R +     T
Sbjct  6    MVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKT  65

Query  263  QQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
              DR+ AC+CLK+ A     +     + LP  CG+     IS   NC  V
Sbjct  66   TADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATV  115



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 52/113 (46%), Gaps = 2/113 (2%)
 Frame = +2

Query  74   NRAMAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRG  253
            N  +A V+ +  ++ A     AI C TV   +  C+GYL+ GG  P   CC   + L   
Sbjct  3    NMKIACVVLMMCMIVAPMADAAISCGTVTSALGPCIGYLK-GGPGPSPACCGGVKRLNGA  61

Query  254  TPTQQDRQEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
              T  DRQ AC CLK A  A   +    AS LP  CG+     IS   NC  +
Sbjct  62   AATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGVNIPYKISTSTNCATI  114



>ref|XP_007141473.1| hypothetical protein PHAVU_008G198900g [Phaseolus vulgaris]
 gb|ESW13467.1| hypothetical protein PHAVU_008G198900g [Phaseolus vulgaris]
Length=123

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +2

Query  116  AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECL  295
            AA+   +A+ C+    +++ CL +L      P   CC+ F  ++   PT+++++  C CL
Sbjct  20   AAIEPPKALTCEQTKSLVTPCLDFLTSKTNTPSTPCCEGFNEVIFSAPTKEEKRATCNCL  79

Query  296  KATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNVL  412
            K  A+  P++  D A+ LP  C       IS+D +C+ ++
Sbjct  80   KEAASHIPNLDNDKANKLPKVCNFDLDNLISKDFDCEKII  119



>ref|XP_003546844.1| PREDICTED: LOW QUALITY PROTEIN: non-specific lipid-transfer protein 
8-like [Glycine max]
Length=138

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLKATAARP  316
            AI C  V   +  C+ YL  G   PP  CC   + L     T +D++ AC C+K+T+   
Sbjct  47   AISCSDVIKDLRPCVSYLVSGSGQPPAACCSGAKALASAATTSEDKKAACNCIKSTSKSI  106

Query  317  DIKADVASVLPWSCGLASSITISRDINCQNV  409
            +I + +A  LP +CG+   + IS + +C  V
Sbjct  107  NINSQLAQALPGNCGITLPVAISPNADCSKV  137



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ A    +A+ C  V   ++ C+GYL +GGA PP  CC+  + L     T  DRQ AC 
Sbjct  2    MVVAAHYAEALSCGQVSSSLAPCIGYLTKGGAVPP-ACCNGVKGLNNAAKTTPDRQAACG  60

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK A  +   I A  A+ LP  CG++    IS   +C  V
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_009126703.1| PREDICTED: non-specific lipid-transfer protein 4-like [Brassica 
rapa]
Length=113

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 51/104 (49%), Gaps = 2/104 (2%)
 Frame = +2

Query  98   FIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQ  277
             +  V  A  +  A+ C TV   ++ C  YL +GGA  P  CC   + L     T  DRQ
Sbjct  11   LVLTVCIAASVDAALTCGTVTSSLAPCATYLSKGGAVVPGPCCAGVKKLNDMAQTTPDRQ  70

Query  278  EACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            +AC+CLKA A    I   +AS LP  C ++    IS   NC NV
Sbjct  71   QACKCLKAAAK--SINPSLASGLPGKCSVSIPYPISMSTNCDNV  112



>gb|EYU40720.1| hypothetical protein MIMGU_mgv1a025606mg [Erythranthe guttata]
Length=115

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query  119  AVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK  298
            A   G+A+ C  +   ++ CL YL  GG  P   CC   R+      + QDRQ AC C+K
Sbjct  18   AATPGEAVSCGELQSSLAPCLSYLT-GGGEPSESCCGGLRSASGSIQSTQDRQTACYCMK  76

Query  299  ATAA-RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            + A+   ++  D A+ LP  CG++  +TIS +++C  +
Sbjct  77   SAASCTYNVPTDAAASLPGKCGVSVGMTISPNVDCSQI  114



>ref|XP_011089414.1| PREDICTED: non-specific lipid-transfer protein A-like [Sesamum 
indicum]
Length=116

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (50%), Gaps = 5/111 (5%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            ++ + AV A V L    GQA+ C  VD  +  C+ YL   G  P   CC   + +     
Sbjct  5    IVAVLAVFAIVSLIVQQGQAVTCGQVDAALVPCISYLTGHGDSPSPACCAGVKAVKGMAQ  64

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQNV  409
            T  D++ +C C+KA A R  D+K D A  LP  C +   I +SR ++C  +
Sbjct  65   TTADKRASCACVKAAANRYADLKDDAAQSLPTKCNVQMDIPVSRSVDCDKI  115



>emb|CDY18379.1| BnaA04g22080D [Brassica napus]
Length=119

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 3/100 (3%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            V   +    A+ C TV+  ++ C+GY+ +GG  P   CC     L     T  DRQ+AC 
Sbjct  17   VAGPITANAALTCGTVNSNVAPCIGYITQGGPLP-GACCTGVSKLNSMARTTPDRQQACR  75

Query  290  CLK--ATAARPDIKADVASVLPWSCGLASSITISRDINCQ  403
            CLK  A+A  P++ A  A+ +P +CG++    IS + NC 
Sbjct  76   CLKTAASALGPNLNAGRAAGIPKACGVSVPFPISTNTNCN  115



>gb|KDP28820.1| hypothetical protein JCGZ_14591 [Jatropha curcas]
Length=114

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 5/109 (5%)
 Frame = +2

Query  92   VIFIAAVLAAVRL----GQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTP  259
            +I I  V+A V+L    G+A+DC  V+  ++ C+ ++      P   CC   +NL    P
Sbjct  5    IITILIVVAFVQLMAMPGEAVDCGQVNSALAPCIPFMTGADTAPSAACCGGVKNLKALAP  64

Query  260  TQQDRQEACECLKATAAR-PDIKADVASVLPWSCGLASSITISRDINCQ  403
            T  DR+ AC+C KA A+  P+I  D AS LP  CG+  +I IS++INCQ
Sbjct  65   TTADRRAACDCAKAAASHYPNINEDSASSLPKKCGVEVNIPISKNINCQ  113



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   VIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            ++ +  ++ A+ + QAI C  V   IS C+ Y++ GGA P   CC   RNL     T  D
Sbjct  11   LVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP-APCCSGIRNLNGMAKTTAD  69

Query  272  RQEACECLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            RQ  C CLK A      +  ++A+ LP  CG++    IS   NC  V
Sbjct  70   RQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACECLK-ATAA  310
            Q++ C TV   +  CL Y++ GGA P M+CC+  R+L     T  DRQ  C C+K A ++
Sbjct  1    QSMSCSTVVTDLYPCLDYVENGGAVP-MDCCEGIRSLYTSAATTADRQTVCNCMKNAASS  59

Query  311  RPDIKADVASVLPWSCGLASSITISRDINCQNV  409
               +  D+A+ LP  CG++    IS  ++C  V
Sbjct  60   VTGLNLDLAAGLPQKCGVSIPYQISPSVDCATV  92



>gb|EYU37388.1| hypothetical protein MIMGU_mgv1a018287mg [Erythranthe guttata]
Length=119

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 52/109 (48%), Gaps = 3/109 (3%)
 Frame = +2

Query  83   MAPVIFIAAVLAAVRLGQAIDCQTVDLIISSCLGYLQ--EGGAHPPMECCDSFRNLLRGT  256
            +A VIF   V  A     +I C  V   +  C+ YL+   G A PP  CC    NL    
Sbjct  11   LASVIF-GLVFFAAPSSSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLATSA  69

Query  257  PTQQDRQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQ  403
             T  D+Q AC CLK  A   ++  D+A  LP  CG++ S  IS  ++C 
Sbjct  70   TTTADKQTACACLKNAAKNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>sp|P07597.1|NLTP1_HORVU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Probable amylase/protease inhibitor; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA41946.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 emb|CAA28805.1| unnamed protein product [Hordeum vulgare]
 gb|AAA32970.1| amylase/protease inhibitor [Hordeum vulgare]
 emb|CAP16136.1| non-specific lipid transport protein 1 precursor [Hordeum vulgare]
Length=117

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = +2

Query  80   AMAPVIFIAAVL-----AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNL  244
            A A V+ +AA L     AA R   A++C  VD  +  CL Y+Q GG  P  ECC+  R+L
Sbjct  2    ARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDL  60

Query  245  LRGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 +  DRQ  C CLK  A    ++  + A+ +P  C +    TIS DI+C  +
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>emb|CDY60288.1| BnaA09g52860D [Brassica napus]
Length=116

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +2

Query  95   IFIAAVLAAVRLGQ-AIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQD  271
            IF+  +    R  + AI C  V   +  C+ YL  G   PP  CCD  R+L   T T  D
Sbjct  10   IFVLGIFLTPRYSESAISCSVVLSDLQPCVSYLTSGSGQPPETCCDGVRSLDAATTTSAD  69

Query  272  RQEACECLKATAARPDIKADVASVLPWSCGLASSITISRDINCQ  403
            ++ AC+C+K+ A    +K ++A  L  +C  +  +  S  ++C 
Sbjct  70   KKAACQCIKSVANSVTVKPELAKALASNCNASLPVDASSTVDCN  113



>dbj|BAK05317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = +2

Query  80   AMAPVIFIAAVL-----AAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNL  244
            A A V+ +AA L     AA R   A++C  VD  +  CL Y+Q GG  P  ECC+  R+L
Sbjct  2    ARAQVLLMAAALVLMLMAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDL  60

Query  245  LRGTPTQQDRQEACECLKATA-ARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
                 +  DRQ  C CLK  A    ++  + A+ +P  C +    TIS DI+C  +
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ A    +A+ C  V   ++ C+GYL +GGA PP  CC+  + L     T  DRQ AC 
Sbjct  2    MVVAATYAEALSCGQVSSSLAPCIGYLTKGGAVPP-ACCNGVKGLNNAAKTTPDRQAACG  60

Query  290  CLK-ATAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK A  +   I A  A+ LP  CG++    IS   +C  V
Sbjct  61   CLKSAYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAAVRLGQAIDCQTVDLIISSCLGYLQEGGAHPPMECCDSFRNLLRGTPTQQDRQEACE  289
            ++ +V + QAI C  V   ++ C+GY++ GGA PP  CC+  RN+     T  DR+ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACN  75

Query  290  CLKA-TAARPDIKADVASVLPWSCGLASSITISRDINCQNV  409
            CLK  + +   +  + A+ LP  CG+     IS   NC  V
Sbjct  76   CLKQLSGSISGVNPNNAAALPGKCGVNIPYKISISTNCAAV  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 794979557040