BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24691_g1_i1 len=619 path=[2134:0-77 941:78-200 1064:201-248
3448:249-302 2432:303-332 3984:333-336 3988:337-337 2466:338-378
2507:379-404 4009:405-407 2844:408-502 4043:503-514 652:515-540
1381:541-552 1393:553-618]

Length=619
                                                                      Score     E

ref|XP_002511594.1|  Nonspecific lipid-transfer protein A, putative   96.3    1e-21   Ricinus communis
ref|XP_002511596.1|  Nonspecific lipid-transfer protein A, putative   96.3    1e-21   Ricinus communis
ref|XP_004233683.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    3e-21   
ref|XP_009785298.1|  PREDICTED: non-specific lipid-transfer prote...  94.0    7e-21   
ref|XP_009623063.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    1e-20   
ref|XP_006338457.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    2e-19   
sp|P10973.1|NLTPA_RICCO  RecName: Full=Non-specific lipid-transfe...  89.4    2e-19   Ricinus communis
ref|XP_006437592.1|  hypothetical protein CICLE_v10033516mg           89.7    4e-19   
ref|XP_006451724.1|  hypothetical protein CICLE_v10010357mg           88.6    7e-19   
ref|XP_006484285.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    9e-19   
ref|XP_006437824.1|  hypothetical protein CICLE_v10033852mg           88.2    1e-18   
ref|XP_006485829.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   
ref|XP_006484581.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    3e-18   
gb|KDO70214.1|  hypothetical protein CISIN_1g043414mg                 85.5    1e-17   
ref|XP_006437630.1|  hypothetical protein CICLE_v10033367mg           84.3    3e-17   
gb|AAM00273.1|AF363506_1  lipid transfer protein 2                    83.6    7e-17   Euphorbia lagascae
gb|KDP34869.1|  hypothetical protein JCGZ_09157                       83.2    8e-17   
ref|XP_002283359.2|  PREDICTED: non-specific lipid-transfer prote...  82.4    1e-16   Vitis vinifera
ref|XP_002527124.1|  Nonspecific lipid-transfer protein B, putative   82.0    2e-16   Ricinus communis
ref|XP_010106165.1|  Auxin response factor 6                          87.0    4e-16   
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    5e-16   
emb|CAN72931.1|  hypothetical protein VITISV_020613                   80.9    6e-16   Vitis vinifera
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              80.9    6e-16   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    7e-16   
gb|KDP28851.1|  hypothetical protein JCGZ_14622                       79.7    1e-15   
ref|XP_009773021.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    1e-15   
ref|XP_002527125.1|  Nonspecific lipid-transfer protein B, putative   79.3    2e-15   Ricinus communis
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
gb|KDP28819.1|  hypothetical protein JCGZ_14590                       78.6    4e-15   
ref|XP_011031945.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   
gb|KEH22495.1|  Nodule Cysteine-Rich (NCR) secreted peptide           78.2    4e-15   
ref|XP_010540223.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    5e-15   
ref|XP_010527034.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  78.2    7e-15   Prunus avium [gean]
gb|ADR66942.1|  non-specific lipid transfer protein                   78.2    7e-15   
ref|NP_001241103.1|  uncharacterized protein LOC100798112 precursor   77.4    1e-14   
gb|ADR66943.1|  non-specific lipid transfer protein                   77.4    1e-14   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    2e-14   
gb|AAY84146.1|  lipid transfer protein                                77.0    2e-14   Catharanthus roseus [chatas]
ref|XP_011031956.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    2e-14   
emb|CDY68862.1|  BnaCnng60800D                                        77.0    4e-14   
gb|AGW21333.1|  lipid transfer protein                                75.5    6e-14   
gb|AGH27864.1|  lipid transfer protein precursor                      75.5    6e-14   
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  75.1    7e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    7e-14   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    75.1    8e-14   Triticum aestivum [Canadian hard winter wheat]
gb|ADR66953.1|  non-specific lipid transfer protein                   75.1    8e-14   
emb|CDP14198.1|  unnamed protein product                              75.1    9e-14   
ref|XP_008229617.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    9e-14   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  74.7    1e-13   Prunus dulcis [sweet almond]
gb|AGH27866.1|  lipid transfer protein precursor                      74.3    1e-13   
gb|KHG04165.1|  Non-specific lipid-transfer A                         74.3    2e-13   
ref|XP_003533715.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    2e-13   
emb|CDX72398.1|  BnaC07g44200D                                        73.9    2e-13   
gb|AGW21344.1|  lipid transfer protein                                73.9    2e-13   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           73.6    2e-13   
ref|XP_004229753.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
ref|XP_006468966.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
sp|P10974.1|NLTPB_RICCO  RecName: Full=Non-specific lipid-transfe...  72.8    3e-13   Ricinus communis
gb|EYU34081.1|  hypothetical protein MIMGU_mgv1a024111mg              73.2    3e-13   
emb|CDY46122.1|  BnaA03g52460D                                        73.2    4e-13   
ref|NP_001236359.1|  uncharacterized protein LOC100306531 precursor   72.8    5e-13   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  72.8    5e-13   Hordeum vulgare [barley]
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  72.8    5e-13   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK05317.1|  predicted protein                                    72.8    5e-13   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           72.8    6e-13   
ref|XP_009138182.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    6e-13   
ref|XP_002282792.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   Vitis vinifera
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  72.4    6e-13   
gb|AGH27863.1|  lipid transfer protein precursor                      72.4    6e-13   
gb|ADR66950.1|  non-specific lipid transfer protein                   72.4    6e-13   
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 72.8    7e-13   
emb|CAA42832.1|  LTP 1                                                72.8    7e-13   Hordeum vulgare [barley]
ref|XP_010523199.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    72.0    1e-12   Prunus persica
emb|CDP14199.1|  unnamed protein product                              72.0    1e-12   
ref|XP_010437771.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
gb|KHN44022.1|  Non-specific lipid-transfer protein A                 70.9    2e-12   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       71.2    2e-12   
ref|XP_003560704.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
gb|ADR66946.1|  non-specific lipid transfer protein                   71.2    2e-12   
ref|XP_007141467.1|  hypothetical protein PHAVU_008G198300g           71.2    2e-12   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
gb|KHG13955.1|  Non-specific lipid-transfer 1                         71.2    2e-12   
gb|ABK94706.1|  unknown                                               70.9    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009607862.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    2e-12   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        70.9    2e-12   
ref|XP_009108805.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
emb|CDP15101.1|  unnamed protein product                              70.9    3e-12   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    3e-12   
ref|XP_006375125.1|  hypothetical protein POPTR_0014s04590g           70.9    3e-12   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       70.9    3e-12   Artemisia vulgaris [common wormwood]
ref|XP_009607859.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
ref|XP_009788621.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
gb|ADR66949.1|  non-specific lipid transfer protein                   70.5    3e-12   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 70.5    3e-12   
ref|XP_006446845.1|  hypothetical protein CICLE_v10017229mg           70.5    3e-12   
ref|XP_007141461.1|  hypothetical protein PHAVU_008G197700g           70.5    4e-12   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
ref|XP_004970395.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
pdb|1BWO|A  Chain A, The Crystal Structure Of Wheat Non-Specific ...  69.7    4e-12   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 70.1    5e-12   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  70.1    5e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010447248.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
ref|XP_007217372.1|  hypothetical protein PRUPE_ppa021924mg           70.1    5e-12   
sp|P82007.2|NLTP1_HELAN  RecName: Full=Non-specific lipid-transfe...  70.1    5e-12   Helianthus annuus
ref|XP_007141469.1|  hypothetical protein PHAVU_008G198500g           69.7    6e-12   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              69.7    6e-12   
gb|ACE07189.1|  Art v 3 allergen precursor                            69.7    6e-12   Artemisia vulgaris [common wormwood]
ref|XP_006412367.1|  hypothetical protein EUTSA_v10026585mg           69.7    6e-12   
ref|NP_680758.3|  pathogenesis-related lipid-transfer family protein  69.7    7e-12   Arabidopsis thaliana [mouse-ear cress]
pdb|1CZ2|A  Chain A, Solution Structure Of Wheat Ns-Ltp Complexed...  68.9    7e-12   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    7e-12   
ref|XP_009591276.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    7e-12   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 69.7    7e-12   
gb|EMT21909.1|  Non-specific lipid-transfer protein 4.1               70.5    7e-12   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 69.7    8e-12   
gb|ABK96515.1|  unknown                                               69.3    8e-12   Populus trichocarpa x Populus deltoides
ref|XP_002869218.1|  predicted protein                                69.3    8e-12   
ref|XP_009616321.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
ref|XP_002305878.2|  lipid transfer family protein                    69.3    9e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           69.3    9e-12   
ref|XP_007140136.1|  hypothetical protein PHAVU_008G087000g           69.3    9e-12   
ref|XP_009796551.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
gb|ADR66947.1|  non-specific lipid transfer protein                   69.3    9e-12   
gb|ACI47547.1|  nonspecific lipid transfer protein                    69.3    1e-11   Juglans regia
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  68.6    1e-11   
ref|NP_001238031.1|  uncharacterized protein LOC100500178 precursor   69.3    1e-11   
emb|CDY45038.1|  BnaA08g11810D                                        70.1    1e-11   
emb|CAB96876.2|  pru p 1                                              68.2    1e-11   Prunus persica
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            68.9    1e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           68.9    1e-11   
gb|EYU42244.1|  hypothetical protein MIMGU_mgv1a024175mg              68.9    1e-11   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
ref|XP_009607858.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    1e-11   
ref|NP_001031782.1|  pathogenesis-related lipid-transfer family p...  68.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDM80997.1|  unnamed protein product                              68.6    1e-11   
ref|XP_009607860.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
ref|XP_010527037.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|EYU37388.1|  hypothetical protein MIMGU_mgv1a018287mg              68.6    2e-11   
gb|ACM78614.1|  lipid transfer protein 2                              68.6    2e-11   Tamarix hispida
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       68.6    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010432572.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|ABI26087.1|  lipid transfer protein precursor                      68.6    2e-11   Ginkgo biloba [ginkgo]
gb|AAQ54611.1|  Gly d Mal d 3-like protein                            68.6    2e-11   Glycyphagus domesticus
emb|CDM80964.1|  unnamed protein product                              68.2    2e-11   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  68.2    2e-11   
dbj|BAD54259.1|  hypothetical protein                                 68.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  68.2    2e-11   Hordeum vulgare [barley]
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  68.2    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|ADR66948.1|  non-specific lipid transfer protein                   67.8    3e-11   
gb|ACE80968.1|  putative allergen Pru du 3.03                         67.8    3e-11   Prunus dulcis x Prunus persica
ref|XP_007161356.1|  hypothetical protein PHAVU_001G062300g           67.8    3e-11   
gb|AFK46170.1|  unknown                                               67.8    3e-11   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  67.8    3e-11   Hordeum vulgare [barley]
dbj|BAH03575.1|  nonspecific lipid transfer protein                   67.8    3e-11   Citrus jambhiri [citronelle]
gb|ACE07186.1|  Art v 3.0201 allergen precursor                       67.8    3e-11   Artemisia vulgaris [common wormwood]
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
ref|XP_006347954.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    3e-11   
gb|AAC63372.1|  lipid transfer protein                                67.8    3e-11   Brassica oleracea
gb|AAB70539.1|  lipid transfer protein LPT II                         67.4    4e-11   Oryza sativa Indica Group [Indian rice]
gb|KHN12008.1|  Non-specific lipid-transfer protein A                 67.4    4e-11   
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           67.4    4e-11   
gb|KDP35110.1|  hypothetical protein JCGZ_10952                       67.4    4e-11   
gb|ACE80969.1|  putative allergen Pru p 3.03                          67.4    4e-11   Prunus dulcis x Prunus persica
gb|AGC08425.1|  lipid transfer protein                                67.8    4e-11   
gb|AHB19226.1|  non specific lipid transfer protein 1B                67.4    4e-11   
emb|CAC86258.1|  lipid transfer protein                               67.4    5e-11   Fragaria x ananassa
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  66.6    5e-11   Prunus persica
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            67.4    5e-11   
emb|CDY07725.1|  BnaA03g17860D                                        67.4    5e-11   
prf||2115353A  lipid transfer protein                                 67.0    5e-11
gb|AAT80649.1|  lipid transfer protein precursor                      67.0    5e-11   Malus domestica [apple tree]
gb|ABB96481.1|  non-specific lipid transfer protein precursor         67.0    6e-11   Malus domestica [apple tree]
emb|CDP07650.1|  unnamed protein product                              67.0    6e-11   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    66.6    7e-11   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  66.6    7e-11   Ricinus communis
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  66.6    7e-11   Hordeum vulgare [barley]
gb|AAA74624.1|  lipid transfer protein precursor                      66.6    7e-11   Oryza sativa Indica Group [Indian rice]
gb|ABG54494.1|  putative allergen Rub i 3                             66.6    7e-11   Rubus idaeus [European raspberry]
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  66.6    7e-11   Brassica oleracea var. italica [asparagus broccoli]
gb|AAY83343.1|  non-specific lipid transfer protein precursor         66.6    8e-11   Fragaria x ananassa
ref|XP_011069906.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    8e-11   
ref|NP_001275802.1|  lipid-transfer protein precursor                 66.6    8e-11   
gb|AGC08421.1|  lipid transfer protein                                67.0    8e-11   
ref|NP_001067782.1|  Os11g0427800                                     66.6    8e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAR22488.1|  allergen Mal d 3                                      66.2    8e-11   Malus domestica [apple tree]
gb|ACE07187.1|  Art v 3 allergen precursor                            66.2    9e-11   Artemisia vulgaris [common wormwood]
emb|CDX93316.1|  BnaC04g45800D                                        66.6    9e-11   
gb|AAL27855.1|  lipid transfer protein precursor                      66.2    1e-10   Davidia involucrata
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               66.2    1e-10   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           67.0    1e-10   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         66.2    1e-10   Retama raetam [retem]
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  65.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KDP28846.1|  hypothetical protein JCGZ_14617                       65.5    1e-10   
ref|NP_001176316.1|  Os11g0115466                                     65.9    1e-10   
ref|XP_006285119.1|  hypothetical protein CARUB_v10006452mg           65.9    1e-10   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  65.5    1e-10   Prunus domestica
ref|NP_001065986.1|  Os12g0115000                                     65.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ADV02773.1|  lipid transfer protein 1b                             65.5    1e-10   
ref|XP_007141462.1|  hypothetical protein PHAVU_008G197800g           65.9    1e-10   
gb|AFM35695.1|  nonspecific lipid transfer protein                    65.9    1e-10   
gb|EEE65837.1|  hypothetical protein OsJ_21599                        65.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004229752.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AGN56421.1|  non-specific lipid transfer protein 1                 65.9    1e-10   
sp|P86137.2|NLTP1_ACTDE  RecName: Full=Non-specific lipid-transfe...  65.1    2e-10   Actinidia deliciosa [Chinese gooseberry]
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  65.5    2e-10   Cicer arietinum [garbanzo]
gb|AGN56422.1|  non-specific lipid transfer protein 2                 65.5    2e-10   
gb|ADV02772.1|  lipid transfer protein 1a                             65.9    2e-10   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         65.5    2e-10   Fragaria x ananassa
gb|AAL25839.1|  lipid transfer precursor protein                      65.5    2e-10   Hevea brasiliensis [Para rubber tree]
gb|KDP28820.1|  hypothetical protein JCGZ_14591                       65.5    2e-10   
pdb|1MID|A  Chain A, Non-Specific Lipid Transfer Protein 1 From B...  64.7    2e-10   
ref|XP_010553199.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
pdb|1BE2|A  Chain A, Lipid Transfer Protein Complexed With Palmit...  64.7    2e-10   
gb|ABK22458.1|  unknown                                               65.5    2e-10   Picea sitchensis
dbj|BAI94497.1|  lipid transfer protein                               65.5    2e-10   
gb|ABK21290.1|  unknown                                               65.1    2e-10   Picea sitchensis
gb|KFK36763.1|  lipid transfer protein                                65.1    2e-10   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  65.1    2e-10   Hordeum vulgare [barley]
gb|ABB90546.1|  lipid transfer protein                                65.1    2e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            65.1    3e-10   
gb|KEH29195.1|  Lipid transfer protein                                65.9    3e-10   
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  65.1    3e-10   Lens culinaris
gb|AHG99490.1|  lipid-transfer protein                                64.7    3e-10   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  65.5    3e-10   
gb|KFK29949.1|  hypothetical protein AALP_AA7G198800                  64.7    3e-10   
ref|XP_009607362.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_008342316.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_007141468.1|  hypothetical protein PHAVU_008G198400g           64.7    3e-10   
gb|AAB70538.1|  lipid transfer protein                                64.7    3e-10   Oryza sativa [red rice]
ref|XP_006836299.1|  hypothetical protein AMTR_s00092p00020690        64.7    4e-10   
gb|EMT31304.1|  Non-specific lipid-transfer protein 3                 64.7    4e-10   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  63.9    4e-10   Prunus armeniaca
gb|ACP43542.1|  lipid transfer protein                                64.7    4e-10   Chimonanthus praecox [wintersweet]
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        64.7    4e-10   Vitis cinerea var. helleri x Vitis vinifera
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   64.3    4e-10   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         64.3    4e-10   Fragaria x ananassa
gb|AEN70936.1|  lipid transfer protein                                64.3    4e-10   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
ref|NP_001147136.1|  LOC100280743 precursor                           64.3    5e-10   Zea mays [maize]
ref|XP_009798115.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    5e-10   
gb|AFV30232.1|  lipid transfer protein                                64.3    5e-10   
gb|AFR43276.1|  lipid transfer protein precursor                      64.3    5e-10   
gb|AEC04836.1|  lipid transfer protein                                64.3    5e-10   
sp|P85206.1|NLTP2_ACTDE  RecName: Full=Non-specific lipid-transfe...  63.5    5e-10   
dbj|BAK05751.1|  predicted protein                                    64.3    5e-10   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  64.3    6e-10   
gb|EYU42349.1|  hypothetical protein MIMGU_mgv1a016557mg              63.9    6e-10   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    6e-10   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    7e-10   
gb|ADK60918.1|  lipid transfer protein                                63.9    7e-10   
gb|AEG79730.2|  lipid transfer protein precursor                      63.9    7e-10   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        63.9    7e-10   Sorghum bicolor [broomcorn]
gb|AAB33171.1|  acyl-binding/lipid-transfer protein isoform II, A...  63.2    7e-10   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    7e-10   
prf||2115353B  lipid transfer protein                                 63.9    7e-10
emb|CAQ86909.1|  lipid transfer protein                               63.5    8e-10   Vigna radiata [mung bean]
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    8e-10   
emb|CDY18379.1|  BnaA04g22080D                                        63.5    8e-10   
ref|XP_010690792.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    8e-10   
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    8e-10   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           65.1    8e-10   
gb|AFM39014.1|  lipid transfer protein                                63.5    8e-10   
emb|CDM80995.1|  unnamed protein product                              63.5    9e-10   
ref|XP_009803924.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    9e-10   
gb|KHG09723.1|  Non-specific lipid-transfer                           63.5    9e-10   
emb|CDM80963.1|  unnamed protein product                              63.5    9e-10   
ref|XP_004965551.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    9e-10   
gb|AER92599.1|  putative lipid transfer protein                       63.5    9e-10   
emb|CAH03799.1|  lipid transfer protein                               62.8    1e-09   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            63.5    1e-09   
ref|XP_009788622.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    1e-09   
ref|XP_006347955.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    1e-09   
emb|CDY60751.1|  BnaA05g34760D                                        63.5    1e-09   
emb|CAA69949.1|  lipid transfer protein                               63.2    1e-09   
gb|AFR43285.1|  lipid transfer protein precursor                      63.5    1e-09   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  63.2    1e-09   
ref|XP_007141473.1|  hypothetical protein PHAVU_008G198900g           63.5    1e-09   
ref|XP_004492085.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
gb|AAB80805.1|  PrLTP1                                                63.5    1e-09   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
gb|ACN31691.1|  unknown                                               65.1    1e-09   
ref|XP_010911896.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|XP_002511593.1|  Nonspecific lipid-transfer protein A, putative   62.8    1e-09   
gb|ABF06565.1|  non-specific lipid transfer-like protein              63.2    1e-09   
dbj|BAC77694.1|  lipid transfer protein                               63.2    1e-09   
gb|ACJ62381.1|  lipid-transfer protein                                63.2    1e-09   
gb|ACL01093.1|  lipid transfer protein                                63.2    1e-09   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            63.2    1e-09   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    1e-09   
ref|NP_001159077.1|  nonspecific lipid-transfer protein 3 precursor   63.2    1e-09   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  62.8    1e-09   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   
gb|ABG27026.1|  phosophlipid protein                                  63.2    1e-09   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         62.8    1e-09   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   62.8    1e-09   
emb|CDY68127.1|  BnaC03g71570D                                        63.2    2e-09   
ref|XP_006836298.1|  hypothetical protein AMTR_s00092p00019850        62.8    2e-09   
gb|ACJ62387.1|  lipid-transfer protein                                62.8    2e-09   
gb|AAM22768.1|  lipid transfer protein                                62.4    2e-09   
emb|CAH69188.1|  type 1 non specific lipid transfer protein precu...  62.8    2e-09   
dbj|BAI94498.1|  lipid transfer protein                               62.8    2e-09   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   62.8    2e-09   
pir||EPRZ  phospholipid transfer protein homolog - rice               62.0    2e-09
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-09   
emb|CDX88695.1|  BnaA03g09540D                                        62.8    2e-09   
gb|AEN70916.1|  lipid transfer protein                                62.8    2e-09   
gb|ACJ62361.1|  lipid-transfer protein                                62.8    2e-09   
emb|CDP12680.1|  unnamed protein product                              62.8    2e-09   
gb|KHN33234.1|  Non-specific lipid-transfer protein                   63.5    2e-09   
ref|XP_009396870.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    2e-09   
emb|CCD33109.1|  lipid transfer protein                               62.4    2e-09   
ref|XP_008787647.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
gb|AFR43292.1|  lipid transfer protein precursor                      62.4    2e-09   
ref|XP_006298841.1|  hypothetical protein CARUB_v10014953mg           62.4    2e-09   
ref|XP_007141470.1|  hypothetical protein PHAVU_008G198600g           62.0    2e-09   
ref|NP_001065987.1|  Os12g0115100                                     62.4    2e-09   
ref|XP_010109650.1|  Non-specific lipid-transfer protein              62.8    2e-09   
ref|XP_010537417.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           62.4    2e-09   
ref|XP_010690794.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
emb|CDY32650.1|  BnaA02g07120D                                        62.4    2e-09   
ref|XP_009359208.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   
gb|ABU49731.1|  putative non-specific lipid transfer protein a1       62.0    3e-09   
emb|CAB96874.1|  mal d 3                                              61.6    3e-09   
ref|XP_009126703.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
emb|CAB53447.1|  non-specific lipid transfer protein                  62.0    3e-09   
ref|XP_004972928.1|  PREDICTED: probable non-specific lipid-trans...  62.4    3e-09   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  62.0    3e-09   
ref|XP_011094394.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
ref|XP_007134822.1|  hypothetical protein PHAVU_010G079000g           62.0    3e-09   
gb|KFK40228.1|  hypothetical protein AALP_AA3G347300                  62.0    3e-09   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  62.0    3e-09   
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            62.0    3e-09   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               62.0    3e-09   
ref|XP_011089499.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-09   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              65.9    3e-09   
gb|EYU42353.1|  hypothetical protein MIMGU_mgv1a016579mg              62.0    3e-09   
gb|ABY54820.1|  lipid transfer protein                                62.0    3e-09   
gb|AEN70935.1|  lipid transfer protein                                62.0    3e-09   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   62.0    3e-09   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  62.0    3e-09   
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        62.0    3e-09   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   62.0    3e-09   
sp|P80450.1|NLTP_AMACA  RecName: Full=Non-specific lipid-transfer...  61.2    3e-09   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  62.0    3e-09   
ref|XP_002884130.1|  protease inhibitor/seed storage/lipid transf...  62.0    3e-09   
gb|ACJ62320.1|  lipid-transfer protein                                62.0    3e-09   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               61.6    4e-09   
gb|AFR43295.1|  lipid transfer protein precursor                      62.0    4e-09   
ref|NP_001105392.1|  phospholipid transfer protein precursor          62.0    4e-09   
ref|XP_006409161.1|  hypothetical protein EUTSA_v10022915mg           61.6    4e-09   
gb|ABO28527.1|  lipid transfer protein                                61.6    4e-09   
gb|ACJ62316.1|  lipid-transfer protein                                61.6    4e-09   
ref|XP_003522131.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           62.0    4e-09   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    61.6    4e-09   
gb|AFR43288.1|  lipid transfer protein precursor                      61.6    4e-09   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
emb|CAH04983.1|  type 1 non-specific lipid transfer protein precu...  61.6    4e-09   
ref|XP_009112488.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           61.2    4e-09   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       61.6    4e-09   
ref|XP_011089509.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    4e-09   
ref|XP_007134821.1|  hypothetical protein PHAVU_010G079000g           61.6    4e-09   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  61.2    4e-09   
gb|EYU42354.1|  hypothetical protein MIMGU_mgv1a016560mg              61.6    4e-09   
gb|ACJ62323.1|  lipid-transfer protein                                61.6    4e-09   
gb|ACJ62315.1|  lipid-transfer protein                                61.6    4e-09   
ref|XP_006295253.1|  hypothetical protein CARUB_v10024341mg           61.6    4e-09   
gb|AGC08426.1|  lipid transfer protein                                61.6    4e-09   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  61.6    5e-09   
ref|NP_001232879.1|  nonspecific lipid-transfer protein 3 precursor   61.2    5e-09   
gb|ACG45901.1|  nonspecific lipid-transfer protein 3 precursor        62.0    5e-09   
gb|AAA03284.1|  CW21=non-specific lipid transfer protein              60.8    5e-09   
emb|CBW38502.1|  lipid transfer protein                               60.8    5e-09   
gb|ACJ62319.1|  lipid-transfer protein                                61.2    5e-09   
gb|ACJ62318.1|  lipid-transfer protein                                61.2    5e-09   
gb|ACJ62355.1|  lipid-transfer protein                                61.2    5e-09   
gb|AFR43291.1|  lipid transfer protein precursor                      61.2    5e-09   
gb|ACG31565.1|  nonspecific lipid-transfer protein 3 precursor        61.2    5e-09   
ref|XP_006836300.1|  hypothetical protein AMTR_s00092p00021420        61.2    5e-09   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  60.8    5e-09   
gb|ACJ62339.1|  lipid-transfer protein                                61.2    5e-09   
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  61.2    6e-09   
gb|AFR43289.1|  lipid transfer protein precursor                      61.2    6e-09   
gb|AEN70919.1|  lipid transfer protein                                61.2    6e-09   
gb|AFX65219.1|  lipid transfer precursor protein                      61.2    6e-09   
emb|CAH69194.1|  type 1 non specific lipid transfer protein precu...  61.2    6e-09   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  61.2    6e-09   
gb|ACJ62342.1|  lipid-transfer protein                                61.2    6e-09   
ref|XP_004249049.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
gb|AET05733.1|  lipid transfer protein isoform d                      60.8    6e-09   
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  61.2    6e-09   
ref|NP_179428.1|  non-specific lipid-transfer protein 8               61.2    6e-09   
ref|NP_001065583.1|  Os11g0115400                                     61.2    6e-09   
emb|CAA80809.1|  lipid transfer protein                               61.2    6e-09   
gb|AAQ74628.1|  lipid tranfer protein II                              61.2    6e-09   
gb|AGH13363.1|  lipid transfer protein                                60.8    6e-09   
ref|XP_011089414.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    6e-09   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           61.2    6e-09   
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        61.2    7e-09   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   61.2    7e-09   
ref|XP_009396875.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    7e-09   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             60.8    7e-09   
ref|XP_003595853.1|  Non-specific lipid-transfer protein              60.8    7e-09   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    7e-09   
ref|XP_006662670.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  60.8    7e-09   
ref|XP_009399315.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
emb|CDY60288.1|  BnaA09g52860D                                        60.8    7e-09   
gb|AFK45186.1|  unknown                                               60.8    7e-09   
ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    7e-09   
ref|XP_003579022.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    7e-09   
gb|EYU42355.1|  hypothetical protein MIMGU_mgv1a021081mg              60.8    8e-09   
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    60.8    8e-09   
gb|AEN70917.1|  lipid transfer protein                                60.8    8e-09   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              60.8    8e-09   
gb|EMS50623.1|  Non-specific lipid-transfer protein                   60.8    8e-09   
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  60.1    8e-09   
ref|XP_004492552.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    8e-09   
emb|CDP09436.1|  unnamed protein product                              60.8    8e-09   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        60.8    9e-09   
gb|AFR43293.1|  lipid transfer protein precursor                      60.8    9e-09   
gb|AAY43800.1|  FSLTP2                                                60.8    9e-09   
gb|AEN70918.1|  lipid transfer protein                                60.8    9e-09   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           60.5    9e-09   
gb|ABA33853.1|  phospholipid transfer protein 1                       60.5    9e-09   
gb|ABA34089.1|  phospholipid transfer protein 2                       60.8    9e-09   
ref|XP_007134820.1|  hypothetical protein PHAVU_010G079000g           60.8    9e-09   
gb|ABA29446.1|  non-specific lipid transfer protein                   60.8    9e-09   
gb|ABX56711.1|  LTP isoallergen 1 precursor                           60.5    9e-09   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    9e-09   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   60.5    9e-09   
gb|ABA33849.1|  phospholipid transfer protein 1                       60.8    9e-09   
emb|CBW38501.1|  lipid transfer protein                               60.5    9e-09   
gb|ABA34083.1|  phospholipid transfer protein 2                       60.5    9e-09   
gb|ABA33850.1|  phospholipid transfer protein 1                       60.8    9e-09   
gb|AFK35133.1|  unknown                                               60.5    9e-09   
gb|EMT31305.1|  Non-specific lipid-transfer protein                   60.5    9e-09   
gb|AHB19225.1|  non specific lipid transfer protein 1C                60.5    9e-09   
gb|ABA33858.1|  phospholipid transfer protein 1                       60.5    1e-08   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  60.5    1e-08   
gb|EYU42352.1|  hypothetical protein MIMGU_mgv1a016589mg              60.5    1e-08   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               60.5    1e-08   
gb|ABA34092.1|  phospholipid transfer protein 2                       60.5    1e-08   
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    1e-08   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 60.5    1e-08   
gb|ABA33847.1|  phospholipid transfer protein 1                       60.5    1e-08   
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    60.5    1e-08   
gb|ABA33860.1|  phospholipid transfer protein 1                       60.5    1e-08   
gb|ABA33866.1|  phospholipid transfer protein 1                       60.5    1e-08   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
ref|XP_002269620.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
gb|ADE77948.1|  unknown                                               60.8    1e-08   
gb|AEN70915.1|  lipid transfer protein                                60.5    1e-08   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       60.5    1e-08   
ref|XP_009126702.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
gb|AFW86765.1|  non-specific lipid-transfer protein                   60.5    1e-08   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
gb|ACG25505.1|  nonspecific lipid-transfer protein 3 precursor        60.5    1e-08   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             60.5    1e-08   
ref|NP_001148872.1|  nonspecific lipid-transfer protein 3 precursor   60.8    1e-08   
sp|Q43304.1|NLTPD_BRAOT  RecName: Full=Non-specific lipid-transfe...  60.5    1e-08   
gb|ABF74563.1|  lipid transfer protein                                60.5    1e-08   
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        60.5    1e-08   
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    60.5    1e-08   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            60.5    1e-08   
gb|ADR66945.1|  non-specific lipid transfer protein                   60.5    1e-08   
ref|XP_004137680.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
gb|EPS73761.1|  non-specific lipid-transfer protein                   60.5    1e-08   
gb|ABA33857.1|  phospholipid transfer protein 1                       60.5    1e-08   
gb|EPS66894.1|  hypothetical protein M569_07878                       60.1    1e-08   
gb|AAA73947.1|  lipid transfer protein                                60.5    1e-08   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-08   
gb|ABA34080.1|  phospholipid transfer protein 2                       60.5    1e-08   
gb|AAB70541.1|  lipid transfer protein LPT IV                         60.1    1e-08   
ref|XP_004249706.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  60.1    1e-08   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
ref|XP_006400973.1|  hypothetical protein EUTSA_v10015064mg           60.1    1e-08   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  59.7    1e-08   
gb|AFR43294.1|  lipid transfer protein precursor                      60.1    1e-08   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           60.5    1e-08   



>ref|XP_002511594.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50263.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=113

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +2

Query  95   IFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTK  265
            I M  VLA ++    G+A+DC  V+ S+ASC+ +L GGVA P   CC   +NL    PT 
Sbjct  6    ISMLVVLAIVQFVMPGEAVDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTS  65

Query  266  QDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
             DR+ ACEC+K  AAR P IK D A  LP+ CG+  +  IS+  NCQ
Sbjct  66   ADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQ  112



>ref|XP_002511596.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50265.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=115

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLR  250
            M  A+ S + + A++  +  G+A+DC  V+ S+ASC+ +L GGVA P   CC   +NL  
Sbjct  1    MKGAVISMLVVLAIVQFVMPGEAVDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKT  60

Query  251  YTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              PT  DR+ AC+C+K  AAR P IK D A  LP+ CG+  +  IS+  NCQ +
Sbjct  61   LAPTTADRRAACDCIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAI  114



>ref|XP_004233683.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=112

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 73/113 (65%), Gaps = 5/113 (4%)
 Frame = +2

Query  77   RAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRY  253
            + +  ++FM  V+  ++LG++++C  V  ++A C+ YL QGG   P + CCD  + ++  
Sbjct  2    KGILVSLFMLLVVV-VQLGESINCGEVGGALAPCVPYLTQGG--DPSVSCCDGVKKVVET  58

Query  254  TPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            TPT+QDRQ ACEC+K  AAR P++K D A  LP  CGL +   IS  INC++V
Sbjct  59   TPTQQDRQVACECMKSAAARYPNVKPDAASNLPSRCGLTTPIPISPTINCKSV  111



>ref|XP_009785298.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=112

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTK  265
            + + +  VLA ++LG+A++C  VD ++  C+ YL QGG  +P   CCD  + L+  TPT+
Sbjct  5    AVVTLLMVLALVKLGEAINCGQVDATLVPCVPYLTQGG--NPTGPCCDGVKRLIAMTPTQ  62

Query  266  QDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            QDRQ ACEC+K  AAR  ++K D A  LP  CG+ ++  IS   NC+++
Sbjct  63   QDRQDACECMKTAAARYTNLKPDAATNLPSRCGVTTNIPISPTTNCKSI  111



>ref|XP_009623063.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=112

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +2

Query  86   ASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPT  262
            A+ + +  VLA ++LG+A++C  VD ++  C+ YL QGG   P   CCD  + ++  TPT
Sbjct  4    AAVVTLLMVLAVVKLGEAINCGQVDATLVPCVPYLTQGG--DPTGPCCDGVKRVIAMTPT  61

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +QDRQ ACEC+K  AAR  ++K D A  LP  CG+ ++  IS   NC+++
Sbjct  62   QQDRQDACECVKTAAARYTNLKPDAATNLPSRCGVTTNIPISATTNCKSI  111



>ref|XP_006338457.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Solanum 
tuberosum]
Length=111

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +2

Query  86   ASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPT  262
             +A+ ++  +  ++LG+A++C  V  ++A C+ YL QGG   P   CCD  + +++ TPT
Sbjct  3    GAAVLVSLFMLVVQLGEAINCGEVGGAVAPCVPYLTQGG--DPSGSCCDGVKKVVQLTPT  60

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +QDRQ ACEC+K  AAR  ++K D A  LP  CG+ ++  IS   NC++V
Sbjct  61   QQDRQDACECMKAAAARYSNLKPDAASNLPSRCGITTAIPISPTTNCKSV  110



>sp|P10973.1|NLTPA_RICCO RecName: Full=Non-specific lipid-transfer protein A; Short=NS-LTP 
A; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
 prf||1204170A protein,nonspecific lipid transfer
Length=92

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            +DC  V+ S+ASC+ +L GGVA P   CC   +NL    PT  DR+ ACEC+K  AAR P
Sbjct  1    VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFP  60

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             IK D A  LP+ CG+  +  IS+  NCQ +
Sbjct  61   TIKQDAASSLPKKCGVDINIPISKTTNCQAI  91



>ref|XP_006437592.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
 gb|ESR50832.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
Length=119

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = +2

Query  80   AMASAIFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYT  256
            +M   +F    L   + G+A + C  VD S+ASC+ YL GG  +P   CCD  +NL   T
Sbjct  9    SMLVVVFAMVQLLVAKPGEAAITCGQVDSSLASCIPYLMGGGNNPAAACCDGLKNLKAIT  68

Query  257  PTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            PT  DR+ AC+C+K  AAR P+IK D A  LP  CG+     IS+  NC
Sbjct  69   PTTADRRAACDCVKAAAARYPNIKEDAASSLPTKCGVQIGIPISKTTNC  117



>ref|XP_006451724.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|ESR64964.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|KDO48328.1| hypothetical protein CISIN_1g047252mg [Citrus sinensis]
Length=105

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            + +A V   ++ G+A+ C  VD S+ASC+SYL  G   P   CCD  +NL   TP   DR
Sbjct  2    LVVALVQIMVKPGEAVTCGQVDASLASCISYLTAG-GSPSAVCCDGLKNLKTITPPTADR  60

Query  275  QTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            + AC+C+K  AAR P+IK D A  LP  CG+  +  ISR  NC
Sbjct  61   RAACDCVKAAAARYPNIKEDAASSLPTKCGVQMNIPISRSTNC  103



>ref|XP_006484285.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=115

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 65/115 (57%), Gaps = 7/115 (6%)
 Frame = +2

Query  83   MASAIFMAAVLAAL-----RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            M +AI    VL AL       G+A+ C  VD S+ASC+ YL  G  +P   CCD  +NL 
Sbjct  1    MKAAIVSMLVLVALMQMIVTPGEAITCGQVDASLASCIPYLIAG-GNPDAACCDGVKNLK  59

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              TP   D + ACEC+K  AAR P+IK D A  LP+ CG+  +  IS+  NC N+
Sbjct  60   SITPATADGRAACECVKAAAARYPNIKEDAASSLPQKCGVQMNIPISKTTNCANI  114



>ref|XP_006437824.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
 gb|ESR51064.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
Length=113

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +2

Query  83   MASAIFMAAVLAAL-----RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            M +AI    VL AL       G+A+ C  VD S+ASC+ YL  G  +P   CCD  +NL 
Sbjct  1    MKAAIVSMLVLVALMQMIVTPGEAITCGQVDASLASCIPYLIAG-GNPDAACCDGVKNLK  59

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
              TP   DR+ ACEC+K  AAR P+IK D A  LP+ CG+  +  IS+  NC
Sbjct  60   SITPATADRRAACECVKAAAARYPNIKEDAASSLPQKCGVQMNIPISKTTNC  111



>ref|XP_006485829.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=113

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  83   MASAIFMAAVLAALRL-----GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            M S +    V+A  +      G+A+ C  VD S+ASC+SYL  G   P   CCD  +NL 
Sbjct  1    MKSVVIFVLVVAMFQFIMVKPGEAVTCGQVDASLASCISYLTAG-GSPSAVCCDGLKNLK  59

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
              TP   DR+ AC+C+K  AAR P+IK D A  LP  CG+  +  ISR  NC
Sbjct  60   TITPPTADRRAACDCVKAAAARYPNIKEDAASSLPTKCGVQMNIPISRSTNC  111



>ref|XP_006484581.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=119

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 3/107 (3%)
 Frame = +2

Query  95   IFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            +F    L A + G+A + C   D S+ASC+ YL GG  +P   CCD  +NL   TPT  D
Sbjct  13   VFAMVQLLAAKPGEAAITCGQEDSSLASCIPYLMGG-GNPAAACCDGLKNLKAITPTTAD  71

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            R+ AC+C+K  AAR P+IK + A  LP  CG+     IS+  NC N+
Sbjct  72   RRAACDCVKAAAARNPNIKENAASSLPSKCGVQIDIPISKTTNCANI  118



>gb|KDO70214.1| hypothetical protein CISIN_1g043414mg [Citrus sinensis]
Length=113

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = +2

Query  83   MASAIFMAAVLAAL-----RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            M +AI    VL AL       G+A+ C  VD S+ASC+ YL  G  +P   CCD  +NL 
Sbjct  1    MKAAIVSMLVLVALMQMIVTPGEAITCGQVDASLASCIPYLIAG-GNPDAACCDGVKNLK  59

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
              TP   D + ACEC+K  AAR P+IK D A  LP+ CG+  +  IS+  NC
Sbjct  60   SITPATADGRAACECVKAAAARYPNIKEDAASSLPQKCGVQMNIPISKTTNC  111



>ref|XP_006437630.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
 gb|ESR50870.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
Length=117

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (58%), Gaps = 3/104 (3%)
 Frame = +2

Query  95   IFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            +F    L A + G+A + C   D S+ASC+ YL GG  +P   CCD  +NL   TPT  D
Sbjct  13   VFAMVQLLAAKPGEAAITCGQEDSSLASCIPYLMGG-GNPAAACCDGLKNLKAITPTTAD  71

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            R+ AC+C+K  AAR P+IK + A  LP  CG+     IS+  NC
Sbjct  72   RRAACDCVKAAAARNPNIKENAASSLPSKCGVQIDIPISKTTNC  115



>gb|AAM00273.1|AF363506_1 lipid transfer protein 2 [Euphorbia lagascae]
Length=116

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+DC  V+ ++A+C+ YL G    PP  CCD  +NL +   T  DR+ ACEC+K  A+
Sbjct  23   GEAVDCKDVNSNLATCIPYLTGKDTAPPTTCCDGVKNLPKIAQTTADRRAACECVKAAAS  82

Query  311  RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               I    A  LP+ CG + +  IS+  NCQ +
Sbjct  83   HYTINEKAASSLPKDCGAVINIPISKTTNCQQI  115



>gb|KDP34869.1| hypothetical protein JCGZ_09157 [Jatropha curcas]
Length=114

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+DC  V+ S+A C+ +L GG   P   CC   +NL    PT  DR+ AC+C+K  A+
Sbjct  22   GEAVDCGQVNSSLAPCIPFLTGGDTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAAS  81

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P+I  D A  LP+ CG+  +  IS++ NCQ
Sbjct  82   HYPNINEDSASSLPKKCGVEVTIPISKNTNCQ  113



>ref|XP_002283359.2| PREDICTED: non-specific lipid-transfer protein 1-like [Vitis 
vinifera]
Length=115

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            +A+ C  V+ ++A C+SYL GG A P   CCD  R L   +PT  DRQTAC+C K  A+R
Sbjct  23   RAITCSDVNKALAPCVSYLTGGGA-PTSACCDGVRTLKSLSPTTSDRQTACQCAKDAASR  81

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             P+I+ D A  LP  CG+ +   ISR  +C  V
Sbjct  82   NPNIREDAAAALPNKCGVQTDIPISRSTDCSTV  114



>ref|XP_002527124.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35287.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 2/114 (2%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL-GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            M  A+ S +  A +L A+ + G+A++C  V+ +++SC+ +L G    P + CC     L 
Sbjct  2    MKGAVISVLAAAIILQAMAMQGEAVNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELK  61

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQN  406
            R  PT +D++ ACEC+K  AAR P+I+ D A  LP  CG++ +  IS+  NC  
Sbjct  62   RLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCHE  115



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-  307
            GQA+ C  VDI++  CL YL+G    PP+ECC+   ++ + TPTK DRQ AC+C+K  A 
Sbjct  25   GQAITCAQVDIALRPCLDYLKGTTGQPPVECCNGVASIKQNTPTKADRQAACQCVKRAAE  84

Query  308  ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +   +  D A  LP  C +  S  ISR++NC  +
Sbjct  85   SLAGLSDDAAKNLPVRCNVQISVPISRNVNCNKM  118



>ref|XP_006359128.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 7/120 (6%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL-------GQAMDCHTVDISIASCLSYLQGGVAHPPMECCD  229
            MN ++ + + +   + AL L         A+ C TV  SI  CLSYLQG    PP  CCD
Sbjct  1    MNSSIQAKLVLVPFMMALILLLIAPSSEGAITCGTVISSIKPCLSYLQGSGGKPPQPCCD  60

Query  230  SFRNLLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              ++L+    T  D+Q AC CLK  + + +I + +A  LP+SCG+  SF IS  ++C  +
Sbjct  61   GCQSLVSAATTVPDKQAACTCLKNASQKININSQLAGSLPKSCGISLSFPISSTVDCTKI  120



>emb|CAN72931.1| hypothetical protein VITISV_020613 [Vitis vinifera]
Length=113

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            +A+ C  V+ ++A C+SYL GG A P   CCD  R L   +PT  DRQTAC+C K  A+R
Sbjct  23   RAITCSDVNKALAPCVSYLTGGGA-PTSACCDGVRTLKSLSPTTSDRQTACQCAKDAASR  81

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINC  400
             P+I+ D A  LP  CG+ +   ISR  +C
Sbjct  82   NPNIREDAAAALPNKCGVQTDIPISRSTDC  111



>gb|EYU34080.1| hypothetical protein MIMGU_mgv1a026469mg, partial [Erythranthe 
guttata]
Length=112

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  +  S++ CLSYLQ G   P   CC   R++     + QDRQTAC CLK  A+
Sbjct  22   GEAVSCGELQSSLSPCLSYLQAGGGEPSESCCGGVRSVTGSIQSTQDRQTACNCLKSAAS  81

Query  311  RPDIKADVAVYLPRSCGLISSFTISRDINC  400
              +++ DVA  LP  CG     TIS +++C
Sbjct  82   SYNVRTDVAANLPGKCGASIGMTISPNVDC  111



>ref|XP_009613304.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
tomentosiformis]
Length=111

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A+ C TV  +I  CLSYLQG    PP  CC + ++L   T T  DRQ AC CLK  A + 
Sbjct  20   AITCGTVISTIRPCLSYLQGTGGKPPQPCCTACQSLASATSTTPDRQAACTCLKNAAQKI  79

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +I A +A  LP+SCG+  SF IS  ++C  +
Sbjct  80   NINAQLAQGLPQSCGISLSFPISTSVDCTKI  110



>gb|KDP28851.1| hypothetical protein JCGZ_14622 [Jatropha curcas]
Length=114

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+DC  V+ ++A C+ +L G    P   CC   +NL    PT  DR+ AC+C+K  ++
Sbjct  22   GEAVDCGQVNAALAPCIPFLTGADTAPSAACCGGVKNLKVLAPTTADRRAACDCVKAASS  81

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P+I  D A  LP+ CG+  +  IS++INCQ
Sbjct  82   HYPNINEDSASSLPKKCGVEVNIPISKNINCQ  113



>ref|XP_009773021.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
sylvestris]
Length=111

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A+ C TV  +I  C SYLQG    PP  CC + ++L   T T  DRQ AC CLK  A + 
Sbjct  20   AISCGTVISTIKPCFSYLQGTGGKPPQPCCTACQSLQSATSTTPDRQAACTCLKNAAQKV  79

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +I A +A  LP+SCG+  SF IS  ++C  +
Sbjct  80   NINAQLAKGLPQSCGISLSFPISTSVDCTKI  110



>ref|XP_002527125.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35288.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G A+DC  V++ + +C+ YL G  + P + CC   RNL R  PT  DR+ AC+C+K  AA
Sbjct  23   GVAIDCAQVNLLLGTCMPYLIGFDSSPSLACCAGVRNLKRLAPTTADRRVACDCVKAAAA  82

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
            R P+I+ D A  LP  CG+  +  +S    CQ
Sbjct  83   RHPNIRDDAASTLPNKCGVDFNIPVSNTTKCQ  114



>ref|XP_004229551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=121

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A+ C TV  SI  CLSYLQG    PP  CCD  ++L     T  DRQ AC CLK  + + 
Sbjct  30   AITCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLASAATTVPDRQAACTCLKNASQKI  89

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             I + +A  LP+SCG+  SF IS  ++C  +
Sbjct  90   KINSQLAGSLPKSCGISLSFPISPTVDCTKI  120



>ref|XP_011098616.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Sesamum 
indicum]
Length=114

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V  S+A CL+YL GG   P   CC   R+L     ++QDRQTAC C+K  A+
Sbjct  22   GEAISCGDVQGSLAPCLAYLTGG-GEPSSSCCGGVRSLAGSLQSQQDRQTACYCMKSAAS  80

Query  311  RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              ++++D A  LP  CG+    T++ DI+C  V
Sbjct  81   SFNVRSDAASNLPGKCGVSIGMTVTPDIDCSKV  113



>gb|KDP28819.1| hypothetical protein JCGZ_14590 [Jatropha curcas]
Length=114

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+DC  V+ ++ASC+ +L G    P   CC   +NL    PT  DR+ AC+C+K  A+
Sbjct  22   GEAVDCGQVNSALASCIPFLTGADTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAAS  81

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P+I  D A  LP+ C +  +  IS++ NCQ
Sbjct  82   HYPNINEDSASSLPKKCAVEVNIPISKNTNCQ  113



>ref|XP_011031945.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=118

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQG-GVAHPPMECCDSFRNLLRYTPTKQD  271
            + +A V  +++ G+A+ C  V+  +A+C+SYL G G   PP +CC     L     +  D
Sbjct  11   VVVAMVQFSVKPGEAITCGEVNSDLAACVSYLTGKGGDFPPPQCCAGVIKLKESAVSIAD  70

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +Q ACEC+K  AAR PDIK + A  LP  C + + F IS++ NC ++
Sbjct  71   KQAACECVKAAAARIPDIKDEAASSLPAKCKVQADFPISKNFNCADI  117



>gb|KEH22495.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=99

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 1/95 (1%)
 Frame = +2

Query  128  LGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA  307
            +G A DC     SI  C+ YL G   HP + CC+  ++L    PTK DR  ACECLK  +
Sbjct  4    VGYAFDCEEAKTSILPCIGYLIGEDDHPSIACCNGVKDLKSSVPTKGDRHKACECLKKTS  63

Query  308  AR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +   +I+ D+   LP+ CG+  +FTI++ I C  +
Sbjct  64   SHFHNIRDDLNALLPKRCGVDLNFTINKSIKCDQI  98



>ref|XP_010540223.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=119

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  VD S+  C+ YLQ G   P   CC   RN+   TPT  DRQ ACECLK+ A   
Sbjct  28   AITCGEVDRSLVPCIVYLQNG-GSPSAACCAGVRNIEAITPTTTDRQVACECLKLAAQNY  86

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            P+ K D A  LP  CG+  +  IS+  NC+++
Sbjct  87   PNFKEDAASTLPAKCGVTFNIPISKATNCKSI  118



>ref|XP_010527034.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
 ref|XP_010527036.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
Length=115

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C   ++S+A CLSYL  G  +P   CC   +NL + TP K DRQT C CLK  A 
Sbjct  22   GKAITCSQANLSMAPCLSYLMNG-GNPSALCCKGMKNLKKATPEKDDRQTVCRCLKDTAT  80

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            + P IK D A  LP  CG+      S   NC +V
Sbjct  81   KNPKIKDDNASQLPGKCGVDFGVPFSTGTNCDSV  114



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C++Y++GG A PP  CC+  RN+     T  DRQTAC 
Sbjct  17   MVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P + A+ A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C++Y++GG A PP  CC+  RN+     T  DRQTAC 
Sbjct  17   MVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P + A+ A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|NP_001241103.1| uncharacterized protein LOC100798112 precursor [Glycine max]
 gb|ACU13757.1| unknown [Glycine max]
 gb|KHN40656.1| Non-specific lipid-transfer protein [Glycine soja]
Length=117

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 61/116 (53%), Gaps = 3/116 (3%)
 Frame = +2

Query  65   ATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRN  241
            A+M       I   AV+ A  + QAM C+ V +++A CLSYL QGG   P   CC   +N
Sbjct  2    ASMKVTWVVVIMCMAVVGAPMMAQAMTCNDVTVNMAQCLSYLMQGGT--PSTLCCSGVKN  59

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +L    T  D+QT C CLK  AAR +I    A  LP  C +   + ISR  NC ++
Sbjct  60   ILGSAVTTVDKQTVCNCLKADAARYNINDQYAQALPGFCKVNVPYKISRSTNCASI  115



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C+ Y++GG A PP  CC+  RN+     T  DRQTAC 
Sbjct  17   MVVSVPIAQALTCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P + A+ A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_010547844.1| PREDICTED: non-specific lipid-transfer protein 1 [Tarenaya hassleriana]
Length=115

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 60/103 (58%), Gaps = 4/103 (4%)
 Frame = +2

Query  110  VLAALRLGQ--AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTA  283
            VL+ L + Q  A+ C  VD S+  CL YL  G A P  +CCD  R+L   TPT  DRQTA
Sbjct  13   VLSTLLVDQSHAITCGEVDSSLRPCLPYLMAGGA-PTSKCCDGVRDLKMMTPTTADRQTA  71

Query  284  CECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            C C+K  A+R  +IKA+ A  LP  C +     ISR+++C  +
Sbjct  72   CRCMKDDASRFREIKAEAAAQLPSKCSVEFGVPISREVDCDRI  114



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 64/118 (54%), Gaps = 3/118 (3%)
 Frame = +2

Query  62   KATMNRAMASAIFMAAVLA-ALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            K  M + +   + +  +LA   R  +A+ C  V+ ++ SCLSY+ GG    P  CC   +
Sbjct  5    KLFMQKQLLGLVILIWMLAYNPRPSEALTCDDVNNNLISCLSYVAGG-GKVPTSCCSGVK  63

Query  239  NLLRYTPTKQDRQTACECLKVIAARPDI-KADVAVYLPRSCGLISSFTISRDINCQNV  409
            NLL    T+ DRQTAC CLK +A   +  +   A  +P+SC L   F ISRD++C  V
Sbjct  64   NLLSLAKTRNDRQTACSCLKSLAVEANNDQLKRAQTVPKSCSLTIPFPISRDVDCSKV  121



>ref|XP_011031956.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=117

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQG-GVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA  307
            G+A+ C  V+  +A+C+SYL G G   PP ECC     L     +  D+Q ACEC+K  A
Sbjct  22   GEAITCGDVNSDLAACVSYLTGKGGDFPPPECCAGGIKLKESAVSIADKQAACECVKAAA  81

Query  308  AR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            AR PDIK + A  LP  C + + F IS++ NC ++
Sbjct  82   ARIPDIKDEAASSLPAKCKVQADFPISKNFNCADI  116



>emb|CDY68862.1| BnaCnng60800D [Brassica napus]
Length=162

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +2

Query  68   TMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            T N+ M   +F   ++ A   G+A+ C  + + +A CLSY++GG  +PP  CC    NL 
Sbjct  5    TKNQTMLLLVFTLLMVIAYHEGEAIQCSQITMYLAPCLSYVKGG-GNPPPPCCAGLNNLK  63

Query  248  RYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQ  403
               P K D+Q AC+CLK +A A      D A  LP  CG+      S+ ++C 
Sbjct  64   ASAPGKPDKQAACQCLKNVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDCN  116



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC NV
Sbjct  76   CLKQLSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC NV
Sbjct  76   CLKQLSASVPGVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>sp|P24296.2|NLTP1_WHEAT RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Full=ns-LTP1; Flags: Precursor, partial [Triticum aestivum]
 pir||S22528 lipid transfer protein precursor - durum wheat (fragment)
 emb|CAA45210.1| lipid transfer protein [Triticum turgidum subsp. durum]
Length=113

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +2

Query  77   RAMASAIFMAAVLAAL-RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRY  253
            + M  A+ +  +LAA+ R   A+DC  VD  +  CLSY+QGG   P  +CCD  +NL   
Sbjct  2    QVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQ  60

Query  254  TPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              ++ DRQ+AC CLK IA    ++  D A  +P  CG+   +TIS +I+C  V
Sbjct  61   ARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  113



>ref|XP_010683514.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 55/107 (51%), Gaps = 1/107 (1%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            AIF+  V+AA     AM+C  V  ++A CLSYL G    PP  CC   + L     T  D
Sbjct  12   AIFLCMVVAAPHAEAAMNCGMVASNVAPCLSYLMGSAKQPPSGCCAGIKKLKNMASTPMD  71

Query  272  RQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            R+TAC CLK  A A  ++    A  LP+ CG+   + IS   +C  V
Sbjct  72   RRTACGCLKSAATAMKNMNYGKAAGLPKQCGVSIPYAISPKTDCSRV  118



>gb|AAN75627.1| lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CAH69187.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 3/113 (3%)
 Frame = +2

Query  77   RAMASAIFMAAVLAAL-RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRY  253
            + M  A+ +  +LAA+ R   A+DC  VD  +  CLSY+QGG   P  +CCD  +NL   
Sbjct  5    QVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQ  63

Query  254  TPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              ++ DRQ+AC CLK IA    ++  D A  +P  CG+   +TIS +I+C  V
Sbjct  64   ARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  116



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVKGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC NV
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            +A+ C  V  ++A C++Y++ G   PP  CC   R L+    T  DR+TAC CLK  A R
Sbjct  26   EAITCGQVSGAVAPCINYVRSGGVVPP-SCCGGIRGLVGAAKTTADRRTACNCLKSAAGR  84

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             P +K  +A  LP  CG+   F IS  +NC  V
Sbjct  85   IPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>ref|XP_008229617.1| PREDICTED: non-specific lipid-transfer protein A-like [Prunus 
mume]
Length=117

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +2

Query  125  RLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKV  301
            +LGQA + C  V  S+A C+ YL  G   PP  CC+    L +   T +DR+ AC+CLK 
Sbjct  20   KLGQATVTCQQVASSVAPCVPYLTSGTGSPPTACCNGVSGLKQLASTTKDRRAACQCLKD  79

Query  302  IAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             A    +IK DVA  LP +C +  +  ISR +NC +V
Sbjct  80   AADHYQNIKEDVAAGLPTACKVQINVPISRSVNCNDV  116



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC NV
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANV  116



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C++Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIAYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>gb|KHG04165.1| Non-specific lipid-transfer A [Gossypium arboreum]
Length=117

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLA-ALRLGQA-MDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRN  241
            M RA+ S   M A+    ++ GQA + C  VD ++A+C+ YL  GGV  P   CC+    
Sbjct  2    MKRAVISVFVMLAMFQFVVKQGQAAVTCKQVDDALAACVPYLTNGGV--PSTPCCNGVGE  59

Query  242  LLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     T  DRQ AC C+K  AAR P IK D A  LP  C +   F IS++ NC+++
Sbjct  60   LRNSAETTADRQAACNCVKQAAARIPTIKEDDAATLPAKCHVQVDFPISKNTNCEDI  116



>ref|XP_003533715.1| PREDICTED: non-specific lipid-transfer protein A-like [Glycine 
max]
Length=120

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 1/106 (1%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            + +  ++AA   G+  DC     S+ SC+ YL G V  P   CC+  + L    PTK ++
Sbjct  14   VLVLTIMAADPAGKGYDCEKAKRSLKSCMEYLTGNVDSPSAACCNGVKELKASAPTKDEK  73

Query  275  QTACECL-KVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               C+C+ + +   P+ K D A+ LP+ CG+ + F I ++  C ++
Sbjct  74   IAECQCIEEALTPIPNFKQDRAIALPKECGVDAGFPIPKNFTCSSI  119



>emb|CDX72398.1| BnaC07g44200D [Brassica napus]
Length=118

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            V+ A   G+A+ C  V++ +A CLSYL+GG  +P   CC    +L    P K +RQTAC+
Sbjct  18   VVIAYHEGEAISCSQVNMFLAPCLSYLRGG-GNPSQPCCAGLNSLKAAAPGKAERQTACQ  76

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++   P I  D A  LP  CG+      S+ ++C ++
Sbjct  77   CLKSVSNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  117



>gb|AGW21344.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAVLPGKCGVSIPYKISASTNCATV  116



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_004229753.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=115

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 61/114 (54%), Gaps = 8/114 (7%)
 Frame = +2

Query  86   ASAIFMAAVLAALRLGQ----AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLR  250
            A AI +  VLA  +L      A+ C  VD ++A C+ +L QGG   P   CC   R L  
Sbjct  3    AIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGG--EPGAACCSGVRTLNG  60

Query  251  YTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             T +  DR+TAC C+K  A R P++K D A  LP  CG+  +  ISR +NC  +
Sbjct  61   NTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI  114



>ref|XP_006468966.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
Length=115

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            + I MAA++   R   A+ C  VD  +A CL+YL G  A P   CC     L   TPT  
Sbjct  8    AVILMAAIVMVERGQAAITCGQVDSFLAPCLAYLTGE-AKPSRACCTGVEYLKDNTPTTA  66

Query  269  DRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            DRQ AC+C+K  A R   IK D A  LP+ CG+     I+ DI+C  +
Sbjct  67   DRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>sp|P10974.1|NLTPB_RICCO RecName: Full=Non-specific lipid-transfer protein B; Short=NS-LTP 
B; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
Length=92

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            ++C  V+ +++SC+ +L G    P + CC     L R  PT +D++ ACEC+K  AAR P
Sbjct  1    VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYP  60

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +I+ D A  LP  CG++ +  IS+  NC  +
Sbjct  61   NIREDAASSLPYKCGVVINVPISKTTNCHEI  91



>gb|EYU34081.1| hypothetical protein MIMGU_mgv1a024111mg, partial [Erythranthe 
guttata]
Length=109

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 1/90 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  +  S+A CLSYL GG   P   CC   R+      + QDRQTAC C+K  A+
Sbjct  20   GEAVSCGELQSSLAPCLSYLTGG-GEPSESCCGGLRSASGSIQSTQDRQTACYCMKSAAS  78

Query  311  RPDIKADVAVYLPRSCGLISSFTISRDINC  400
              ++  D A  LP  CG+    T+S +++C
Sbjct  79   TYNVPTDAAASLPGKCGVSVGMTVSPNVDC  108



>emb|CDY46122.1| BnaA03g52460D [Brassica napus]
Length=120

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V++ +A CLSYL+GG  +P   CC    +L    P K +RQTAC+CLK ++ 
Sbjct  27   GEAISCSQVNMFLAPCLSYLRGG-GNPSQPCCAGLNSLKAAAPGKAERQTACQCLKSVSN  85

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P I  D A  LP  CG+      S+ ++C ++
Sbjct  86   TIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>ref|NP_001236359.1| uncharacterized protein LOC100306531 precursor [Glycine max]
 gb|ACU14742.1| unknown [Glycine max]
Length=120

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 1/106 (1%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            + +  ++AA   G+  DC     S+ SC+ YL G V  P   CC+  + L    PTK ++
Sbjct  14   VLVLTIMAADPAGKGYDCEKAKRSLKSCMEYLTGNVDSPSAACCNGVKELKASAPTKDEK  73

Query  275  QTACECL-KVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               C+C+ + +   P+ K D A+ LP+ CG+   F I ++  C ++
Sbjct  74   IAECQCIEEALTPIPNFKQDRAIALPKECGVDVGFPIPKNFTCSSI  119



>sp|P07597.1|NLTP1_HORVU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Probable amylase/protease inhibitor; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA41946.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 emb|CAA28805.1| unnamed protein product [Hordeum vulgare]
 gb|AAA32970.1| amylase/protease inhibitor [Hordeum vulgare]
 emb|CAP16136.1| non-specific lipid transport protein 1 precursor [Hordeum vulgare]
Length=117

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 61/116 (53%), Gaps = 7/116 (6%)
 Frame = +2

Query  80   AMASAIFMAAVL-----AALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNL  244
            A A  + MAA L     AA R   A++C  VD  +  CL+Y+QGG   P  ECC+  R+L
Sbjct  2    ARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDL  60

Query  245  LRYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                 +  DRQT C CLK IA    ++  + A  +P  C +   +TIS DI+C  +
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>emb|CAH04989.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 64/113 (57%), Gaps = 3/113 (3%)
 Frame = +2

Query  77   RAMASAIFMAAVLAAL-RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRY  253
            + M  A+ +  +LAA+ R   A+DC  VD  +  CLSY+QGG   P  +CCD  +NL   
Sbjct  5    QVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQ  63

Query  254  TPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              ++ DRQ+AC CL+ IA    ++  D A   P  CG+   +TIS +I+C  V
Sbjct  64   ARSQSDRQSACNCLRGIARGIHNLNEDNARGTPLKCGVNLPYTISLNIDCSRV  116



>dbj|BAK05317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 61/116 (53%), Gaps = 7/116 (6%)
 Frame = +2

Query  80   AMASAIFMAAVL-----AALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNL  244
            A A  + MAA L     AA R   A++C  VD  +  CL+Y+QGG   P  ECC+  R+L
Sbjct  2    ARAQVLLMAAALVLMLMAAPRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDL  60

Query  245  LRYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                 +  DRQT C CLK IA    ++  + A  +P  C +   +TIS DI+C  +
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>ref|XP_007206674.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
 gb|EMJ07873.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
Length=118

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 5/116 (4%)
 Frame = +2

Query  65   ATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNL  244
            A M  A+  A+ M   + ++ + QA+ C  +  ++A C+ Y++GG A PP  CC+  RN+
Sbjct  6    APMKLALVVALCM---VVSVPIAQAITCGQLFSNLAPCIPYVRGGGAVPP-ACCNGIRNV  61

Query  245  LRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                 T  DRQ AC CLK ++A  P +  + A  LP  CG+   + IS   NC+ V
Sbjct  62   NNLAKTTPDRQAACNCLKQLSASIPGVNPNNAAALPGKCGVSIPYKISASTNCKTV  117



>ref|XP_009138182.1| PREDICTED: non-specific lipid-transfer protein 11 [Brassica rapa]
Length=120

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  +++ +A CLSYL+GG  +P   CC    +L    P K +RQTAC+CLK ++ 
Sbjct  27   GEAISCSQINMFLAPCLSYLRGG-GNPSQPCCAGLNSLKAAAPGKAERQTACQCLKSVSN  85

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P I  D A  LP  CG+      S+ ++C ++
Sbjct  86   TIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>ref|XP_002282792.1| PREDICTED: non-specific lipid-transfer protein A-like [Vitis 
vinifera]
Length=116

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G A+ C  V+ S+A C+ YL GG  +P   CC+  +NL   TPT  DR+ AC C+K  A+
Sbjct  23   GYAVTCGQVETSLAPCMPYLTGG-GNPAAPCCNGVQNLKLLTPTTTDRRDACRCVKAAAS  81

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +  +IK D A  LP  CG+     IS   NC  +
Sbjct  82   KFQNIKEDAASALPTKCGVQIGIPISMTTNCDQI  115



>gb|KFK36745.1| hypothetical protein AALP_AA4G164400 [Arabis alpina]
Length=118

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSY-LQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA-  310
            A+ C  V+ ++A C+ Y LQGG   P   CC+  R L     T  DR+ AC+CLK  AA 
Sbjct  26   ALGCGQVNSAVAPCIGYILQGGAVTP--GCCNGIRRLNGAARTTPDRKAACQCLKNAAAA  83

Query  311  -RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P + A  A  LPR+CG+   F IS   NC NV
Sbjct  84   LGPGLNAGRAAGLPRACGVSVPFPISTSTNCNNV  117



>gb|AGH27863.1| lipid transfer protein precursor [Prunus mira]
 gb|AGW21339.1| lipid transfer protein [Prunus mira]
Length=117

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-TCCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>gb|KDO63444.1| hypothetical protein CISIN_1g044686mg, partial [Citrus sinensis]
Length=130

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 56/105 (53%), Gaps = 2/105 (2%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            + I MAA++   R   A+ C  VD  +A CL+YL G  A P   CC     L   TPT  
Sbjct  25   AVILMAAIVMVERGQAAITCGQVDSFLAPCLAYLTG-EAKPSRACCTGVEYLKDNTPTTA  83

Query  269  DRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            DRQ AC+C+K  A R   IK D A  LP+ CG+     I+ DI+C
Sbjct  84   DRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDC  128



>emb|CAA42832.1| LTP 1 [Hordeum vulgare]
Length=134

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = +2

Query  80   AMASAIFMAAVL-----AALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNL  244
            A A  + MAA L     AA R   A++C  VD  +  CL+Y+QGG   P  ECC+  R+L
Sbjct  2    ARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDL  60

Query  245  LRYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINC  400
                 +  DRQT C CLK IA    ++  + A  +P  C +   +TIS DI+C
Sbjct  61   HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDC  113



>ref|XP_010523199.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=111

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A++C  VD S+  C+ YLQ G   P   CC   +++   TPT  DRQ ACECLK  A   
Sbjct  22   AVNCGEVDRSLVPCIIYLQNG-GSPSASCCGGVKHIEAITPTTTDRQDACECLKQAAQNY  80

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
            P++K + A  LP  CG+  +  IS+  NC+
Sbjct  81   PNLKEEAASTLPAKCGVSFNIPISKATNCK  110



>gb|AAV40850.1| lipid transfer protein 1 precursor [Prunus persica]
Length=117

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C     S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQASSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            +A+ C+TV   + +CL YLQ G A P   CC   R+L     T  DR+TAC CLK +A R
Sbjct  26   EAITCNTVAGDLGACLGYLQKGGAVPA-GCCTGIRSLNSQAKTTVDRRTACSCLKSLAGR  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              +   +A  LP  CG+   + IS   NC +V
Sbjct  85   VRVNQGLAAGLPGKCGVNVGYPISTSTNCNSV  116



>ref|XP_010437771.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V++ +A CL YL+ G   PP  CC+   +L    P K DRQ AC CLK +A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAG-GTPPAMCCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P I  D A  LP  CG+      S+ ++C ++
Sbjct  85   TIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>gb|KHN44022.1| Non-specific lipid-transfer protein A [Glycine soja]
Length=99

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = +2

Query  113  LAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACEC  292
            +AA   G+  DC     S+ SC+ YL G V  P   CC+  + L    PTK ++   C+C
Sbjct  1    MAADPAGKGYDCEKAKRSLKSCMEYLTGNVDSPSAACCNGVKELKASAPTKDEKIAECQC  60

Query  293  L-KVIAARPDIKADVAVYLPRSCGLISSFTISRDINC  400
            + + +   P+ K D A+ LP+ CG+ + F I ++  C
Sbjct  61   IEEALTPIPNFKQDRAIALPKECGVDAGFPIPKNFTC  97



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = +2

Query  68   TMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            +M   +A  + M  V+ A     A+ C  V  S+++C+ YL+ GVA PP  CC   R+L 
Sbjct  4    SMATKLACVLVMCMVVGAPLAEAAITCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLN  63

Query  248  RYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQN  406
                T  DRQ AC+CLK  + + P I  ++A  LP  CG+   + IS  ++C  
Sbjct  64   AAAKTTADRQQACKCLKSASNSIPGIDLNLAAGLPGKCGVSIPYKISPSVDCSK  117



>ref|XP_003560704.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Brachypodium 
distachyon]
Length=123

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARPD  319
            M C  V    + CL +LQG   +P  +CC+   +L+    T  DRQ ACECLK  A    
Sbjct  33   MSCSDVVSGASPCLGFLQGEEDYPSSDCCEGVSSLVAAAATTADRQQACECLKSAAGDGS  92

Query  320  IKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +A  A  LP  CGL   FTIS D++C  +
Sbjct  93   AEASAARDLPADCGLSLPFTISPDVDCSQI  122



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y+ GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSNSVAPCIPYVIGGGAVPP-ACCNGIRNVENLAKTTADRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++   P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISISTNCAAV  116



>ref|XP_007141467.1| hypothetical protein PHAVU_008G198300g [Phaseolus vulgaris]
 gb|ESW13461.1| hypothetical protein PHAVU_008G198300g [Phaseolus vulgaris]
Length=121

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  MAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQT  280
            +   +AA    +A+ C      +  CL +L      PP  CC+    L+  TPTK+++  
Sbjct  15   LVLTVAATEPPKALTCEETKSLVTPCLDFLTDKTNTPPTPCCEGLNKLIVSTPTKEEKLA  74

Query  281  ACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
            AC+CLK  A+  P+        LP+ C +  +F+IS+D +C+N++
Sbjct  75   ACKCLKEAASHIPNFDVGRVNNLPKVCNINVNFSISKDFDCENII  119



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQA---MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTP  259
            S +F+AA++ A+    A   + C TV   ++ CL Y++ G A P M CC+  RNL     
Sbjct  8    SVMFIAAMVIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTM-CCNGIRNLFSAAS  66

Query  260  TKQDRQTACECLKVIAAR--PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            T QDRQT C C+K  AAR    +  ++A  LP  CG+I  + IS  I+C  V
Sbjct  67   TTQDRQTVCNCMKS-AARVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKV  117



>gb|KHG13955.1| Non-specific lipid-transfer 1 [Gossypium arboreum]
Length=114

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A+ C  V   +A CLSYLQ G  + P  CCD  R+L     T  DRQT C CL+  A   
Sbjct  24   AITCGDVTSKVAGCLSYLQNG-GNVPKACCDGIRSLNNMARTTPDRQTVCGCLQAAAKAV  82

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             IK ++A  LP  C +   + IS   NC+NV
Sbjct  83   KIKGNLAETLPAKCSVNIPYKISTSTNCKNV  113



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 63/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            + ++M+  +A A+ +A V++A     A+ C  V  S+A C++YLQ G A P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             L     T  DRQ  C CLK +A +   I   VA  LP  CG+  S+ IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>ref|XP_009607862.1| PREDICTED: non-specific lipid-transfer protein A-like, partial 
[Nicotiana tomentosiformis]
Length=155

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = +2

Query  83   MASAIFMAAVLAALRL----GQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLL  247
            M   I   AVLA ++L    GQA+ C  VD S+A C+ YL QGG   P   CC   ++L 
Sbjct  1    MKGIIIAIAVLAMIQLMFEPGQALTCGQVDASLAPCIPYLTQGG--DPSSACCSGVKSLK  58

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDIN  397
                T  D++TAC C+K  A R  ++K D A  LP  CG+     +SR +N
Sbjct  59   ELAQTTADKRTACNCVKAAANRYANLKDDAAQALPTKCGVTMDTPVSRTVN  109



>gb|KHG09865.1| Non-specific lipid-transfer P3 [Gossypium arboreum]
Length=116

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 50/93 (54%), Gaps = 4/93 (4%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V     SC+ YLQ G  +PP  CC+  RNL R   T +DRQTAC CL+  AAR 
Sbjct  25   ALTCGQVASQTGSCIRYLQRG-GNPPAACCNGVRNLNRQARTTRDRQTACRCLQT-AART  82

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               I A +A  LP  CG+   + IS   NC  V
Sbjct  83   ISGINAKLAAGLPAKCGVKIPYKISPSTNCNRV  115



>ref|XP_009108805.1| PREDICTED: non-specific lipid-transfer protein 11-like [Brassica 
rapa]
Length=119

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 2/115 (2%)
 Frame = +2

Query  68   TMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            T N+ M   +    ++ A   G+A+ C  + + +A CLSY++GG  +PP  CC    NL 
Sbjct  5    TKNQTMLLLVVTLLMVIAYHEGEAIQCSQITMYLAPCLSYVKGG-GNPPPPCCAGLNNLK  63

Query  248  RYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               P + D+Q AC+CLK +A A      D A  LP  CG+      S+ ++C ++
Sbjct  64   SSAPGRPDKQAACQCLKNVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDCNSI  118



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = +2

Query  41   LKLYTKIKATMNRAMASAIFMAA-VLAALRLGQA-MDCHTVDISIASCLSYLQGGVAHPP  214
            +   T  KA+  + +   +F++  +++  R GQA + C TV   ++ C+ ++  G   PP
Sbjct  1    MAFTTMAKASSLKPLVFVLFVSMLIMSFFRSGQAQISCDTVKNDLSPCIGFIMNGGKVPP  60

Query  215  MECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRD  391
              CC     LL    T+ DRQ+AC CLK +A +  D +   A  +P SCG+   F ISRD
Sbjct  61   -ACCSGLNTLLSLAKTRTDRQSACSCLKSVAESATDDQLKNAAQIPHSCGVNLPFKISRD  119

Query  392  INC  400
            ++C
Sbjct  120  VDC  122



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-AR  313
            A+ C  V  SIA CL+YLQ G A PP  CC   ++L     T  DRQTAC CLK  A + 
Sbjct  28   AITCGQVVSSIAPCLNYLQKGGAVPP-ACCSGVKSLNSAAKTTPDRQTACNCLKSAAVSN  86

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            P I+A +A  LP  CG+   + IS   +C  V
Sbjct  87   PSIQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>ref|XP_006375125.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
 gb|ERP52922.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
Length=115

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQG-GVAHPPMECCDSFRNLLRYTPTKQD  271
            + +A V   ++ G+A+ C  V+  +++C+SYL G G   PP +CC     L     +  D
Sbjct  10   VAVAMVQFMVKPGEAITCGDVNSDLSACVSYLTGKGGDFPPPQCCAGVNKLKESAVSIAD  69

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            +Q ACEC+K  AAR PD+K + A  LP  C +     IS++ NC
Sbjct  70   KQAACECVKAAAARIPDMKDEAASSLPAKCKVQVDVPISKNFNC  113



>gb|ACE07188.1| Art v 3.0301 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKV-IAA  310
             A+ C  V   I+ CLSYL+ G    P +CC   + L   T T  DRQTAC CLK    +
Sbjct  25   SALTCSDVSTKISPCLSYLKKG-GEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKS  83

Query  311  RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              D+K+D AV LP  CGL   + +S + +C  V
Sbjct  84   NKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116



>ref|XP_009607859.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=113

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA  307
            GQA+ C  VD S+A C+ YL QGG   P   CC+  ++L     +  DR+TAC C+K  A
Sbjct  22   GQALTCGQVDASLAPCVPYLTQGG--EPGTACCNGVKDLKVMAQSIADRRTACNCVKAAA  79

Query  308  AR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
             R  ++K D A  LP  CG+     +SR INC
Sbjct  80   NRYANLKDDAAQALPSKCGVTMDIPVSRTINC  111



>ref|XP_009788621.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=115

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = +2

Query  107  AVLAALRL----GQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQD  271
            AVLA ++     GQA+ C  VD S+A C+ YL QGG   P   CC+  R L        D
Sbjct  10   AVLAMIQFMVEPGQALTCGQVDASLAPCIPYLTQGG--DPGAACCNGVRALKGMAQNTAD  67

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            ++ AC C+K  A R  ++K D A  LP  CG+    T+S+ +NC
Sbjct  68   KRAACNCVKAAANRYANLKEDAAQALPTKCGVTLDITVSKSVNC  111



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR---NLLRYTPTKQDRQT  280
            ++ ++ + QA+ C  V  ++A C+ Y++GG A PP  CC+  R   NL R TP   DRQ 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGIRDVNNLARTTP---DRQA  72

Query  281  ACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            AC CLK ++A  P +  + A  LP  CG+   + IS   NC  V
Sbjct  73   ACNCLKQLSASVPGVNPNNAAVLPGKCGVNIPYKISPSTNCATV  116



>gb|KHN29530.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 57/102 (56%), Gaps = 3/102 (3%)
 Frame = +2

Query  107  AVLAALRLGQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTA  283
            AV++A  + QA+ C+ V +++A CLSYL QGG    P  CC   RN+L    T  D+QT 
Sbjct  15   AVMSAPMMVQAVSCNDVSVNLAPCLSYLMQGG--DVPESCCSGVRNILGSASTTFDKQTV  72

Query  284  CECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            C+CL+  A    I  + A  LP  C +   + ISR  NC ++
Sbjct  73   CKCLQQAANNYGINDEYAQALPARCNVSVPYKISRSTNCDSI  114



>ref|XP_006446845.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
 gb|ESR60085.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
Length=115

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 3/115 (3%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            M   +  A+ + A +  +  GQA + C  VD  +A CL+YL G    P   CC     L 
Sbjct  1    MKAGVVLAVMLLAAIVMVERGQAAITCGQVDSFLAPCLAYLTG-EGKPSRACCTGVEYLK  59

Query  248  RYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              TPT  DRQ AC+C+K  A R   IK D A  LP+ CG+     I+ DI+C  +
Sbjct  60   DNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>ref|XP_007141461.1| hypothetical protein PHAVU_008G197700g [Phaseolus vulgaris]
 gb|ESW13455.1| hypothetical protein PHAVU_008G197700g [Phaseolus vulgaris]
Length=123

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            ++  + +A  +AA +  +A+ C      +  CL YL    + P   CC     L+  TPT
Sbjct  9    LSLVVVLALTVAATKPPKALTCEQTKSLVTPCLDYLTKKTSTPSTPCCQGLNKLIASTPT  68

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
            K+++  AC+CLK  A+  P++  D A  LP+ C +   + IS+D +C+ ++
Sbjct  69   KKEKCAACKCLKKEASHIPNLDVDRANKLPKVCNINVDYPISKDFDCEKII  119



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  ++A C+ Y+ GG A PP  CC+  RN+     T  DRQ AC 
Sbjct  17   MVVSVPIAQAITCGQVSSNLAPCIPYVIGGGAVPP-ACCNGIRNVDNLANTTADRQAACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++   P +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSGSIPGVNPNNAASLPGKCGVNIPYNISSSTNCATV  116



>ref|XP_004970395.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Setaria 
italica]
Length=124

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVI----A  307
            M C TV  ++  CL ++Q G A PP  CCD  RNLLR      DR+T C CLK +    A
Sbjct  30   MSCTTVYNTLMPCLPFVQMGGAMPPQPCCDGIRNLLRQASNTPDRRTICGCLKNVANSAA  89

Query  308  ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                   D A  LP  CG+   + IS  +NC  +
Sbjct  90   GGSGTYIDRAAVLPSKCGVSLPYKISTSVNCNTI  123



>pdb|1BWO|A Chain A, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1BWO|B Chain B, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1GH1|A Chain A, Nmr Structures Of Wheat Nonspecific Lipid Transfer Protein
 gb|AAB22334.1| non-specific phospholipid transfer protein, nsPLTP [Tricum aestivum=wheat, 
var. Camp Remy, seeds, Peptide, 90 aa]
 prf||1814270A phospholipid transfer protein
Length=90

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARP  316
            +DC  VD  +  CLSY+QGG   P  +CCD  +NL     ++ DRQ+AC CLK IA    
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            ++  D A  +P  CG+   +TIS +I+C  V
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + S + +  VL+  +    + C TV   +  CLSY+  G  + P ECC+  ++L+    T
Sbjct  10   LLSFLLICLVLSPPQTRAVITCDTVFSDLKPCLSYVLVG-GNVPTECCNGLKSLITNATT  68

Query  263  KQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +DRQ AC C+K +A A  D + D A  LP  CG+   F ISRD++C  V
Sbjct  69   TEDRQMACSCVKNLATAATDEQVDRAASLPGKCGVNVPFKISRDVDCTKV  118



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             +  +L    +  A+ C  V  S+A C+++L+ G   PP  CC+  R+L     T  DRQ
Sbjct  10   LLLCILVTAPVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQ  69

Query  278  TACECLK-VIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             AC CLK    + P I A+VA  LPR CG+   + IS + +C  V
Sbjct  70   AACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRV  114



>emb|CAH04986.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 57/118 (48%), Gaps = 7/118 (6%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRLGQ----AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            M R    A+F   VLAAL + +    A+ C  V  +IA C+SY  G  + P   CC   R
Sbjct  1    MARVALLAVFT--VLAALAVAEMASGAVTCSDVTSAIAPCMSYATGQASSPSAGCCSGVR  58

Query  239  NLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             L     T  DRQ AC CLK +A     I    A  +P  CG+  SF I+  +NC N+
Sbjct  59   TLNGKASTSADRQAACRCLKNLAGSFNGISMGNAANIPGKCGVSVSFPINNSVNCNNL  116



>ref|XP_010447248.1| PREDICTED: non-specific lipid-transfer protein 11 [Camelina sativa]
Length=119

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            + +  ++A    G+A+ C  V++ +A CL YL+ G    PM CC+   +L    P K DR
Sbjct  14   LVITIIMAIAYHGEAIACPQVNMYLAQCLPYLKAGGTPSPM-CCNGLNSLKAAAPAKADR  72

Query  275  QTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            Q AC CLK +A   P I  D A  LP  CG+      S+ ++C ++
Sbjct  73   QVACNCLKSVANTIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>ref|XP_007217372.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
 gb|EMJ18571.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
Length=116

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 2/95 (2%)
 Frame = +2

Query  125  RLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKV  301
            + GQA + C  V  S+A C+ YL  G   PP  CC+    L +   T +DR+ AC+CLK 
Sbjct  21   KPGQATVTCQQVVSSVAPCIPYLTSGTGSPPTACCNGVSGLNQLASTTKDRRAACQCLKD  80

Query  302  IAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
             A    +IK DVA  LP +C +  +  ISR +NC 
Sbjct  81   TADHYQNIKEDVAAGLPTACKVQINVPISRSVNCN  115



>sp|P82007.2|NLTP1_HELAN RecName: Full=Non-specific lipid-transfer protein AP10; Short=Ha-AP10; 
Short=LTP; Short=NsLTP; Flags: Precursor [Helianthus 
annuus]
 gb|AAP47226.1| putative lipid transfer protein [Helianthus annuus]
Length=116

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 61/112 (54%), Gaps = 3/112 (3%)
 Frame = +2

Query  80   AMASAIFMAAVLAALRL--GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRY  253
            +M  AI    V+A L +    A+ C+ V  ++  CL YL+ G   P   CC   + LL  
Sbjct  5    SMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSG-GKPTPACCAGAKKLLGA  63

Query  254  TPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            T T+ DR+TAC+C K  A +  ++ D+A  LP  CG+ +S  I+ ++NC  +
Sbjct  64   TRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGISTSIPINPNVNCNTI  115



>ref|XP_007141469.1| hypothetical protein PHAVU_008G198500g [Phaseolus vulgaris]
 gb|ESW13463.1| hypothetical protein PHAVU_008G198500g [Phaseolus vulgaris]
Length=121

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  MAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQT  280
            +   +AA    +A+ C      +  CL +L      PP  CC     L+  TPTK+++ T
Sbjct  15   LVLTVAATEPPKALTCEETKSLVTPCLDFLTDKTNTPPTPCCQGLNKLIVSTPTKEEKLT  74

Query  281  ACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
            AC+CLK  A++ P+        LP+ C +  ++ IS+D +C N++
Sbjct  75   ACKCLKEAASQIPNFDVSRVNNLPKVCNINVNYPISKDFDCDNII  119



>gb|EYU40720.1| hypothetical protein MIMGU_mgv1a025606mg [Erythranthe guttata]
Length=115

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  +  S+A CLSYL GG   P   CC   R+      + QDRQTAC C+K  A+
Sbjct  22   GEAVSCGELQSSLAPCLSYLTGG-GEPSESCCGGLRSASGSIQSTQDRQTACYCMKSAAS  80

Query  311  -RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               ++  D A  LP  CG+    TIS +++C  +
Sbjct  81   CTYNVPTDAAASLPGKCGVSVGMTISPNVDCSQI  114



>gb|ACE07189.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=117

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKV-IAAR  313
            A+ C  V   I+ CL+YL+ G    P +CC   + L   T T  DRQTAC CLK    + 
Sbjct  26   ALTCSDVSTKISPCLNYLKKG-GEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSN  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             D+K+D AV LP  CGL   + +S + +C  V
Sbjct  85   KDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV  116



>ref|XP_006412367.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
 gb|ESQ53820.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
Length=120

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-  307
            G+A+ C  V++ +A CL YL+ G  +P + CC    +L    P K D+Q AC+CLK +A 
Sbjct  27   GEAIQCSQVNMYLAPCLPYLRAG-GNPSVPCCGGLNSLKAAAPGKPDKQAACQCLKNVAN  85

Query  308  ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            A P I  D A  LP  CG+      SR ++C ++
Sbjct  86   AIPGIIDDNAKQLPAKCGVNLGVPFSRSVDCNSI  119



>ref|NP_680758.3| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 sp|Q2V3C1.1|NLTPB_ARATH RecName: Full=Non-specific lipid-transfer protein 11; Short=LTP 
11; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86211.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=119

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V++ +A CL YL+ G    PM CC+   +L    P K DRQ AC CLK +A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVAN  84

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P I  D A  LP  CG+      S+ ++C ++
Sbjct  85   TIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSI  118



>pdb|1CZ2|A Chain A, Solution Structure Of Wheat Ns-Ltp Complexed With Prostaglandin 
B2.
Length=90

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +2

Query  143  DCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARPD  319
            DC  VD  +  CLSY+QGG   P  +CCD  +NL     ++ DRQ+AC CLK IA    +
Sbjct  2    DCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  60

Query  320  IKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +  D A  +P  CG+   +TIS +I+C  V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>ref|XP_010690793.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=118

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 54/105 (51%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
            FM  V+ A     AM C TV  +IA C++YL+GG   P   CCD    L     T  D++
Sbjct  14   FMCMVVVAPHAEAAMSCGTVTKNIAQCITYLKGG-DSPSKGCCDGVTTLKNLASTPADKK  72

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            TAC CLK  AA    +    A  LP  CG+  S++IS + +C  V
Sbjct  73   TACACLKSAAASIKGLDEKKAAGLPDKCGVSISYSISPNTDCSKV  117



>ref|XP_009591276.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = +2

Query  95   IFMAAVLAALRL----GQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTP  259
            I + A+LA ++L    GQA+ C  VD S+A C+ YL QGG   P   CC   ++L     
Sbjct  6    ISVIAMLAMIQLMFEPGQALTCGQVDASLAPCIPYLTQGG--DPSSACCSGVKSLKGLAQ  63

Query  260  TKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            T  D++ AC C+K  A R  ++K D A  LP  CG+     +SR++NC
Sbjct  64   TIADKRAACNCVKAAANRYANLKDDAAQALPTKCGVTMDIPVSRNVNC  111



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            +L    +  A+ C  V  S+A C+++L+ G   PP  CC+  R+L     T  DRQ AC 
Sbjct  14   ILVTAPVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACN  73

Query  290  CLK-VIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
            CLK    + P I A+VA  LPR CG+   + IS + +C  ++
Sbjct  74   CLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRIL  115



>gb|EMT21909.1| Non-specific lipid-transfer protein 4.1 [Aegilops tauschii]
Length=155

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            +M C  +   ++ CL +LQG   +P  +CCD   +L+    T  DRQ ACECLK  A   
Sbjct  31   SMSCSGMLTDLSPCLGFLQGEEDYPSADCCDGASSLVAAAATTADRQEACECLKSAAGEG  90

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQN  406
              +   +  LP  CGL   FTIS D++C  
Sbjct  91   SAEVTASRDLPADCGLSLPFTISPDVDCSQ  120



>gb|KDO49686.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=126

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 55/106 (52%), Gaps = 1/106 (1%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             +  +L    +  A+ C  V  S+A C+++L+ G   PP  CC+  R+L     T  DRQ
Sbjct  10   LLLCILVTAPVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQ  69

Query  278  TACECLK-VIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
             AC CLK    + P I A+VA  LPR CG+   + IS + +C   V
Sbjct  70   AACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRYV  115



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            + ++M+  +A A+ +A V++A     A+ C  V  S+A C+ YLQ G A P   CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             L     T  DRQ  C CLK +A +   I   +A  LP  CG+  S+ IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGVSISYKISPSTDCKSV  117



>ref|XP_002869218.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45477.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=119

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V++ +A CL YL+ G    PM CC+   +L    P K DRQ AC CLK +A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPTPM-CCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P I  D A  LP  CG+      S+ ++C ++
Sbjct  85   TIPGINDDYAKQLPAKCGVNIGVPFSKTVDCNSI  118



>ref|XP_009616321.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:22114713}-like 
[Nicotiana tomentosiformis]
Length=121

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  56   KIKATMNRAMASAIFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQGGVAHPPMECCDS  232
            K++   N A+   + +  V   ++ GQA + C  V+ S+A C++YL   V  P   CC+ 
Sbjct  2    KVEKMENVAILMIVILTMVKFMVQPGQATITCGEVETSLAPCITYLTQDV-QPYPACCNG  60

Query  233  FRNLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
             RNL     T  D++T C CLK  A R  ++K D A  LP+ CG+   F ISR  NC+
Sbjct  61   VRNLKGMALTVTDQRTVCICLKNAAKRYSNLKEDAAQTLPQKCGVKLDFPISRSFNCE  118



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 60/118 (51%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            + ++M   +  A+ +A V++A     A+ C  V  S+A C+ YLQ G A P   CC   +
Sbjct  1    MASSMGLKLTYAMLIAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGGAVPA-ACCSGLK  59

Query  239  NLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             L     T  DRQ  C CLK +A +   I   VA  LP  CG+  S+ IS   +C++V
Sbjct  60   GLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA-  310
            A+ C TV  ++A+C+ Y+ QGG    P  CC   +NL     T  DRQ AC CLK  A  
Sbjct  26   ALTCGTVTSNVAACIGYITQGGPV--PGACCSGIKNLNSMARTTPDRQQACRCLKTAANA  83

Query  311  -RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P++ A  A  LP++CG+   F IS   NC +V
Sbjct  84   LGPNLNAGRAAGLPKACGVNVPFPISTSTNCNSV  117



>ref|XP_007140136.1| hypothetical protein PHAVU_008G087000g [Phaseolus vulgaris]
 gb|ESW12130.1| hypothetical protein PHAVU_008G087000g [Phaseolus vulgaris]
Length=116

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 57/115 (50%), Gaps = 2/115 (2%)
 Frame = +2

Query  65   ATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNL  244
            A++  A    +FMA V A + + QA+ C+ V + +  CL YL  G       CC   RNL
Sbjct  2    ASVKVACVVVMFMAVVSAPMMV-QAVTCNDVIMQLTPCLPYLMNG-GGASAGCCSGVRNL  59

Query  245  LRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L    T  D+QT C CLK  A R +I    A  LP  C +   + ISR  NC N+
Sbjct  60   LGAAGTTADKQTVCNCLKNAAGRFNINDQYAQALPGVCHVNVPYKISRSTNCANI  114



>ref|XP_009796551.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=114

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            QA+ C  VD ++A C+ YL QGG   P   CC   +NL R   T  DR+TAC C+K  A 
Sbjct  21   QAITCGQVDAALAPCVPYLTQGG--EPGAACCSGVKNLKRMAATTDDRRTACNCVKAAAN  78

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            R  ++K D A  L   CG+     +S+ INC  +
Sbjct  79   RYTNLKDDAAQALASKCGVAMDVPVSKTINCDTI  112



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DR+TAC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++     +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATV  116



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V  S+ SC+ YL+G V   P  CC+  ++L +   T  DRQ ACECLK  +   P
Sbjct  28   ITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIP  87

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +   +A  LP  CG+   + IS   NC+ V
Sbjct  88   GLNPGLAAGLPGKCGVSVPYKISTSTNCKAV  118



>pdb|2ALG|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2ALG|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
Length=92

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC CLK ++A  P
Sbjct  2    ITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  60

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +  + A  LP  CG+   + IS   NC  V
Sbjct  61   GVNPNNAAALPGKCGVSIPYKISASTNCATV  91



>ref|NP_001238031.1| uncharacterized protein LOC100500178 precursor [Glycine max]
 gb|ACU15136.1| unknown [Glycine max]
Length=119

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            + +  ++AA   G+  +C     S+  C+ YL   V  P   CC+  + +    PTK ++
Sbjct  14   VLVLTIIAAEPAGKGYNCEKAKSSVTPCIKYLTSKVDTPSAVCCNGVKEVKSSAPTKDEK  73

Query  275  QTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              AC+CLK +    P++K D A  LP+ CG+ + F I++  NC ++
Sbjct  74   IAACQCLKEVTTHIPNLKEDRATALPKQCGVDAGFLITKK-NCSSI  118



>emb|CDY45038.1| BnaA08g11810D [Brassica napus]
Length=162

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 2/113 (2%)
 Frame = +2

Query  68   TMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            T N+ M   +    ++ A   G+A+ C  + + +A CLSY++GG  +PP  CC    NL 
Sbjct  5    TKNQTMLLLVVTLLMVIAYHEGEAIQCSQITMYLAPCLSYVKGG-GNPPPPCCAGLNNLK  63

Query  248  RYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQ  403
               P + D+Q AC+CLK +A A      D A  LP  CG+      S+ ++C 
Sbjct  64   SSAPGRPDKQAACQCLKNVANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDCN  116



>emb|CAB96876.2| pru p 1 [Prunus persica]
Length=91

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DRQ AC CLK ++A  P
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +  + A  LP  CG+   + IS   NC  V
Sbjct  60   GVNPNNAAALPGKCGVSIPYKISASTNCATV  90



>gb|AAG27707.1|AF302788_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAS84745.1| lipid transfer protein [Triticum aestivum]
 gb|AAV65513.1| lipid transfer protein [Triticum aestivum]
 gb|EMT15838.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M R  A+ + + A++AA+ L     A+ C  V+ ++ASC+SY +G  A PP  CC   R 
Sbjct  1    MARTAATKLVLVALVAAMLLVASDAAISCGQVNSALASCVSYAKGSGASPPGACCSGVRR  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC C+K  A    +    A  +P  CG+   ++IS  ++C  +
Sbjct  61   LAGLARSTADKQAACRCIKSAAG--GLNPGKAASIPSKCGVSIPYSISASVDCSKI  114



>ref|XP_006429567.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
 ref|XP_006481182.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42807.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
Length=115

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + SA+ +  ++      QA+ C  V  S+A C+ YL+ G    P+ CC+  R+L     T
Sbjct  6    LVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSG-GPIPVPCCNGVRSLNAAART  64

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DRQTAC CLK  A   P++  + AV LPR+CG+   + IS   +C  V
Sbjct  65   TPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV  114



>gb|EYU42244.1| hypothetical protein MIMGU_mgv1a024175mg [Erythranthe guttata]
Length=119

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGG--VAHPPMECCDSFRNLLRYT  256
            +AS IF     AA     ++ C  V   +  C++YL+GG   A PP  CC    NL    
Sbjct  11   LASVIFGLVFFAAPS-SSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLATSA  69

Query  257  PTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQ  403
             T  D+QTAC CLK  A   ++  D+A  LP  CG+  SF IS  ++C 
Sbjct  70   TTTADKQTACACLKNAATNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            + ++M+  +A A+ +A V++A     A+ C  V  S+A C+ YLQ G A PP  CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGALPP-ACCSGLK  59

Query  239  NLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +L     T  DRQ  C CLK +A +   +   +A  LP  CG+   + IS   +C+ V
Sbjct  60   SLNSAAKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTV  117



>ref|XP_009607858.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=142

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 61/119 (51%), Gaps = 11/119 (9%)
 Frame = +2

Query  62   KATMNRAMASAIFMAAVLAALRL----GQAMDCHTVDISIASCLSYL-QGGVAHPPMECC  226
            KA M   + SAI   AVLA ++     GQA+ C  VD S+A C+ YL QGG   P   CC
Sbjct  27   KANMKGIIISAI---AVLAMIQFMVEPGQALTCGQVDASLAPCIPYLTQGG--DPSAACC  81

Query  227  DSFRNLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
                 L        D++ AC C+K  A R  ++K D A  LP  CG+    T+S+ +NC
Sbjct  82   IGVTALKGMAQNTADKRAACNCVKATANRYANLKEDAAQALPNKCGVTLDITVSKSVNC  140



>ref|NP_001031782.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 gb|AAS47601.1| At4g33355 [Arabidopsis thaliana]
 gb|AAS76723.1| At4g33355 [Arabidopsis thaliana]
 gb|AEE86212.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=117

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V++ +A CL YL+ G    PM CC+   +L    P K DRQ AC CLK +A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVAN  84

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P I  D A  LP  CG+      S+ ++C 
Sbjct  85   TIPGINDDFAKQLPAKCGVNIGVPFSKTVDCN  116



>emb|CDM80997.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M R  A+ + + A++AA+ L     A+ C  V  +++ C+SY +G  A+PP  CC   R+
Sbjct  1    MARGAATQLVLVAMVAAMLLVASDAAISCGQVTSALSPCISYARGNGANPPAACCSGVRS  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  A    + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>ref|XP_009607860.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = +2

Query  107  AVLAALRL----GQAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQD  271
            AVLA ++     GQA+ C  VD S+A C+ YL QGG  +P   CC+    L        D
Sbjct  10   AVLAMIQFMVEPGQALTCGQVDASLAPCIPYLTQGG--NPGAACCNGVNALKGMAQNTAD  67

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            ++ AC C+K  A +  ++K D A  LP  CG+    T+S+ +NC
Sbjct  68   KRAACNCVKAAANKYANLKEDAAQALPSKCGVTLDITVSKSVNC  111



>ref|XP_010527037.1| PREDICTED: non-specific lipid-transfer protein 1-like [Tarenaya 
hassleriana]
Length=115

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             M  +LA    G A+ C  V+ ++  C  Y+  G   P  +CC   ++L      K DRQ
Sbjct  11   IMMLILAISERGNAITCQAVESTLMPCAGYIVKG-GTPSSKCCAGLKSLKAMARKKADRQ  69

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             AC CLK +A+R P +K D A  LP+ CG+      +R  NC +V
Sbjct  70   AACRCLKDVASRYPGVKDDNASRLPKKCGVDFGVPFTRKTNCNSV  114



>gb|EYU37388.1| hypothetical protein MIMGU_mgv1a018287mg [Erythranthe guttata]
Length=119

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGG--VAHPPMECCDSFRNLLRYT  256
            +AS IF     AA     ++ C  V   +  C++YL+GG   A PP  CC    NL    
Sbjct  11   LASVIFGLVFFAAPS-SSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLATSA  69

Query  257  PTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQ  403
             T  D+QTAC CLK  A   ++  D+A  LP  CG+  SF IS  ++C 
Sbjct  70   TTTADKQTACACLKNAAKNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 5/106 (5%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A FM  +++A     A+ C TV   +A CL +L+GG   PP  CC   RNL     +  D
Sbjct  15   AAFM--IVSAPHAEAAISCGTVVSKLAPCLGFLRGG-GSPPPACCSGIRNLQSMARSTPD  71

Query  272  RQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            RQ AC CLK  +A  +++   A  LP  CG+   + ISR ++C  V
Sbjct  72   RQAACGCLKSASAGVNMRN--AAALPGKCGVNIGYPISRSVDCSRV  115



>gb|ABF14723.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M R  A+ + + A++AA+ L     A+ C  V+ ++ASC+SY +G  A PP  CC   R 
Sbjct  1    MARTAATKLVLVALVAAMLLVASDAAIPCGQVNSALASCVSYAKGSGASPPGACCSGVRR  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC C+K  A    +    A  +P  CG+   ++IS  ++C  +
Sbjct  61   LAGLARSTADKQAACRCIKSAAG--GLNPGKAASIPSKCGVSIPYSISASVDCSKI  114



>ref|XP_010432572.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V++ +A CL YL+ G   P   CC+   +L    P K DRQ AC CLK +A 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAG-GTPSAMCCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P I  D A  LP  CG+      S+ ++C ++
Sbjct  85   TIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>gb|ABI26087.1| lipid transfer protein precursor [Ginkgo biloba]
Length=119

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 47/92 (51%), Gaps = 0/92 (0%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A  C TVD  +A C+SYLQ G  +P ++CC   + L     T +DR+  CEC+K  A R 
Sbjct  28   APGCDTVDTDLAPCISYLQTGTGNPTVQCCSGVKTLAGTAQTTEDRKAICECIKTAAIRV  87

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
               A+    LP  C +   F IS   +C  +V
Sbjct  88   KPVANAVKSLPGLCSVTLPFPISIATDCNKIV  119



>gb|AAQ54611.1| Gly d Mal d 3-like protein [Glycyphagus domesticus]
 gb|EMT27039.1| putative Non-specific lipid-transfer protein [Aegilops tauschii]
Length=116

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 63/113 (56%), Gaps = 3/113 (3%)
 Frame = +2

Query  77   RAMASAIFMAAVLAAL-RLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRY  253
            + M  A+ +  +LAA+ R   A+DC  VD  +  CLSY+QGG + P  +CC   ++L   
Sbjct  5    QVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQGGPS-PSGQCCGGVQSLHNQ  63

Query  254  TPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              +K DRQ AC CLK IA    ++  D A  L   CG+   + IS DI+C +V
Sbjct  64   AQSKSDRQAACNCLKGIARGIHNLNEDNARSLAPKCGVNLPYHISLDIDCNSV  116



>emb|CDM80964.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26653.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M R  A+ + + A++AA+ L     A+ C  V  +++ C+SY +G  A+PP  CC   R+
Sbjct  1    MARGAATQLVLVAMVAAMLLIATDAAISCGQVSPALSPCISYARGNGANPPAACCSGVRS  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  A    + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSVPYAISATVDCSKI  114



>gb|AFR54362.1| nonspecific lipid transfer protein 5 [Triticum aestivum]
 emb|CDM80962.1| unnamed protein product [Triticum aestivum]
 emb|CDM80969.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M R  A+ + + A++AA+ L     A+ C  V  +++ C+SY +G  A+PP  CC   R+
Sbjct  1    MARGAATQLVLVAMVAAMLLVACDAAISCGQVTSALSPCISYARGNGANPPAACCSGVRS  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  A    + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>dbj|BAD54259.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEC80769.1| hypothetical protein OsI_23278 [Oryza sativa Indica Group]
Length=123

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 45/87 (52%), Gaps = 2/87 (2%)
 Frame = +2

Query  146  CHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLK--VIAARPD  319
            C  V   +  CL +LQG   HP  ECCD    L+    T +DRQ ACECLK  V      
Sbjct  35   CSDVVADVTPCLGFLQGDDDHPSGECCDGLSGLVAAAATTEDRQAACECLKSAVSGQFTA  94

Query  320  IKADVAVYLPRSCGLISSFTISRDINC  400
            ++A  A  LP  CGL   +T S D++C
Sbjct  95   VEAAPARDLPADCGLSLPYTFSPDVDC  121



>sp|Q43767.1|NLT41_HORVU RecName: Full=Non-specific lipid-transfer protein 4.1; Short=LTP 
4.1; AltName: Full=CW-21; Short=CW21; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48621.1| Cw-21 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ92944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA AS + + A++AA+ L     A+ C  V  +++ C+SY +G  A PP  CC   + 
Sbjct  1    MARAAASQLVLVALVAAMLLVAADAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKR  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  +A   + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIK--SAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>emb|CAH69190.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69209.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V  +IA C+SY  G  + P   CC   R L     T  DRQ AC CLK +A   
Sbjct  25   AVTCGDVTSAIAPCMSYATGKASAPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSF  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              I    A  +P  CG+  SF I+ ++NC N+
Sbjct  85   KGISMGNAATIPGKCGVSVSFPINTNVNCNNI  116



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 51/105 (49%), Gaps = 1/105 (1%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            IF+  ++ A    QA+ C  V   +  CL YL+ G    P  CC   +NL     TK DR
Sbjct  14   IFITMLVVAPHAAQALTCGQVLNMVMPCLGYLKNG-GSIPATCCGGVKNLASSAKTKPDR  72

Query  275  QTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            Q AC+CLK  A    I  D A  LP +CG+     IS  I+C  V
Sbjct  73   QQACKCLKPAAKSYGINYDRANKLPSACGVDYKINISPTIDCSTV  117



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ ++ + QA+ C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DR+TAC 
Sbjct  17   MVVSVPIAQAITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK ++     +  + A  LP  CG+   + IS   NC  V
Sbjct  76   CLKQLSGSISGVNPNNAAALPGKCGVNIPYKISISTNCAAV  116



>gb|ACE80968.1| putative allergen Pru du 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQ-GGVAHPPMECCDSFRNLLRYTPTK  265
            A+FM  V+AA  + +A + C  +   +A CL YLQ GGV  P   CC   + L+    T 
Sbjct  9    ALFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRGGV--PAGGCCPGIKRLVGSATTT  66

Query  266  QDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             DRQ AC+CLK +A A   I    A  LP  CG+   + IS   NC +V
Sbjct  67   ADRQNACKCLKTVAGAVKGINTGYAAALPSLCGVKIPYKISASTNCNSV  115



>ref|XP_007161356.1| hypothetical protein PHAVU_001G062300g [Phaseolus vulgaris]
 gb|ESW33350.1| hypothetical protein PHAVU_001G062300g [Phaseolus vulgaris]
Length=121

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 53/105 (50%), Gaps = 1/105 (1%)
 Frame = +2

Query  101  MAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQT  280
            +   +AA    +A+ C      +  CL +L      PP  CC     L+  TPTK+++  
Sbjct  15   LVLTVAATEPPKALTCEETKSLVTPCLDFLTDKTNTPPTPCCQGLNKLIVSTPTKEEKLA  74

Query  281  ACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
            AC+CLK  A+  P+        LP+ C +  ++ IS+D +C+N++
Sbjct  75   ACKCLKEAASHIPNFDVGRVNNLPKVCNINVNYPISKDFDCENII  119



>gb|AFK46170.1| unknown [Lotus japonicus]
Length=119

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 56/110 (51%), Gaps = 3/110 (3%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            M  AI MA V A +    A+ C +V  ++  C+ YL GG A  P +CC   +NL     T
Sbjct  10   MVVAICMALVAAPMAE-AAISCGSVIGALTPCMPYLTGGPAPSP-QCCAGVKNLNAAAST  67

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DR+TAC CLK  A   P++ A  A  LP  CG+   + IS   NC  +
Sbjct  68   TPDRKTACGCLKNAAGSMPNLNAGNAAALPGKCGVNIPYKISTSTNCNTI  117



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 2/118 (2%)
 Frame = +2

Query  59   IKATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFR  238
            + ++M+  +A A+ +A V++A     A+ C  V  S+A C+ YLQ G A  P  CC   +
Sbjct  1    MASSMSLKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGGAV-PAACCSGLK  59

Query  239  NLLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +L     T  DRQ  C CLK +A +   +   +A  LP  CG+  S+ IS   +C+ V
Sbjct  60   SLNSAAATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTV  117



>sp|Q42842.1|NLT43_HORVU RecName: Full=Non-specific lipid-transfer protein 4.3; Short=LTP 
4.3; Flags: Precursor [Hordeum vulgare]
 emb|CAA91435.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA A+ + + A++AA+ L     A+ C  V  +++ C+SY +G  A PP+ CC   + 
Sbjct  1    MARAAATQLVLVAMVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKR  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  +A   + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIK--SAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>dbj|BAH03575.1| nonspecific lipid transfer protein [Citrus jambhiri]
Length=115

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + SA+ +  ++      QA+ C  V  ++A C+ YL+ G    P+ CC+  R+L     T
Sbjct  6    LVSALVLCMLVTGPLSAQAITCGQVSSALAPCIFYLRAG-GPIPVPCCNGVRSLNAAART  64

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DRQTAC CLK  A   P++  + AV LPR+CG+   + IS   +C  V
Sbjct  65   TPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV  114



>gb|ACE07186.1| Art v 3.0201 allergen precursor [Artemisia vulgaris]
Length=114

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLK-VIAA  310
            +A+ C  V   I++CLSYL+ G    P +CC   + L     T  DRQTAC CLK    +
Sbjct  22   EALKCSDVSNKISACLSYLKQG-GEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKS  80

Query  311  RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              D K+D A  LP  CG+   + IS + +C  V
Sbjct  81   NKDFKSDFAASLPSKCGVNIPYKISLETDCNKV  113



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (52%), Gaps = 8/116 (7%)
 Frame = +2

Query  83   MASAIFMAAVLA------ALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNL  244
            MASA+   A++A      A+ + QA+ C  V  ++A C +Y++ G A P   CC+  R+L
Sbjct  1    MASAVMKLALVALICIVVAVPVAQAITCGQVTQNVAPCFNYVKSGGAVP-AACCNGIRSL  59

Query  245  LRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                 T  DR+  C CLK  A     + A++A  LP  CG+   + IS   NC NV
Sbjct  60   NSAAKTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNV  115



>ref|XP_006347954.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
tuberosum]
Length=115

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            A+ C  VD ++A C+S+L QGG   P   CC   + L     +  DR+TAC C+K    R
Sbjct  24   AITCGQVDANLAPCVSFLTQGG--EPGAACCSGVKTLNGNAQSSDDRKTACNCVKAAVNR  81

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             P++K D A  LP  CG+  +  ISR +NC  +
Sbjct  82   YPNLKDDAAQSLPSKCGISVNVPISRTVNCDTI  114



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA-  310
            A+ C TV+ ++A C+ Y+ QGG    P  CC     L     T  DRQ AC CLK  A+ 
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGPL--PRACCTGVSKLNSMARTTPDRQQACRCLKTAASA  83

Query  311  -RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P++ A  A  +P++CG+   F IS + NC NV
Sbjct  84   LGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ +++ CLSY +GG + P   CC   RNL     T  DR+TAC CLK +A   
Sbjct  27   AISCGQVNSAVSPCLSYPRGG-SGPSAACCSGVRNLNSAASTTADRRTACNCLKNVAGSI  85

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C +V
Sbjct  86   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  117



>gb|KHN12008.1| Non-specific lipid-transfer protein A [Glycine soja]
Length=117

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 2/103 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            + +  ++AA   G+  +C     S+  C+ YL   V  P   CC+  + +    PTK ++
Sbjct  14   VLVLTIIAAEPAGKGYNCEKAKSSVTPCIKYLTSKVDTPSAACCNGVKEVKSSAPTKDEK  73

Query  275  QTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
              AC+CLK +    P++K D A  LP+ CG+   F I++  NC
Sbjct  74   IAACQCLKEVTTHIPNLKEDRATALPKQCGVDVGFLITKK-NC  115



>ref|XP_007206160.1| hypothetical protein PRUPE_ppa013558mg [Prunus persica]
 gb|EMJ07359.1| hypothetical protein PRUPE_ppa013558mg [Prunus persica]
Length=116

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQ-GGVAHPPMECCDSFRNLLRYTPTK  265
            A+FM  V+AA  + +A + C  +   +A CL YLQ GGV  P   CC   + L+    T 
Sbjct  9    ALFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRGGV--PAGGCCPGIKRLVGSATTT  66

Query  266  QDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             DRQ AC+CLK +A A   I    A  LP  CG+   + IS   NC +V
Sbjct  67   ADRQNACKCLKTVAGAVKGINPGYAAALPSLCGVKIPYKISASTNCNSV  115



>gb|KDP35110.1| hypothetical protein JCGZ_10952 [Jatropha curcas]
Length=114

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+ C  V+ ++A C+  L G    P   CC   +N+    PT  DR+ A +C+K  A+
Sbjct  22   GEAVGCGQVNSALAPCIPCLTGAGTAPSAACCGGAKNVKALAPTTADRRAAGDCVKAAAS  81

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P+I  D A  LP+ CG+  +  IS++ NC 
Sbjct  82   HYPNINEDSASSLPKKCGVEVTIPISKNTNCH  113



>gb|ACE80969.1| putative allergen Pru p 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQA-MDCHTVDISIASCLSYLQ-GGVAHPPMECCDSFRNLLRYTPTK  265
            A+FM  V+AA  + +A + C  +   +A CL YLQ GGV  P   CC   + L+    T 
Sbjct  9    ALFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRGGV--PAGGCCPGIKRLVGSATTT  66

Query  266  QDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             DRQ AC+CLK +A A   I    A  LP  CG+   + IS   NC +V
Sbjct  67   ADRQNACKCLKTVAGAVKGINPGYAAALPSLCGVKIPYKISASTNCNSV  115



>gb|AGC08425.1| lipid transfer protein [Gossypium hirsutum]
Length=129

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V     SC+ YLQ G  +PP  CC+  RNL R   T +DRQTAC CL+  AAR 
Sbjct  25   ALTCGQVASQTGSCIRYLQRG-GNPPAACCNGVRNLNRQARTTRDRQTACRCLQT-AART  82

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
               I   +A  LP  CG+   + IS   NC   +
Sbjct  83   ISGINTKLAAGLPAKCGVKIPYKISPSTNCNRYI  116



>gb|AHB19226.1| non specific lipid transfer protein 1B [Punica granatum]
Length=120

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 1/110 (1%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            +  A+F+  V+AA  +  A+ C  V  S+  C+ Y +G VA P   CC   R+L     T
Sbjct  10   LVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKT  69

Query  263  KQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DRQTAC CLKVIA +   I       LP  CG+   + IS   +C  V
Sbjct  70   TPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRV  119



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (51%), Gaps = 2/108 (2%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            S + +  ++ AL + QA+ C  V  +I+ CL+Y++ G A P   CC   RNL     T  
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP-AACCSGIRNLNGMAKTTA  68

Query  269  DRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            DRQ AC CLK  A     +  ++A  LP  CG+   + IS   NC  V
Sbjct  69   DRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 53/107 (50%), Gaps = 3/107 (3%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A+ M  V+A +    A+ C  V  ++A CL YLQGG   P  +CC   RNL     T  D
Sbjct  10   ALIMCIVIAPMAE-SAITCGRVSAALAPCLGYLQGG-PGPSAQCCGGVRNLNSAAVTTPD  67

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            RQ AC CLK  A     + A+ A  LP  CG+   + IS   NC  +
Sbjct  68   RQAACNCLKSAAGSISRLNANNAAALPGKCGVNIPYKISTSTNCATI  114



>sp|P81402.1|NLTP1_PRUPE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Allergen Pru p 1; AltName: Full=Major allergen 
Pru p 3; AltName: Allergen=Pru p 3 [Prunus persica]
Length=91

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V  ++A C+ Y++GG A PP  CC+  RN+     T  DRQ AC CLK ++A  P
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +  + A  LP  CG+   + IS   NC  V
Sbjct  60   GVNPNNAAALPGKCGVHIPYKISASTNCATV  90



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 52/104 (50%), Gaps = 3/104 (3%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A+ M  V+A +    A+ C  V  ++A CL YLQGG   P  +CC   RNL     T  D
Sbjct  10   ALIMCIVIAPMAE-SAITCGRVSAALAPCLGYLQGGPG-PSAQCCGGVRNLNSAAVTTPD  67

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            RQ AC CLK  A     + A+ A  LP  CG+   + IS   NC
Sbjct  68   RQAACNCLKSAAGSISRLNANNAAALPGKCGVNIPYKISTSTNC  111



>emb|CDY07725.1| BnaA03g17860D [Brassica napus]
Length=137

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A+ C +V  ++A C+SYL+G        CC   +N+   + T  DRQ AC CLK +   P
Sbjct  26   ALSCASVVSNMAPCISYLRGSTGAISSACCSGVKNINGLSRTPSDRQIACGCLKRVVTLP  85

Query  317  -DIKADVAVYLPRSCGLISSFTISRDINC  400
             +I AD A  LP++CG+   + IS+  NC
Sbjct  86   NNINADRAAGLPKACGVSLPYNISKSANC  114



>prf||2115353A lipid transfer protein
Length=115

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA AS + + A++AA+ L     A+ C  V  +++ C+SY +G  A PP  CC   + 
Sbjct  1    MARAAASQLVLVALVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKR  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  +A   + +  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIK--SAAGGLNSGKAAGIPSMCGVSVPYAISASVDCSKI  114



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             + A+  A+ +  A+ C  V  S+A C+ Y++ G A PP  CC+  R +     T  DRQ
Sbjct  11   LVVALCMAVSVAHAITCGQVTSSLAPCIGYVRNGGAVPP-ACCNGIRTINSLARTTADRQ  69

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            TAC CLK +A     +  + A  LP  CG+   + IS   NC  V
Sbjct  70   TACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 57/117 (49%), Gaps = 7/117 (6%)
 Frame = +2

Query  62   KATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
             A  N A+  A+ MA  +A      A+ C  V  S+A C+ Y++ G A PP  CC+  R 
Sbjct  4    SAVTNLALVVALCMAVSVA-----HAITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRT  57

Query  242  LLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +     T  DRQTAC CLK +A     +  + A  LP  CG+   + IS   NC  V
Sbjct  58   INGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>emb|CDP07650.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A F+   L A     A+ C  V   IA C+ YL+ G   PP  CC   + L     T  D
Sbjct  13   AAFLVLFLIAPASDAAVTCGDVAKKIAPCVDYLRSGSGAPPPPCCGGVKALAASATTTPD  72

Query  272  RQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +Q AC CLK  +   +IK ++A  LP +CG+   + IS + +C  +
Sbjct  73   KQAACACLKTQSKNLNIKPELAQALPGNCGVSLPYPISPNFDCTTI  118



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             + A+  A+ +  A+ C  V  S+A C+ Y++ G A PP  CC+  R +     T  DRQ
Sbjct  11   LVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQ  69

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            TAC CLK +A     +  + A  LP  CG+   + IS   NC  V
Sbjct  70   TACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_002532869.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF29523.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=116

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQG-GVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-  307
            QA+ C  V  S+  CL+YL+G G   P   CC+  R +     T  DRQTAC+CLK  A 
Sbjct  22   QAITCGQVASSLGPCLNYLKGAGGTAPSAACCNGVRGINSAAKTTADRQTACQCLKSAAN  81

Query  308  ARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P ++  +A  LP +C +   + IS   NCQ++
Sbjct  82   GIPGLQPKLAESLPGNCNVNIPYKISLSTNCQSI  115



>sp|Q43875.1|NLT42_HORVU RecName: Full=Non-specific lipid-transfer protein 4.2; Short=LTP 
4.2; AltName: Full=Low-temperature-responsive protein 4.9; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA91436.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 gb|AAB05812.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 prf||2115353C lipid transfer protein
Length=115

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA A+ + + A++AA+ +     A+ C  V  +++ C+SY +G  A PP+ CC   + 
Sbjct  1    MARAAATQLVLVAMVAAMLIVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKR  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  +A   + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAAQSTADKQAACKCIK--SAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKI  114



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ +++ CLSY +GG + P   CC   R+L     T  DR+TAC CLK +A   
Sbjct  27   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C +V
Sbjct  86   SGLNAGNAASIPSKCGVTIPYTISPSIDCSSV  117



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ A+ + QA+ C  V  ++A C +Y++ G A P   CC+  RNL     T  DRQ  C 
Sbjct  17   IVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP-AACCNGVRNLNSQAKTTADRQQTCN  75

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK  A   P +   +A  LP  CG+   + IS   NC  V
Sbjct  76   CLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATV  116



>sp|Q42641.1|NLTPA_BRAOT RecName: Full=Non-specific lipid-transfer protein A; Short=LTP 
A; AltName: Full=Wax-associated protein 9A; Flags: Precursor 
[Brassica oleracea var. italica]
 gb|AAA73945.1| lipid transfer protein [Brassica oleracea var. italica]
Length=118

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            +A+ C TV+ ++A C+ Y+ QGG    P  CC     L     T  DRQ AC CL+  AA
Sbjct  25   RALTCGTVNSNVAPCIGYITQGGTL--PGACCTGVSKLNSMARTTPDRQQACRCLET-AA  81

Query  311  R---PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            R   P++ A  A  +P++CG+   F IS + NC NV
Sbjct  82   RALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 2/108 (2%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            S + +  ++ AL + QA+ C  V  SIA C++Y++ G A P   CC+  R+L     T  
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASSIAPCVNYVKSGGAVP-AACCNGVRSLNSAAKTTA  68

Query  269  DRQTACECLK-VIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            DRQT C CLK    A   +  ++A  LP  CG+   + IS   NC  V
Sbjct  69   DRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>ref|XP_011069906.1| PREDICTED: non-specific lipid-transfer protein A-like [Sesamum 
indicum]
Length=116

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 7/112 (6%)
 Frame = +2

Query  89   SAIFMAAVLAALRL----GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYT  256
            +A+F  A+LA + L    G A+ C  VD ++  C+SYL G V  P   CC   + +    
Sbjct  6    AAVF--AILAIISLVVQPGGAVTCGQVDAALVPCISYLTGHVDSPSAACCGGVKAVKGMA  63

Query  257  PTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             T  D++  C C+K  A R  D+K D A  LP  CG+     ISR ++C  +
Sbjct  64   ETTADKRACCSCVKAAANRYADLKDDAAQSLPTKCGVQMDVPISRSVDCDKI  115



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 2/110 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + SA+ +  ++      QA+ C  V  S+A C+ +L+ G    PM CC+  R+L     T
Sbjct  6    LVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSG-GPIPMPCCNGVRSLNAAART  64

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DRQTAC CLK  A   P++  + A  LP +CG+   + IS   +C  V
Sbjct  65   TPDRQTACNCLKQAAGSIPNLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>gb|AGC08421.1| lipid transfer protein [Gossypium hirsutum]
Length=147

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARP  316
            A+ C  V   +A CLSYLQ G  + P  CCD  R+L     T  DRQT C CL+  A   
Sbjct  24   AITCGDVTSKVAGCLSYLQNG-GNVPKACCDGIRSLNMMARTTPDRQTVCGCLQTAAKAV  82

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
             IK ++A  LP  C +   + IS   NC+ ++
Sbjct  83   KIKGNLAETLPAKCSVNIPYKISTSTNCKKLI  114



>ref|NP_001067782.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|AAX96637.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|ABA93211.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28145.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|EAY80752.1| hypothetical protein OsI_35929 [Oryza sativa Indica Group]
 gb|EAZ18211.1| hypothetical protein OsJ_33751 [Oryza sativa Japonica Group]
 dbj|BAG87838.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92398.1| unnamed protein product [Oryza sativa Japonica Group]
Length=117

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 3/92 (3%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR--  313
            + C  V+ ++  CL+Y +GG A P   CC+  R+L     T  DR+TAC CLK  AAR  
Sbjct  26   ITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLKN-AARGI  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C  V
Sbjct  85   KGLNAGNAASIPSKCGVSVPYTISASIDCSRV  116



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             + A+  A+ +  A+ C  V  S+A C+ Y++ G A PP  CC+  R +     T  DRQ
Sbjct  11   LVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQ  69

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            TAC CLK +A     +  + A  LP  CG+   + IS   NC  V
Sbjct  70   TACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|ACE07187.1| Art v 3 allergen precursor [Artemisia vulgaris]
Length=116

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 56/115 (49%), Gaps = 6/115 (5%)
 Frame = +2

Query  80   AMASAIFMAAVLAALRL----GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLL  247
            AM    F  A++  + L     +A+ C  V   I  CL+YL+ G    P +CC   + L 
Sbjct  2    AMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQG-GEVPADCCTGVKGLN  60

Query  248  RYTPTKQDRQTACECLKV-IAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                T  DRQTAC CLK    +  D+K+D A  LP  CG+   + IS + +C  V
Sbjct  61   DAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV  115



>emb|CDX93316.1| BnaC04g45800D [Brassica napus]
Length=118

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            A+ C TV+ ++A C+ Y+ QGG    P  CC     L     T  DRQ AC CL+  AAR
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGTL--PGACCTGVSKLNSMARTTPDRQQACRCLET-AAR  82

Query  314  ---PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               P++ A  A  +P++CG+   F IS + NC NV
Sbjct  83   ALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A+ M  V++A     A+ C TV +S+A CL+YL+ G   PP  CC+  ++L     T  D
Sbjct  14   AVLMCMVVSAPHAEAAITCGTVTVSLAPCLNYLKKGGPVPP-ACCNGIKSLNAAAKTTAD  72

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            RQ AC CLK  +     I    A  LP  CG+   + IS   +C  V
Sbjct  73   RQAACNCLKTASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKV  119



>gb|EMT04675.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA A+ + + A++AA+ L     A+ C  V  +++ C+SY +G  A+P   CC   R+
Sbjct  1    MARAAATQLVLVALVAAMLLVATDAAISCGQVSSALSPCISYARGNGANPTAACCSGVRS  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  +A   + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIK--SAAGGLTAGKAAGIPSKCGVSVPYAISASVDCSKI  114



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ ++  CLSY +GG A P   CC   R+L     T  DR+TAC CLK  A   
Sbjct  26   AISCGQVNSAVGPCLSYARGG-AGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSI  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C  V
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ ++  CLSY +GG A P   CC   R+L     T  DR+TAC CLK  A   
Sbjct  26   AISCGQVNSAVGPCLSYARGG-AGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSI  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C  V
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>ref|XP_006429568.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
 gb|ESR42808.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
Length=164

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 2/111 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + SA+ +  ++      QA+ C  V  S+A C+ YL+ G    P+ CC+  R+L     T
Sbjct  6    LVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSG-GPIPVPCCNGVRSLNAAART  64

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
              DRQTAC CLK  A   P++  + AV LPR+CG+   + IS   +C   +
Sbjct  65   TPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKYI  115



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 2/101 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            ++ A  + QA+ C  V  ++  C++YLQ G A P  +CC+  + L+    T  D+QTAC 
Sbjct  16   MVGAAPIAQAITCGQVVSNLTPCITYLQRGGAVP-GQCCNGVKTLVSSAQTTADKQTACN  74

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK  AA  P+I    A  LP  CG+   + IS   NC ++
Sbjct  75   CLKSTAATIPNINFGNAGSLPGKCGVNLPYKISPSTNCASI  115



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ +++ CLSY +GG + P   CC   R+L     T  DR+TAC CLK +A   
Sbjct  26   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C +V
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  116



>gb|KDP28846.1| hypothetical protein JCGZ_14617 [Jatropha curcas]
Length=92

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+DC  V+ ++A C+ +L G    P   CC   +NL    PT  DR+ A +C+K  A+
Sbjct  5    GEAVDCGQVNSALAPCIPFLTGADTAPSAACCGGIKNLKALAPTTADRRAARDCVKAAAS  64

Query  311  R-PDIKADVAVYLPRSCGLISSFTISR  388
              P+I  D A   P+ CG+  +  IS+
Sbjct  65   HYPNINEDSASSFPKKCGVEVNIPISK  91



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ +++ CLSY +GG + P   CC   R+L     T  DR+TAC CLK +A   
Sbjct  27   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C +V
Sbjct  86   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  117



>ref|XP_006285119.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
 gb|EOA18017.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
Length=117

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G A+ C  V++ +A CL YL+ G   P   CC+   +L    P K DRQ AC CLK +A 
Sbjct  26   GDAIACPQVNMYLAQCLPYLKAG-GTPSAMCCNGLNSLKAAAPAKPDRQVACNCLKSVAN  84

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P I  D A  LP  CG+      S+ ++C 
Sbjct  85   TIPGINDDYAKQLPSKCGVNLGVPFSKTVDCN  116



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V  ++A C++Y++GG A PP  CC+  RN+     T  DR+ AC CLK ++   P
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIP  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +  + A  LP  CG+   + IS   NC  V
Sbjct  60   GVNPNNAAALPGKCGVNVPYKISASTNCATV  90



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V+ +++ CLSY +GG + P   CC   R+L     T  DR+TAC CLK +A   
Sbjct  19   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  77

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              + A  A  +P  CG+   +TIS  I+C +V
Sbjct  78   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  109



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
            Q+M C TV   +  CL Y++ G A P M+CC+  R+L     T  DRQT C C+K  A+ 
Sbjct  1    QSMSCSTVVTDLYPCLDYVENGGAVP-MDCCEGIRSLYTSAATTADRQTVCNCMKNAASS  59

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
               +  D+A  LP+ CG+   + IS  ++C  V
Sbjct  60   VTGLNLDLAAGLPQKCGVSIPYQISPSVDCATV  92



>ref|XP_007141462.1| hypothetical protein PHAVU_008G197800g [Phaseolus vulgaris]
 gb|ESW13456.1| hypothetical protein PHAVU_008G197800g [Phaseolus vulgaris]
Length=117

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 55/108 (51%), Gaps = 1/108 (1%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            ++  + +   +AA +  +A+ C      +  CL YL    + P   CC      +  TPT
Sbjct  9    LSLVVVLGLTVAATKPPKALTCEQTKSLVTPCLDYLTKKTSTPSTPCCQGLNKFIASTPT  68

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
            K+++  AC+CLK  A+  P++  D A  LP+ C +   + IS+D +C+
Sbjct  69   KKEKCAACKCLKKEASHIPNLDVDRANKLPKVCNISVDYPISKDFDCE  116



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V  S++ CL+YL+ G   PP  CC   +NL     T  DRQTAC+CLK ++   
Sbjct  28   AITCGQVTSSLSPCLNYLKSGGPVPP-GCCSGIKNLNSAAQTTADRQTACKCLKSLSGSI  86

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            P I   +A  LP  CG+   + IS   +C  V
Sbjct  87   PGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|EEE65837.1| hypothetical protein OsJ_21599 [Oryza sativa Japonica Group]
Length=123

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 44/85 (52%), Gaps = 2/85 (2%)
 Frame = +2

Query  152  TVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLK--VIAARPDIK  325
            T    +  CL +LQG   HP  ECCD    L+    T +DRQ ACECLK  V      ++
Sbjct  37   TWSPDVTPCLGFLQGDDDHPSGECCDGLSGLVAAAATTEDRQAACECLKSAVSGQFTAVE  96

Query  326  ADVAVYLPRSCGLISSFTISRDINC  400
            A  A  LP  CGL   +T S D++C
Sbjct  97   AAPARDLPADCGLSLPYTFSPDVDC  121



>ref|XP_004229752.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=120

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 54/101 (53%), Gaps = 6/101 (6%)
 Frame = +2

Query  119  ALRLGQ--AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            A RL Q   + C  VD ++A C+SYL QGG   P   CC   + +     +  +R+TAC 
Sbjct  21   AGRLEQQGGVSCGQVDANMAPCISYLTQGG--EPSASCCSGVKTVSGMAQSTDERRTACN  78

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            CLK  A R  ++K D A  LP  CG+  +  ISR INC  +
Sbjct  79   CLKAAANRYANLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR  313
             A+ C  V  S++ C+SY++ G    P  CC   R+L     T  DR+T C CLK  AAR
Sbjct  26   NAITCGQVASSVSGCISYVRSG-GSIPASCCSGVRSLAGSAKTTADRRTVCNCLKSTAAR  84

Query  314  -PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
               IK  +A  LP  CG+   FTIS   +C  V 
Sbjct  85   ISGIKPALAAGLPSKCGVRIPFTISPSTDCSKVT  118



>gb|AGN56421.1| non-specific lipid transfer protein 1 [Linum usitatissimum]
Length=116

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + S + + A++AA      + C  V   +A+CL+YL G     P  CC+  R LL    T
Sbjct  7    LVSILLVCALVAAPITVSGLTCGQVSSGMAACLTYLTGRAPVTP-ACCNGMRGLLNMAKT  65

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
              DR+ AC CLK  A   P +   +A  LP  CG+   + IS   NC   V
Sbjct  66   TADRRLACTCLKTAAGNVPGLNPAIAAGLPGKCGVKIPYKISTSTNCNTYV  116



>sp|P86137.2|NLTP1_ACTDE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Short=nsLTP1; AltName: Allergen=Act d 10.01 [Actinidia deliciosa]
Length=92

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTK-QDRQTACECLKVIAAR  313
            A+ C  VD ++  CL+YL  G   P  +CC   R+L   T TK  DRQ AC CLK  AAR
Sbjct  1    AVSCGQVDTALTPCLTYLTKG-GTPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAAR  59

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
                 D A  L + CG+  S  ISR  +C  +
Sbjct  60   YQGIKDAAAALSQKCGVQLSVPISRSTDCSKI  91



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 53/107 (50%), Gaps = 3/107 (3%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A+ M  V+A +    A+ C  VD ++A CL YLQGG   P  +CC   RNL     T  D
Sbjct  10   ALIMCIVIAPMAE-SAITCGRVDTALAPCLGYLQGG-PGPSAQCCGGVRNLNSAAVTTPD  67

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            RQ AC CLK  A     + A+ A  LP  C +   + IS   NC  +
Sbjct  68   RQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATI  114



>gb|AGN56422.1| non-specific lipid transfer protein 2, partial [Linum usitatissimum]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + S + + A++AA      + C  V   +A+CL+YL G     P  CC+  R LL    T
Sbjct  7    LVSILLVCALVAAPITVSGLTCGQVSSGMAACLTYLTGRAPVTP-ACCNGMRGLLNMAKT  65

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNVV  412
              DR+ AC CLK  A   P +   +A  LP  CG+   + IS   NC   V
Sbjct  66   TADRRLACTCLKTAAGNVPGLNPAIAAGLPGKCGVKIPYKISTSTNCNTYV  116



>gb|ADV02772.1| lipid transfer protein 1a [Ipomoea batatas]
Length=120

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 2/102 (2%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGV-AHPPMECCDSFRNLLRYTPTKQDRQTAC  286
            V+AA     A+ C ++   ++SCLSY+QG V   PP  CC + +++     T  DRQ AC
Sbjct  18   VVAAPSAEAAITCGSMVAKLSSCLSYVQGKVTGGPPAACCGAIKSINSVATTTPDRQAAC  77

Query  287  ECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            +CLK +A     +   V   LP  CG+   + IS  ++C  V
Sbjct  78   KCLKQMAGSYSSVNMGVVSSLPSKCGVNIGYPISTSVDCAKV  119



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 2/108 (2%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            S + +  ++ AL + QA+ C  V  SI+ C++Y++ G A P   CC+  R+L     T  
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP-AACCNGIRSLNSAAKTTA  68

Query  269  DRQTACECLK-VIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            DRQT C CLK    A   +  ++A  LP  CG+   + IS   NC  V
Sbjct  69   DRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 1/110 (1%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            M S + +  ++AA    QA+ C  V  ++  CLSYL+     PP  CC+  R +     T
Sbjct  6    MVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKT  65

Query  263  KQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DR+TAC+CLK  A     +       LP  CG+   + IS   NC  V
Sbjct  66   TADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATV  115



>gb|KDP28820.1| hypothetical protein JCGZ_14591 [Jatropha curcas]
Length=114

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  131  GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            G+A+DC  V+ ++A C+ ++ G    P   CC   +NL    PT  DR+ AC+C K  A+
Sbjct  22   GEAVDCGQVNSALAPCIPFMTGADTAPSAACCGGVKNLKALAPTTADRRAACDCAKAAAS  81

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P+I  D A  LP+ CG+  +  IS++INCQ
Sbjct  82   HYPNINEDSASSLPKKCGVEVNIPISKNINCQ  113



>pdb|1MID|A Chain A, Non-Specific Lipid Transfer Protein 1 From Barley In 
Complex With L-Alfa-Lysophosphatidylcholine, Laudoyl
 pdb|3GSH|A Chain A, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
 pdb|3GSH|B Chain B, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
Length=91

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARP  316
            ++C  VD  +  CL+Y+QGG   P  ECC+  R+L     +  DRQT C CLK IA    
Sbjct  1    LNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIH  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            ++  + A  +P  C +   +TIS DI+C  +
Sbjct  60   NLNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>ref|XP_010553199.1| PREDICTED: non-specific lipid-transfer protein 4-like [Tarenaya 
hassleriana]
Length=118

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARP  316
            + C TV   +A C+ Y+ GG    P  CC   ++L     T  DR+ AC CL+  A    
Sbjct  27   ITCGTVQSKLAPCIMYVTGGGGTVPPPCCAGIKDLYGMAGTTPDRRQACLCLQSAAKGIT  86

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             IK D+A  LPR+CG+   + IS  INC ++
Sbjct  87   GIKPDLAASLPRACGVSLPYPISGSINCNSI  117



>pdb|1BE2|A Chain A, Lipid Transfer Protein Complexed With Palmitate, Nmr, 
10 Structures
 pdb|1JTB|A Chain A, Lipid Transfer Protein Complexed With Palmitoyl Coenzyme 
A, Nmr, 16 Structures
 pdb|1LIP|A Chain A, Barley Lipid Transfer Protein (Nmr, 4 Structures)
Length=91

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARP  316
            ++C  VD  +  CL+Y+QGG   P  ECC+  R+L     +  DRQT C CLK IA    
Sbjct  1    LNCGQVDSKMKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIH  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            ++  + A  +P  C +   +TIS DI+C  +
Sbjct  60   NLNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>gb|ABK22458.1| unknown [Picea sitchensis]
 gb|ACN40889.1| unknown [Picea sitchensis]
Length=118

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARPD  319
            + C TV   +  CLSY+ G  A+P   CC+  + L     T  DRQ AC+C+K  AA   
Sbjct  28   ISCSTVISDLVPCLSYVAGSAANPTAACCNGVKALNAAAKTTPDRQAACKCIKSAAASYK  87

Query  320  IKADVAVYLPRSCGLISSFTISRDINCQNV  409
              +  A  +P  CG+  SF IS  +NC  +
Sbjct  88   YNSGKAGKIPGLCGVSVSFPISASVNCNAI  117



>dbj|BAI94497.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = +2

Query  77   RAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYT  256
            R +A A+ +  V+ A    +A+ C  V  S+ASC+SYL+ G   P   CC   + L    
Sbjct  8    RKVACAMILCIVMTAPYATEALTCGQVSGSLASCISYLK-GAPGPSGACCGGIKRLNGMA  66

Query  257  PTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             T  DR+TAC CLK  AA    I   +A  LP  CG+   + IS + +C  V
Sbjct  67   QTPPDRKTACGCLKSAAAAISGINYGLANALPGKCGVSIPYPISPNTDCSRV  118



>gb|ABK21290.1| unknown [Picea sitchensis]
 gb|ABK26772.1| unknown [Picea sitchensis]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAARPD  319
            + C TV   +  CLSY+ G  A+P   CC+  + L     T  DRQ AC+C+K  AA   
Sbjct  28   ISCSTVISDLVPCLSYVAGSAANPTAACCNGVKALNAAAKTTPDRQAACKCIKSAAASYK  87

Query  320  IKADVAVYLPRSCGLISSFTISRDINCQNV  409
              +  A  +P  CG+  SF IS  +NC  +
Sbjct  88   YNSGKAGKIPGLCGVSVSFPISASVNCNAI  117



>gb|KFK36763.1| lipid transfer protein [Arabis alpina]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSY-LQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA-  310
            A+ C  V+ ++A C+ Y LQGG       CC+  R L     T  DR+ AC+CLK  AA 
Sbjct  26   ALGCGQVNNAVAPCIGYILQGGAIT--SGCCNGVRGLNNAARTTPDRKAACQCLKNAAAA  83

Query  311  -RPDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              P + A  A  LPR+CG+   F IS   NC 
Sbjct  84   LGPGLNAGRAAGLPRACGVSVPFPISTSTNCN  115



>sp|Q43766.1|NLTP3_HORVU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; AltName: Full=CW-19; AltName: Full=CW-20; Short=CW20; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA48623.1| Cw-19 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (50%), Gaps = 4/117 (3%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA A+ + + A++AA+ L     A+ C  V  +++ C+SY +G  A PP+ CC   + 
Sbjct  1    MARAAATQLVLVAMVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKR  60

Query  242  LLRYTPTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC CLK +A     I       +P  CG+   F IS   +C  V
Sbjct  61   LAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKV  117



>gb|ABB90546.1| lipid transfer protein [Triticum aestivum]
 gb|ABF14725.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = +2

Query  71   MNRAMASAIFMAAVLAALRL---GQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRN  241
            M RA A+ + +  ++AA+ L     A+ C  V  +++ C+SY +G  + PP  CC   R+
Sbjct  1    MARAAAAQLVLFTLVAAMVLTATDAAISCGQVSSALSPCISYARGSGSSPPAACCSGVRS  60

Query  242  LLRYTPTKQDRQTACECLKVIAARPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            L     +  D+Q AC+C+K  A    + A  A  +P  CG+   + IS  ++C  +
Sbjct  61   LAGAARSTADKQAACKCIKSAAG--GLNAGKAAGIPSKCGVSIPYAISSSVDCSKI  114



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = +2

Query  95   IFMAAVLAA--LRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            +F+A ++ A  +    A+ C  V  ++A C+ Y+  G A PP  CC+  RNL     T  
Sbjct  10   LFLACMIVAGPITANAALSCGAVSSNLAPCIGYVMQGGAIPP-ACCNGVRNLNSMARTTP  68

Query  269  DRQTACECLKVIAAR--PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            DRQ AC C++ +A      + A  A  +P+SCG+   + IS   NC+ V
Sbjct  69   DRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTV  117



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = +2

Query  107  AVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTAC  286
            AV+    L +A+ C  V  S+A C++YL+ G A P   CC+  R+L     T  DRQ AC
Sbjct  14   AVVVGAPLAEAITCGQVSSSVAPCINYLKVGGAVP-AACCNGVRSLNSAAKTTADRQAAC  72

Query  287  ECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
             CLK  +A    I   +A  LP  CG+   + IS   NC 
Sbjct  73   NCLKTASASIKGINLSLAAGLPGKCGVSVPYKISPSTNCN  112



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 4/127 (3%)
 Frame = +2

Query  32   QAKLKLYTKIKATMNRAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHP  211
            +    L   I A+M   +A  + M  ++ A     A+ C TV  S+A C+ YL+GG   P
Sbjct  48   KTHFSLQRNIMASMK--VACVLLMMCIIVAPMAEAAITCGTVTGSLAPCIGYLKGGSG-P  104

Query  212  PMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARPDIKADVAVYLPRSCGLISSFTISR  388
               CC   + L     T  DRQ AC CLK  A A   +  ++A  LP  CG+   + IS 
Sbjct  105  SAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAISGLNPNIAAGLPGKCGVNIPYKIST  164

Query  389  DINCQNV  409
              NC  +
Sbjct  165  STNCATI  171



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 50/107 (47%), Gaps = 2/107 (2%)
 Frame = +2

Query  92   AIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQD  271
            A+ M  V+ A     A+ C TV   +A C+ YL GG A P   CC   + LL   PT  D
Sbjct  11   ALVMCMVVIAPMAEAAVSCGTVTGDLAPCIPYLTGG-AGPTDSCCAGVKKLLAAAPTTAD  69

Query  272  RQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            RQ AC CLK  A    ++    A  LP  C +   + IS   NC  +
Sbjct  70   RQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTI  116



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 58/111 (52%), Gaps = 4/111 (4%)
 Frame = +2

Query  83   MASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPT  262
            + SA+ +  ++      QA+ C  V  S+A C+ +L+ G    PM CC+  R+L     T
Sbjct  6    LVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSG-GPIPMPCCNGVRSLNAAART  64

Query  263  KQDRQTACECLKVIAAR--PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              DRQTAC CLK  AAR  P +  + A  LP +CG+   + IS   +C  V
Sbjct  65   TPDRQTACNCLKQ-AARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = +2

Query  77   RAMASAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYT  256
            + + S + +  VL+  +    + C TV   +  CL+Y+  G  + P ECC+  ++L+   
Sbjct  47   KFLLSFLLICLVLSPPQARAVITCDTVFNDLKPCLNYVLVG-GNVPAECCNGLKSLIVKA  105

Query  257  PTKQDRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             T  DRQ+ C CLK +A    D + D A  LP  CG+   F ISRD++C  V
Sbjct  106  ITTADRQSICSCLKSLATTATDEQVDRAASLPGKCGVKVPFKISRDVDCTKV  157



>gb|KFK29949.1| hypothetical protein AALP_AA7G198800 [Arabis alpina]
Length=113

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query  119  ALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLK  298
            A   G+A+ C  V++ +A CL+YL+ G A P + CC    +L    P   D+Q AC CLK
Sbjct  16   AYHEGEAIVCSQVNMFLAPCLTYLKAGGA-PSVPCCGGLNSLKNAAPGIADKQAACNCLK  74

Query  299  VIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +A+  P I  D A  LP  CG+      ++ ++C ++
Sbjct  75   NVASTIPGINDDNAKQLPAKCGVDLGVPFTKTVDCNSI  112



>ref|XP_009607362.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=116

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 4/94 (4%)
 Frame = +2

Query  134  QAMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA  310
            QA+ C  VD ++A C+ YL QGG   P   CC   +NL     T  DR+TAC C+K  A 
Sbjct  23   QAITCGQVDAALAPCVPYLTQGG--EPGAACCSGVKNLKGMAATTDDRRTACNCVKAAAN  80

Query  311  R-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            R  ++K D A  L   CG+     +S+ I+C  +
Sbjct  81   RYTNLKDDAAQALASKCGVAMDVPVSKTIDCDTI  114



>ref|XP_009372014.1| PREDICTED: non-specific lipid-transfer protein-like [Pyrus x 
bretschneideri]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             + A+  A+ +  A+ C  V  ++ +C+ Y++ G A PP  CC+  R +     T  DRQ
Sbjct  11   LVVALCMAVSVAHAITCGQVTSNLGACIGYVKNGGAVPP-ACCNGIRTVNGLARTTADRQ  69

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            T C CLK +A     +  + A  LP  CG+   F IS   NC  V
Sbjct  70   TTCNCLKSLAGSIKGVNPNNAATLPAKCGVNVPFKISISTNCATV  114



>ref|XP_008342316.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=117

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = +2

Query  146  CHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-PDI  322
            C     S+  CL YL  G   PP+ CC     L + T T +DR+TAC+CL   A +  DI
Sbjct  28   CQQAMSSVTPCLQYLTSGSGTPPVACCSGVSGLRQLTQTTEDRRTACQCLMDAANQNQDI  87

Query  323  KADVAVYLPRSCGLISSFTISRDINCQNV  409
            K   A  LP +C +  +  ISR ++C N+
Sbjct  88   KEAAAXGLPAACRVQINVPISRSVDCNNI  116



>ref|XP_007141468.1| hypothetical protein PHAVU_008G198400g [Phaseolus vulgaris]
 gb|ESW13462.1| hypothetical protein PHAVU_008G198400g [Phaseolus vulgaris]
Length=117

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 1/99 (1%)
 Frame = +2

Query  110  VLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
             LAA    +A++C      ++ CL YL    + P   CC     L+  TPTK+++  AC+
Sbjct  18   TLAATEPPKALNCEQTKSLMSPCLDYLTKKTSTPSTPCCLGLNKLIVSTPTKEEKCAACK  77

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
            CLK  A+  P++  D A  LP+ C +   + IS+D +C+
Sbjct  78   CLKGEASHIPNLDVDRANSLPKVCKINVDYPISKDFDCE  116



>gb|AAB70538.1| lipid transfer protein [Oryza sativa Indica Group]
Length=115

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V+ +++ CLSY +GG + P   CC   RNL     T  DR+TAC CLK +A    
Sbjct  25   ISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRNLNSAATTTADRRTACNCLKNVAGSIS  83

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             + A  A  +P  CG+   +TIS  + C +V
Sbjct  84   GLNAGNAASIPSKCGVSIPYTISPSVYCSSV  114



>ref|XP_006836299.1| hypothetical protein AMTR_s00092p00020690 [Amborella trichopoda]
 gb|ERM99152.1| hypothetical protein AMTR_s00092p00020690 [Amborella trichopoda]
Length=114

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +2

Query  119  ALRLG---QAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACE  289
            A +LG   +A+DC  V  S+  C++YL G    P   CC   ++L +   T  D++ AC+
Sbjct  15   AYQLGHQARAIDCTAVTESLVQCVTYLTGAADQPAAACCSGMKHLTQIAATVADKRAACD  74

Query  290  CLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINC  400
            C+K  A R  +IK + A  LP +CG+  S  IS + +C
Sbjct  75   CIKKEAERFHNIKEEAATKLPGACGVTISVPISPNTDC  112



>gb|EMT31304.1| Non-specific lipid-transfer protein 3 [Aegilops tauschii]
Length=117

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 44/90 (49%), Gaps = 1/90 (1%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-  313
            A+ C  V  +IA C+SY  G  + P   CC   R L     T  DRQ AC CLK +A   
Sbjct  25   AVTCGDVTSAIAPCMSYATGQASSPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSF  84

Query  314  PDIKADVAVYLPRSCGLISSFTISRDINCQ  403
              I    A  +P  CG+  SF I+ ++NC 
Sbjct  85   KGISMGNAANIPGECGVSVSFPINNNVNCD  114



>ref|XP_010509136.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010509137.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Camelina sativa]
Length=118

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +2

Query  95   IFMAAVLAA--LRLGQAMDCHTVDISIASCLSY-LQGGVAHPPMECCDSFRNLLRYTPTK  265
            +F+A ++ A  +    A+ C  V  ++A C+ Y +QGGV  P   CC+  RNL     T 
Sbjct  10   LFLACMIVAGPITANAALSCGAVSSNLAPCIGYVMQGGVIPP--ACCNGVRNLNSMARTT  67

Query  266  QDRQTACECLKVIAAR--PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             DRQ AC C++ +A      + A  A  +P+SCG+   + IS   NC+ V
Sbjct  68   PDRQQACNCIQSVARNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTV  117



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAAR-P  316
            + C  V  S+A C+ Y++GG A PP  CC+  RN+     T  DR+TAC CLK ++    
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS  59

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             +  + A  LP  CG+   + IS   NC  V
Sbjct  60   GVNPNNAAALPGKCGVNIPYKISASTNCATV  90



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = +2

Query  95   IFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDR  274
            +F + +L++L+   A  C TV  S+  CL+YL+ G    P  CC   ++L     T  DR
Sbjct  14   MFSSILLSSLQAEAAFSCGTVVSSLTPCLTYLKSG-GSVPTTCCSGVKSLNAAAKTTPDR  72

Query  275  QTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            QTAC C+K  AA    +K ++A  LP  CG+   + IS   +C  V
Sbjct  73   QTACNCMKNAAAGITGLKLELAGSLPTKCGVNIPYKISPSTDCSKV  118



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query  140  MDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIA-ARP  316
            + C  V  +++SCL YL+ G A PP  CC   +NL     T  DRQ AC+CLK  + + P
Sbjct  29   ITCGQVSSALSSCLGYLKNGGAVPP-GCCSGIKNLNSAAQTTADRQAACKCLKTFSNSIP  87

Query  317  DIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             I   +A  LP  CG+   + IS   +C  V
Sbjct  88   GINLGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  98   FMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQDRQ  277
             + A+  A+ +  A+ C  V  S+A C++Y +GG   PP  CC+  R +     T  DRQ
Sbjct  11   LVVALSMAVSVAHAITCGQVTSSLAPCINYAKGGGVVPP-ACCNGIRTINGIARTTADRQ  69

Query  278  TACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
             AC CLK +A     +  + A  LP  CG+   + IS   NC  V
Sbjct  70   AACNCLKNLAGSIRGVNPNNAAALPGKCGVNVPYKISTSTNCATV  114



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +2

Query  137  AMDCHTVDISIASCLSYL-QGGVAHPPMECCDSFRNLLRYTPTKQDRQTACECLKVIAA-  310
            A+ C TV+ ++A C+ Y+ QGG    P  CC     L     T  DRQ AC CLK  A+ 
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGPL--PGACCTGVSKLNSMARTTPDRQQACRCLKTAASA  83

Query  311  -RPDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
              P + A  A  +P++CG+   F IS + NC +V
Sbjct  84   LGPSLNAGRAAGIPKACGVSVPFPISTNTNCNSV  117



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 54/108 (50%), Gaps = 2/108 (2%)
 Frame = +2

Query  89   SAIFMAAVLAALRLGQAMDCHTVDISIASCLSYLQGGVAHPPMECCDSFRNLLRYTPTKQ  268
            S + +  ++ AL + QA+ C  V  +I+ C++Y++ G A P   CC   RNL     T  
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP-APCCSGIRNLNGMAKTTA  68

Query  269  DRQTACECLKVIAAR-PDIKADVAVYLPRSCGLISSFTISRDINCQNV  409
            DRQ  C CLK  A     +  ++A  LP  CG+   + IS   NC  V
Sbjct  69   DRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 820624058880