BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24677_g1_i2 len=983 path=[1451:0-99 3605:100-106 1555:107-125
1574:126-178 1627:179-197 1646:198-203 319:204-250 3658:251-253
1700:254-286 388:287-316 1762:317-363 1809:364-374 1820:375-466
1911:467-470 58:471-536 1980:537-585 2029:586-655 2099:656-716
2160:717-982]

Length=983
                                                                      Score     E

ref|XP_009627921.1|  PREDICTED: uncharacterized protein LOC104118395    215   5e-65   
ref|XP_009794767.1|  PREDICTED: uncharacterized protein LOC104241517    211   7e-64   
ref|XP_006339001.1|  PREDICTED: uncharacterized protein LOC102585649    206   7e-62   
ref|XP_004249554.1|  PREDICTED: uncharacterized protein LOC101267755    204   6e-61   
ref|XP_009613648.1|  PREDICTED: uncharacterized protein LOC104106740    203   1e-60   
ref|XP_009783756.1|  PREDICTED: uncharacterized protein LOC104232282    203   1e-60   
emb|CDP06536.1|  unnamed protein product                                196   8e-58   
ref|XP_007026832.1|  PAR1 protein                                       192   1e-56   
ref|XP_007207936.1|  hypothetical protein PRUPE_ppa017583mg             192   3e-56   
ref|XP_010262709.1|  PREDICTED: uncharacterized protein LOC104601167    191   7e-56   
ref|XP_004302677.1|  PREDICTED: uncharacterized protein LOC101299015    190   2e-55   
ref|XP_002309105.2|  hypothetical protein POPTR_0006s09540g             189   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002276542.1|  PREDICTED: uncharacterized protein LOC100246012    189   3e-55   Vitis vinifera
ref|XP_009787582.1|  PREDICTED: uncharacterized protein LOC104235494    189   3e-55   
ref|XP_011019183.1|  PREDICTED: uncharacterized protein LOC105121988    188   7e-55   
ref|XP_011012958.1|  PREDICTED: uncharacterized protein LOC105117111    188   8e-55   
ref|XP_008388101.1|  PREDICTED: uncharacterized protein LOC103450515    188   9e-55   
ref|XP_010101846.1|  hypothetical protein L484_023636                   187   1e-54   
gb|KHG02999.1|  ATP-dependent RNA helicase dbp6                         187   1e-54   
ref|XP_008239896.1|  PREDICTED: uncharacterized protein LOC103338466    187   3e-54   
ref|XP_002323542.2|  hypothetical protein POPTR_0016s11600g             186   3e-54   Populus trichocarpa [western balsam poplar]
gb|KHN12948.1|  hypothetical protein glysoja_042216                     186   4e-54   
ref|NP_001242705.1|  uncharacterized protein LOC100815307 precursor     186   8e-54   
gb|KHN27004.1|  hypothetical protein glysoja_040812                     185   1e-53   
gb|KHF97273.1|  hypothetical protein F383_36747                         185   1e-53   
gb|EYU41813.1|  hypothetical protein MIMGU_mgv1a014652mg                184   2e-53   
ref|XP_011008006.1|  PREDICTED: uncharacterized protein LOC105113506    184   2e-53   
ref|NP_001238081.1|  uncharacterized protein LOC100500181 precursor     184   4e-53   
ref|XP_009358815.1|  PREDICTED: uncharacterized protein LOC103949427    184   4e-53   
ref|XP_006429255.1|  hypothetical protein CICLE_v10012857mg             184   5e-53   
ref|XP_006349478.1|  PREDICTED: uncharacterized protein LOC102591129    183   8e-53   
ref|XP_004506651.1|  PREDICTED: uncharacterized protein LOC101492243    182   2e-52   
gb|KDP24516.1|  hypothetical protein JCGZ_25080                         181   4e-52   
gb|EYU26632.1|  hypothetical protein MIMGU_mgv1a014768mg                179   3e-51   
gb|AFK35102.1|  unknown                                                 177   1e-50   
gb|KHG11879.1|  uncharacterized protein F383_20075                      178   1e-50   
ref|XP_010256734.1|  PREDICTED: uncharacterized protein LOC104597044    177   2e-50   
ref|XP_004137744.1|  PREDICTED: uncharacterized protein LOC101218677    177   2e-50   
ref|XP_008442484.1|  PREDICTED: uncharacterized protein LOC103486338    177   2e-50   
ref|XP_010044045.1|  PREDICTED: uncharacterized protein LOC104433099    177   2e-50   
ref|XP_003604797.1|  hypothetical protein MTR_4g018880                  176   3e-50   
gb|KEH23077.1|  PAR1 protein                                            176   4e-50   
ref|XP_004249680.1|  PREDICTED: uncharacterized protein LOC101253546    175   1e-49   
ref|XP_010046385.1|  PREDICTED: uncharacterized protein LOC104435305    175   1e-49   
ref|XP_011078704.1|  PREDICTED: uncharacterized protein LOC105162404    174   1e-49   
gb|EYU27489.1|  hypothetical protein MIMGU_mgv1a014649mg                174   2e-49   
ref|XP_003604795.1|  hypothetical protein MTR_4g018860                  176   2e-49   
ref|XP_007133951.1|  hypothetical protein PHAVU_010G006000g             174   2e-49   
ref|XP_011073213.1|  PREDICTED: uncharacterized protein LOC105158236    174   2e-49   
ref|XP_010553064.1|  PREDICTED: uncharacterized protein LOC104823275    174   2e-49   
ref|XP_011077605.1|  PREDICTED: uncharacterized protein LOC105161572    174   2e-49   
gb|AFK48062.1|  unknown                                                 174   4e-49   
ref|XP_011094948.1|  PREDICTED: uncharacterized protein LOC105174517    173   4e-49   
ref|XP_011073217.1|  PREDICTED: uncharacterized protein LOC105158241    172   6e-49   
gb|ABK26953.1|  unknown                                                 173   9e-49   Picea sitchensis
ref|XP_010905376.1|  PREDICTED: uncharacterized protein LOC105032593    172   3e-48   
gb|ABK26944.1|  unknown                                                 172   4e-48   Picea sitchensis
ref|XP_009370270.1|  PREDICTED: uncharacterized protein LOC103959642    171   5e-48   
ref|XP_009388026.1|  PREDICTED: uncharacterized protein LOC103974853    170   5e-48   
ref|XP_011073214.1|  PREDICTED: uncharacterized protein LOC105158237    170   5e-48   
ref|XP_009370269.1|  PREDICTED: uncharacterized protein LOC103959641    171   6e-48   
ref|XP_003604794.1|  hypothetical protein MTR_4g018850                  171   7e-48   
ref|XP_010908211.1|  PREDICTED: uncharacterized protein LOC105034670    171   7e-48   
ref|XP_011073208.1|  PREDICTED: uncharacterized protein LOC105158231    170   8e-48   
ref|XP_006488680.1|  PREDICTED: uncharacterized protein DDB_G0271...    171   9e-48   
ref|XP_008811495.1|  PREDICTED: uncharacterized protein LOC103722643    170   9e-48   
ref|XP_011073219.1|  PREDICTED: uncharacterized protein LOC105158242    169   1e-47   
ref|XP_011073211.1|  PREDICTED: uncharacterized protein LOC105158234    169   2e-47   
ref|XP_010923167.1|  PREDICTED: uncharacterized protein LOC105046...    169   2e-47   
ref|XP_006848036.1|  hypothetical protein AMTR_s00029p00186810          169   3e-47   
ref|XP_007143423.1|  hypothetical protein PHAVU_007G071100g             169   3e-47   
gb|ABK21049.1|  unknown                                                 169   3e-47   Picea sitchensis
ref|XP_011081437.1|  PREDICTED: uncharacterized protein LOC105164481    168   3e-47   
ref|XP_010039173.1|  PREDICTED: uncharacterized protein LOC104427850    171   4e-47   
gb|KDP46577.1|  hypothetical protein JCGZ_08549                         168   5e-47   
ref|XP_006361911.1|  PREDICTED: uncharacterized protein LOC102603240    168   6e-47   
ref|XP_011073221.1|  PREDICTED: uncharacterized protein LOC105158244    167   7e-47   
gb|KCW49488.1|  hypothetical protein EUGRSUZ_K03007                     170   8e-47   
ref|XP_011073216.1|  PREDICTED: uncharacterized protein LOC105158240    167   1e-46   
ref|XP_008798941.1|  PREDICTED: uncharacterized protein LOC103713707    167   1e-46   
ref|XP_011094949.1|  PREDICTED: uncharacterized protein LOC105174518    167   1e-46   
ref|XP_008239908.1|  PREDICTED: uncharacterized protein LOC103338475    174   1e-46   
ref|XP_004234399.1|  PREDICTED: uncharacterized protein LOC101252465    167   1e-46   
ref|XP_010490608.1|  PREDICTED: uncharacterized protein LOC104768360    167   2e-46   
ref|XP_006288746.1|  hypothetical protein CARUB_v10002062mg             166   3e-46   
gb|AFK41674.1|  unknown                                                 167   3e-46   
ref|XP_006353293.1|  PREDICTED: uncharacterized protein LOC102592141    166   3e-46   
ref|XP_009604561.1|  PREDICTED: uncharacterized protein LOC104099311    166   4e-46   
ref|XP_010423911.1|  PREDICTED: uncharacterized protein LOC104708952    165   6e-46   
ref|XP_009421325.1|  PREDICTED: uncharacterized protein LOC104000897    165   6e-46   
emb|CAA58731.1|  PAR-1b                                                 165   7e-46   Nicotiana tabacum [American tobacco]
ref|XP_002322474.1|  hypothetical protein POPTR_0015s13050g             165   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011073222.1|  PREDICTED: uncharacterized protein LOC105158245    164   8e-46   
ref|XP_011073223.1|  PREDICTED: uncharacterized protein LOC105158246    164   1e-45   
ref|XP_010553262.1|  PREDICTED: uncharacterized protein LOC104823394    164   1e-45   
ref|XP_002279995.1|  PREDICTED: uncharacterized protein LOC100267406    164   1e-45   Vitis vinifera
ref|NP_001241627.1|  uncharacterized protein LOC100787709 precursor     165   1e-45   
ref|XP_009770389.1|  PREDICTED: uncharacterized protein LOC104221096    164   1e-45   
ref|XP_011094947.1|  PREDICTED: uncharacterized protein LOC105174516    164   1e-45   
ref|XP_004234398.1|  PREDICTED: uncharacterized protein LOC101252153    164   1e-45   
ref|XP_010326144.1|  PREDICTED: uncharacterized protein LOC101261443    164   1e-45   
ref|XP_011073210.1|  PREDICTED: uncharacterized protein LOC105158233    164   1e-45   
ref|XP_009590873.1|  PREDICTED: uncharacterized protein LOC104087977    165   2e-45   
ref|XP_009599617.1|  PREDICTED: uncharacterized protein LOC104095236    164   2e-45   
ref|XP_002510782.1|  conserved hypothetical protein                     164   2e-45   Ricinus communis
gb|KHF98264.1|  Cytosolic beta-glucosidase                              164   2e-45   
ref|XP_011073220.1|  PREDICTED: uncharacterized protein LOC105158243    163   2e-45   
ref|XP_009139267.1|  PREDICTED: uncharacterized protein LOC103863264    164   3e-45   
ref|XP_002267610.1|  PREDICTED: uncharacterized protein LOC100251502    164   3e-45   Vitis vinifera
emb|CAA58733.1|  PAR-1a                                                 163   3e-45   Nicotiana tabacum [American tobacco]
ref|XP_010035143.1|  PREDICTED: uncharacterized protein LOC104424423    163   3e-45   
ref|XP_003592283.1|  PAR-1a protein                                     164   3e-45   
ref|XP_011048721.1|  PREDICTED: uncharacterized protein LOC105142675    164   4e-45   
ref|XP_006363092.1|  PREDICTED: uncharacterized protein LOC102590619    162   4e-45   
ref|XP_009103899.1|  PREDICTED: uncharacterized protein LOC103829...    162   8e-45   
ref|XP_004496561.1|  PREDICTED: uncharacterized protein LOC101495651    163   8e-45   
ref|XP_003555381.1|  PREDICTED: uncharacterized protein LOC100784217    162   8e-45   
ref|XP_010662746.1|  PREDICTED: uncharacterized protein LOC100254...    162   9e-45   
ref|XP_006363091.1|  PREDICTED: uncharacterized protein LOC102590281    162   1e-44   
ref|XP_008377489.1|  PREDICTED: uncharacterized protein LOC103440565    162   1e-44   
ref|XP_011073212.1|  PREDICTED: uncharacterized protein LOC105158235    161   1e-44   
ref|XP_009763985.1|  PREDICTED: uncharacterized protein LOC104215...    163   1e-44   
gb|AFK34890.1|  unknown                                                 162   1e-44   
ref|XP_010427069.1|  PREDICTED: uncharacterized protein LOC104711981    162   1e-44   
ref|XP_006421929.1|  hypothetical protein CICLE_v10005988mg             162   1e-44   
emb|CDY13179.1|  BnaC04g26560D                                          162   1e-44   
emb|CDY66558.1|  BnaC08g48820D                                          162   1e-44   
emb|CDY60770.1|  BnaAnng17210D                                          162   1e-44   
gb|KDP22273.1|  hypothetical protein JCGZ_26104                         161   2e-44   
ref|XP_011045688.1|  PREDICTED: uncharacterized protein LOC105140517    160   2e-44   
gb|KEH26321.1|  PAR1 protein                                            162   2e-44   
ref|XP_008785460.1|  PREDICTED: uncharacterized protein LOC103704086    161   2e-44   
ref|XP_010662745.1|  PREDICTED: uncharacterized protein LOC100254...    161   2e-44   
ref|XP_008376590.1|  PREDICTED: uncharacterized protein LOC103439761    161   2e-44   
ref|XP_002267611.1|  PREDICTED: uncharacterized protein LOC100254...    161   3e-44   Vitis vinifera
emb|CBI22723.3|  unnamed protein product                                161   4e-44   
emb|CAA58732.1|  PAR-1c                                                 160   4e-44   Nicotiana tabacum [American tobacco]
ref|XP_010035141.1|  PREDICTED: uncharacterized protein LOC104424421    160   4e-44   
ref|XP_010035139.1|  PREDICTED: uncharacterized protein LOC104424419    160   4e-44   
gb|EPS70832.1|  hypothetical protein M569_03929                         160   5e-44   
ref|XP_010035142.1|  PREDICTED: uncharacterized protein LOC104424422    160   5e-44   
emb|CDY07560.1|  BnaC06g15040D                                          160   5e-44   
ref|XP_010515917.1|  PREDICTED: uncharacterized protein LOC104791676    160   6e-44   
ref|XP_011030114.1|  PREDICTED: uncharacterized protein LOC105129658    160   6e-44   
ref|XP_010035140.1|  PREDICTED: uncharacterized protein LOC104424420    160   7e-44   
ref|XP_009342968.1|  PREDICTED: uncharacterized protein LOC103934926    160   8e-44   
ref|XP_009340031.1|  PREDICTED: uncharacterized protein LOC103932...    160   8e-44   
ref|XP_011073209.1|  PREDICTED: uncharacterized protein LOC105158232    159   1e-43   
ref|XP_002318235.1|  hypothetical protein POPTR_0012s13140g             159   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006587314.1|  PREDICTED: uncharacterized protein LOC100778782    159   2e-43   
ref|XP_011073591.1|  PREDICTED: uncharacterized protein LOC105158505    159   2e-43   
ref|XP_008370129.1|  PREDICTED: uncharacterized protein LOC103433639    160   2e-43   
ref|XP_002520453.1|  conserved hypothetical protein                     158   3e-43   Ricinus communis
gb|KEH28949.1|  PAR1 protein                                            156   3e-43   
gb|AAM62984.1|  photoassimilate-responsive protein PAR-like protein     158   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200052.1|  PAR1 protein                                          158   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291916.1|  hypothetical protein CARUB_v10018100mg             157   5e-43   
emb|CDP05191.1|  unnamed protein product                                158   5e-43   
ref|XP_004246366.2|  PREDICTED: uncharacterized protein LOC101261147    157   5e-43   
ref|XP_004230259.1|  PREDICTED: uncharacterized protein LOC101259981    159   8e-43   
ref|XP_006827667.1|  hypothetical protein AMTR_s00009p00254330          157   9e-43   
ref|XP_007038703.1|  PAR1 protein                                       157   9e-43   
emb|CDX76173.1|  BnaA04g04370D                                          157   9e-43   
gb|EYU25099.1|  hypothetical protein MIMGU_mgv1a014446mg                157   1e-42   
ref|XP_009139268.1|  PREDICTED: uncharacterized protein LOC103863265    156   1e-42   
ref|XP_002865911.1|  hypothetical protein ARALYDRAFT_918281             157   2e-42   
ref|NP_190972.1|  PAR1 protein                                          156   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424982.1|  hypothetical protein CICLE_v10029842mg             155   3e-42   
ref|XP_009774343.1|  PREDICTED: uncharacterized protein LOC104224406    155   3e-42   
ref|XP_004308085.1|  PREDICTED: uncharacterized protein LOC101293047    155   4e-42   
ref|XP_010060939.1|  PREDICTED: uncharacterized protein LOC104448745    155   5e-42   
ref|XP_010923168.1|  PREDICTED: uncharacterized protein LOC105046...    155   6e-42   
ref|XP_010452028.1|  PREDICTED: uncharacterized protein LOC104734198    154   9e-42   
ref|XP_002862543.1|  hypothetical protein ARALYDRAFT_920570             154   1e-41   
ref|XP_009127249.1|  PREDICTED: uncharacterized protein LOC103852106    155   1e-41   
ref|XP_002877953.1|  hypothetical protein ARALYDRAFT_485800             154   2e-41   
ref|XP_011032296.1|  PREDICTED: uncharacterized protein LOC105131158    154   2e-41   
ref|XP_011076161.1|  PREDICTED: uncharacterized protein LOC105160472    154   2e-41   
emb|CDP09133.1|  unnamed protein product                                153   2e-41   
ref|XP_011085664.1|  PREDICTED: uncharacterized protein LOC105167590    155   2e-41   
ref|XP_004240617.1|  PREDICTED: uncharacterized protein LOC101257567    153   3e-41   
ref|XP_010273059.1|  PREDICTED: uncharacterized protein LOC104608702    154   3e-41   
ref|XP_008794209.1|  PREDICTED: uncharacterized protein LOC103710316    153   4e-41   
ref|XP_009599697.1|  PREDICTED: uncharacterized protein LOC104095302    152   4e-41   
ref|XP_009601817.1|  PREDICTED: uncharacterized protein LOC104097019    152   6e-41   
ref|XP_010671872.1|  PREDICTED: uncharacterized protein LOC104888551    154   7e-41   
ref|XP_010255407.1|  PREDICTED: uncharacterized protein LOC104596084    152   7e-41   
ref|XP_006358715.1|  PREDICTED: uncharacterized protein LOC102594490    152   8e-41   
ref|XP_006388430.1|  hypothetical protein POPTR_0187s00200g             152   8e-41   
ref|XP_008778806.1|  PREDICTED: uncharacterized protein LOC103698551    152   1e-40   
ref|XP_010909892.1|  PREDICTED: uncharacterized protein LOC105035875    151   2e-40   
ref|XP_007218440.1|  hypothetical protein PRUPE_ppa011685mg             151   2e-40   
emb|CDY60088.1|  BnaC02g45000D                                          151   3e-40   
ref|XP_010529780.1|  PREDICTED: uncharacterized protein LOC104806532    150   3e-40   
ref|XP_010909577.1|  PREDICTED: uncharacterized protein LOC105035650    150   6e-40   
gb|AFG47187.1|  hypothetical protein 0_8609_01                          148   7e-40   
gb|ABK24725.1|  unknown                                                 149   8e-40   Picea sitchensis
gb|AFG47186.1|  hypothetical protein 0_8609_01                          148   8e-40   
ref|XP_010482600.1|  PREDICTED: uncharacterized protein LOC104761...    149   9e-40   
emb|CDY27075.1|  BnaA02g10950D                                          155   1e-39   
ref|XP_010923169.1|  PREDICTED: uncharacterized protein LOC105046...    149   1e-39   
gb|EYU38454.1|  hypothetical protein MIMGU_mgv1a024144mg                149   1e-39   
ref|XP_010923170.1|  PREDICTED: uncharacterized protein LOC105046...    148   1e-39   
ref|XP_010482599.1|  PREDICTED: uncharacterized protein LOC104761...    149   1e-39   
ref|XP_008234242.1|  PREDICTED: uncharacterized protein LOC103333213    149   2e-39   
gb|KDO52035.1|  hypothetical protein CISIN_1g029827mg                   147   3e-39   
gb|KFK26839.1|  hypothetical protein AALP_AA8G300600                    148   4e-39   
ref|XP_006401831.1|  hypothetical protein EUTSA_v10014733mg             148   4e-39   
gb|AFG47202.1|  hypothetical protein 0_8609_01                          146   4e-39   
ref|XP_009763986.1|  PREDICTED: uncharacterized protein LOC104215...    148   5e-39   
ref|XP_009629076.1|  PREDICTED: uncharacterized protein LOC104119315    147   6e-39   
gb|ABK22647.1|  unknown                                                 147   9e-39   Picea sitchensis
ref|XP_006281102.1|  hypothetical protein CARUB_v10027132mg             147   1e-38   
gb|ABK27044.1|  unknown                                                 146   2e-38   Picea sitchensis
ref|XP_006358727.1|  PREDICTED: uncharacterized protein LOC102598423    146   2e-38   
ref|XP_010671873.1|  PREDICTED: uncharacterized protein LOC104888552    146   3e-38   
ref|XP_002314136.2|  hypothetical protein POPTR_0009s04480g             145   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008439231.1|  PREDICTED: uncharacterized protein LOC103484081    145   3e-38   
ref|XP_010444786.1|  PREDICTED: uncharacterized protein LOC104727386    144   9e-38   
ref|XP_009103900.1|  PREDICTED: uncharacterized protein LOC103829...    144   1e-37   
ref|XP_010255408.1|  PREDICTED: uncharacterized protein LOC104596085    143   2e-37   
ref|XP_006388432.1|  hypothetical protein POPTR_0187s00220g             143   2e-37   
emb|CDY13175.1|  BnaC04g26600D                                          144   2e-37   
ref|XP_008806881.1|  PREDICTED: uncharacterized protein LOC103719421    143   2e-37   
ref|XP_010934761.1|  PREDICTED: uncharacterized protein LOC105054842    144   4e-37   
ref|XP_006388431.1|  hypothetical protein POPTR_0187s00210g             142   6e-37   
ref|XP_004157197.1|  PREDICTED: uncharacterized protein LOC101225828    142   9e-37   
ref|XP_010537178.1|  PREDICTED: LOW QUALITY PROTEIN: sulfated sur...    142   1e-36   
ref|XP_007152257.1|  hypothetical protein PHAVU_004G1144000g            139   1e-36   
ref|XP_004140776.1|  PREDICTED: uncharacterized protein LOC101216404    141   1e-36   
ref|XP_009788534.1|  PREDICTED: uncharacterized protein LOC104236325    139   5e-36   
ref|XP_006403624.1|  hypothetical protein EUTSA_v10010808mg             138   5e-36   
ref|XP_010504193.1|  PREDICTED: uncharacterized protein LOC104781266    138   6e-36   
ref|XP_010040888.1|  PREDICTED: uncharacterized protein LOC104429762    138   3e-35   
ref|XP_006848035.1|  hypothetical protein AMTR_s00029p00186480          135   6e-35   
ref|XP_001775001.1|  predicted protein                                  133   2e-34   
emb|CDP09132.1|  unnamed protein product                                135   2e-34   
ref|XP_008439229.1|  PREDICTED: uncharacterized protein LOC103484080    134   2e-34   
ref|XP_009420109.1|  PREDICTED: uncharacterized protein LOC103999932    135   9e-34   
ref|XP_010108343.1|  hypothetical protein L484_006498                   134   2e-33   
ref|XP_004962356.1|  PREDICTED: uncharacterized protein LOC101785352    132   3e-33   
ref|XP_002439633.1|  hypothetical protein SORBIDRAFT_09g017290          131   5e-33   Sorghum bicolor [broomcorn]
ref|XP_002971753.1|  hypothetical protein SELMODRAFT_412334             130   2e-32   
ref|XP_004140837.1|  PREDICTED: uncharacterized protein LOC101212311    130   2e-32   
ref|XP_004157223.1|  PREDICTED: uncharacterized protein LOC101232096    130   3e-32   
ref|XP_008649530.1|  PREDICTED: uncharacterized protein LOC103630240    129   3e-32   
ref|XP_002527887.1|  conserved hypothetical protein                     126   4e-32   Ricinus communis
ref|XP_002993093.1|  hypothetical protein SELMODRAFT_431237             129   7e-32   
emb|CDP09118.1|  unnamed protein product                                132   8e-32   
ref|XP_011032294.1|  PREDICTED: uncharacterized protein LOC105131157    124   1e-30   
gb|KCW44819.1|  hypothetical protein EUGRSUZ_L01611                     123   1e-30   
ref|XP_002975599.1|  hypothetical protein SELMODRAFT_103819             123   2e-30   
ref|XP_002971544.1|  hypothetical protein SELMODRAFT_412333             122   2e-29   
ref|XP_002993113.1|  hypothetical protein SELMODRAFT_48837              119   3e-29   
ref|XP_002973571.1|  hypothetical protein SELMODRAFT_99579              119   5e-29   
emb|CDP09117.1|  unnamed protein product                                119   1e-28   
gb|KGN57378.1|  hypothetical protein Csa_3G182140                       118   3e-28   
ref|XP_002300182.2|  hypothetical protein POPTR_0001s32040g             115   7e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006403623.1|  hypothetical protein EUTSA_v10011155mg             112   1e-26   
ref|XP_010058903.1|  PREDICTED: uncharacterized protein LOC104446793    112   1e-25   
gb|AFW78200.1|  hypothetical protein ZEAMMB73_055272                    110   1e-25   
ref|XP_002439897.1|  hypothetical protein SORBIDRAFT_09g022160          110   2e-25   Sorghum bicolor [broomcorn]
ref|XP_002439898.1|  hypothetical protein SORBIDRAFT_09g022170          110   2e-25   Sorghum bicolor [broomcorn]
gb|AEW08582.1|  hypothetical protein CL606Contig1_05                    102   2e-23   
gb|AFG71360.1|  hypothetical protein CL606Contig1_05                    100   2e-22   
ref|XP_008352803.1|  PREDICTED: TMV resistance protein N-like           106   2e-21   
gb|AFG71371.1|  hypothetical protein CL606Contig1_05                  97.1    2e-21   
gb|AFG71368.1|  hypothetical protein CL606Contig1_05                  97.1    2e-21   
gb|AFG71365.1|  hypothetical protein CL606Contig1_05                  95.5    7e-21   
ref|XP_002439894.1|  hypothetical protein SORBIDRAFT_09g022140        95.1    5e-20   Sorghum bicolor [broomcorn]
ref|XP_010446049.1|  PREDICTED: uncharacterized protein LOC104728819  87.8    7e-18   
gb|AFG65028.1|  hypothetical protein CL4404Contig1_01                 84.0    7e-17   
ref|XP_002439896.1|  hypothetical protein SORBIDRAFT_09g022150        84.0    7e-16   Sorghum bicolor [broomcorn]
gb|AFG70528.1|  hypothetical protein CL1287Contig1_05                 75.9    5e-14   
gb|AEW08703.1|  hypothetical protein CL1287Contig1_05                 75.5    7e-14   
gb|KHN23208.1|  hypothetical protein glysoja_042488                   74.3    3e-13   
gb|KEH23075.1|  PAR1 protein                                          63.5    2e-09   
emb|CBI16024.3|  unnamed protein product                              54.7    4e-06   
ref|XP_002439895.1|  hypothetical protein SORBIDRAFT_09g022145        53.5    1e-05   Sorghum bicolor [broomcorn]
ref|XP_011079320.1|  PREDICTED: uncharacterized protein LOC105162865  53.9    2e-05   



>ref|XP_009627921.1| PREDICTED: uncharacterized protein LOC104118395 [Nicotiana tomentosiformis]
Length=186

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 4/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS    S ++L  ACTL   G L +IICENLP N C+FS++S GKRC+LENS   +GK+
Sbjct  1    MASHMKHSSIILFFACTLFLRGALGEIICENLPTNVCSFSIASSGKRCLLENSENKDGKM  60

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            EY+CKTSEVVVG+ MAEY+ETDECV ACGV R SVG+SSD+LLE  FTAKLCSP CY NC
Sbjct  61   EYQCKTSEVVVGN-MAEYIETDECVNACGVDRNSVGISSDSLLEPQFTAKLCSPPCYQNC  119

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PN+VDLYFNLAAGEG YLPDLC K++       R MI+L
Sbjct  120  PNVVDLYFNLAAGEGVYLPDLCNKQRSS---PHRAMIEL  155



>ref|XP_009794767.1| PREDICTED: uncharacterized protein LOC104241517 [Nicotiana sylvestris]
Length=181

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 122/153 (80%), Gaps = 4/153 (3%)
 Frame = +1

Query  70   SSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKT  249
            +S ++L  ACTL   G L +IICENLP N C+FS++S GKRC+LENS  ++GK+EY+CKT
Sbjct  2    ASYMILFFACTLFLQGALGEIICENLPKNVCSFSIASSGKRCLLENSANNDGKMEYQCKT  61

Query  250  SEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDL  429
            SEVVVG+ MAEY+ETDECV ACGV R SVG+SSD+LLE  FTAKLCSP CY NCPN+VDL
Sbjct  62   SEVVVGN-MAEYIETDECVNACGVDRNSVGISSDSLLEPHFTAKLCSPPCYQNCPNVVDL  120

Query  430  YFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            YFNLAAGEG YLP+LC K++       R MI+L
Sbjct  121  YFNLAAGEGVYLPELCNKQRSS---PHRAMIEL  150



>ref|XP_006339001.1| PREDICTED: uncharacterized protein LOC102585649 [Solanum tuberosum]
Length=186

 Score =   206 bits (525),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 123/157 (78%), Gaps = 5/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK SS+ VL  A TL     L +I CENLPIN C+FS+SS GKRC+LENS  ++GK+EY
Sbjct  4    SMKHSSI-VLFFASTLFLQVALGEITCENLPINICSFSISSSGKRCLLENSANEDGKLEY  62

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +CKTSEV+V +++AEY+ETDEC+ +CGV R SVG+SSD+LLE  FTAKLCSP CY NCPN
Sbjct  63   QCKTSEVIV-ANIAEYIETDECINSCGVDRNSVGISSDSLLEPQFTAKLCSPSCYRNCPN  121

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +VDLYFNLAAGEG YLPDLC K++       R MI+L
Sbjct  122  VVDLYFNLAAGEGVYLPDLCSKQRSS---PHRAMIEL  155



>ref|XP_004249554.1| PREDICTED: uncharacterized protein LOC101267755 [Solanum lycopersicum]
Length=187

 Score =   204 bits (519),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK SS+ +L  A TL     L +I CENLP N C+FS+SS GKRC+LENS  ++GK+EY
Sbjct  4    SMKHSSI-ILFFASTLFLQVALGEITCENLPTNVCSFSISSSGKRCLLENSATEDGKLEY  62

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +CKTSEVVV +++AEY+ETDEC+ +CGV R SVG+SSD+LLE  FTAKLCSP CY NCPN
Sbjct  63   QCKTSEVVV-ANIAEYVETDECINSCGVDRNSVGISSDSLLEPQFTAKLCSPSCYRNCPN  121

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +VDLYFNLAAGEG YLPDLC K++       R MI+L
Sbjct  122  VVDLYFNLAAGEGVYLPDLCSKQRSS---PHRAMIEL  155



>ref|XP_009613648.1| PREDICTED: uncharacterized protein LOC104106740 [Nicotiana tomentosiformis]
Length=174

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 6/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK  S L+L   C+L     L +IICENLP N CAFS++S GKRC+LE S  ++GK E
Sbjct  3    SSMK--SSLILFFTCSLFLQVALGEIICENLPTNVCAFSIASSGKRCLLEKSALEDGKSE  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y+CKTSEV+VG+ M EY+ETDECV ACGV R SVG+SSD+LLEA FT+KLCSP+CY+ CP
Sbjct  61   YQCKTSEVIVGN-MREYIETDECVNACGVDRNSVGISSDSLLEAQFTSKLCSPDCYHKCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            N+VDLYFNLAAGEG YLPDLC+K++       R MI+L
Sbjct  120  NVVDLYFNLAAGEGVYLPDLCKKQRTN---PHRAMIEL  154



>ref|XP_009783756.1| PREDICTED: uncharacterized protein LOC104232282 [Nicotiana sylvestris]
Length=174

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 6/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK  S L+L   C+L     L +IICENLP N CAFS++S GKRC+LE S  ++GK E
Sbjct  3    SSMK--SSLILFFTCSLFLQVALGEIICENLPTNICAFSIASSGKRCLLEKSTLEDGKSE  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y+CKTSEV+VG+ M EY+ETDECV ACGV R SVG+SSD+LLEA FT+KLCSP+CY+ CP
Sbjct  61   YQCKTSEVIVGN-MREYIETDECVNACGVDRNSVGISSDSLLEAQFTSKLCSPDCYHKCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            N+VDLYFNLAAGEG YLPDLC+K++       R MI+L
Sbjct  120  NVVDLYFNLAAGEGVYLPDLCKKQRSN---PHRAMIEL  154



>emb|CDP06536.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 117/160 (73%), Gaps = 6/160 (4%)
 Frame = +1

Query  49   SMASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            S +S+ FS   VL  AC+L   G   +I+CE LP N C+FS++S GKRC+LEN    +GK
Sbjct  3    SSSSLTFS--FVLFFACSLFLRGTQGEIVCEELPTNVCSFSIASSGKRCLLENLKGKDGK  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
            VEY+C+TSEVVV   MAE++ETDECV ACGV R +VG+SSDA  E  FTAKLCSP CY N
Sbjct  61   VEYQCRTSEVVV-ERMAEHIETDECVSACGVDRNAVGISSDAFFEPLFTAKLCSPACYQN  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNI+DLYFNLAAGEG YLP LCEK++       R MI+L
Sbjct  120  CPNIIDLYFNLAAGEGVYLPALCEKQRSR---PHRAMIEL  156



>ref|XP_007026832.1| PAR1 protein [Theobroma cacao]
 gb|EOY07334.1| PAR1 protein [Theobroma cacao]
Length=179

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 117/159 (74%), Gaps = 7/159 (4%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS KF    V L   +L  H  LA+IICE+LP + CAFS++S GKRC+LE ++  +G V
Sbjct  1    MASFKFP---VFLFISSLFLHASLAEIICEDLPKDVCAFSIASSGKRCLLETAVVKDGNV  57

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            EY+C+TSEVVV   MAEY+E+DECV+ACGV R S+G+SSD+LLE   TAKLC+P CY  C
Sbjct  58   EYQCRTSEVVV-ERMAEYIESDECVRACGVDRSSIGISSDSLLEPQLTAKLCAPACYQKC  116

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNIVDLYFNLAAGEG +LPDLC  ++      RR M +L
Sbjct  117  PNIVDLYFNLAAGEGVFLPDLCHAQRTN---PRRTMFEL  152



>ref|XP_007207936.1| hypothetical protein PRUPE_ppa017583mg [Prunus persica]
 gb|EMJ09135.1| hypothetical protein PRUPE_ppa017583mg [Prunus persica]
Length=195

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 118/160 (74%), Gaps = 7/160 (4%)
 Frame = +1

Query  49   SMASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            ++ S KFS  L L    +L  H VL   ICE+LP + CAFSVSS GKRC+LE   K +G 
Sbjct  2    ALISTKFSLALFL---SSLCIHAVLGGFICEDLPNDVCAFSVSSAGKRCLLETMAKKDGS  58

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
            +EY+C+TSEV+V   +AEY+ETD+CVKACG+ RKSVG+SSDALLE  F  KLCSP CY  
Sbjct  59   IEYQCRTSEVLV-QGVAEYIETDQCVKACGIDRKSVGISSDALLEPQFMTKLCSPTCYQK  117

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNIV+LYFNLAAGEGA+LPDLC+K++       R M+QL
Sbjct  118  CPNIVELYFNLAAGEGAFLPDLCDKQRTN---PHRAMLQL  154



>ref|XP_010262709.1| PREDICTED: uncharacterized protein LOC104601167 [Nelumbo nucifera]
Length=191

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            S   + +L L  + ++S HGVL +IICENLP + CAFS++S G+RC+LE  + D G  EY
Sbjct  4    STTITILLPLFFSLSVSLHGVLGEIICENLPKDLCAFSIASSGQRCLLETYLTD-GTTEY  62

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +C+TS+V+V   M E++E+DECV+ACGV R SVG+SSDALLE  FTAKLCSP CY NCPN
Sbjct  63   QCRTSDVIV-ERMTEWIESDECVRACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPN  121

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            IVDLYFNLAAGEGA+LPDLC  ++       R MI+L
Sbjct  122  IVDLYFNLAAGEGAFLPDLCMAQRTN---PHRAMIEL  155



>ref|XP_004302677.1| PREDICTED: uncharacterized protein LOC101299015 [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            LVL L+ +L  H  LA  +CE+LP + CAFSVSS GKRC++E   K+NG VEY+C+TSEV
Sbjct  7    LVLFLS-SLFIHAALAAFVCEDLPNDVCAFSVSSAGKRCLIETMAKNNGNVEYQCRTSEV  65

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            +V   +AEY+ETDECV ACGV RKSVG+SSD+LLE  F +KLCSP CY  CPNIV+LYFN
Sbjct  66   MV-EGLAEYMETDECVNACGVDRKSVGISSDSLLEPQFMSKLCSPNCYQKCPNIVELYFN  124

Query  439  LAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            LAAGEG +LPDLCE+++       R MI+L
Sbjct  125  LAAGEGVFLPDLCERQRSN---PHRAMIEL  151



>ref|XP_002309105.2| hypothetical protein POPTR_0006s09540g [Populus trichocarpa]
 gb|EEE92628.2| hypothetical protein POPTR_0006s09540g [Populus trichocarpa]
Length=178

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 106/139 (76%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
               LA+I+CE LP + CAF+VSS GKRC+LE   K NG VEY+C+TSEVVV   MA+Y+E
Sbjct  18   QAALAEIVCEELPNDICAFTVSSSGKRCLLETYAKQNGAVEYQCRTSEVVV-EKMADYIE  76

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD CVKACGV R SVG+SSDALLE  FT KLCSP CY NCPNIVDLYFNLAAGEGA+LPD
Sbjct  77   TDACVKACGVDRNSVGISSDALLEPQFTGKLCSPACYQNCPNIVDLYFNLAAGEGAFLPD  136

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LC+  +       R MIQL
Sbjct  137  LCDAARYN---PHRSMIQL  152



>ref|XP_002276542.1| PREDICTED: uncharacterized protein LOC100246012 [Vitis vinifera]
 emb|CBI30454.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
             +L L  +L  H    +IICE LP + CAFS++S GKRC+LE   ++NG++EY+C+TSEV
Sbjct  12   FILFLVSSLLLHAAFGEIICEELPNDKCAFSIASSGKRCLLEKYARENGEMEYQCRTSEV  71

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            +V   M+EY+ETD+CV ACGV R SVG+SSD+LLE  FTAKLCS  CY+NCPNI+DLYFN
Sbjct  72   IV-ERMSEYIETDQCVSACGVDRSSVGISSDSLLEPQFTAKLCSSNCYHNCPNIIDLYFN  130

Query  439  LAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            LAAGEG +LPDLCE ++  + P  R M++L
Sbjct  131  LAAGEGVFLPDLCEARR--INP-HRSMVEL  157



>ref|XP_009787582.1| PREDICTED: uncharacterized protein LOC104235494 [Nicotiana sylvestris]
 dbj|BAB16427.1| NtEIG-E80 [Nicotiana tabacum]
Length=175

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 6/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +++K+S  +++  A  L   G L + ICE+LP N C F++++ GKRC+LENS  ++GKVE
Sbjct  3    STLKYS--MIIFFASALFLQGTLGNFICEDLPTNVCGFAIATSGKRCLLENSAGEDGKVE  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y+CKTSEV+VG+ M E++ETDECV ACG  R SVG+SSDALL++ FT KLCSP CY  C 
Sbjct  61   YQCKTSEVIVGN-MKEHIETDECVDACGCDRNSVGISSDALLDSQFTFKLCSPACYQKCA  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDLYFNLAAGEG YLPDLC K++       R MI+L
Sbjct  120  NIVDLYFNLAAGEGVYLPDLCNKQRTNP---HRAMIEL  154



>ref|XP_011019183.1| PREDICTED: uncharacterized protein LOC105121988 [Populus euphratica]
 ref|XP_011019184.1| PREDICTED: uncharacterized protein LOC105121988 [Populus euphratica]
Length=178

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
               LA+I+CE LP + CAF++SS GKRC+LE   K NG VEY+C+TSEVVV   MA Y+E
Sbjct  18   QAALAEIVCEELPNDVCAFTISSSGKRCLLETYAKQNGAVEYQCRTSEVVV-EKMAGYIE  76

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD CVKACGV R SVG+SSDALLE  FT KLCSP CY NCPNIVDLYFNLAAGEGA+LPD
Sbjct  77   TDACVKACGVDRNSVGISSDALLEPQFTGKLCSPACYQNCPNIVDLYFNLAAGEGAFLPD  136

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LC+  +       R MIQL
Sbjct  137  LCDAARYN---PHRSMIQL  152



>ref|XP_011012958.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
 ref|XP_011012960.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
 ref|XP_011012961.1| PREDICTED: uncharacterized protein LOC105117111 [Populus euphratica]
Length=178

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 106/139 (76%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H   A+I+CE LP + CAF++SS GKRC+LE     NG VEY+C+TSEVVV   MA+Y+E
Sbjct  18   HAASAEIVCEELPNDICAFTISSSGKRCLLETYATKNGAVEYQCRTSEVVV-EKMADYIE  76

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD CVKACGV R SVG+SSDALLE  FTAKLCSP CY NCPNIVDLYFNLAAGEGA+LPD
Sbjct  77   TDACVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPD  136

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LC+  +       R MIQL
Sbjct  137  LCDAARYN---PHRSMIQL  152



>ref|XP_008388101.1| PREDICTED: uncharacterized protein LOC103450515 [Malus domestica]
Length=190

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 113/156 (72%), Gaps = 4/156 (3%)
 Frame = +1

Query  61   MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            M  S+  + L    LS H VL + ICE+LP + CAFSVSS GKRC+LE   K +G +EY+
Sbjct  1    MAVSTKFLALFLSFLSIHAVLGEFICEDLPNDVCAFSVSSAGKRCLLETMSKKDGSIEYQ  60

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            C+TSEVVV   +A+Y+ETD+CV+ACG+ RKSVG+SSDALLE  F AKLCS  CY  CPNI
Sbjct  61   CRTSEVVV-EGVADYIETDQCVQACGIDRKSVGISSDALLEPQFMAKLCSAPCYQKCPNI  119

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             DLYFNLAAGEG +LPDLC+K++       R MI L
Sbjct  120  ADLYFNLAAGEGVFLPDLCDKQRSN---PHRSMIAL  152



>ref|XP_010101846.1| hypothetical protein L484_023636 [Morus notabilis]
 gb|EXB89983.1| hypothetical protein L484_023636 [Morus notabilis]
Length=180

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 121/158 (77%), Gaps = 6/158 (4%)
 Frame = +1

Query  61   MKFSS-VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKD-NGKVE  234
            M FS+ V V+L   +L  H  LA+I+CE LP++ CAF+++S GKRC+LE +    +G+VE
Sbjct  1    MAFSTKVPVVLFLSSLFIHAALAEIVCEELPLDVCAFAIASSGKRCLLETTAAGKDGRVE  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            ++C+TSEVVV   MAEY+ETD CV+ACGV RKSVG+SSD+LLE  F AKLC+ EC+ NCP
Sbjct  61   HQCRTSEVVV-ERMAEYIETDRCVEACGVDRKSVGISSDSLLEPQFMAKLCAQECHQNCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDLYFNLAAGEG +LPDLCEK++       R M++L
Sbjct  120  NIVDLYFNLAAGEGVFLPDLCEKQRYS---PHRVMVEL  154



>gb|KHG02999.1| ATP-dependent RNA helicase dbp6 [Gossypium arboreum]
Length=182

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 116/159 (73%), Gaps = 7/159 (4%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS+KF    + L   +LS H  +A+IICE+LP + CAFS++  GKRCVLE +   +  V
Sbjct  1    MASLKFP---IFLFISSLSLHASMAEIICEDLPKDVCAFSIALSGKRCVLETAADKDSDV  57

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            E++C+TSEVVV   MA+Y+E+DECV ACGV R S+G+SSD+LL+  FTAKLC+P CY NC
Sbjct  58   EHQCRTSEVVV-ERMADYIESDECVAACGVNRNSIGISSDSLLDQQFTAKLCAPACYQNC  116

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PN++DLYFNLAAGEG +LPDLC  +       RR M+ L
Sbjct  117  PNVIDLYFNLAAGEGVFLPDLCNAQWSN---PRRSMVDL  152



>ref|XP_008239896.1| PREDICTED: uncharacterized protein LOC103338466 [Prunus mume]
Length=195

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = +1

Query  109  FHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYL  288
             H VL   ICE+LP + CAFSVSS GKRC+LE   K +G +EY+C+TSEV+V   +AEY+
Sbjct  19   IHAVLGGFICEDLPNDVCAFSVSSAGKRCLLETMAKKDGSIEYQCRTSEVLV-QGVAEYI  77

Query  289  ETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLP  468
            ETD+CVKACG+ RKSVG+SSDALLE  F  KLCSP CY  CPNIV+LYFNLAAGEGA+LP
Sbjct  78   ETDQCVKACGIDRKSVGISSDALLEPQFMTKLCSPTCYQKCPNIVELYFNLAAGEGAFLP  137

Query  469  DLCEKKQKEVGPGRRDMIQL  528
            DLC+K++       R M+QL
Sbjct  138  DLCDKQRTNP---HRAMLQL  154



>ref|XP_002323542.2| hypothetical protein POPTR_0016s11600g [Populus trichocarpa]
 gb|EEF05303.2| hypothetical protein POPTR_0016s11600g [Populus trichocarpa]
Length=178

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H   A+I+CE LP + CAF++SS GKRC+LE     N  VEY+C+TSEVVV   MA+Y+E
Sbjct  18   HAASAEIVCEELPNDICAFTISSSGKRCLLETYATKNDAVEYQCRTSEVVV-EKMADYIE  76

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD CVKACGV R SVG+SSDALLE  FTAKLCSP CY NCPNIVDLYFNLAAGEGA+LPD
Sbjct  77   TDACVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPD  136

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LC+  +       R MIQL
Sbjct  137  LCDAARYN---PHRSMIQL  152



>gb|KHN12948.1| hypothetical protein glysoja_042216 [Glycine soja]
Length=180

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 5/157 (3%)
 Frame = +1

Query  61   MKFSSVLVL-LLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M FS+ L L LL  +L  H  LA+++CE+LP   CAFSV+S GKRC+LE     +G VEY
Sbjct  1    MSFSTKLPLVLLFSSLFIHASLAEMVCEDLPKEVCAFSVASSGKRCLLETEKAADGGVEY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +C+TSEVVV   MA+Y+ETD+CV+ACGV R SVG+SSDA  E  FT KLCSP CY  CPN
Sbjct  61   QCRTSEVVV-ERMADYIETDQCVEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQKCPN  119

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            IVDL+FNLAAGEG +LP+LCEK +      RR M++L
Sbjct  120  IVDLFFNLAAGEGVFLPELCEKHKTN---PRRAMVEL  153



>ref|NP_001242705.1| uncharacterized protein LOC100815307 precursor [Glycine max]
 gb|ACU17875.1| unknown [Glycine max]
Length=180

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 115/157 (73%), Gaps = 5/157 (3%)
 Frame = +1

Query  61   MKFSSVLVL-LLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M FS+ L L LL  +L  H  LA+++CE+LP   CAFSV+S GKRC+LE     +G VEY
Sbjct  1    MSFSTKLPLVLLFSSLFIHASLAEMVCEDLPKEVCAFSVASSGKRCLLETEKAADGGVEY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +C+TSEVVV   MA+Y+ETD+CV+ACGV R SVG+SSDA  E  FT KLCSP CY  CPN
Sbjct  61   QCRTSEVVV-ERMADYIETDQCVEACGVDRNSVGISSDAFFEPQFTDKLCSPACYQKCPN  119

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            IVDL+FNLAAGEG +LP+LCEK +      RR M++L
Sbjct  120  IVDLFFNLAAGEGVFLPELCEKHKTN---PRRAMVEL  153



>gb|KHN27004.1| hypothetical protein glysoja_040812 [Glycine soja]
Length=181

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 5/157 (3%)
 Frame = +1

Query  61   MKFSSVLVL-LLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M FS+ L L LL  +L  H  LA+++CE+LP   CAFS++S GKRC+LE     +G VEY
Sbjct  1    MSFSTKLPLVLLFSSLFIHASLAEMVCEDLPKEVCAFSLASSGKRCLLETEKVADGGVEY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +C+TSEVVV   MAEY+ETD+CV+ACGV R SVG+SSDA  E  FT KLCSP CY  CPN
Sbjct  61   QCRTSEVVV-ERMAEYIETDQCVEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQKCPN  119

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            I+DL+FNLAAGEG +LP+LCEK +      RR M++L
Sbjct  120  IIDLFFNLAAGEGVFLPELCEKHKTN---PRRAMVEL  153



>gb|KHF97273.1| hypothetical protein F383_36747 [Gossypium arboreum]
Length=179

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS+KF  VL +    +L  H  LA++ICE+LP + CAFS++S GKRCVLE ++K  G V
Sbjct  1    MASLKFPIVLFIS---SLLLHSSLAEMICEDLPKDLCAFSIASSGKRCVLETAVKKEGDV  57

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            +Y+C+TSEVVV   MAEY+ETDECV ACG  R SVG+SSD+LL+  FTAKLC+P CY  C
Sbjct  58   QYQCRTSEVVV-ERMAEYIETDECVAACGADRNSVGISSDSLLDQQFTAKLCTPACYQKC  116

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNIVDLYFNLAAGEG +LPDLC  ++      RR M++L
Sbjct  117  PNIVDLYFNLAAGEGVFLPDLCNAQRSN---PRRSMVEL  152



>gb|EYU41813.1| hypothetical protein MIMGU_mgv1a014652mg [Erythranthe guttata]
Length=182

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 116/158 (73%), Gaps = 6/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK  S L+L  A +L   G+LA++ICE+LP N C+F+++S GKRCVLEN   + G ++
Sbjct  3    SSMK--SSLILFFASSLFVQGILAELICEDLPANRCSFAIASSGKRCVLENFSDERGTLD  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y CKTSEVVV   ++ Y+ETDECV ACGV R  VG+SSDA L A FT +LCSP CY NCP
Sbjct  61   YTCKTSEVVV-ERLSGYIETDECVNACGVDRGFVGISSDAFLTADFTPRLCSPACYQNCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDLYFNLAAGEG YLP LC+K++       R M++L
Sbjct  120  NIVDLYFNLAAGEGVYLPALCQKQKSNP---HRAMLEL  154



>ref|XP_011008006.1| PREDICTED: uncharacterized protein LOC105113506 [Populus euphratica]
Length=171

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
            A+I+CE LP + CAF++SS GKRC+LE     NG VEY+C+TSEVVV   MA+Y+ETD C
Sbjct  15   AEIVCEELPNDICAFTISSSGKRCLLETYATKNGAVEYQCRTSEVVV-EKMADYIETDAC  73

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            VKACGV R SVG+SSDALLE  FTAKLCSP CY NCPNIVDLYFNLAAGEGA+LPDLC+ 
Sbjct  74   VKACGVDRNSVGISSDALLEPQFTAKLCSPACYQNCPNIVDLYFNLAAGEGAFLPDLCDA  133

Query  484  KQKEVGPGRRDMIQL  528
             +       R MIQL
Sbjct  134  ARYN---PHRSMIQL  145



>ref|NP_001238081.1| uncharacterized protein LOC100500181 precursor [Glycine max]
 gb|ACU15142.1| unknown [Glycine max]
Length=181

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 5/157 (3%)
 Frame = +1

Query  61   MKFSSVLVL-LLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M FS+ L L LL  +L  H  LA+++CE+LP   CAFS++S GKRC+LE     +G VEY
Sbjct  1    MSFSTKLPLVLLFSSLFIHASLAEMVCEDLPKEVCAFSLASSGKRCLLETEKVADGCVEY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +C+TSEVVV   MAEY+ETD+CV+ACGV R SVG+SSDA  E  FT KLCSP CY  CPN
Sbjct  61   QCRTSEVVV-ERMAEYIETDQCVEACGVDRNSVGISSDAFFEPQFTGKLCSPACYQKCPN  119

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            I+DL+FNLAAGEG +LP+LCEK +      RR M++L
Sbjct  120  IIDLFFNLAAGEGVFLPELCEKHKTN---PRRAMVEL  153



>ref|XP_009358815.1| PREDICTED: uncharacterized protein LOC103949427 [Pyrus x bretschneideri]
Length=190

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 4/156 (3%)
 Frame = +1

Query  61   MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            M  S+  + L     S H VL + ICE+LP + CAFSVSS GKRC+LE   K +G +EY+
Sbjct  1    MAVSTKFLALFLSFQSIHVVLGEFICEDLPNDVCAFSVSSAGKRCLLETMSKKDGSIEYQ  60

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            C+TSEVVV   +A+Y+ETD+CV+ACG+ RKSVG+SSDALLE  F AKLCS  CY  CPNI
Sbjct  61   CRTSEVVV-EGVADYIETDQCVQACGIDRKSVGISSDALLEPQFMAKLCSAPCYQKCPNI  119

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             DLYFNLAAGEG +LPDLC+K++       R MI L
Sbjct  120  ADLYFNLAAGEGVFLPDLCDKQRSN---PHRAMIAL  152



>ref|XP_006429255.1| hypothetical protein CICLE_v10012857mg [Citrus clementina]
 ref|XP_006480931.1| PREDICTED: uncharacterized protein LOC102628059 [Citrus sinensis]
 gb|ESR42495.1| hypothetical protein CICLE_v10012857mg [Citrus clementina]
 gb|KDO58021.1| hypothetical protein CISIN_1g029564mg [Citrus sinensis]
Length=191

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 7/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +S++ S VL L    +L  H  LA+I CE+LP N CAFS++S GKRC+LE     +G +E
Sbjct  3    SSLRLSFVLFL---SSLFLHAALAEIECESLPKNVCAFSIASSGKRCLLETYTTKDGSLE  59

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            + CKTS+VVV   MA+Y+ETD CVKACGV R +VG+SSDALLE  F +KLCSP CY  CP
Sbjct  60   FLCKTSDVVV-EKMADYIETDRCVKACGVDRNAVGISSDALLEPEFASKLCSPACYQKCP  118

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDLYFNLAAGEGAYLPD+C+  +       R M+QL
Sbjct  119  NIVDLYFNLAAGEGAYLPDICQATRSN---PHRSMLQL  153



>ref|XP_006349478.1| PREDICTED: uncharacterized protein LOC102591129 [Solanum tuberosum]
Length=175

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S  +L    TL   G L   ICE LP N C F++++  KRC+LENS  ++GKVEY+CKTS
Sbjct  7    SSFILFFVSTLFLQGTLGSFICEELPTNVCGFAIATSAKRCLLENSSGNDGKVEYQCKTS  66

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            EVVV ++M E++ETDECV ACGV R SVG+SSDALL++ FT+KLCS +CY++C NI+DLY
Sbjct  67   EVVV-ANMREHIETDECVDACGVDRNSVGISSDALLDSQFTSKLCSLDCYHHCANIIDLY  125

Query  433  FNLAAGEGAYLPDLCEKKQ  489
            FNLAAGEG YLPDLC K++
Sbjct  126  FNLAAGEGVYLPDLCNKQR  144



>ref|XP_004506651.1| PREDICTED: uncharacterized protein LOC101492243 [Cicer arietinum]
Length=180

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H  LA+++CE+LP + CAFSV+S GKRC+LE     NG++EYEC+TSEV+V   MAEY+E
Sbjct  19   HASLAEMVCEDLPKDVCAFSVASSGKRCLLETEKGMNGEIEYECRTSEVIV-ERMAEYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD+CV+ CGV R SVG+SSDA  E  FTAKLCSP CY  CPNIVDL+FNLAAGEG +LP+
Sbjct  78   TDQCVEKCGVDRNSVGISSDAFFEPQFTAKLCSPICYQKCPNIVDLFFNLAAGEGVFLPE  137

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCEK +      RR MI+L
Sbjct  138  LCEKHKTN---PRRAMIEL  153



>gb|KDP24516.1| hypothetical protein JCGZ_25080 [Jatropha curcas]
Length=180

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +1

Query  121  LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDE  300
            L +I CE LP + CAFS+++ GKRC+LE   + +GKVEY+C+TSEV+V  +MA+Y+ETD+
Sbjct  21   LCEIDCEELPKDVCAFSIAASGKRCLLETYARGDGKVEYQCRTSEVIV-ETMADYIETDQ  79

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCE  480
            CVKACGV R SVG+SSDALLE  FTAKLCSP CY  CPNI+DLYFNLAAGEGA+LPDLC+
Sbjct  80   CVKACGVDRNSVGISSDALLEPHFTAKLCSPPCYQKCPNIIDLYFNLAAGEGAFLPDLCD  139

Query  481  KKQKEVGPGRRDMIQL  528
              +       R +IQL
Sbjct  140  AARTN---PHRSLIQL  152



>gb|EYU26632.1| hypothetical protein MIMGU_mgv1a014768mg [Erythranthe guttata]
Length=179

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 108/151 (72%), Gaps = 4/151 (3%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
             L L   C+L   G LA+++CENLP N C+F+++S GKRCVLEN   ++GK++Y CK+SE
Sbjct  8    TLALFFTCSLFLQGTLAEVVCENLPENLCSFAIASSGKRCVLENYKNEDGKLDYTCKSSE  67

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            VVV   ++ Y+E+D+C+ ACG+ R  VG+SSDA L   FT  LCSP CY NCPNIVDLYF
Sbjct  68   VVV-ERLSGYIESDQCIAACGLDRTFVGISSDAFLTQEFTTSLCSPACYQNCPNIVDLYF  126

Query  436  NLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NLAAGEG YLP LC+K++       R M +L
Sbjct  127  NLAAGEGVYLPALCQKQKTS---PHRAMFEL  154



>gb|AFK35102.1| unknown [Lotus japonicus]
Length=183

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H   A+++CE+LP   CAFSV+S GKRC+LE     +G VEY+C+TSEVVV   MAEY+E
Sbjct  19   HASFAEMVCEDLPKEVCAFSVASSGKRCLLETEKGADGGVEYQCRTSEVVV-ERMAEYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD+CV++CGV R SVG+SSDA  E  FT KLCSP CY  CPNIVDLYFNLAAGEG +LP+
Sbjct  78   TDQCVESCGVDRSSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLYFNLAAGEGVFLPE  137

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCEK +       R M++L
Sbjct  138  LCEKHRSN---PHRAMVEL  153



>gb|KHG11879.1| uncharacterized protein F383_20075 [Gossypium arboreum]
Length=216

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 111/139 (80%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H  LA+IICE+LP + CAF+++S GKRC+LE  ++ N K EY+C+TSEV+V   MAEY+E
Sbjct  18   HASLAEIICEDLPNDVCAFAIASSGKRCLLETGLEKNEKEEYQCRTSEVMV-ERMAEYIE  76

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
             D+CV+ACGV R S+G+SSD+LLE  FTAKLC+P C + CPNIVDL+FNLAAGEG +LPD
Sbjct  77   NDDCVRACGVDRNSIGISSDSLLEPQFTAKLCAPACCHKCPNIVDLFFNLAAGEGVFLPD  136

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE ++  V P RR M++L
Sbjct  137  LCEAQR--VNP-RRSMVEL  152



>ref|XP_010256734.1| PREDICTED: uncharacterized protein LOC104597044 [Nelumbo nucifera]
Length=180

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 112/152 (74%), Gaps = 5/152 (3%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            +L  L A     HG + + I+CE LP N CAFS+SS G+RC LE     +G VEY+C+TS
Sbjct  8    ILTFLFALATYVHGGVGEGIVCEELPKNICAFSISSSGQRCTLETYAAQDGNVEYQCRTS  67

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
             V V  +MA ++ETDEC++ACG+ R SVG+SSDALLE+ FTA+LCS  CY+NCPNIVDLY
Sbjct  68   NVSV-ENMAGWIETDECIQACGLDRNSVGISSDALLESQFTAQLCSIGCYDNCPNIVDLY  126

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LPD+CE ++  +    R+MI+L
Sbjct  127  FNLAAGEGVFLPDICEAQRNNL---HREMIEL  155



>ref|XP_004137744.1| PREDICTED: uncharacterized protein LOC101218677 [Cucumis sativus]
 ref|XP_004168412.1| PREDICTED: uncharacterized LOC101218677 [Cucumis sativus]
 gb|KGN58812.1| hypothetical protein Csa_3G732680 [Cucumis sativus]
Length=183

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%), Gaps = 4/143 (3%)
 Frame = +1

Query  100  TLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMA  279
            +L       +I+CE L ++ CAFS++S GKRC+LE S    GK EY+C+TSEV+V   MA
Sbjct  15   SLFVSAAFGEIVCEELSVDVCAFSIASSGKRCLLETSETKEGKFEYQCRTSEVIV-EWMA  73

Query  280  EYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGA  459
            +Y+E+D+C+ ACG+ R SVG++SDALLE  FTAKLCSP CY  CPNIVDLYFN+AAGEG 
Sbjct  74   DYIESDQCINACGLDRNSVGIASDALLEPQFTAKLCSPSCYQKCPNIVDLYFNMAAGEGV  133

Query  460  YLPDLCEKKQKEVGPGRRDMIQL  528
            +LPDLCEK++      RR M QL
Sbjct  134  FLPDLCEKQRTN---PRRAMAQL  153



>ref|XP_008442484.1| PREDICTED: uncharacterized protein LOC103486338 [Cucumis melo]
Length=181

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 107/148 (72%), Gaps = 4/148 (3%)
 Frame = +1

Query  85   LLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVV  264
            LL   +L       +I+CE L ++ CAFS++S GKRC+LE S    GK EY+C+TSEV+V
Sbjct  10   LLFISSLFVSAAFGEIVCEELSVDVCAFSIASSGKRCLLETSETKEGKFEYQCRTSEVMV  69

Query  265  GSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLA  444
               MA+Y+ETD+C+ ACG+ R SVG++SDALLE  FTAKLCSP CY  CPNIVDLYFN+A
Sbjct  70   -EWMADYIETDQCINACGLDRNSVGIASDALLEPQFTAKLCSPSCYQKCPNIVDLYFNMA  128

Query  445  AGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            AGEG +LPDLCEK++       R M +L
Sbjct  129  AGEGVFLPDLCEKQRTN---PHRAMAEL  153



>ref|XP_010044045.1| PREDICTED: uncharacterized protein LOC104433099 [Eucalyptus grandis]
 gb|KCW86048.1| hypothetical protein EUGRSUZ_B02754 [Eucalyptus grandis]
Length=181

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H  LA+I+CE LP + CAFS++S GKRC LE     +G VEY+C+TSEV+V   M  Y+E
Sbjct  20   HATLAEIVCEELPKDLCAFSIASSGKRCSLETYANQSGGVEYQCRTSEVIV-ERMGGYIE  78

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TDECV+ACGV R +VG+SSDALLE  FTAKLCSP CY  CPNI+DLY+NLAAGEG +LPD
Sbjct  79   TDECVRACGVDRDAVGISSDALLEPQFTAKLCSPACYRRCPNIIDLYYNLAAGEGVFLPD  138

Query  472  LCEKK  486
            LCE +
Sbjct  139  LCEMQ  143



>ref|XP_003604797.1| hypothetical protein MTR_4g018880 [Medicago truncatula]
 gb|AES86994.1| PAR1 protein [Medicago truncatula]
 gb|AFK33904.1| unknown [Medicago truncatula]
Length=181

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H  LA+++CE+LP   C FSV+S GKRC+LE     NG++EY+C+TSEV+V   ++EY+E
Sbjct  19   HASLAEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNGEIEYQCRTSEVIV-ERISEYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD+CV+ACGV R SVG+SSDA  E  FT KLCSP CY  CPNIVDL+FN+AAGEG +LP+
Sbjct  78   TDQCVEACGVDRSSVGISSDAFFEPQFTGKLCSPACYKKCPNIVDLFFNMAAGEGVFLPE  137

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCEK +      RR M++L
Sbjct  138  LCEKHKTN---PRRAMVEL  153



>gb|KEH23077.1| PAR1 protein [Medicago truncatula]
Length=169

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 4/147 (3%)
 Frame = +1

Query  88   LLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVG  267
            +  C+L  H  LA+++CE L  + C+FS++S GKRC+LE     +G +EY+C+TSEVV+ 
Sbjct  1    MFFCSLIIHSSLAEVVCEELQKDLCSFSIASSGKRCLLETEKAADGGIEYQCRTSEVVL-  59

Query  268  SSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAA  447
              MA Y+ETD+CVKACGV R  VG+SSDALLE  FTAKLCS  CY NCPNIVDLYFNLAA
Sbjct  60   ERMAGYIETDQCVKACGVERNFVGISSDALLEPQFTAKLCSSSCYQNCPNIVDLYFNLAA  119

Query  448  GEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            GEG +LPDLCE ++       R MI+L
Sbjct  120  GEGVFLPDLCEIQKTN---PHRAMIEL  143



>ref|XP_004249680.1| PREDICTED: uncharacterized protein LOC101253546 [Solanum lycopersicum]
Length=175

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 5/153 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGV-LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKT  249
            S  +L     +   G  L   ICE+L  N C F++S+ GKRC+LENS   +GKVEY+CKT
Sbjct  7    SCFILFFVSMVFLQGTTLGSFICEDLATNVCGFAISTSGKRCLLENSSGKDGKVEYQCKT  66

Query  250  SEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDL  429
            SEVVV ++M E++ET+ECV ACGV R +VG+SSDALL++ FT+KLCS +CY++CPNI+DL
Sbjct  67   SEVVV-ANMREHIETEECVDACGVDRNTVGISSDALLDSQFTSKLCSLDCYHHCPNIIDL  125

Query  430  YFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            YFNLAAGEG YLPDLC K++       R +I+L
Sbjct  126  YFNLAAGEGVYLPDLCNKQRTN---PHRAIIEL  155



>ref|XP_010046385.1| PREDICTED: uncharacterized protein LOC104435305 [Eucalyptus grandis]
Length=185

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIK-DNGKVEYECKTSE  255
            L+L LA +    G L +I CE LP   C+FS++S G+RCVLEN +   +GK+EYECKTS+
Sbjct  3    LILFLAFSFFLQGALGNIACEQLPTELCSFSIASNGRRCVLENYVSLMDGKMEYECKTSQ  62

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            V V   M E++ETD+C++ACGV R+SVG+SSDALL+ +FT KLCSP CY+NCPNIVDLYF
Sbjct  63   VAV-DIMHEWIETDDCIRACGVDRQSVGISSDALLQPSFTTKLCSPACYHNCPNIVDLYF  121

Query  436  NLAAGEGAYLPDLCEKKQK  492
            NLA GEG YL D CE ++ 
Sbjct  122  NLALGEGVYLADHCEVRRS  140



>ref|XP_011078704.1| PREDICTED: uncharacterized protein LOC105162404 [Sesamum indicum]
Length=171

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (71%), Gaps = 7/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SM+FS  LV+  AC+L   G LA+++CENLP N C+F++SS GKRCVLE+     G+++
Sbjct  3    SSMRFS--LVIFFACSLFVQGTLAEVVCENLPANLCSFAISSTGKRCVLESYKIGRGEID  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TSEVVV   +  Y+E+D CVKACGV R+S  +SSD  L + FTA LCSP CY NCP
Sbjct  61   YMCRTSEVVV-ERLYGYIESDHCVKACGVHRESTSISSDVFLSSEFTAHLCSPACYQNCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIV+L+FNLAAGEG  LP LC   QKE     R M+ +
Sbjct  120  NIVELFFNLAAGEGLSLPTLCH-NQKE---NHRTMLAI  153



>gb|EYU27489.1| hypothetical protein MIMGU_mgv1a014649mg [Erythranthe guttata]
Length=182

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 112/154 (73%), Gaps = 7/154 (5%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLA--DIICENLPINACAFSVSSIGKRCVLEN-SIKDNGKVEYECK  246
             LVL  AC+L   G LA  +++CENLP N CAF+++S GKRCVLEN   ++ GK++Y CK
Sbjct  8    TLVLFFACSLFLQGTLAVGEVVCENLPENLCAFAIASSGKRCVLENYKNEEEGKLDYTCK  67

Query  247  TSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVD  426
            +SEVVV   ++ Y+E+D+C+ ACGV R  VG+SSDA L   FT+ LCSP+CY NCPNIVD
Sbjct  68   SSEVVV-ERLSGYIESDQCINACGVDRTFVGISSDAFLTQEFTSSLCSPDCYRNCPNIVD  126

Query  427  LYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            LYFNLAAGEG YLP LC+K++       R M +L
Sbjct  127  LYFNLAAGEGVYLPALCDKQKSS---PHRAMFEL  157



>ref|XP_003604795.1| hypothetical protein MTR_4g018860 [Medicago truncatula]
 gb|AES86992.1| PAR1 protein [Medicago truncatula]
Length=211

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 112/157 (71%), Gaps = 5/157 (3%)
 Frame = +1

Query  61   MKFSSVLVL-LLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M FS+ L L LL  +   H   A ++CE+LP   CAFSV+S GKRC+LE     NG+ EY
Sbjct  1    MSFSTKLPLVLLLSSFLIHTSFAMMVCEDLPKEVCAFSVASSGKRCLLETEKNINGETEY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +C+TSEV+V   +A Y+ETD+CV+ACGV R SVG+SSDA  E  FT+KLCSP C++ CPN
Sbjct  61   QCRTSEVMV-ERIAAYIETDQCVEACGVDRSSVGISSDAFFEPYFTSKLCSPSCFSKCPN  119

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            IVDL+FNLAAGEG +LP+LCEK +      RR  I+L
Sbjct  120  IVDLFFNLAAGEGVFLPELCEKHKTN---PRRATIEL  153



>ref|XP_007133951.1| hypothetical protein PHAVU_010G006000g [Phaseolus vulgaris]
 gb|ESW05945.1| hypothetical protein PHAVU_010G006000g [Phaseolus vulgaris]
Length=179

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H  L +I+CE+LP   CAFSV+S GKRC+LE     +G VEY+C+TSEVVV   MAEY+E
Sbjct  19   HASLGEIVCEDLPKEVCAFSVASSGKRCLLETEKAADGGVEYQCRTSEVVV-ERMAEYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD+CV+ACGV R SVG+SSDA  E  FTAKLCS +CY  C NIVDL+FNLAAGEG +LP+
Sbjct  78   TDQCVEACGVDRNSVGISSDAFFEPQFTAKLCSSQCYQKCFNIVDLFFNLAAGEGVFLPE  137

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE+++      RR M++L
Sbjct  138  LCERQKTN---PRRAMVEL  153



>ref|XP_011073213.1| PREDICTED: uncharacterized protein LOC105158236 [Sesamum indicum]
Length=167

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  LVL  AC++     LAD+ICENLP N C+F+++S GKRCVLE       K+ 
Sbjct  3    SSMKLS--LVLFFACSIFVQTTLADVICENLPTNLCSFAIASSGKRCVLECHKNTQEKI-  59

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
              CKTSE+VV   ++ Y+ETD+CVKACGV R+SVG+SSDALL + FTA LCSP CY+NCP
Sbjct  60   --CKTSEIVV-EKLSGYIETDQCVKACGVCRESVGLSSDALLSSEFTAHLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDL+FNLAAGEG  LP LC K Q+E     R M+ +
Sbjct  117  NIVDLFFNLAAGEGVSLPALC-KNQEE---NHRSMLAI  150



>ref|XP_010553064.1| PREDICTED: uncharacterized protein LOC104823275 [Tarenaya hassleriana]
Length=179

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 115/159 (72%), Gaps = 6/159 (4%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            M S+  +S++VL+     SF    A+IICE+LP + CAFS+S  GKRC+LE   +  G V
Sbjct  1    MVSIFRTSLMVLI--SFYSFDPSHANIICEDLPEDICAFSISGAGKRCLLETEARFAGGV  58

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            ++ C+TSE+ VG  M  Y+E+D CV ACGV R+SVG+SSD LL+  FTAKLCSPEC++NC
Sbjct  59   DFRCRTSEIEVGR-MTNYVESDACVHACGVDRRSVGISSDGLLDPDFTAKLCSPECFDNC  117

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNIVDLYFNLAAGEGA+LPD+C  ++       R M+++
Sbjct  118  PNIVDLYFNLAAGEGAFLPDVCAARRAN---PHRTMVEI  153



>ref|XP_011077605.1| PREDICTED: uncharacterized protein LOC105161572 [Sesamum indicum]
Length=186

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 105/146 (72%), Gaps = 4/146 (3%)
 Frame = +1

Query  91   LACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGS  270
              C+L   G LA+++CE+LP N CAF++++ GKRCVLEN   + G V+Y CKTSEVVV  
Sbjct  15   FVCSLFLPGTLAEVVCEDLPENLCAFAIAASGKRCVLENYKSEEGSVDYTCKTSEVVV-E  73

Query  271  SMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAG  450
             +A Y+ETDECV ACGV R  VG+SSDA L   F + LCSP CY NCPNIVDLYFNLAAG
Sbjct  74   RLAGYVETDECVNACGVDRNFVGISSDAFLTPEFISSLCSPACYRNCPNIVDLYFNLAAG  133

Query  451  EGAYLPDLCEKKQKEVGPGRRDMIQL  528
            EG +LP LCEK++       R M++L
Sbjct  134  EGVFLPALCEKQKTS---PHRAMLEL  156



>gb|AFK48062.1| unknown [Lotus japonicus]
Length=183

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H   A+++CE+LP   CAFSV+S GKRC+LE     +G VEY+C+TSEVVV   MAEY+E
Sbjct  19   HASFAEMVCEDLPKEVCAFSVASSGKRCLLETEKGADGGVEYQCRTSEVVV-ERMAEYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD+CV++CGV R SVG+SSDA  E  FT KLCSP CY  CPNIVDLYFNLAAGEG +LP+
Sbjct  78   TDQCVESCGVDRSSVGISSDAFFEPQFTGKLCSPACYQKCPNIVDLYFNLAAGEGVFLPE  137

Query  472  LCEKKQKEVGPGRRDMIQL  528
            L EK +       R M++L
Sbjct  138  LYEKHRSN---PHRAMVEL  153



>ref|XP_011094948.1| PREDICTED: uncharacterized protein LOC105174517 [Sesamum indicum]
Length=176

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS    S+L+   AC+L   G LA++ICENLP+N CAF+++S GKRCVLE +    G++
Sbjct  1    MASSTKFSLLLFFFACSLFIQGTLAEVICENLPMNLCAFAIASSGKRCVLEKTKNARGEI  60

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             + CKTSEVVV   ++ YLETD+CV  CG+ R+ +G+SSD  + + FTA LCSP C+ NC
Sbjct  61   GFTCKTSEVVV-ERLSGYLETDQCVNGCGLHREFIGLSSDVFISSEFTAHLCSPACFQNC  119

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNIVDLY NLAAGEG  LP LC+  QKE     R M+ +
Sbjct  120  PNIVDLYLNLAAGEGVSLPILCQ-NQKE---NHRAMLTI  154



>ref|XP_011073217.1| PREDICTED: uncharacterized protein LOC105158241 [Sesamum indicum]
Length=173

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 117/158 (74%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  LVL   C+L     LAD+ICENLP N C+F+++S GKRCVLEN    N + E
Sbjct  3    SSMKLS--LVLFFTCSLFVQRTLADVICENLPTNLCSFAIASSGKRCVLENC--KNAQ-E  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
             +CKTSEVVV   ++ Y+ETD+CVKACGV R+SVG+SSD  L + FTA+LCSP CY+NCP
Sbjct  58   KKCKTSEVVV-EKLSGYIETDQCVKACGVCRESVGISSDTFLSSEFTARLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DL+FNLAAGEG  LP LC+ ++++     R+M+ +
Sbjct  117  NIIDLFFNLAAGEGVSLPALCKNQEEK----HREMLAI  150



>gb|ABK26953.1| unknown [Picea sitchensis]
Length=208

 Score =   173 bits (439),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = +1

Query  61   MKFSSVLVLL--LACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M  +S+L+ +  L   +S  GVL  I+CENLP+  CAFSVSS G RCVLE SI  +G V+
Sbjct  1    MAVTSILLTVSALISVISLQGVLGGIVCENLPMEVCAFSVSSSGARCVLEKSILRDGNVQ  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            YEC++S+V+   ++ E++ETDEC+ ACGV R +VG+S+DAL++   T KLCSP CYN CP
Sbjct  61   YECQSSDVI-AETIKEWIETDECMNACGVERMAVGISTDALVDGRSTRKLCSPNCYNKCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQ  525
            NI++LYFNLAAGEG YLP LCE  +     G R MI 
Sbjct  120  NILELYFNLAAGEGIYLPRLCEAHRS----GDRRMIS  152



>ref|XP_010905376.1| PREDICTED: uncharacterized protein LOC105032593 [Elaeis guineensis]
Length=195

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  34   IKESRSMASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSI  213
            I  S+ MA     S+ VL    + S     A +ICE+LP + CAF++SS  KRCVLE++ 
Sbjct  6    IPSSKMMAWALLLSLSVLHFLPSAS-----AGVICEDLPQDLCAFAISSASKRCVLESTP  60

Query  214  KDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSP  393
            +  G  EY+C+TS+VVV   M++++ETDECV+ACGV R SVG+SSD+LLE  FT KLCSP
Sbjct  61   RSWGPTEYQCRTSDVVV-DQMSDWIETDECVRACGVDRNSVGISSDSLLEPQFTEKLCSP  119

Query  394  ECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGR  510
             C+ NCPNIVDL+FNLAAGEG +LP+LCE +   V P R
Sbjct  120  ACHQNCPNIVDLFFNLAAGEGVFLPELCEARH--VNPHR  156



>gb|ABK26944.1| unknown [Picea sitchensis]
Length=208

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = +1

Query  61   MKFSSVLVLL--LACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M  +S+L+ +  L   +S  GVL  I+CENLP+  CAFSVSS G RCVLE SI  +G V+
Sbjct  1    MAVTSILLTVSALISVISLQGVLGGIVCENLPMEVCAFSVSSSGARCVLEKSILRDGNVQ  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            YEC++S+V+    + E++ET+EC+ ACGV R +VGMS+DAL++   T KLCSP CYN CP
Sbjct  61   YECQSSDVI-AEIIKEWIETEECMNACGVERMAVGMSTDALVDGRSTRKLCSPNCYNKCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQ  525
            NI++LYFNLAAGEG YLP LCE  +     G R MI 
Sbjct  120  NILELYFNLAAGEGIYLPRLCEAHRS----GDRRMIS  152



>ref|XP_009370270.1| PREDICTED: uncharacterized protein LOC103959642 [Pyrus x bretschneideri]
Length=180

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
            + +LL    L  H  L +I+CE+LP   CAFSVSS GKRC+LE   K  GKVE+EC+TS 
Sbjct  3    IPLLLFHSLLFIHAALGEIVCEHLPNEICAFSVSSSGKRCLLETMAKKGGKVEHECRTSG  62

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            VVV   MAEY+ETDEC+KACGV RK++G+SSD LL+     KLCS  CY+ CPNI++LYF
Sbjct  63   VVV-EKMAEYIETDECIKACGVDRKAIGISSDTLLDPRVLNKLCSTACYHKCPNIIELYF  121

Query  436  NLAAGEGAYLPDLCEKKQ  489
            N+A GEG +LP LCEK++
Sbjct  122  NMAVGEGVFLPYLCEKQR  139



>ref|XP_009388026.1| PREDICTED: uncharacterized protein LOC103974853 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +1

Query  118  VLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETD  297
             LA +ICE LP   CAF++SS  KRC+L+++    G+ EY+C+TSE VV   M++++ETD
Sbjct  26   ALAGVICEELPQELCAFAISSTSKRCLLDSTQNQGGRTEYQCRTSEAVV-ERMSDWIETD  84

Query  298  ECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            ECV+ACGV R SVG+SSD+L+E+ F  KLCS  CY NCPNIVDLYFNLAAGEG +LPDLC
Sbjct  85   ECVRACGVSRDSVGISSDSLMESDFAQKLCSQPCYRNCPNIVDLYFNLAAGEGVFLPDLC  144

Query  478  EKKQKEVGPGRRDMIQL  528
            E ++  V P RR M Q+
Sbjct  145  EAQR--VNP-RRSMAQI  158



>ref|XP_011073214.1| PREDICTED: uncharacterized protein LOC105158237 [Sesamum indicum]
Length=173

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 113/157 (72%), Gaps = 10/157 (6%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK S  L L   C+L     LAD+ICENLP N C+F+++S GKRCVLEN        E 
Sbjct  4    SMKLS--LFLFFTCSLFVQRTLADVICENLPTNLCSFAIASSGKRCVLENC---KNAQEK  58

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +CKTSEVVV   ++ Y+ETD+CVKACGV R+SVG+SSD  L + FTA+LCSP CY+NCPN
Sbjct  59   KCKTSEVVV-DKLSGYIETDQCVKACGVCRESVGISSDTFLSSEFTARLCSPACYHNCPN  117

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            I+DL+FNLAAGEG  LP LC+ ++++     R+M+ +
Sbjct  118  IIDLFFNLAAGEGVSLPALCKNQEEK----HREMLAI  150



>ref|XP_009370269.1| PREDICTED: uncharacterized protein LOC103959641 [Pyrus x bretschneideri]
Length=180

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
            + +LL    L  H  L +I+CE+LP   CAFSVSS GKRC+LE   K  GKVE+EC+TS 
Sbjct  3    IPLLLFHSFLFIHAALGEIVCEHLPNEICAFSVSSSGKRCLLETMAKKGGKVEHECRTSG  62

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            VVV   MAEY+ETDEC+KACGV RK++G+SSD LL+     KLCS  CY+ CPNI++LYF
Sbjct  63   VVV-EKMAEYIETDECIKACGVDRKAIGISSDTLLDPRVLNKLCSTACYHKCPNIIELYF  121

Query  436  NLAAGEGAYLPDLCEKKQ  489
            N+A GEG +LP LCEK++
Sbjct  122  NMAVGEGVFLPYLCEKQR  139



>ref|XP_003604794.1| hypothetical protein MTR_4g018850 [Medicago truncatula]
 gb|AES86991.1| PAR1 protein [Medicago truncatula]
Length=215

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H   A ++CE+LP   CAFSV+S GKRC+LE     NG+ EY+C+TSEV+V   +A Y+E
Sbjct  19   HTSFAMMVCEDLPKEVCAFSVASSGKRCLLETEKNINGETEYQCRTSEVMV-ERIAAYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TDECV+ACGV R SVG+SSDA  E  FT+KLCSP C++ CPNIVDL+FNLAAGEG +LP+
Sbjct  78   TDECVEACGVDRSSVGISSDAFFEPYFTSKLCSPSCFSKCPNIVDLFFNLAAGEGVFLPE  137

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCEK +      RR  I+L
Sbjct  138  LCEKHKNN---PRRATIEL  153



>ref|XP_010908211.1| PREDICTED: uncharacterized protein LOC105034670 [Elaeis guineensis]
Length=191

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
            A ++CE+LP + CAF++SS  KRCVLE++       EY+C+TSEVVV   M++++ETDEC
Sbjct  27   AGVVCEDLPQDLCAFAISSSSKRCVLESTQHSGRPTEYQCRTSEVVV-ERMSDWIETDEC  85

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            V+ACG  R SVG+SSD+LLE  FT KLCSP C+ NCPNI+DLYFNLAAGEG +LPDLCE 
Sbjct  86   VRACGADRNSVGISSDSLLEPQFTEKLCSPACHENCPNIIDLYFNLAAGEGVFLPDLCEA  145

Query  484  KQKEVGPGRRDMIQL  528
            ++  V P R  M+ L
Sbjct  146  RR--VNPHRSMMVIL  158



>ref|XP_011073208.1| PREDICTED: uncharacterized protein LOC105158231 [Sesamum indicum]
Length=173

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L     LAD+ICENLP N C+F+++S GKRCVLEN    N + E
Sbjct  3    SSMKLS--LLLFFTCSLFVERTLADVICENLPTNLCSFAIASSGKRCVLENC--KNAQ-E  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
             +CKTSEVVV   ++ Y+ETD+CV ACGV R+SVG+SSDA L + FTA LCSP CY+NCP
Sbjct  58   KKCKTSEVVV-EKLSGYIETDQCVNACGVCRESVGISSDAFLSSEFTAHLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDL+FNLAAGEG  LP LC K Q+E     R M+ +
Sbjct  117  NIVDLFFNLAAGEGVSLPALC-KNQEE---NHRSMLAI  150



>ref|XP_006488680.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
 gb|KDO66716.1| hypothetical protein CISIN_1g043358mg [Citrus sinensis]
Length=229

 Score =   171 bits (434),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            ++L LA      G L  IICE LP   C++SVSS GKRC+LEN    +G V Y+CKTSEV
Sbjct  4    IILFLAFCFFLQGALGGIICEQLPKQLCSYSVSSSGKRCLLENFASSDGTVTYQCKTSEV  63

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            +V   + +++ET+EC  ACGV RKSVG+SSD+LL+  FTAKLCS  CY NCPNIVDLYFN
Sbjct  64   IV-DVVHDWIETEECTNACGVDRKSVGISSDSLLQPQFTAKLCSDACYQNCPNIVDLYFN  122

Query  439  LAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            LA GEG YLP LCE ++      RR M
Sbjct  123  LALGEGVYLPSLCEAQRTNP---RRAM  146



>ref|XP_008811495.1| PREDICTED: uncharacterized protein LOC103722643 [Phoenix dactylifera]
Length=194

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            +ICE+LP + CAF++SS  KRCVLE++  + G  EY+C+TS+VVV   M+ ++ETDECV+
Sbjct  32   VICEDLPQDLCAFAISSSSKRCVLESTPHNGGATEYQCRTSDVVV-HRMSAWIETDECVR  90

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
            ACGV R SVG+SSD+LLE  FT KLCSP C+ NCPNIVDLYFNLAAGEG +LP LCE ++
Sbjct  91   ACGVDRNSVGISSDSLLEPQFTEKLCSPACHRNCPNIVDLYFNLAAGEGVFLPKLCEARR  150

Query  490  KEVGPGRRDMIQL  528
              V P RR M++L
Sbjct  151  --VNP-RRAMVEL  160



>ref|XP_011073219.1| PREDICTED: uncharacterized protein LOC105158242 [Sesamum indicum]
Length=169

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 112/157 (71%), Gaps = 10/157 (6%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK S  LVL   C+L     L D+ICENLP N C+F+V+S GKRCVLE      GK   
Sbjct  4    SMKLS--LVLFFTCSLFVQRTLGDVICENLPTNLCSFAVASSGKRCVLEICKNAQGK---  58

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +CKTSEVVV   ++ Y+ETD+CV +CGV R+SVG+SSDA L + FTA LCSP CY+NCPN
Sbjct  59   KCKTSEVVV-EKLSGYIETDQCVNSCGVCRESVGLSSDAFLSSKFTAHLCSPACYHNCPN  117

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            IVDL+FNLAAGEG  LP LC+ ++++     R+M+ +
Sbjct  118  IVDLFFNLAAGEGVSLPALCKNQEEK----HREMLAI  150



>ref|XP_011073211.1| PREDICTED: uncharacterized protein LOC105158234 [Sesamum indicum]
Length=171

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L     LA++ICENLP N C+F+++S GKRCVLEN     GK  
Sbjct  3    SSMKLS--LILFFTCSLFVQNTLANVICENLPTNMCSFAIASSGKRCVLENHKSPQGKT-  59

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
              CKTSEVVV   ++ Y+ETD+CV ACGV R++VG+SSDA L + FTA LCSP C++NCP
Sbjct  60   --CKTSEVVV-EKLSGYIETDQCVNACGVCREAVGISSDAFLSSEFTAHLCSPACFHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQK  492
            NIVDL+FNLAA EG  LP LC+ +++
Sbjct  117  NIVDLFFNLAASEGVSLPTLCKNQEE  142



>ref|XP_010923167.1| PREDICTED: uncharacterized protein LOC105046307 isoform X1 [Elaeis 
guineensis]
Length=186

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            +ICE+LP + CAF++SS  KRCVLE+   + G  EY+C+TSEVVV   M++++ETDECVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
            ACGV R +VG+SSD+LLE  FT K+CSP C+ NCPNI+DLYFNLAA EG +LPDLCE ++
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAEGVFLPDLCEARR  151

Query  490  KEVGPGRRDM  519
               G  RR M
Sbjct  152  ---GNPRRSM  158



>ref|XP_006848036.1| hypothetical protein AMTR_s00029p00186810 [Amborella trichopoda]
 gb|ERN09617.1| hypothetical protein AMTR_s00029p00186810 [Amborella trichopoda]
Length=175

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNG-KVEYECKTSE  255
            L L    ++  HG  A+I+CENL  + CAFS+SS GKRCVLE    ++G + E++C++SE
Sbjct  3    LALFFVLSMLLHGAFAEIVCENLSKDKCAFSISSAGKRCVLEKYAGNDGDEAEFQCRSSE  62

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            VVV   ++E++ET+EC++ACG+ R SVG+SSD+LLE  FTAKLC+  C+NNCPN+VDLY 
Sbjct  63   VVV-ERLSEWIETEECIQACGLDRNSVGISSDSLLEPQFTAKLCATACFNNCPNVVDLYV  121

Query  436  NLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NLAAGEG +LP+LC+ ++  + P RR M +L
Sbjct  122  NLAAGEGVFLPELCQVQR--INP-RRGMAEL  149



>ref|XP_007143423.1| hypothetical protein PHAVU_007G071100g [Phaseolus vulgaris]
 gb|ESW15417.1| hypothetical protein PHAVU_007G071100g [Phaseolus vulgaris]
Length=191

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MAS-MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS   F + +V  LA +L+    L    CENL    C+F+VSS GKRCVLE  +K +G+
Sbjct  1    MASNFSFRTFMVFFLAFSLTLEATLGGTECENLSHETCSFAVSSGGKRCVLEKRVKRSGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
             EY CKTS++    ++ +++ETD+C+KACG+ R S+G+SSD+LLE+TFT KLCSP CY+ 
Sbjct  61   EEYTCKTSDIE-AENLKDHIETDQCIKACGLDRNSLGISSDSLLESTFTHKLCSPHCYHF  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPN+VDLYFNLAAGEG +LP LCE +       RR M +L
Sbjct  120  CPNVVDLYFNLAAGEGVFLPKLCEVEGVN---ARRGMAEL  156



>gb|ABK21049.1| unknown [Picea sitchensis]
Length=182

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 100/145 (69%), Gaps = 5/145 (3%)
 Frame = +1

Query  91   LACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGS  270
            L   +S   V   I+CE LP+  CAFSVS+ G RCVLE SI  +G V+YEC+ SEV+   
Sbjct  13   LISVISLRVVFGGIVCEKLPVEVCAFSVSTSGARCVLEKSILSDGNVQYECQRSEVI-AE  71

Query  271  SMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAG  450
            ++ E +ET+ECV ACGV R +VGMS+D+L E  FT KLCS  CYNNCPNIVDLYFNLAAG
Sbjct  72   NLNELIETEECVNACGVERMTVGMSTDSLAERGFTNKLCSTRCYNNCPNIVDLYFNLAAG  131

Query  451  EGAYLPDLCEKKQKEVGPGRRDMIQ  525
            EG YLP LCE  +     G R MI 
Sbjct  132  EGVYLPRLCEAHRS----GARRMIS  152



>ref|XP_011081437.1| PREDICTED: uncharacterized protein LOC105164481 [Sesamum indicum]
Length=171

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L   G LAD+IC+NLP N C+F+++S GKRCVLE+        E
Sbjct  3    SSMKLS--LILFFTCSLFIQGTLADVICDNLPANLCSFAIASSGKRCVLES---HKNTQE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
             +CKTSEVVV   ++ Y+ET++CVKACGV R+SVG+SSD  L + FTA LCSP CY+NCP
Sbjct  58   KKCKTSEVVV-EKLSGYIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDL+FNLAA EG  LP LC K Q+E     R M+ +
Sbjct  117  NIVDLFFNLAASEGVSLPTLC-KNQEE---NHRAMLAI  150



>ref|XP_010039173.1| PREDICTED: uncharacterized protein LOC104427850 [Eucalyptus grandis]
Length=257

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 104/134 (78%), Gaps = 4/134 (3%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            +I CE +P + CAF+++S GKRC+LE      G+VEY+C+TSEVVV   MA Y+E DECV
Sbjct  101  EITCEEIPNDMCAFAIASSGKRCLLETLTSAGGEVEYQCRTSEVVV-ERMAGYVEGDECV  159

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
            +ACGV R+SVG+SSD+L++  FT++LC+P+C+ NCPNIVDLYFNLAAGEG YLPDLC+ +
Sbjct  160  QACGVDRRSVGISSDSLMDPQFTSRLCAPQCFQNCPNIVDLYFNLAAGEGVYLPDLCDAQ  219

Query  487  QKEVGPGRRDMIQL  528
            +       R MI+L
Sbjct  220  RAN---PHRTMIEL  230



>gb|KDP46577.1| hypothetical protein JCGZ_08549 [Jatropha curcas]
Length=181

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            L++ +A +L  HG L +++CE LP+  C++S++S  KRC++EN    +GK+ Y+CKTSEV
Sbjct  3    LIIFIAFSLVLHGALGELVCEKLPVELCSYSIASSSKRCLIENFATKDGKIAYQCKTSEV  62

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            VV   + E++E+DEC+ ACGV R +VG+SSD LL+  F AKLCS +CY +CPNIVDLYFN
Sbjct  63   VV-DILHEWIESDECISACGVDRNTVGISSDTLLQPQFLAKLCSNDCYQSCPNIVDLYFN  121

Query  439  LAAGEGAYLPDLCEKKQKEV  498
            LA GEG +LPDLC   ++ +
Sbjct  122  LALGEGVFLPDLCTNPRRAL  141



>ref|XP_006361911.1| PREDICTED: uncharacterized protein LOC102603240 [Solanum tuberosum]
Length=186

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  49   SMASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            S  ++K  +++   LA  L     L  I CENL  ++CAF++SS GKRCVLE S++ +G+
Sbjct  4    SFNNLKTLAIVAFTLA--LCVQVTLGSITCENLNKDSCAFAISSTGKRCVLEKSLRRSGE  61

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+   + +   +ETD C+++CGV R ++G+SSD+LLE  FT KLCSPECY +
Sbjct  62   QVYTCRTSEIEADNKLKNRIETDNCIQSCGVNRNTLGISSDSLLECHFTKKLCSPECYKH  121

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNIVDLYFNLAAGEG YLP LCE++    G GRR M ++
Sbjct  122  CPNIVDLYFNLAAGEGVYLPRLCEEQG---GNGRRGMAEI  158



>ref|XP_011073221.1| PREDICTED: uncharacterized protein LOC105158244 [Sesamum indicum]
Length=175

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 113/158 (72%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L   G LAD+ICENLP N C+F+++S GKRCVLE     N + E
Sbjct  3    SSMKLS--LILFFTCSLFVQGTLADVICENLPANLCSFAIASSGKRCVLE--CHKNTQ-E  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
             +CKTSEVVV   ++ Y+ET++CVKACGV R+SVG+SSD  L + FTA LCSP CY+NCP
Sbjct  58   KKCKTSEVVV-EKLSGYIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDL+FNLAA EG  LP LC K Q+E     R M+ +
Sbjct  117  NIVDLFFNLAASEGVSLPTLC-KNQEE---NHRAMLAI  150



>gb|KCW49488.1| hypothetical protein EUGRSUZ_K03007 [Eucalyptus grandis]
Length=257

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 104/134 (78%), Gaps = 4/134 (3%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            +I CE +P + CAF+++S GKRC+LE      G+VEY+C+TSEVVV   MA Y+E DECV
Sbjct  101  EITCEEIPNDMCAFAIASSGKRCLLETLTSAGGEVEYQCRTSEVVV-ERMAGYVEGDECV  159

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
            +ACGV R+SVG+SSD+L++  FT++LC+P+C+ NCPNIVDLYFNLAAGEG YLPDLC+ +
Sbjct  160  QACGVDRRSVGISSDSLMDPQFTSRLCAPQCFQNCPNIVDLYFNLAAGEGVYLPDLCDAQ  219

Query  487  QKEVGPGRRDMIQL  528
            +       R MI+L
Sbjct  220  RAN---PHRTMIEL  230



>ref|XP_011073216.1| PREDICTED: uncharacterized protein LOC105158240 [Sesamum indicum]
Length=170

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 113/157 (72%), Gaps = 11/157 (7%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            +S+K S  L+L   C+L     +A D+ICENLP N C+F+++S GKRCVLEN    +GK 
Sbjct  3    SSVKLS--LLLFFTCSLFVQITIAEDVICENLPTNLCSFAIASSGKRCVLENHKNAHGKT  60

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
               CKTSEVVV   ++ Y+ETDECVKACGV R+SVG+SSDA L + FTA LCSP CY+ C
Sbjct  61   ---CKTSEVVV-DKLSGYIETDECVKACGVCRESVGLSSDAFLSSKFTAHLCSPACYHKC  116

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMI  522
            PNIVDL+FNLAAGEG  LP LC+ ++ +     R+M+
Sbjct  117  PNIVDLFFNLAAGEGVSLPALCKNQEDK----HREML  149



>ref|XP_008798941.1| PREDICTED: uncharacterized protein LOC103713707 [Phoenix dactylifera]
Length=192

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
            A + CE+LP + CAF++SS  KRCVLE++       EY+C+TSEVVV   M+ ++ETDEC
Sbjct  27   AGVTCEDLPQDLCAFAISSSSKRCVLESTQHSGRPTEYQCRTSEVVVAR-MSNWIETDEC  85

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            VKACGV R SVG+SSD+LLE  FT KLCSP C+ NCPNI+DLYFNLAAGEG  LP+LCE 
Sbjct  86   VKACGVDRNSVGISSDSLLEPQFTEKLCSPACHENCPNIIDLYFNLAAGEGVLLPELCEA  145

Query  484  KQKEVGPGRRDMIQL  528
            ++  V P R  M  L
Sbjct  146  RR--VNPHRSMMTIL  158



>ref|XP_011094949.1| PREDICTED: uncharacterized protein LOC105174518 [Sesamum indicum]
Length=175

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK S  LVL   C+L   G  A+++CE LP N CAF+++S GKRC+LE    + G V++
Sbjct  4    SMKLS--LVLFFTCSLFVQGTFAEVLCEKLPSNLCAFAIASSGKRCILETYRNEQGDVDF  61

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             CKT+EVVV   MA ++E+D+C+ ACGV R+ +G+S+D+ L + FTA LCS  CY+NCPN
Sbjct  62   ICKTTEVVV-ERMAGHIESDQCINACGVEREFIGISTDSFLSSEFTAHLCSSACYHNCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            ++DL+FNLAAGEG  LP LCE +QKE     R M+ L
Sbjct  121  VIDLFFNLAAGEGVSLPALCE-QQKE---NHRAMLTL  153



>ref|XP_008239908.1| PREDICTED: uncharacterized protein LOC103338475 [Prunus mume]
Length=468

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 5/147 (3%)
 Frame = +1

Query  61   MKFSSVLV----LLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            M FS+ L+    +L    LS H  L +I+CE+LP + CAFSVSS GKRC+LE   K +G 
Sbjct  1    MAFSTNLIFLPFILFLSPLSIHAALGEIVCEHLPNDVCAFSVSSSGKRCLLETMSKQDGT  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
            ++Y+C+TS  VV   MAEY+ETD+CVKACGV RKS+G+SSD LL+  F  +LCSP CY  
Sbjct  61   LQYQCRTSGEVV-EKMAEYIETDQCVKACGVDRKSLGISSDTLLDPYFLNRLCSPACYEK  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
            CPNIV+LYFN+A GEG ++P LCE+++
Sbjct  120  CPNIVELYFNMAEGEGVFMPYLCEQER  146



>ref|XP_004234399.1| PREDICTED: uncharacterized protein LOC101252465 [Solanum lycopersicum]
Length=181

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 114/159 (72%), Gaps = 6/159 (4%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS+   +++   LA        L DI CENL  ++CAF++SS GKRCVLE  ++ +G+ 
Sbjct  1    MASLNTLAIVAFALA--FFVQVTLGDIACENLNEDSCAFAISSTGKRCVLEKHVRRSGEE  58

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             Y C+TSE+     + +++ETDEC++ACGV R ++G+SSDALLE+ FT+KLCS  CYN C
Sbjct  59   VYICRTSEIE-SDKLKDWIETDECIEACGVDRNALGISSDALLESRFTSKLCSSACYNKC  117

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNI+DLYFNLAAGEG YLP LC +++   G GRR+M ++
Sbjct  118  PNIIDLYFNLAAGEGVYLPKLCAEQK---GKGRREMAEI  153



>ref|XP_010490608.1| PREDICTED: uncharacterized protein LOC104768360 [Camelina sativa]
Length=182

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 4/157 (3%)
 Frame = +1

Query  61   MKFSSVLVLLLACTL-SFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M + S   LLL  T+ S     A++ICE+LP + C+FS+S+ GKRCVLE  ++  G V+Y
Sbjct  1    MVYVSKACLLLFITICSSTSSHANVICEDLPDDICSFSISASGKRCVLETEVRQTGGVDY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C++SE+ V  +MA Y+ETDECV ACGV R+SVG+SSDALLE  F  KLC+P+C  +CPN
Sbjct  61   RCQSSEIDVDGTMANYIETDECVNACGVDRRSVGISSDALLEPGFAVKLCTPQCLEDCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            I DLYFNL A EG++LPDLC  ++       R M ++
Sbjct  121  IADLYFNLVAAEGSHLPDLCAARRNN---PHRSMFEI  154



>ref|XP_006288746.1| hypothetical protein CARUB_v10002062mg [Capsella rubella]
 gb|EOA21644.1| hypothetical protein CARUB_v10002062mg [Capsella rubella]
Length=183

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 5/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            M S+  + +L+ +  C  SF    A++ICE++P + C+FS+S++GKRCVLE  ++  G +
Sbjct  1    MVSVSKACLLMFITFC--SFTSSHANVICEDIPDDMCSFSISALGKRCVLETEVRQTGGI  58

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             Y C++SEV V  ++A Y+ETDECV ACGV R+SVG+SSDALLE  F  KLC+PEC  +C
Sbjct  59   NYRCRSSEVDVDVTLANYIETDECVNACGVDRRSVGISSDALLEPGFAVKLCTPECLEDC  118

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNI DLY NL A EG++LPDLC  ++       R M ++
Sbjct  119  PNIADLYSNLVAAEGSFLPDLCAARRNN---PHRSMFEI  154



>gb|AFK41674.1| unknown [Lotus japonicus]
Length=198

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MAS-MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS     S+ +L L  +L+  G L  I CENL    C+F+VSS GKRCVLE  +K  G+
Sbjct  1    MASNFSLMSLAILALTFSLAVQGTLGGIECENLSEETCSFAVSSGGKRCVLEKRVKRTGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++ET++CVKACG+ RKS+G+SSD+LLE+ FT +LCSP+CY +
Sbjct  61   EAYTCRTSEIEA-DKLKDHIETEQCVKACGLDRKSLGISSDSLLESRFTHQLCSPQCYQS  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPN+VDLYFNLAAGEG +LP LCE    E G  RR M +L
Sbjct  120  CPNVVDLYFNLAAGEGVFLPMLCE---AEGGNARRGMAEL  156



>ref|XP_006353293.1| PREDICTED: uncharacterized protein LOC102592141 [Solanum tuberosum]
Length=184

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MASMK-FSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS+   +++ ++  A        L DI CENL  ++CAF++SS GKRCVLE  ++ +G+
Sbjct  1    MASLHSLNTLAIVAFALAFLVQVTLGDIACENLNEDSCAFAISSTGKRCVLEKHLRRSGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++ETDEC+  CGV R ++G+SSDALLE+ FT+KLCS  CYNN
Sbjct  61   EVYICRTSEIE-ADKLKDWIETDECIGECGVDRNALGISSDALLESRFTSKLCSSACYNN  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNI+DLYFNLAAGEG YLP LC +++   G GRR+M ++
Sbjct  120  CPNIIDLYFNLAAGEGVYLPKLCAEQK---GNGRREMAEI  156



>ref|XP_009604561.1| PREDICTED: uncharacterized protein LOC104099311 [Nicotiana tomentosiformis]
Length=185

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 6/156 (4%)
 Frame = +1

Query  67   FSSVLVLLLACTLSF--HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            F S  + ++AC L+F     L  I CENL  ++CAF++SS GKRCVLE  ++ +G+  Y 
Sbjct  5    FHSFTLAIVACALAFCVQVTLGSITCENLNKDSCAFAISSTGKRCVLEKRLQRSGEEVYT  64

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            CKTSE+     + +++ETD+C++ACGV R + G+SSD+LLE  FT KLCS +CY +CPNI
Sbjct  65   CKTSEIE-ADKLKDWIETDQCIQACGVDRNTFGISSDSLLECHFTQKLCSLQCYKHCPNI  123

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +DLYFNLAAGEG YLP LCE   ++VG  RR M ++
Sbjct  124  IDLYFNLAAGEGVYLPRLCE---EQVGNARRGMAEI  156



>ref|XP_010423911.1| PREDICTED: uncharacterized protein LOC104708952 [Camelina sativa]
Length=183

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +1

Query  61   MKFSSVLVLLLACTL-SFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            M + S   LLL  T+ S     A++ICE+LP + C+FS+S+ GKRCVLE  ++  G V+Y
Sbjct  1    MVYVSKACLLLFITICSSTSSHANVICEDLPDDICSFSISASGKRCVLETEVRQTGGVDY  60

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C+ SEV V  +MA Y+ETDECV ACGV R+S+G+SSDALL+  F  KLC+PEC  +CPN
Sbjct  61   RCRGSEVDVDGTMANYIETDECVNACGVDRRSIGISSDALLDPGFAVKLCTPECLEDCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            I DLYFNL A EG++LPDLC  ++       R M ++
Sbjct  121  IADLYFNLVAAEGSHLPDLCAARRNN---PHRSMFEI  154



>ref|XP_009421325.1| PREDICTED: uncharacterized protein LOC104000897 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
            A +ICE+LP + CAF+VSS  KRC+LEN+    G+ +Y+C+TSE V    +++++ETDEC
Sbjct  28   AGVICEDLPQDLCAFAVSSASKRCLLENTQLGGGRTDYQCRTSEAVA-EGISDWIETDEC  86

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            V+ACGV R +VG+SSD+LLE  F  K+CS ECY+NCPNIVDLYFNLA+GEG +LPDLCE 
Sbjct  87   VRACGVARGNVGISSDSLLEPDFVQKICSAECYSNCPNIVDLYFNLASGEGVFLPDLCEA  146

Query  484  KQKEVGPGRRDMIQL  528
            ++   G  RR M + 
Sbjct  147  QR---GDPRRAMAEF  158



>emb|CAA58731.1| PAR-1b [Nicotiana tabacum]
Length=185

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = +1

Query  67   FSSVLVLLLACTLSF--HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            F +  + ++AC L F     L  I CENL  ++CAF++SS GKRCVLE  ++ +G+  Y 
Sbjct  5    FHNFTLAIVACALVFCVQVTLGSITCENLNKDSCAFAISSTGKRCVLEKRLQRSGEEVYT  64

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            CKTSE+     + +++ETD+C++ACGV R + G+SSD+LLE  FT KLCSP+CY +CPNI
Sbjct  65   CKTSEIE-ADKLKDWIETDQCIQACGVDRNTFGISSDSLLECHFTQKLCSPQCYKHCPNI  123

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +DLYFNLAAGEG YLP LCE++    G  RR M ++
Sbjct  124  IDLYFNLAAGEGVYLPRLCEEQG---GNARRGMAEI  156



>ref|XP_002322474.1| hypothetical protein POPTR_0015s13050g [Populus trichocarpa]
 gb|ABK94866.1| unknown [Populus trichocarpa]
 gb|EEF06601.1| hypothetical protein POPTR_0015s13050g [Populus trichocarpa]
Length=193

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = +1

Query  67   FSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECK  246
            F+ + VL LA T+   G L +I CE+L  + CA+++SS GKRCVLE S+K  G+  Y C+
Sbjct  5    FNILSVLALALTICVQGTLGEITCEHLDQDTCAYAISSSGKRCVLEKSVKRTGEEAYTCR  64

Query  247  TSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVD  426
            TSE+     +  ++ETD+C+KACG+ RKS+G+SSD+LLE+ F  +LCSP+CY++CPN+VD
Sbjct  65   TSEID-ADRLRNWIETDQCIKACGLDRKSLGISSDSLLESRFAQQLCSPQCYDSCPNVVD  123

Query  427  LYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMI  522
            LYFNLAA EG +LP LCE ++  V   RR ++
Sbjct  124  LYFNLAAAEGVFLPGLCEAQEGNV---RRGLM  152



>ref|XP_011073222.1| PREDICTED: uncharacterized protein LOC105158245 [Sesamum indicum]
Length=171

 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L++   C+L     LA++ICENLP N C+F+++S GKRCVLEN     GK  
Sbjct  3    SSMKLS--LIIFFTCSLFVQNTLANVICENLPTNMCSFAIASSGKRCVLENHKSPQGKT-  59

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
              CKTSEVVV   ++ Y+ETD+CV ACGV R+ VG+SSDA L + FTA LCSP C  NCP
Sbjct  60   --CKTSEVVV-EKLSGYIETDQCVNACGVCREVVGISSDAFLSSEFTAHLCSPACLQNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQK  492
            NIVDL+FNLAA EG  LP LC+ +++
Sbjct  117  NIVDLFFNLAASEGVSLPTLCKNQEE  142



>ref|XP_011073223.1| PREDICTED: uncharacterized protein LOC105158246 [Sesamum indicum]
Length=171

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L   G LA +ICENLP+N C+F+++S G+RCVLE+        E
Sbjct  3    SSMKLS--LILFFTCSLFVQGTLAYVICENLPVNLCSFAIASSGERCVLES---HKNTQE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
             +CK+SEVVV   ++ Y+ET++CVKACGV R+SVG+SSD  L + FTA LCSP CY+NCP
Sbjct  58   KKCKSSEVVV-EKLSGYIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDL+FNLAA EG  LP LC K Q+E     R M+ +
Sbjct  117  NIVDLFFNLAASEGVSLPTLC-KNQEE---NHRAMLAI  150



>ref|XP_010553262.1| PREDICTED: uncharacterized protein LOC104823394 [Tarenaya hassleriana]
Length=162

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 105/149 (70%), Gaps = 7/149 (5%)
 Frame = +1

Query  82   VLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVV  261
            + ++  +L  H  L DIICENLP   CAFS+S+ GKRCVLE    +N   ++ C+TSEV 
Sbjct  9    ISIIVSSLLLHAALGDIICENLPEEMCAFSISASGKRCVLET---ENVAGKFYCRTSEVD  65

Query  262  VGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNL  441
            V   M  ++ETD+C+ ACGV RK+VG+SSD LLE  F AKLCS  CY+NCPNIVDLYFNL
Sbjct  66   V-EGMVNHVETDDCMAACGVDRKTVGISSDKLLEPGFAAKLCSRACYDNCPNIVDLYFNL  124

Query  442  AAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            AAGEGA+LPDLCE  +       R M+++
Sbjct  125  AAGEGAFLPDLCEAHRAN---PHRSMLEI  150



>ref|XP_002279995.1| PREDICTED: uncharacterized protein LOC100267406 [Vitis vinifera]
Length=180

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
              +L  A +L   G L ++ICE LP + C+FS++S GKRC+LE     +G  E +CKTSE
Sbjct  2    AFILFFAFSLLLQGALGELICEGLPTDLCSFSIASSGKRCLLEKCASTDGTTELQCKTSE  61

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            VVV   M+ ++ET++C+ ACGV R S+G+SSD+LL+  FTA+LCS  CY NCPNI+DLYF
Sbjct  62   VVV-DGMSAWIETEQCIHACGVDRNSIGISSDSLLDPQFTAQLCSLACYQNCPNIIDLYF  120

Query  436  NLAAGEGAYLPDLCEKKQKEV  498
            NLA+ EG +LPDLC    + +
Sbjct  121  NLASAEGGFLPDLCANPHRAM  141



>ref|NP_001241627.1| uncharacterized protein LOC100787709 precursor [Glycine max]
 gb|ACU20485.1| unknown [Glycine max]
 gb|KHN21748.1| hypothetical protein glysoja_027632 [Glycine soja]
Length=194

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MAS-MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS     ++++  LA  L+  G L  I CE L  + C+F+VSS GKRCVLE  +K  G+
Sbjct  1    MASNFSLRTLMIFSLAFWLALKGTLGGIECETLSHDTCSFAVSSAGKRCVLEKRVKRTGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++ET++C+KACG+ RKS+G+SSD+LLE+TFT KLCSP CY  
Sbjct  61   EAYTCRTSEIEA-DKLKDHIETEQCIKACGLDRKSLGISSDSLLESTFTQKLCSPHCYQC  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPN+VDLYFNLAAGEG +LP LCE +       RR M +L
Sbjct  120  CPNVVDLYFNLAAGEGVFLPKLCEAQGVN---ARRGMAEL  156



>ref|XP_009770389.1| PREDICTED: uncharacterized protein LOC104221096 [Nicotiana sylvestris]
Length=185

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +1

Query  67   FSSVLVLLLACTLSF--HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            F S  + ++AC L F     L  I CENL  ++C F++SS GKRCVLE  ++ +G+  Y 
Sbjct  5    FHSFTLAIVACALVFCVQVTLGSITCENLNKDSCTFAISSTGKRCVLEKHLRRSGEEVYA  64

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            CKT E+     +  ++ETD+C++ACGV R ++G+SSD+LLE  FT KLCSP+CY +CPNI
Sbjct  65   CKTLEIE-ADKLKNWIETDQCIQACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNI  123

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            VDLYFNLAAGEG YLP LCEK+    G  RR M ++
Sbjct  124  VDLYFNLAAGEGVYLPRLCEKQG---GNARRGMAEI  156



>ref|XP_011094947.1| PREDICTED: uncharacterized protein LOC105174516 [Sesamum indicum]
Length=176

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 7/158 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMKF+   VL  AC+L   G LA++ICENLP N C+F+V+S GKRCVL++      K +
Sbjct  3    SSMKFA--FVLFFACSLFVQGTLAEVICENLPKNLCSFAVASSGKRCVLDHHKNAQEKTD  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
              CKTSEVVV   ++ Y+E+D+CV ACGV R+S  +SSD  L + FTA+LCSP CY NCP
Sbjct  61   CTCKTSEVVV-ERLSGYIESDQCVNACGVHRESAEISSDVFLSSEFTARLCSPACYQNCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIV+L+ NLAAGEG  LP LC+  QKE     R M+ +
Sbjct  120  NIVELFVNLAAGEGVSLPTLCQ-DQKE---NHRAMLAI  153



>ref|XP_004234398.1| PREDICTED: uncharacterized protein LOC101252153 [Solanum lycopersicum]
Length=184

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 113/160 (71%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MASM-KFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS+   +++ ++  A        L  I CENL  ++CAF++SS GKRCVLE  ++ +G+
Sbjct  1    MASLYSLNTLAIVAFALAFLVQLTLGHIACENLNEDSCAFAISSTGKRCVLEKHVRRSGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++ETDEC++ACGV R ++G+SSDALLE  FT KLCS  CYNN
Sbjct  61   EVYICRTSEIE-SDKLKDWIETDECIEACGVDRNALGISSDALLEYRFTRKLCSSACYNN  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNI+DLYFNLAAGEG YLP LC +++   G GRR+M ++
Sbjct  120  CPNIIDLYFNLAAGEGVYLPKLCAEQK---GKGRREMAEI  156



>ref|XP_010326144.1| PREDICTED: uncharacterized protein LOC101261443 [Solanum lycopersicum]
Length=168

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV-  231
            +SMK  S L+L   C+L F  V   + CE+LP + CAF++SS GKRCVLE + K    + 
Sbjct  3    SSMK--SSLILFFTCSL-FLQVAYAVKCESLPNSDCAFAISSTGKRCVLEKAKKPKDDLI  59

Query  232  --EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYN  405
              EYECKTSEV+V  +M E++ETDEC+++CG+ R   G+SSD LLE  F +KLC+P CY 
Sbjct  60   SSEYECKTSEVMV-QNMKEHIETDECIESCGLNRNFFGISSDDLLEPRFVSKLCAPACYQ  118

Query  406  NCPNIVDLYFNLAAGEGAYLPDLCEKKQK  492
             CPNIVDLYFNLAAGEGAYLPD+C K +K
Sbjct  119  QCPNIVDLYFNLAAGEGAYLPDICNKNKK  147



>ref|XP_011073210.1| PREDICTED: uncharacterized protein LOC105158233 [Sesamum indicum]
Length=171

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L     LA++ICENLP N C+F+++S GKRCVLEN     GK  
Sbjct  3    SSMKLS--LILFFTCSLFVQNTLANVICENLPTNLCSFAIASSGKRCVLENHKSPQGKT-  59

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
              CKTSEVVV   ++ Y+ETD+CV ACGV R+S G+SSDA L + FTA LCS  C+ NCP
Sbjct  60   --CKTSEVVV-EKLSGYIETDQCVNACGVCRESFGISSDAFLSSEFTAHLCSSACFQNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQK  492
            NIVDL+FNLAA EG  LP LC+ +++
Sbjct  117  NIVDLFFNLAASEGVSLPTLCKNQEE  142



>ref|XP_009590873.1| PREDICTED: uncharacterized protein LOC104087977 [Nicotiana tomentosiformis]
Length=213

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 106/153 (69%), Gaps = 6/153 (4%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLA--DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            L + L  +L  HG L   +I+CE+L +  CA+SV+S GKRC LE      G   Y+CKTS
Sbjct  3    LTIFLVFSLLIHGALGNGEIVCEDLSVGKCAYSVASSGKRCTLETYESSEGTRGYQCKTS  62

Query  253  EVVVG-SSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDL  429
            EVVV  + +A ++E+DEC+ ACG  R SVG+SSD LLE++FT+KLCS ECY  CPNIVDL
Sbjct  63   EVVVAINGIANWIESDECISACGANRDSVGISSDYLLESSFTSKLCSQECYQKCPNIVDL  122

Query  430  YFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            Y+NLA GEG YLP  C+ K+     GRR+M Q+
Sbjct  123  YYNLALGEGVYLPAFCKGKKLN---GRREMSQI  152



>ref|XP_009599617.1| PREDICTED: uncharacterized protein LOC104095236 [Nicotiana tomentosiformis]
Length=185

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = +1

Query  67   FSSVLVLLLACTLSF--HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            F S  + ++AC L+F     L  I CENL  ++C F++SS GKRC LE  ++ +G+  Y 
Sbjct  5    FHSFTLAIVACALAFCVQVTLGSITCENLNKDSCEFAISSTGKRCALEKHLRRSGEEVYT  64

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            CKTSE+     + +++ETD+C++ACGV R ++G+SSD+LLE  FT KLCSP+CY +CPNI
Sbjct  65   CKTSEIE-ADKLKDWIETDQCIQACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNI  123

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +DLYFNLAAGEG YLP LCE++    G  RR M ++
Sbjct  124  IDLYFNLAAGEGIYLPRLCEEQG---GNARRGMAEI  156



>ref|XP_002510782.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51384.1| conserved hypothetical protein [Ricinus communis]
Length=185

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = +1

Query  103  LSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAE  282
             S  G L +I CENL    C+++VSS GKRCVLE  +K +GK  Y C+ SE+     +  
Sbjct  16   FSKQGTLGEITCENLDQETCSYAVSSSGKRCVLETHVKRSGKASYACRNSEIE-ADRLRN  74

Query  283  YLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAY  462
            ++ETD+C+KACG+ RKS+G+SSD+LLE++FT +LCSP+CY++CPNI+DLYFNLAAGEG +
Sbjct  75   WIETDQCIKACGLDRKSLGISSDSLLESSFTKQLCSPQCYDSCPNIIDLYFNLAAGEGVF  134

Query  463  LPDLCEKKQKEVGPGRRDM  519
            LP LC   Q   G  RR++
Sbjct  135  LPKLC---QATKGNARREL  150



>gb|KHF98264.1| Cytosolic beta-glucosidase [Gossypium arboreum]
Length=184

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 111/157 (71%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK +  ++ L   +      L +IICE+L  + CA++V+S GKRCVLE  +K +G+ EY
Sbjct  6    SMKMTLAILALSLFSSCLQATLGEIICEHLDQDTCAYAVASTGKRCVLEKHVKRSGEEEY  65

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C+TSE+     +  ++ETD+CVK+CG+ RKS G+SSD+LLE+ FT  LCSP+CYN CPN
Sbjct  66   TCRTSEIEA-DKINNWIETDQCVKSCGLDRKSFGISSDSLLESRFTEMLCSPQCYNGCPN  124

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            ++DLYFNLAAGEG +LP LCE ++  +   RR M ++
Sbjct  125  VIDLYFNLAAGEGIFLPKLCEAQKGNI---RRGMSEI  158



>ref|XP_011073220.1| PREDICTED: uncharacterized protein LOC105158243 [Sesamum indicum]
Length=171

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 10/158 (6%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +SMK S  L+L   C+L   G LAD+ICENLP N C+F+++S GKRCVLE     N + E
Sbjct  3    SSMKLS--LILFFTCSLFVQGTLADVICENLPANLCSFAIASSGKRCVLE--CHKNTQ-E  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
             +CK+ EVVV   ++ Y+ET++CVKACGV R+SVG+SSD  L + FTA LCSP CY+NCP
Sbjct  58   KKCKSLEVVV-EKLSGYIETEQCVKACGVCRESVGISSDVFLSSEFTAHLCSPACYHNCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDL+FNLAA EG  LP LC K Q+E     R M+ +
Sbjct  117  NIVDLFFNLAASEGVSLPTLC-KNQEE---NHRAMLAI  150



>ref|XP_009139267.1| PREDICTED: uncharacterized protein LOC103863264 [Brassica rapa]
 emb|CDX76172.1| BnaA04g04360D [Brassica napus]
Length=183

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L  DIICENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEDIICENLPTNMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++EA F AKLCSP C + CP
Sbjct  58   YTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++       R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQRTNP---HRSMLEM  151



>ref|XP_002267610.1| PREDICTED: uncharacterized protein LOC100251502 [Vitis vinifera]
 emb|CBI22724.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 110/152 (72%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S+ VL L   +   G L  I CENL  + CA++VSS GKRCVLE  ++ +G+  Y C+TS
Sbjct  9    SLAVLALTLAVCVQGSLGGITCENLNKDTCAYAVSSSGKRCVLEKHVRRSGEEAYVCRTS  68

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C++ACGV RKS+G+SSD+LLE  FT KLCS +CYN+CPNIVDLY
Sbjct  69   EIEA-DKVKDWVESDQCIEACGVDRKSLGISSDSLLECGFTHKLCSSQCYNSCPNIVDLY  127

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE ++   G  RR+M ++
Sbjct  128  FNLAAGEGVFLPKLCEAQR---GDARREMAEI  156



>emb|CAA58733.1| PAR-1a [Nicotiana tabacum]
Length=185

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +1

Query  67   FSSVLVLLLACTLSF--HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            F S  + ++AC L F     L  I CENL  ++C F++SS GKRCVLE  ++ +G+  Y 
Sbjct  5    FHSFTLAIVACALVFCVQVTLGSITCENLNKDSCTFAISSTGKRCVLEKHLRRSGEEVYA  64

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            CKT E+     +  ++ETD+C++ACGV R ++G+SSD+LLE  FT KLCSP+CY +CPNI
Sbjct  65   CKTLEIE-ADKLKNWIETDQCIQACGVDRNTLGISSDSLLECHFTQKLCSPQCYKHCPNI  123

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            VDLYFNLAAG+G YLP LCEK+    G  RR M ++
Sbjct  124  VDLYFNLAAGQGVYLPRLCEKQG---GNARRGMAEI  156



>ref|XP_010035143.1| PREDICTED: uncharacterized protein LOC104424423 [Eucalyptus grandis]
 gb|KCW46436.1| hypothetical protein EUGRSUZ_K00268 [Eucalyptus grandis]
Length=181

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = +1

Query  82   VLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVV  261
            ++ LA      G L DI CENL   +CAF+VSS GKRCVLE  ++ +G+  Y C++SE+ 
Sbjct  10   LVALAIAFCVQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEAYTCRSSEIE  69

Query  262  VGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNL  441
               ++ +++ETDEC+ ACG+ RK++G+SSD+LLE+ FT KLCS  CY NCPNIVDLYF+L
Sbjct  70   A-DNLKDHIETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSL  128

Query  442  AAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            AAGEG +LP LCE ++   G  RR M ++
Sbjct  129  AAGEGVFLPKLCEAQR---GIARRGMAEI  154



>ref|XP_003592283.1| PAR-1a protein [Medicago truncatula]
 gb|AES62534.1| PAR1 protein [Medicago truncatula]
Length=198

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S+L+  LA +L+  G L  I CENL    C+F+VSS  KRCVLE  +K  G+  Y CKT 
Sbjct  9    SLLIASLAISLAVQGTLGGIECENLSKETCSFAVSSSSKRCVLEKHVKRTGEEAYTCKTL  68

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C+KAC + RKS+G+SSD+LLE++FT KLCSP+CY +CPN+VDLY
Sbjct  69   EIE-ADKLKDHIESDQCIKACDLDRKSLGISSDSLLESSFTKKLCSPQCYKSCPNVVDLY  127

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE +    G  RR M +L
Sbjct  128  FNLAAGEGVFLPKLCEVQG---GNARRGMAEL  156



>ref|XP_011048721.1| PREDICTED: uncharacterized protein LOC105142675 [Populus euphratica]
Length=194

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 109/152 (72%), Gaps = 4/152 (3%)
 Frame = +1

Query  67   FSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECK  246
            F  + VL LA T+   G L +I CE+L  + CA+++SS GKRCVLE S+K  G+  Y C+
Sbjct  5    FHILSVLALALTICVQGTLGEITCEHLDQDTCAYAISSSGKRCVLEKSVKRTGEEAYTCR  64

Query  247  TSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVD  426
             SE+     +  ++ETD+C+KACG+ RKS+G+SSD+LLE+ F  +LCSP+CY++CPN+VD
Sbjct  65   ASEIE-ADRLRNWIETDQCIKACGLDRKSLGISSDSLLESRFAQQLCSPQCYDSCPNVVD  123

Query  427  LYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMI  522
            LYFNLAA EG +LP LCE ++  V   RR ++
Sbjct  124  LYFNLAAAEGVFLPGLCEAQEGNV---RRGLM  152



>ref|XP_006363092.1| PREDICTED: uncharacterized protein LOC102590619 [Solanum tuberosum]
Length=169

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 8/147 (5%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLA----DIICENLPINACAFSVSSIGKRCVLENSIKDNGKV---  231
            S L+L L C+L      A    ++ CE+LP   CAF++SS GKRCVLE +      +   
Sbjct  3    SSLILFLTCSLFLQVAYAVYKTEVKCESLPNGDCAFAISSTGKRCVLEKATTPKDDLISS  62

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            EYECKTSEV+V  +M E++ETDEC+++CG+ R   G+SSD LLE  F +KLC+P CY  C
Sbjct  63   EYECKTSEVIV-ENMKEHIETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACYQEC  121

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQK  492
            PNIVDLYFNLAAGEGAYLPDLC K +K
Sbjct  122  PNIVDLYFNLAAGEGAYLPDLCNKNKK  148



>ref|XP_009103899.1| PREDICTED: uncharacterized protein LOC103829961 isoform X1 [Brassica 
rapa]
 emb|CDX67585.1| BnaA07g16250D [Brassica napus]
Length=186

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L  DI+CENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEDIVCENLPTNMCAFSISASGKRCLLETA---NVTGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++EA F AKLCSP C + CP
Sbjct  58   YTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++  + P  R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQR--INP-HRSMLEI  151



>ref|XP_004496561.1| PREDICTED: uncharacterized protein LOC101495651 [Cicer arietinum]
Length=197

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  52   MAS-MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS   F S ++L  A +L   G L DI CENL    CAF+VSS  KRCVLE  +K  G+
Sbjct  1    MASKFSFESFVILAFAISLVVQGTLGDIECENLNEKTCAFAVSSSSKRCVLEKHVKRTGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TS++     + +++E+D+C+K+C + RKS+G+SSD+LLE+ FT KLCSP+CY +
Sbjct  61   EAYTCRTSDIE-ADKLKDHIESDQCIKSCDLDRKSLGISSDSLLESRFTEKLCSPQCYKS  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCE  480
            CPN+VDLYFNLAAGEG +LP LCE
Sbjct  120  CPNVVDLYFNLAAGEGVFLPKLCE  143



>ref|XP_003555381.1| PREDICTED: uncharacterized protein LOC100784217 [Glycine max]
 gb|KHN26645.1| hypothetical protein glysoja_041469 [Glycine soja]
Length=194

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MAS-MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS     ++++  LA +L+  G L  I CE+L  + C+F+V+S GKRCVLE  +K  G+
Sbjct  1    MASNFSLRTLMIFALAFSLALQGTLGGIECESLSHDTCSFAVTSAGKRCVLEKQVKRTGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++ET++C+KACG+ RKS+G+SSD+LL+++FT KLCSP CY  
Sbjct  61   EAYTCRTSEIE-ADKLKDHIETEQCIKACGLDRKSLGISSDSLLQSSFTQKLCSPICYQC  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPN+VDLYFNLAAGEG +LP LCE +       RR M +L
Sbjct  120  CPNVVDLYFNLAAGEGVFLPKLCEAQGLN---ARRGMAEL  156



>ref|XP_010662746.1| PREDICTED: uncharacterized protein LOC100254969 isoform X3 [Vitis 
vinifera]
Length=186

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MAS-MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS     S+ +L L   +   G L  I CENL  + CAF+VSS GKRCVLE  ++ +G+
Sbjct  1    MASDFGLKSLAILALVLAVCVQGSLGGITCENLNKDTCAFAVSSSGKRCVLEKHVRRSGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++E+D+C++ACG+ RKS+G+SSD+LLE  FT KLCS +CYN 
Sbjct  61   EAYVCRTSEIEA-DKVKDWVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNG  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNIVDLYFN+AAGEG +LP LCE ++   G  RR+M ++
Sbjct  120  CPNIVDLYFNVAAGEGVFLPKLCEAQR---GDARREMAEI  156



>ref|XP_006363091.1| PREDICTED: uncharacterized protein LOC102590281 [Solanum tuberosum]
Length=173

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLA----DIICENLPINACAFSVSSIGKRCVLENSIKDN  222
            +SMK  S L+L   C+L      A    ++ CE+LP   CAF++SS GKRC+LE +    
Sbjct  3    SSMK--SSLILFFTCSLFLQVTYAVYKTEVKCESLPNGDCAFAISSTGKRCILEKATTPK  60

Query  223  GKV---EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSP  393
              +   EYECKTSEV+V  +M E++ETDEC+++CG+ R   G+SSD LLE  F +KLC+P
Sbjct  61   DDLISSEYECKTSEVIV-ENMKEHIETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAP  119

Query  394  ECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQK  492
             CY  CPNIVDLYFNLAAGEGAYLPDLC K  K
Sbjct  120  ACYQECPNIVDLYFNLAAGEGAYLPDLCNKNNK  152



>ref|XP_008377489.1| PREDICTED: uncharacterized protein LOC103440565 [Malus domestica]
Length=198

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
               L  I CENL  +ACAF+VSS GKRCVLE  +K +G+  Y C+TSE+    ++ +++E
Sbjct  22   QATLGGITCENLEHDACAFAVSSSGKRCVLEKHVKRSGEEAYTCRTSEIEA-DNLKDWIE  80

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            +++C+K+CG+ RKS G+SSD+LLE+ FT KLCSP+CY NCPNIVDLYFNLAAGEG +LP 
Sbjct  81   SEKCIKSCGLDRKSYGISSDSLLESRFTQKLCSPQCYGNCPNIVDLYFNLAAGEGVFLPK  140

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE ++      RR+M ++
Sbjct  141  LCEAQEANA---RREMSEI  156



>ref|XP_011073212.1| PREDICTED: uncharacterized protein LOC105158235 [Sesamum indicum]
Length=171

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 108/157 (69%), Gaps = 10/157 (6%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            SMK S  LVL   C+L     L D+ICENLP N C+F+++S GKRCVLEN        E 
Sbjct  4    SMKLS--LVLFFTCSLFVQRTLGDVICENLPTNLCSFAIASSGKRCVLENC---KNTQEK  58

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            +CKTSEVVV   ++ Y+ETD+CV ACGV R+SVG+SSDA L + FTA LCSP C++NCPN
Sbjct  59   KCKTSEVVV-EKLSGYIETDQCVNACGVCRESVGISSDAFLSSKFTAHLCSPACFHNCPN  117

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            IVDL+ NLAA EG  L  LC K Q+E+    R M+ +
Sbjct  118  IVDLFVNLAASEGVSLSTLC-KNQEEI---HRSMLAI  150



>ref|XP_009763985.1| PREDICTED: uncharacterized protein LOC104215785 isoform X1 [Nicotiana 
sylvestris]
Length=209

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 6/153 (4%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLA--DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            L++ L  +   HG L   +I+CE+L +  CA+SV+  GKRC LE      G   Y+CKTS
Sbjct  3    LIIFLVFSFLIHGALGNGEIVCEDLSVGKCAYSVAFSGKRCTLETYESSEGTTGYQCKTS  62

Query  253  EVVVG-SSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDL  429
            EVVV  + +A ++E+DEC+ ACG  R SVG+SSD+LLE++FT+KLCS +CY  CPNIVDL
Sbjct  63   EVVVAINGIANWIESDECISACGANRDSVGISSDSLLESSFTSKLCSQQCYQKCPNIVDL  122

Query  430  YFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            Y+NLA GEG YLP  C+ K      GRR+M Q+
Sbjct  123  YYNLALGEGVYLPAFCKGKNLN---GRREMSQI  152



>gb|AFK34890.1| unknown [Medicago truncatula]
Length=198

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S+L+  LA +L+  G L  I CENL    C+F+VSS  KRCVLE   K  G+  Y CKT 
Sbjct  9    SLLIASLAISLAVQGTLGGIECENLSKETCSFAVSSSSKRCVLEKHAKRTGEEAYTCKTL  68

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C+KAC + RKS+G+SSD+LLE++FT KLCSP+CY +CPN+VDLY
Sbjct  69   EIE-ADKLKDHIESDQCIKACDLDRKSLGISSDSLLESSFTKKLCSPQCYKSCPNVVDLY  127

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE +    G  RR M +L
Sbjct  128  FNLAAGEGVFLPKLCEVQG---GNARRGMAEL  156



>ref|XP_010427069.1| PREDICTED: uncharacterized protein LOC104711981 [Camelina sativa]
Length=183

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L + IICENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGENIICENLPTNMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSD L+EA F AKLCSP+C N CP
Sbjct  58   YTCRTSAVDV-EGIVNHVESDECVAACGVDRKTVGISSDTLMEAGFAAKLCSPDCLNYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+  +       R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAHRMNP---HRSMLEI  151



>ref|XP_006421929.1| hypothetical protein CICLE_v10005988mg [Citrus clementina]
 ref|XP_006490398.1| PREDICTED: uncharacterized protein LOC102613323 [Citrus sinensis]
 gb|ESR35169.1| hypothetical protein CICLE_v10005988mg [Citrus clementina]
 gb|KDO52034.1| hypothetical protein CISIN_1g029827mg [Citrus sinensis]
Length=187

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 105/149 (70%), Gaps = 4/149 (3%)
 Frame = +1

Query  82   VLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVV  261
            V+ LA        L ++ CE+L  NACAF+VS+ GKRCVLE  +K +G+  Y CKTSE+ 
Sbjct  14   VVALAIAFCVQATLGEVTCESLDQNACAFAVSASGKRCVLEKQVKRSGQETYTCKTSEIE  73

Query  262  VGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNL  441
                +  ++ETD+C+K+CG+ RKS+G+SSD+LLE+ FT KLCS  CY +CPNIVDLYFNL
Sbjct  74   A-EKLNNWIETDQCIKSCGLDRKSLGISSDSLLESGFTQKLCSSPCYGSCPNIVDLYFNL  132

Query  442  AAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            AAGEG +LP LCE + K     RR M ++
Sbjct  133  AAGEGVFLPKLCEAQGKGA---RRRMSEI  158



>emb|CDY13179.1| BnaC04g26560D [Brassica napus]
Length=183

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L  DIICENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEDIICENLPTNMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++EA F AK+CSP C + CP
Sbjct  58   YTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEAGFAAKICSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++       R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQRTNP---HRSMLEM  151



>emb|CDY66558.1| BnaC08g48820D [Brassica napus]
Length=181

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 114/161 (71%), Gaps = 12/161 (7%)
 Frame = +1

Query  49   SMASMKFSSVLVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNG  225
            S +S+K S  L+L    +   H  L + IICENLP N CAFS+S+ GKRC+LE +   N 
Sbjct  2    SYSSLKLSIFLIL----SSLLHAALGEGIICENLPTNICAFSISASGKRCLLETA---NV  54

Query  226  KVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYN  405
              EY C+TSEV V   +  ++E+D CV ACGV RK+VG+SSDA++EA F AKLCSP C +
Sbjct  55   AGEYTCRTSEVEV-EGIVNHVESDACVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLD  113

Query  406  NCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             CPNI+DLYFNLAAGEGA+LPDLC+ ++  + P  R M+++
Sbjct  114  YCPNILDLYFNLAAGEGAFLPDLCDAQR--INP-HRSMLEM  151



>emb|CDY60770.1| BnaAnng17210D [Brassica napus]
Length=181

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 114/161 (71%), Gaps = 12/161 (7%)
 Frame = +1

Query  49   SMASMKFSSVLVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNG  225
            S +S+K S  L+L    +   H  L + IICENLP N CAFS+S+ GKRC+LE +   N 
Sbjct  2    SYSSLKLSIFLIL----SSLLHAALGEGIICENLPTNICAFSISASGKRCLLETA---NV  54

Query  226  KVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYN  405
              EY C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++EA F AKLCSP C +
Sbjct  55   AGEYTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLD  113

Query  406  NCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             CPNI+DLYFNLAAGEGA+LPDLC+ ++  + P  R M+++
Sbjct  114  YCPNILDLYFNLAAGEGAFLPDLCDAQR--INP-HRSMLEM  151



>gb|KDP22273.1| hypothetical protein JCGZ_26104 [Jatropha curcas]
Length=184

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G L +I CE+L  + C++++SS GKRCVLE  +K +G+  Y C+TSE+     +  ++E
Sbjct  19   QGTLGEIKCEHLDQDTCSYAISSTGKRCVLEKHVKRSGQESYNCRTSEIEA-DRLRNWIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            +D+C+KACG+ RK++G+SSD+LL++ FT  LCS ECYN+CPN+VDLYFNLAAGEG +LP 
Sbjct  78   SDQCIKACGLDRKTLGISSDSLLDSCFTKHLCSSECYNSCPNVVDLYFNLAAGEGVFLPK  137

Query  472  LCEKKQKEVGPGRRDMI  522
            LCE K+   G GRR++I
Sbjct  138  LCEAKE---GNGRRELI  151



>ref|XP_011045688.1| PREDICTED: uncharacterized protein LOC105140517 [Populus euphratica]
Length=163

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            L++ LA  L  HG L ++ICE LP++ CA+S+++ G+RC+LEN  +++G V+Y+CKT+E+
Sbjct  3    LIIFLAFALLLHGALGELICEQLPVDLCAYSIATSGQRCLLENYEENDGTVKYQCKTTEI  62

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
             V   + E++E+DECV +CG+ R++VG+SSD LL+  F AKLCS ECY  CPNIVDLY N
Sbjct  63   FV-DILNEWIESDECVSSCGLHRETVGVSSDTLLQPQFLAKLCSDECYQACPNIVDLYSN  121

Query  439  LAAGEGAYLPDLC  477
            +A GEG YLP LC
Sbjct  122  MALGEGTYLPTLC  134



>gb|KEH26321.1| PAR1 protein [Medicago truncatula]
Length=192

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 109/152 (72%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            +++++     ++  G L  I CENL  + CAF+VS  GKRCVLE  +K NG+ +Y C+TS
Sbjct  3    NLVIVAFVFFVAVEGTLGGIECENLNQDTCAFAVSYAGKRCVLEKHVKRNGEEKYTCRTS  62

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C+K+CG+ RKS G+SSD+LLE++FT  LCSP+CY +CPNIVDLY
Sbjct  63   EIE-ADKLKDHIESDQCIKSCGLDRKSFGISSDSLLESSFTKNLCSPQCYKSCPNIVDLY  121

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE +       RR+M ++
Sbjct  122  FNLAAGEGVFLPKLCEAQGAN---ARREMAEI  150



>ref|XP_008785460.1| PREDICTED: uncharacterized protein LOC103704086 [Phoenix dactylifera]
Length=174

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = +1

Query  121  LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDE  300
            LA +ICE+LP + CAF++SS  KRCVLE   +  G  +Y+C+TSEVVV   M  ++ETD+
Sbjct  17   LAGVICEDLPQDLCAFAISSSSKRCVLETIPRKGGPTKYQCQTSEVVV-ERMPGWIETDK  75

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCE  480
            CV+ACGV R SVG+SSD+LLE  FT  LCSP C+ NCPNI+DLYFNLAA E  +LPDLC+
Sbjct  76   CVRACGVDRNSVGISSDSLLEPQFTENLCSPACHQNCPNIIDLYFNLAAAEDVFLPDLCK  135

Query  481  KKQKEVGPGRRDMIQL  528
             +Q      RR M+ L
Sbjct  136  ARQGRN--PRRSMLIL  149



>ref|XP_010662745.1| PREDICTED: uncharacterized protein LOC100254969 isoform X1 [Vitis 
vinifera]
Length=186

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S+ +L L   +   G L    CENL  + CAF+VSS GKRCVLE  ++ +G+  Y C+TS
Sbjct  9    SLAILALTLAVCVQGSLGGTTCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTS  68

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C++ACG+ RKS+G+SSD+LLE  FT KLCS +CYN CPNIVDLY
Sbjct  69   EIEA-DKVKDWVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLY  127

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE ++   G  RR+M ++
Sbjct  128  FNLAAGEGVFLPKLCEAQR---GDARREMAEI  156



>ref|XP_008376590.1| PREDICTED: uncharacterized protein LOC103439761 [Malus domestica]
Length=198

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            ++M   ++ VL L+  +     L  I CENL  +ACAF+VSS GKRCVLE  ++ +G+  
Sbjct  3    STMCLKNIAVLALSLAVCVQATLGGITCENLDHDACAFAVSSSGKRCVLEKHVRRSGEEA  62

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TSE+     + +++E++ C+K+CG+ RKS G+SSD+LLE++FT KLCSP+CY +CP
Sbjct  63   YTCRTSEIE-ADKLKDWIESETCIKSCGLDRKSYGISSDSLLESSFTQKLCSPQCYGSCP  121

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDLYFNLAAGEG +LP LC  +       RR+M ++
Sbjct  122  NIVDLYFNLAAGEGVFLPTLCAAQGAN---ARREMSEI  156



>ref|XP_002267611.1| PREDICTED: uncharacterized protein LOC100254969 isoform X2 [Vitis 
vinifera]
 emb|CAN82560.1| hypothetical protein VITISV_031304 [Vitis vinifera]
 emb|CBI22722.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S+ +L L   +   G L    CENL  + CAF+VSS GKRCVLE  ++ +G+  Y C+TS
Sbjct  9    SLAILALTLAVCVQGSLGGTTCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTS  68

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C++ACG+ RKS+G+SSD+LLE  FT KLCS +CYN CPNIVDLY
Sbjct  69   EIEA-DKVKDWVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLY  127

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE ++   G  RR+M ++
Sbjct  128  FNLAAGEGVFLPKLCEAQR---GDARREMAEI  156



>emb|CBI22723.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 111/152 (73%), Gaps = 6/152 (4%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            ++L L+LA  +   G L  I CENL  + CAF+VSS GKRCVLE  ++ +G+  Y C+TS
Sbjct  21   AILALVLA--VCVQGSLGGITCENLNKDTCAFAVSSSGKRCVLEKHVRRSGEEAYVCRTS  78

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     + +++E+D+C++ACG+ RKS+G+SSD+LLE  FT KLCS +CYN CPNIVDLY
Sbjct  79   EIEA-DKVKDWVESDQCIEACGLDRKSLGISSDSLLECGFTRKLCSTQCYNGCPNIVDLY  137

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FN+AAGEG +LP LCE ++   G  RR+M ++
Sbjct  138  FNVAAGEGVFLPKLCEAQR---GDARREMAEI  166



>emb|CAA58732.1| PAR-1c [Nicotiana tabacum]
Length=183

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  52   MASMK-FSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS     ++ ++ LA +      L  I CENL  ++CAF++SS GKRCVLE  ++ +G+
Sbjct  1    MASFHSLKTLAIVALAISYFVQVTLGGIACENLNEDSCAFAISSNGKRCVLEKHLRRSGE  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C+TSE+     + +++ETDEC++ACGV R ++G+SSDALLE+ FT KLCSP CY +
Sbjct  61   EGYTCRTSEIEA-DKLKDWIETDECIEACGVDRNALGISSDALLESRFTNKLCSPACYKH  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNIVDLYFNLAAGEG YLP LC ++    G  RR++ ++
Sbjct  120  CPNIVDLYFNLAAGEGVYLPKLCAEQG---GKARREIAEI  156



>ref|XP_010035141.1| PREDICTED: uncharacterized protein LOC104424421 [Eucalyptus grandis]
 gb|KCW46434.1| hypothetical protein EUGRSUZ_K00266 [Eucalyptus grandis]
Length=181

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 4/142 (3%)
 Frame = +1

Query  103  LSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAE  282
                G L DI CENL   +CAF+VSS GKRCVLE  ++ +G+  Y C++SE+    ++ +
Sbjct  17   FGVQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKD  75

Query  283  YLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAY  462
            ++ETDEC+ ACG+ RK++G+SSD+LLE+ FT KLCS  CY NCPNIVDLYF+LAAGEG +
Sbjct  76   HIETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVF  135

Query  463  LPDLCEKKQKEVGPGRRDMIQL  528
            LP LCE ++   G  RR M ++
Sbjct  136  LPKLCEAQR---GIARRGMGEI  154



>ref|XP_010035139.1| PREDICTED: uncharacterized protein LOC104424419 [Eucalyptus grandis]
 gb|KCW46433.1| hypothetical protein EUGRSUZ_K00265 [Eucalyptus grandis]
Length=181

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 103/142 (73%), Gaps = 4/142 (3%)
 Frame = +1

Query  103  LSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAE  282
                G L DI CENL   +CAF+VSS GKRCVLE  ++ +G+  Y C++SE+    ++ +
Sbjct  17   FGVQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKD  75

Query  283  YLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAY  462
            ++ETDEC+ ACG+ RK++G+SSD+LLE+ FT KLCS  CY NCPNIVDLYF+LAAGEG +
Sbjct  76   HIETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVF  135

Query  463  LPDLCEKKQKEVGPGRRDMIQL  528
            LP LCE ++   G  RR M ++
Sbjct  136  LPKLCEAQR---GIARRGMGEI  154



>gb|EPS70832.1| hypothetical protein M569_03929 [Genlisea aurea]
Length=177

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = +1

Query  82   VLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVV  261
            +L++A +  F   LA++ICE LP + CAF+++S GKRCVLEN++   G+ E+ C+TS VV
Sbjct  8    ILIVAFSFLFQQTLAEVICEELPTDLCAFAIASSGKRCVLENTVNGGGESEFTCETSPVV  67

Query  262  VGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNL  441
            V  S+  Y+ETD+CV ACG  R  VG+SSDA L  +FT+ LC+ EC+ NCPNIVDLY +L
Sbjct  68   V-ESLPGYIETDQCVAACGADRNFVGISSDAFLSPSFTSSLCADECFQNCPNIVDLYVDL  126

Query  442  AAGEGAYLPDLCEKKQKE  495
            AA EG  LPDLC + QKE
Sbjct  127  AAAEGVNLPDLC-RMQKE  143



>ref|XP_010035142.1| PREDICTED: uncharacterized protein LOC104424422 [Eucalyptus grandis]
 gb|KCW46435.1| hypothetical protein EUGRSUZ_K00267 [Eucalyptus grandis]
Length=181

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G L DI CENL   +CAF+VSS GKRCVLE  ++ +G+  Y C++SE+    ++ +++E
Sbjct  20   QGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEAYTCRSSEIEA-DNLKDHIE  78

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TDEC+ ACG+ RK++G+SSD+LLE+ FT KLCS  CY NCPNIVDLYF+LAAGEG +LP 
Sbjct  79   TDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPK  138

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE ++   G  RR M ++
Sbjct  139  LCEAQR---GIARRGMGEI  154



>emb|CDY07560.1| BnaC06g15040D [Brassica napus]
Length=182

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L  DI+CENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEDIVCENLPTNMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++E  F AKLCSP C + CP
Sbjct  58   YTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEEGFAAKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++  + P  R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQR--INP-HRSMLEI  151



>ref|XP_010515917.1| PREDICTED: uncharacterized protein LOC104791676 [Camelina sativa]
Length=183

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 13/160 (8%)
 Frame = +1

Query  61   MKFSSV---LVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            M +SS+   +VL+L+  L  H  L + IICENLP N CAFS+S+ GKRC+LE +   N  
Sbjct  1    MSYSSIKLPIVLILSSLL--HAALGENIICENLPTNMCAFSISASGKRCLLETA---NVA  55

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
             EY C+TS V V   +  ++E+DECV ACGV RK+VG+SSD+L+EA F AK+CSP C + 
Sbjct  56   GEYTCRTSAVDV-EGIVNHVESDECVAACGVDRKTVGISSDSLMEAGFAAKICSPACLDY  114

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNI+DLYFNLAAGEGA+LPDLC+  +       R M+++
Sbjct  115  CPNILDLYFNLAAGEGAFLPDLCDAHRMN---PHRSMLEI  151



>ref|XP_011030114.1| PREDICTED: uncharacterized protein LOC105129658 [Populus euphratica]
Length=191

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            +S    SVL ++LA  +   G L +I CE+L  + CA+++SS GKRCVLE  +K  G+  
Sbjct  3    SSFGILSVLAIVLA--ICVQGTLGEIACEHLDQDTCAYAISSAGKRCVLEKRVKRTGEEA  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TSE+     +  ++ETD+C+KACG+ RKS+G+S+D+LLE++F  +LCSP+CY++CP
Sbjct  61   YTCRTSEIE-ADRLRNWIETDQCIKACGLDRKSLGISTDSLLESSFAQQLCSPQCYDSCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMI  522
            N++DLYFNLAA EG +LP LCE ++   G  RR ++
Sbjct  120  NVIDLYFNLAAAEGVFLPKLCEAQE---GNARRGLM  152



>ref|XP_010035140.1| PREDICTED: uncharacterized protein LOC104424420 [Eucalyptus grandis]
Length=181

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G L DI CENL   +CAF+VSS GKRCVLE  ++ +G+  Y C++SE+    ++ +++E
Sbjct  20   QGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKDHIE  78

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TDEC+ ACG+ RK++G+SSD+LLE+ FT KLCS  CY NCPNIVDLYF+LAAGEG +LP 
Sbjct  79   TDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLAAGEGVFLPK  138

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE ++   G  RR M ++
Sbjct  139  LCEAQR---GIARRGMGEI  154



>ref|XP_009342968.1| PREDICTED: uncharacterized protein LOC103934926 [Pyrus x bretschneideri]
Length=198

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            ++M   ++ VL L+  +     L  I CENL  +ACAF+VSS GKRCVLE  ++ +G+  
Sbjct  3    STMCLKNIAVLALSLAVCVQATLGGITCENLNHDACAFAVSSSGKRCVLEKHVRRSGEEA  62

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TSE+ V   + +++E++ C+K+CG+ RKS G+SSD+LLE+ FT KLCSP+CY +CP
Sbjct  63   YTCRTSEIEV-DKLKDWIESETCIKSCGLDRKSYGISSDSLLESRFTQKLCSPQCYGSCP  121

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NIVDLYFNLAAGEG +LP LC  +       RR++ ++
Sbjct  122  NIVDLYFNLAAGEGVFLPTLCAAQGAN---ARRELSEI  156



>ref|XP_009340031.1| PREDICTED: uncharacterized protein LOC103932203 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009340032.1| PREDICTED: uncharacterized protein LOC103932203 isoform X2 [Pyrus 
x bretschneideri]
Length=198

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
               L  I CENL  +ACAF+VSS GKRCVLE  ++ +G+  Y C+TSE+    ++ +++E
Sbjct  22   QATLGGITCENLEHDACAFAVSSSGKRCVLEKHVRRSGEEAYTCRTSEIEA-DNLKDWIE  80

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            +++C+K+CG+ RKS G+SSD+LLE+ FT KLCSP+CY NCPNIVDLYFNLAAGEG +LP 
Sbjct  81   SEKCIKSCGLDRKSYGISSDSLLESRFTQKLCSPQCYGNCPNIVDLYFNLAAGEGVFLPK  140

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE +       RR+M ++
Sbjct  141  LCEAQGANA---RREMSEI  156



>ref|XP_011073209.1| PREDICTED: uncharacterized protein LOC105158232 [Sesamum indicum]
Length=170

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 111/159 (70%), Gaps = 11/159 (7%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            +S+K S  L+L   C+L     +A D+ICENL  N C+F+++S GKRCVLEN    +GK 
Sbjct  3    SSVKLS--LLLFFTCSLFVQRTIAEDVICENLSTNLCSFAIASSGKRCVLENHKNAHGKT  60

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
               CKTSEVVV   ++ Y+ETDECVKACGV R+SVG+SSD  L + FTA LCSP CY+ C
Sbjct  61   ---CKTSEVVV-DKLSGYIETDECVKACGVCRESVGLSSDVFLSSEFTAHLCSPACYHKC  116

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNIVDL+ NLAAGEG  LP LC+ ++ +     R+M+ +
Sbjct  117  PNIVDLFSNLAAGEGVSLPALCKNQEDK----HREMLAI  151



>ref|XP_002318235.1| hypothetical protein POPTR_0012s13140g [Populus trichocarpa]
 gb|EEE96455.1| hypothetical protein POPTR_0012s13140g [Populus trichocarpa]
Length=191

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 110/157 (70%), Gaps = 5/157 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS  F  + VL +A  +   G L +I CE+L  + CA+++SS GKRCVLE  +K  G+ 
Sbjct  1    MAS-SFRILSVLAIALAICVQGTLGEIACEHLDQDTCAYAISSAGKRCVLEKRVKRTGEE  59

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             Y C+TSE+     +  ++ETD+C+KACG+ RKS+G+S+D+LLE+ F  +LCSP+CY +C
Sbjct  60   AYTCRTSEIE-ADRLRNWIETDQCIKACGLDRKSLGISTDSLLESRFAQQLCSPQCYYSC  118

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMI  522
            PN++DLYFNLAA EG +LP LCE ++   G  RR ++
Sbjct  119  PNVIDLYFNLAAAEGVFLPKLCEAQE---GNARRGLM  152



>ref|XP_006587314.1| PREDICTED: uncharacterized protein LOC100778782 [Glycine max]
Length=199

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 100/143 (70%), Gaps = 4/143 (3%)
 Frame = +1

Query  103  LSFHGVLADII-CENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMA  279
            ++  G L + + CENL  + CAF+VSS GKRCVLE  +K  G+  Y C+TSE+ V   + 
Sbjct  19   VTIQGTLGETLECENLSHDTCAFAVSSEGKRCVLEKRVKRTGEEAYTCRTSEIEVEKQIK  78

Query  280  EYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGA  459
             ++E+DEC+KACG+ RKS G+SSD+L+E  FT  LCSP+CY +CPNIVDLYFNLAAGEG 
Sbjct  79   GHIESDECIKACGLDRKSFGISSDSLMERGFTQNLCSPQCYQSCPNIVDLYFNLAAGEGV  138

Query  460  YLPDLCEKKQKEVGPGRRDMIQL  528
            +LP LC  K       RR M ++
Sbjct  139  FLPKLCAAKGAN---ARRQMAEI  158



>ref|XP_011073591.1| PREDICTED: uncharacterized protein LOC105158505 [Sesamum indicum]
Length=202

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 102/135 (76%), Gaps = 8/135 (6%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
            AD++CENLP N C+F+V+S GKRCVLE      GK   +CKTSEVVV   ++ Y+ETD+C
Sbjct  57   ADVVCENLPTNLCSFAVASSGKRCVLEICKNAQGK---KCKTSEVVV-EKLSGYIETDQC  112

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            V +CGV R+SVG+SSDA L + FTA LCSP CY+NCPNIVDL+FNLAAGEG  LP LC+ 
Sbjct  113  VNSCGVCRESVGLSSDAFLSSKFTAHLCSPACYHNCPNIVDLFFNLAAGEGVSLPALCKN  172

Query  484  KQKEVGPGRRDMIQL  528
            ++++     R+M+ +
Sbjct  173  QEEK----HREMLAI  183



>ref|XP_008370129.1| PREDICTED: uncharacterized protein LOC103433639 [Malus domestica]
Length=228

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 4/134 (3%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            + ICENLP + CAFSVSS GKRC+LE   K +G +EY+C+TSEVVV   +AE +ETDECV
Sbjct  53   EFICENLPNDVCAFSVSSAGKRCLLETMSKKDGSIEYQCRTSEVVV-EGVAEXIETDECV  111

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
            +ACG+ RKSVG+SSD LLE  F AKLCS  CY  CPNI DLYFNLAAGEG +LPDLC K+
Sbjct  112  QACGIDRKSVGISSDTLLEPQFMAKLCSAPCYQKCPNIADLYFNLAAGEGVFLPDLCGKQ  171

Query  487  QKEVGPGRRDMIQL  528
            +       R MI L
Sbjct  172  RSNP---HRAMIAL  182



>ref|XP_002520453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41866.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLEN-SIKDNGKVEYECKTSE  255
            L++ LA +L  HG L +++CE LP+  C++SV+S GKRC+LE  + +++ +V Y+CKTSE
Sbjct  3    LIIFLAVSLLLHGALGELVCEQLPVELCSYSVASFGKRCLLETFATEEDREVIYQCKTSE  62

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            VVV   + E +E+DECV ACG+ R +VG+SSD L E    AKLCS + Y +CPNI+DLYF
Sbjct  63   VVV-DVIQERIESDECVNACGLDRNTVGISSDTLFEPHLLAKLCSSDSYQSCPNIIDLYF  121

Query  436  NLAAGEGAYLPDLCEKKQKEVGPGR  510
            NLA GEG YLPD+C   +  +   R
Sbjct  122  NLALGEGIYLPDICANPRHALSTTR  146



>gb|KEH28949.1| PAR1 protein [Medicago truncatula]
Length=138

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
            H  LA+++CE+LP   C FSV+S GKRC+LE     NG++EY+C+TSEV+V   ++EY+E
Sbjct  19   HASLAEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNGEIEYQCRTSEVIV-ERISEYIE  77

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEG  456
            TD+CV+ACGV R SVG+SSDA  E  FT KLCSP CY  CPNIVDL+FN+AAGEG
Sbjct  78   TDQCVEACGVDRSSVGISSDAFFEPQFTGKLCSPACYKKCPNIVDLFFNMAAGEG  132



>gb|AAM62984.1| photoassimilate-responsive protein PAR-like protein [Arabidopsis 
thaliana]
Length=195

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 108/158 (68%), Gaps = 6/158 (4%)
 Frame = +1

Query  61   MKFSSVLV--LLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M   +VLV  +LL    S      D+ CENL  N CAF+VSS GKRCVLE S+K  G   
Sbjct  1    MALKTVLVAFMLLLAIYSQTTFGDDVKCENLDENTCAFAVSSTGKRCVLEKSMKRTGIEV  60

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C++SE+   + +   +E+DEC+KACG+ RK++G+SSDALLE+ FT KLCS +C N CP
Sbjct  61   YTCRSSEIE-ANKVTNIIESDECIKACGLDRKALGISSDALLESQFTHKLCSVKCLNQCP  119

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            N+VDLYFNLAAGEG YLP LCE ++   G  RR M ++
Sbjct  120  NVVDLYFNLAAGEGVYLPKLCESQE---GKSRRAMSEI  154



>ref|NP_200052.1| PAR1 protein [Arabidopsis thaliana]
 dbj|BAB10536.1| photoassimilate-responsive protein PAR-like protein [Arabidopsis 
thaliana]
 gb|AAM14066.1| putative photoassimilate-responsive protein PAR [Arabidopsis 
thaliana]
 gb|AAM67513.1| putative photoassimilate-responsive protein PAR [Arabidopsis 
thaliana]
 gb|AED96208.1| PAR1 protein [Arabidopsis thaliana]
Length=195

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 109/154 (71%), Gaps = 6/154 (4%)
 Frame = +1

Query  67   FSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECK  246
            F + ++LL   + +  G   D+ CENL  N CAF+VSS GKRCVLE S+K +G   Y C+
Sbjct  7    FVAFMILLAIYSQTTFG--DDVKCENLDENTCAFAVSSTGKRCVLEKSMKRSGIEVYTCR  64

Query  247  TSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVD  426
            +SE+   + +   +E+DEC+KACG+ RK++G+SSDALLE+ FT KLCS +C N CPN+VD
Sbjct  65   SSEIE-ANKVTNIIESDECIKACGLDRKALGISSDALLESQFTHKLCSVKCLNQCPNVVD  123

Query  427  LYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            LYFNLAAGEG YLP LCE ++   G  RR M ++
Sbjct  124  LYFNLAAGEGVYLPKLCESQE---GKSRRAMSEI  154



>ref|XP_006291916.1| hypothetical protein CARUB_v10018100mg [Capsella rubella]
 gb|EOA24814.1| hypothetical protein CARUB_v10018100mg [Capsella rubella]
Length=181

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L + IICENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGENIICENLPTNMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            + C+TS V V   +  ++E+DECV ACGV RK+VG+SSDAL+E+ F +KLCSP C + CP
Sbjct  58   FTCRTSAVDV-EGIVNHVESDECVSACGVDRKTVGISSDALMESGFASKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++       R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQRMN---PHRSMLEI  151



>emb|CDP05191.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 111/156 (71%), Gaps = 7/156 (4%)
 Frame = +1

Query  70   SSVLV---LLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            SS++V   + LAC L       +I CE+L  ++CA++VSS GKRCVLE  ++ +G+ +Y 
Sbjct  6    SSLIVFAFIALACALCVQSTSGNIACEDLKEDSCAYAVSSSGKRCVLEKHVRRSGEEKYT  65

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            C+ S++     + +++ETD+C++ACGV R ++G+SSD+LLE  FT KLCS  CY +CPNI
Sbjct  66   CRASDIEA-EKLKDWIETDKCIEACGVDRHALGISSDSLLEPQFTHKLCSSACYRSCPNI  124

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            VDLYFNLAAGEG YLP LCE ++     GRR+M ++
Sbjct  125  VDLYFNLAAGEGVYLPKLCEAQRAH---GRREMAEI  157



>ref|XP_004246366.2| PREDICTED: uncharacterized protein LOC101261147 [Solanum lycopersicum]
Length=169

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 100/147 (68%), Gaps = 8/147 (5%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLA----DIICENLPINACAFSVSSIGKRCVLENSIKDNGKV---  231
            S L+L L C+L      A    ++ CE+LP   CAF++SS GKRCVLE +      +   
Sbjct  3    SSLILFLTCSLFLQVTYAVYKTEVKCESLPNGDCAFAISSTGKRCVLEKAKTPKDDLISS  62

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            EYECKTSEV+V  +M E++ETDEC+++CG+ R   G+SSD LLE  F +KLC+P CY  C
Sbjct  63   EYECKTSEVMV-QNMKEHIETDECIESCGLNRNFFGISSDDLLEPQFVSKLCAPACYQQC  121

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQK  492
            PNIVDLYFNLA  EGAYLPDLC K  K
Sbjct  122  PNIVDLYFNLAVAEGAYLPDLCNKNNK  148



>ref|XP_004230259.1| PREDICTED: uncharacterized protein LOC101259981 [Solanum lycopersicum]
Length=258

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 104/156 (67%), Gaps = 8/156 (5%)
 Frame = +1

Query  61   MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            MKF    +L  A +L   G L ++ICE LP+  CA S+SS GKRCVLE+   + G  E E
Sbjct  19   MKF----ILFFALSLFLQGALGELICEELPVEMCALSISSDGKRCVLESRPSEEGNNEVE  74

Query  241  CKTSEVVVGSSM-AEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
            C+TSE    + M  EY+ETDECV ACGV R+S+G+SSDAL+++ F AKLCS  CYNNCPN
Sbjct  75   CQTSEAFASNKMLQEYIETDECVGACGVDRQSLGLSSDALVDSKFVAKLCSHHCYNNCPN  134

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQ  525
            I+DLY ++A+ EG  LP +C  ++      RR M Q
Sbjct  135  IIDLYSSVASAEGLSLPKMCASQKTRP---RRGMSQ  167



>ref|XP_006827667.1| hypothetical protein AMTR_s00009p00254330 [Amborella trichopoda]
 gb|ERM95083.1| hypothetical protein AMTR_s00009p00254330 [Amborella trichopoda]
Length=186

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +1

Query  55   ASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            A+++ S  ++++L  T+      A I+CE L  + CAFSVSS G RCVLE  +  +   E
Sbjct  5    AALRTSVAMLMMLVVTIQHTSATAKIVCEQLHKDKCAFSVSSSGTRCVLEQRMTHSTSTE  64

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            YECK SE+   + ++ ++ETD+C++ACG+ R  VG+SSD LLE  F  KLC+ +CY+ CP
Sbjct  65   YECKASEIA-AAHLSNWIETDKCLEACGLNRNMVGISSDFLLEPQFVKKLCATQCYHGCP  123

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI++LYFNLAAGEG YLP LCE ++      RR M ++
Sbjct  124  NILNLYFNLAAGEGVYLPKLCEAQR---ASSRRAMAEI  158



>ref|XP_007038703.1| PAR1 protein [Theobroma cacao]
 gb|EOY23204.1| PAR1 protein [Theobroma cacao]
Length=183

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = +1

Query  118  VLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETD  297
             + +I CE+L  + C ++VSS GKRCVLE  ++ +G+ EY C+TSE+     +  ++ETD
Sbjct  25   TIGEITCEHLDQDTCTYAVSSTGKRCVLEKHVRRSGEEEYTCRTSEIEA-DKIKNWIETD  83

Query  298  ECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            +CVKACG+ RKS G+SSD+LL++ FT  LCSP+CYN+CPN+VDLYFNLAAGEG +LP LC
Sbjct  84   QCVKACGLDRKSFGISSDSLLDSRFTEMLCSPQCYNSCPNVVDLYFNLAAGEGVFLPKLC  143

Query  478  EKKQKEVGPGRRDMIQL  528
            E +       RR M ++
Sbjct  144  EAQGANA---RRGMAEI  157



>emb|CDX76173.1| BnaA04g04370D [Brassica napus]
Length=182

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 110/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L + IICENLP + CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEEIICENLPTSMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++E  F AKLCSP C + CP
Sbjct  58   YTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++       R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQRTNP---HRSMMEM  151



>gb|EYU25099.1| hypothetical protein MIMGU_mgv1a014446mg [Erythranthe guttata]
Length=189

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 4/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MAS  ++S  +      L     L  I C+NL  + C+++VS +GKRCVLE  ++ +G  
Sbjct  1    MAS-PYTSKTLAFFVFALFVQVALGKIECQNLSKDTCSYAVSYVGKRCVLEKHVRRSGVE  59

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
            EY C TSE+     M +++E+DEC+KACG+ R ++G+SSD++LE+ F  KLCS ECY  C
Sbjct  60   EYTCGTSEIEAAGRMKDWIESDECIKACGLDRSALGISSDSMLESHFAGKLCSDECYGGC  119

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PNIVDLYFNLAAGEG YLP LCE +       RR+M ++
Sbjct  120  PNIVDLYFNLAAGEGVYLPKLCEAQGTN---KRREMAEI  155



>ref|XP_009139268.1| PREDICTED: uncharacterized protein LOC103863265 [Brassica rapa]
Length=182

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 109/158 (69%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L + IICENLP + CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEEIICENLPTSMCAFSISASGKRCLLETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+ S V V   +  Y+E+DECV ACGV RK+VG+SSDA++E  F AKLCSP C + CP
Sbjct  58   YTCRNSAVEV-KGIVNYVESDECVAACGVDRKTVGISSDAMMEPGFAAKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEGA+LPDLC+ ++       R M+++
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQRTNP---HRSMMEM  151



>ref|XP_002865911.1| hypothetical protein ARALYDRAFT_918281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42170.1| hypothetical protein ARALYDRAFT_918281 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            ++K   V + LL    S   +  D+ CENL  + CAF+VSS GKRCVLE S++ +G   Y
Sbjct  2    ALKTVFVAITLLLAIYSQTTLGHDVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVY  61

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C++SE+     +   +E+DEC+KACG+ RKS+G+SSDALLE+ FT KLCS +C N CPN
Sbjct  62   TCRSSEIE-ADKVTNIIESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLNQCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +VDL+FNLAAGEG YLP LCE ++   G  RR M ++
Sbjct  121  VVDLFFNLAAGEGVYLPKLCESQE---GKSRRAMSEI  154



>ref|NP_190972.1| PAR1 protein [Arabidopsis thaliana]
 emb|CAB88366.1| photoassimilate-responsive protein PAR-1b-like protein [Arabidopsis 
thaliana]
 gb|AAL62396.1| photoassimilate-responsive protein PAR-1b -like protein [Arabidopsis 
thaliana]
 gb|AAM48022.1| photoassimilate-responsive protein PAR-1b-like protein [Arabidopsis 
thaliana]
 gb|AEE79178.1| PAR1 protein [Arabidopsis thaliana]
Length=183

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = +1

Query  61   MKFSSV--LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M FSS+   + L+  +L    +  +I+CENLP N C+FS+S+ GKRC+LE +   N   E
Sbjct  1    MSFSSLKLPIFLILSSLLHAAIGENIVCENLPTNMCSFSISASGKRCILETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            + C+TS V V   +  ++ETDECV ACGV RK+VG+SSD+L+EA F AKLCS  C + CP
Sbjct  58   FTCRTSAVDV-EGIVNHVETDECVSACGVDRKTVGISSDSLMEAGFAAKLCSSACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            NI+DLYFNLAAGEGA+LPDLC+ ++  + P R  M
Sbjct  117  NILDLYFNLAAGEGAFLPDLCDAQR--MNPQRSMM  149



>ref|XP_006424982.1| hypothetical protein CICLE_v10029842mg [Citrus clementina]
 gb|ESR38222.1| hypothetical protein CICLE_v10029842mg [Citrus clementina]
Length=157

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  121  LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDE  300
            +  IICE LP   C++SVSS GKRC+LEN    +G V Y+CKTSEV+V   + +++ET+E
Sbjct  22   VGGIICEQLPKQLCSYSVSSSGKRCLLENFASSDGTVTYQCKTSEVIV-DVVHDWIETEE  80

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            C  ACGV RKSVG+SSD+LL+  FTAKLCS  CY NCPNIVDLYFNLA GEG + P +C
Sbjct  81   CTNACGVDRKSVGISSDSLLQPQFTAKLCSDACYQNCPNIVDLYFNLALGEGKFHPTIC  139



>ref|XP_009774343.1| PREDICTED: uncharacterized protein LOC104224406, partial [Nicotiana 
sylvestris]
Length=179

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 101/133 (76%), Gaps = 4/133 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            I CENL  ++CAF++SS GKRCVLE  ++ +G+  Y C+TSE+     + +++ETDEC++
Sbjct  23   IACENLNEDSCAFAISSNGKRCVLEKHLRRSGEEGYTCRTSEIE-ADKLKDWIETDECIE  81

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
            ACGV R ++G+SSDALLE+ FT KLCSP CY +CPNIVDLYFNLAAGEG YLP LC ++ 
Sbjct  82   ACGVDRNALGISSDALLESRFTNKLCSPACYKHCPNIVDLYFNLAAGEGVYLPKLCAEQG  141

Query  490  KEVGPGRRDMIQL  528
            K     RR++ ++
Sbjct  142  KS---ARREIAEI  151



>ref|XP_004308085.1| PREDICTED: uncharacterized protein LOC101293047 [Fragaria vesca 
subsp. vesca]
Length=197

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 99/139 (71%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G L  + CENL  + CAF+VSS  KRCVLE  IK +G+  Y C+TSE+     + +++E
Sbjct  22   QGTLGGVTCENLDESTCAFAVSSSAKRCVLEKHIKRSGEEAYTCRTSEIEA-DKLKDWIE  80

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            ++EC+K+CG+ RKS G+SSD+LLE+ F  KLCSP+CY +CPNIVDLYFNLAAGEG +LP 
Sbjct  81   SEECIKSCGLDRKSYGISSDSLLESCFAQKLCSPQCYGSCPNIVDLYFNLAAGEGVFLPK  140

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE +       RR M ++
Sbjct  141  LCEAQGANA---RRQMSEI  156



>ref|XP_010060939.1| PREDICTED: uncharacterized protein LOC104448745 [Eucalyptus grandis]
 gb|KCW90697.1| hypothetical protein EUGRSUZ_A02782 [Eucalyptus grandis]
Length=183

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +1

Query  115  GVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLET  294
            G L  I+CENL  ++CAF+VSS GKRCVLE  +  +G+  Y C+ S +  G  + +Y+ET
Sbjct  24   GTLGGIVCENLNHDSCAFAVSSSGKRCVLEKQVTRSGEEAYTCRQSGIEAGG-LRDYIET  82

Query  295  DECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDL  474
            D+C+ +CGV R+++G++SDALLE  F  +LCS +CY +CPNIVDLYFNLAAGEG +LP L
Sbjct  83   DQCIGSCGVDRRTLGIASDALLEPHFAQQLCSSKCYGSCPNIVDLYFNLAAGEGVFLPKL  142

Query  475  CEKKQKEVGPGRRDMIQL  528
            CE +++E    RR M ++
Sbjct  143  CEAERQEK---RRGMAEI  157



>ref|XP_010923168.1| PREDICTED: uncharacterized protein LOC105046307 isoform X2 [Elaeis 
guineensis]
Length=181

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 9/130 (7%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            +ICE+LP + CAF++SS  KRCVLE+   + G  EY+C+TSEVVV   M++++ETDECVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
            ACGV R +VG+SSD+LLE  FT K+CSP C+ NCPNI+DLYFNLAA E     DLCE ++
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAE-----DLCEARR  146

Query  490  KEVGPGRRDM  519
               G  RR M
Sbjct  147  ---GNPRRSM  153



>ref|XP_010452028.1| PREDICTED: uncharacterized protein LOC104734198 [Camelina sativa]
Length=183

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
            +L+ +  C+ ++    A++ICE+LP +  +FS+S+ GKRCVLE  ++  G V+Y C++SE
Sbjct  9    LLLFITICSSTYSH--ANVICEDLPDDIYSFSISASGKRCVLETEMRQTGGVDYRCRSSE  66

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            V V  +MA Y+ETDECV ACGV R+S+G+SSDALL+  F  KLC+PEC  +CPNI DLY 
Sbjct  67   VDVDGTMANYIETDECVNACGVDRRSLGISSDALLDPGFAVKLCTPECLEDCPNIADLYS  126

Query  436  NLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             L A EG++LPDLC  ++       R M ++
Sbjct  127  ILVAAEGSHLPDLCAARRNN---PHRSMFEI  154



>ref|XP_002862543.1| hypothetical protein ARALYDRAFT_920570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38801.1| hypothetical protein ARALYDRAFT_920570 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            D+ CENL  + CAF+VSS GKRCVLE S++ +G   Y C++SE+     +   +E+DEC+
Sbjct  23   DVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVYTCRSSEIE-ADKVTNIIESDECI  81

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
            KACG+ RKS+G+SSDALLE+ FT KLCS +C N CPN+VDL+FNLAAGEG YLP LCE +
Sbjct  82   KACGLDRKSLGISSDALLESRFTQKLCSVKCLNQCPNVVDLFFNLAAGEGVYLPKLCESQ  141

Query  487  QKEVGPGRRDMIQL  528
            +   G  RR M ++
Sbjct  142  E---GKSRRAMSEI  152



>ref|XP_009127249.1| PREDICTED: uncharacterized protein LOC103852106 [Brassica rapa]
Length=210

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 5/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MA   F  V +LLLA  L    +  ++ CE L  + CAF+VSS GKRCVLE SIK +G  
Sbjct  1    MAMKTFFVVSMLLLAVYLQ-TTLGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIE  59

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             Y C++SE+     +   +E+DEC+KACG+ RKS+G+SSDALLE+ FT KLCS +C   C
Sbjct  60   GYTCRSSEIE-ADKVTNIIESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQC  118

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PN+VDL+FNLAAGEG YLP LCE ++   G  RR M +L
Sbjct  119  PNVVDLFFNLAAGEGVYLPKLCESQE---GQSRRAMSEL  154



>ref|XP_002877953.1| hypothetical protein ARALYDRAFT_485800 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54212.1| hypothetical protein ARALYDRAFT_485800 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLAD-IICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L + IICENLP   CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGENIICENLPTTMCAFSISASGKRCILETA---NVAGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            + C+TS V V   +  ++ETDECV ACGV RK+VG+SSD+L+EA F AKLCS  C + CP
Sbjct  58   FTCRTSAVDV-EGIVNHVETDECVSACGVDRKTVGISSDSLMEAGFAAKLCSSACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NI+DLYFNLAAGEG +LPDLC+ ++       R M+++
Sbjct  117  NILDLYFNLAAGEGVFLPDLCDAQRMN---PHRSMLEI  151



>ref|XP_011032296.1| PREDICTED: uncharacterized protein LOC105131158 [Populus euphratica]
Length=179

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            L+  LA +L  +G L +++CE LP++ C++S+++ GKRC+LEN    +G V+Y+CKTSEV
Sbjct  3    LIAFLALSLLLNGALGELVCEQLPVDFCSYSIATSGKRCLLENYATKDGGVKYQCKTSEV  62

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            VV   + E++E DEC+ ACG+ R +VG+SSD+LL+  F  KLCS  C   CPNIVDLY N
Sbjct  63   VV-DKLNEWIEIDECITACGLNRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLYSN  121

Query  439  LAAGEGAYLPDLCEKKQKEVGPGRRD  516
            LA  EG YLP+LC   ++ +   R +
Sbjct  122  LALAEGVYLPNLCASPRRAMYQTRSN  147



>ref|XP_011076161.1| PREDICTED: uncharacterized protein LOC105160472 [Sesamum indicum]
Length=189

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 97/139 (70%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G    I CENL  ++CAF+VSS GKRCVLE  ++ +G  EY C TS++     M  ++E
Sbjct  25   QGTFGTIECENLNKDSCAFAVSSTGKRCVLEKHVRRSGAEEYACATSQIEA-DKMKNWIE  83

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TD C+ ACG+ R ++G+SSD+LLE+ F  KLCS +CY  CPN+VDLYFNLAAGEGAYLP 
Sbjct  84   TDACIDACGLDRSALGISSDSLLESRFVRKLCSQQCYRGCPNVVDLYFNLAAGEGAYLPK  143

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE +  +    RR+M ++
Sbjct  144  LCEAQGAKA---RREMAEI  159



>emb|CDP09133.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
            ++++LLA +L   G L +++CE LPI  C+F+V+S GKRC LE     +GK+  +C++SE
Sbjct  3    LMIILLAVSLFLQGALGELVCEELPIKMCSFAVASSGKRCSLETYAAKDGKIGLQCRSSE  62

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            ++   ++ E++E DEC+ ACGV RK+VG+SSD L +   T K+CSP+C +NC NIVDLY 
Sbjct  63   ILASDNIHEHIEKDECISACGVSRKTVGISSDNLFQPRHTHKICSPKCQHNCLNIVDLYS  122

Query  436  NLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NLA  EG YLP +C KK  E G  R++M ++
Sbjct  123  NLALAEGLYLPGVC-KKALESG-SRQEMSEI  151



>ref|XP_011085664.1| PREDICTED: uncharacterized protein LOC105167590 [Sesamum indicum]
Length=254

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            D+ICENLP   C+F+V+S GKRCVLEN     GK +Y CKTSEVVV   ++ Y+ET++C+
Sbjct  107  DVICENLPTKLCSFAVASSGKRCVLENYKNAQGKTDYTCKTSEVVV-EKLSGYIETNQCM  165

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
             ACGV R+ +G+SS+A L + FTA+LCS  CY NCPNIVDL+FNLA GEG  LP LC+ +
Sbjct  166  NACGVHREFIGISSEAFLSSEFTARLCSSACYQNCPNIVDLFFNLAVGEGISLPALCQNQ  225

Query  487  QK  492
            ++
Sbjct  226  KE  227



>ref|XP_004240617.1| PREDICTED: uncharacterized protein LOC101257567 [Solanum lycopersicum]
Length=191

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 105/154 (68%), Gaps = 7/154 (5%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLA---DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKT  249
            L++ L  +   HG LA   +I+CE+L +  CA+SV+S GKRC LE+     G   Y+CKT
Sbjct  3    LIIFLVFSFVIHGALASNGEIVCEDLSVGLCAYSVASSGKRCSLESYESIKGTRGYQCKT  62

Query  250  SEVVVGS-SMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVD  426
            S+V+V +  +   +E+DEC+ ACG  R S+G+SSD+LLE+TFT+KLCS EC   CPNIVD
Sbjct  63   SDVLVSNIDITNSIESDECISACGADRNSLGISSDSLLESTFTSKLCSQECNQKCPNIVD  122

Query  427  LYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            LY+NLA GEG YLP  C+ +      GRR+M Q+
Sbjct  123  LYYNLALGEGVYLPAFCKGRNLN---GRREMSQI  153



>ref|XP_010273059.1| PREDICTED: uncharacterized protein LOC104608702 [Nelumbo nucifera]
Length=200

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 97/139 (70%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G L  I CE+L  N CAF+VSS G RCVLE  +K +G   Y C+TSE+     + +++E
Sbjct  23   QGTLGGITCEHLDKNTCAFAVSSSGTRCVLEKHVKRSGDEVYTCRTSEIE-ADKLKDWVE  81

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TDEC++ACG+ R ++G+SSDAL+E  F  KLCS  CY+NCPNI+DLYFNLAAGEG +LP 
Sbjct  82   TDECIQACGLNRNTLGISSDALVEPCFVHKLCSSRCYDNCPNIIDLYFNLAAGEGIFLPK  141

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE +       RR+M ++
Sbjct  142  LCEAQGAN---ARREMSEI  157



>ref|XP_008794209.1| PREDICTED: uncharacterized protein LOC103710316 [Phoenix dactylifera]
Length=199

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 106/160 (66%), Gaps = 8/160 (5%)
 Frame = +1

Query  61   MKFS----SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            M FS    + + ++LA  L    VL  + CE L  + CAF+VSS G RCVLE  ++  G+
Sbjct  1    MAFSYTSKAFIAIILALNLLVPQVLGAVTCERLDRSTCAFAVSSAGTRCVLEKRVRRGGQ  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
             EY C+ S +     + +++ETDEC++ACG+GR ++G+SSD+LL++ FT KLCS  C+N 
Sbjct  61   EEYTCRASRIE-ADGLKDHVETDECLEACGLGRDTLGISSDSLLDSRFTQKLCSARCFNG  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPNIV+LYFNLAAGEG +LP LCE  +      RR M ++
Sbjct  120  CPNIVNLYFNLAAGEGVFLPKLCETHRTS---NRRTMAEI  156



>ref|XP_009599697.1| PREDICTED: uncharacterized protein LOC104095302, partial [Nicotiana 
tomentosiformis]
Length=180

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (75%), Gaps = 4/135 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
             DI CENL  ++CAF++SS GKRCVLE  ++ +G+  Y C+TSE+     + +++ET+EC
Sbjct  22   GDIACENLNEDSCAFAISSNGKRCVLEKHLRRSGEEVYTCRTSEIE-ADKLKDWIETNEC  80

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            ++ACGV R ++G+SSDALLE+ FT KLCS  CY +CPNIVDLYFNLAAGEG YLP LC +
Sbjct  81   IEACGVDRNALGISSDALLESRFTNKLCSLACYKHCPNIVDLYFNLAAGEGVYLPKLCAE  140

Query  484  KQKEVGPGRRDMIQL  528
            + K     RR++ ++
Sbjct  141  QGKS---ARREIAEI  152



>ref|XP_009601817.1| PREDICTED: uncharacterized protein LOC104097019 [Nicotiana tomentosiformis]
Length=186

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 111/162 (69%), Gaps = 7/162 (4%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGV-LADIICENL--PINACAFSVSSIGKRCVLENSIKDN  222
            MAS      L ++     SF  V L DI CENL    ++CAF++SS GKRCVLE  ++ +
Sbjct  1    MASFHSLKTLAIVALAISSFVQVTLGDIACENLNEXEDSCAFAISSNGKRCVLEKHLRRS  60

Query  223  GKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECY  402
            G+  Y C+TSE+     + +++ET+EC++ACGV R ++G+SSDALLE+ FT KLCS  CY
Sbjct  61   GEEVYTCRTSEIE-ADKLKDWIETNECIEACGVDRNALGISSDALLESRFTNKLCSLACY  119

Query  403  NNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             +CPNIVDLYFNLAAGEG YLP LC ++ K     RR++ ++
Sbjct  120  KHCPNIVDLYFNLAAGEGVYLPKLCAEQGKS---ARREIAEI  158



>ref|XP_010671872.1| PREDICTED: uncharacterized protein LOC104888551 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +1

Query  52   MASMKFSSVLVLL-LACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS+     LV L L  +L   G L ++ CE L   ACAF+VSSIGKRCVLE  ++ +G 
Sbjct  1    MASLFNMITLVFLALLSSLLIQGTLGEVTCEQLNKEACAFAVSSIGKRCVLEKYVRRSGL  60

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y+C TS +     + + +E++ C++ACG+ R ++G+SSD+LLE+ FT KLCSP+CY  
Sbjct  61   EAYKCTTSAIDT-DELKDMVESNHCIEACGLDRDTLGISSDSLLESRFTRKLCSPQCYQK  119

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQK  492
            CPN+VDLYFNLAAGEG +LP LCE + +
Sbjct  120  CPNVVDLYFNLAAGEGVFLPKLCESQSQ  147



>ref|XP_010255407.1| PREDICTED: uncharacterized protein LOC104596084 [Nelumbo nucifera]
Length=204

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = +1

Query  52   MASMKFSSVLV--LLLACTLSFHGVLAD--IICENLPINACAFSVSSIGKRCVLENSIKD  219
            MAS   S  L+  L LA T+   G L    I CENL  ++CAF+VSS G RCVLE  ++ 
Sbjct  3    MASFLSSRTLMACLALALTICVKGTLGGGGIRCENLGKDSCAFAVSSSGTRCVLEKKVRR  62

Query  220  NGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPEC  399
            +G+  Y C++SE+     + +++E+DEC++ACG+ R SVG+SSDALLE  FT  LCS  C
Sbjct  63   SGEEVYTCRSSEIEA-DKLKDWIESDECIEACGLSRNSVGISSDALLEPCFTQHLCSSHC  121

Query  400  YNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            Y NCPNIVDLYFNLAAGEG +LP LCE +       RR M ++
Sbjct  122  YANCPNIVDLYFNLAAGEGVFLPKLCEVQGTN---ARRQMSEI  161



>ref|XP_006358715.1| PREDICTED: uncharacterized protein LOC102594490 [Solanum tuberosum]
Length=177

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 106/154 (69%), Gaps = 6/154 (4%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLA--DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKT  249
            ++ + L  +L  HG L   +I+CE+L I  CA+SV+S GKRC LE+     G+  Y+CKT
Sbjct  3    LITIFLGFSLLVHGALGSGEIVCEDLSIGMCAYSVASSGKRCSLESYESIEGRRGYQCKT  62

Query  250  SEVVVGS-SMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVD  426
            SEV+V +  +   +E+DEC+ ACG  R S+G+SSD+LLE++FT+KLCS +C   CPNIVD
Sbjct  63   SEVLVSNIGITNLIESDECISACGADRNSLGISSDSLLESSFTSKLCSQQCCQKCPNIVD  122

Query  427  LYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            LY+NLA GEG YLP  C+ +      GRR+M Q+
Sbjct  123  LYYNLALGEGVYLPAFCKGRDLN---GRREMSQI  153



>ref|XP_006388430.1| hypothetical protein POPTR_0187s00200g [Populus trichocarpa]
 gb|ERP47344.1| hypothetical protein POPTR_0187s00200g [Populus trichocarpa]
Length=180

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            +VL     C   ++  L +++CE LP++ C++S+++ GKRC+LEN    +G V+Y+CKTS
Sbjct  3    AVLNCFFYCLTWYY--LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTS  60

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            EVVVG  ++E++E DEC+ ACG+ R +VG+SSD+LL+  F  KLCS  C   CPNIVDLY
Sbjct  61   EVVVGIVLSEWIEIDECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLY  120

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRD  516
             NLA  EG YLP+LC   ++ +   R +
Sbjct  121  SNLALAEGVYLPNLCASPRRAMYQTRSN  148



>ref|XP_008778806.1| PREDICTED: uncharacterized protein LOC103698551 [Phoenix dactylifera]
 ref|XP_008779191.1| PREDICTED: uncharacterized protein LOC103698922 [Phoenix dactylifera]
Length=192

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 95/137 (69%), Gaps = 5/137 (4%)
 Frame = +1

Query  118  VLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETD  297
             L  I CE+L  N CAF+VSS G RCVLEN ++  G+ E+ C TS++    ++ +++ETD
Sbjct  24   TLGGITCESLARNTCAFAVSSSGMRCVLENRVRRGGQEEFSCSTSDIEA-ENLKDWVETD  82

Query  298  ECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            EC+KACG+ R +VG+SSD+LL+  F  KLCSP CY  CPNIVDLYFNLAAGEG +LP LC
Sbjct  83   ECIKACGLTRSTVGISSDSLLDPRFAQKLCSPPCYQECPNIVDLYFNLAAGEGVFLPKLC  142

Query  478  EKKQKEVGPGRRDMIQL  528
            +         RR M ++
Sbjct  143  QASSN----ARRGMEEI  155



>ref|XP_010909892.1| PREDICTED: uncharacterized protein LOC105035875 [Elaeis guineensis]
Length=193

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            + + L+LA  L    VL  + CE L  + CAF+VSS G RCVLE  ++  G+ EY C+ S
Sbjct  3    AFIALVLALYLFVPHVLGAVTCERLDRSTCAFAVSSAGTRCVLEKRVRRGGQEEYTCRAS  62

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
             V     + +++ETDEC+KACG+ R S+G+SSD+LL++ FT KLCS  CYN CPNIV+LY
Sbjct  63   RVE-ADGLKDHVETDECLKACGLVRGSLGISSDSLLDSRFTQKLCSARCYNGCPNIVNLY  121

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LC+  +      RR M ++
Sbjct  122  FNLAAGEGVFLPKLCKTHRAS---KRRAMAEI  150



>ref|XP_007218440.1| hypothetical protein PRUPE_ppa011685mg [Prunus persica]
 gb|EMJ19639.1| hypothetical protein PRUPE_ppa011685mg [Prunus persica]
Length=200

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 98/139 (71%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
               L  I CE+L  + CAF+VSS  KRCVLE  ++ +G+  Y C+TSE+     + +++E
Sbjct  22   QATLGAITCEDLDKDTCAFAVSSSSKRCVLEKHVRRSGEEAYTCRTSEIE-ADKLKDWVE  80

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            +++C+K+CG+ RKS G+ SD+LLE+ FT KLCSP+CYN CPNIVDLYFNLAAGEG +LP 
Sbjct  81   SEQCIKSCGLDRKSYGICSDSLLESRFTQKLCSPQCYNTCPNIVDLYFNLAAGEGVFLPK  140

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE +       RR M ++
Sbjct  141  LCEAQGAN---ARRQMSEI  156



>emb|CDY60088.1| BnaC02g45000D [Brassica napus]
Length=210

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 5/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MA   F  V +LLLA  L    +  ++ CE L  + CAF+VSS GKRCVLE SIK +G  
Sbjct  1    MAMKTFFVVSMLLLAVYLQ-TTLGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIE  59

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             Y C++SE+     +   +E+DEC+KACG+ RKS+G+SSDALLE+ FT KLCS +C   C
Sbjct  60   GYTCRSSEIE-ADKVTNIIESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQC  118

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PN+VDL+ NLAAGEG YLP LCE ++   G  RR M +L
Sbjct  119  PNVVDLFSNLAAGEGVYLPKLCESQE---GQSRRAMSEL  154



>ref|XP_010529780.1| PREDICTED: uncharacterized protein LOC104806532 [Tarenaya hassleriana]
Length=168

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 4/122 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
             +IICE+LP   CAFS+S+ GKRC+LE    +N   ++ C+TSEV V   +  ++ETD+C
Sbjct  23   GEIICEDLPAKTCAFSISAAGKRCLLET---ENVAGKFYCRTSEVDV-EGILNHVETDDC  78

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            V ACGV RK+VG+SSDALLE  F AKLCS  CY+ CPNIVDLYFNLA GEGA+LPDLCE 
Sbjct  79   VAACGVDRKTVGISSDALLEPGFAAKLCSSACYDFCPNIVDLYFNLAVGEGAFLPDLCEA  138

Query  484  KQ  489
             +
Sbjct  139  HR  140



>ref|XP_010909577.1| PREDICTED: uncharacterized protein LOC105035650 [Elaeis guineensis]
Length=199

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = +1

Query  118  VLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETD  297
             L  I CE+L  + CAF+VSS G RCVLEN ++  G+ E+ C+TS++    ++ +++ETD
Sbjct  24   TLGGITCESLDRSTCAFAVSSSGMRCVLENRLRRGGQEEFSCRTSDIEA-ENLKDWVETD  82

Query  298  ECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            +C+ ACG+ R +VG+SSD+LLE  F  KLCSP+CY  CPN+VDLYFNLAAGEG +LP LC
Sbjct  83   KCINACGLTRNTVGISSDSLLEPQFAQKLCSPQCYQECPNVVDLYFNLAAGEGVFLPKLC  142

Query  478  EKKQKEVGPGRRDMIQL  528
            +         RR M ++
Sbjct  143  QASSN----ARRSMAEI  155



>gb|AFG47187.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47188.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47191.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47192.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47193.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47195.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47196.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47197.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47198.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47199.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47200.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 5/121 (4%)
 Frame = +1

Query  160  CAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVG  339
            CAFSVSS G RCVLE SI  +G ++YEC++SEV+   +M E++ETDEC+ ACGV R +VG
Sbjct  3    CAFSVSSSGARCVLEKSILRDGNMQYECQSSEVIA-ENMKEWIETDECMNACGVERMTVG  61

Query  340  MSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            MS+D++ E  FT  LC P CYN CPNI+DLYFNLAAGEG YLP LC+  +     G R M
Sbjct  62   MSTDSIAERGFTGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRS----GDRRM  117

Query  520  I  522
            +
Sbjct  118  M  118



>gb|ABK24725.1| unknown [Picea sitchensis]
Length=167

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +1

Query  100  TLSFHGVLADII-CENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSM  276
            T++ HGV + II CE LP   CAFS+SS G RCVLE  +  +G ++++C++S VV+   +
Sbjct  2    TITVHGVQSAIIKCEELPAELCAFSISSSGNRCVLEKDLMMDGTLQFQCQSS-VVLVEKL  60

Query  277  AEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEG  456
             E++E++EC+ ACG+ R +VGMS+D+LLE  F+AKLCS EC NNCPNIVDLY NLAAGEG
Sbjct  61   VEWIESEECINACGLERMAVGMSTDSLLEPEFSAKLCSSECRNNCPNIVDLYVNLAAGEG  120

Query  457  AYLPDLCEKKQ  489
              L  +C  ++
Sbjct  121  ISLSSMCASQK  131



>gb|AFG47186.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47189.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47190.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47194.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
 gb|AFG47201.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 5/121 (4%)
 Frame = +1

Query  160  CAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVG  339
            CAFSVSS G RCVLE SI  +G ++YEC++SEV+   +M E++ETDEC+ ACGV R +VG
Sbjct  3    CAFSVSSSGARCVLEKSILRDGNMQYECQSSEVIA-ENMKEWIETDECMNACGVERMTVG  61

Query  340  MSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            MS+D++ E  FT  LC P CYN CPNI+DLYFNLAAGEG YLP LC+  +     G R M
Sbjct  62   MSTDSIAERGFTGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRS----GDRRM  117

Query  520  I  522
            +
Sbjct  118  M  118



>ref|XP_010482600.1| PREDICTED: uncharacterized protein LOC104761248 isoform X2 [Camelina 
sativa]
Length=195

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            +MK   V  +LL    S   +  ++ CENL  + CAF+VSS GKRCVLE S++ +G   Y
Sbjct  2    AMKTVFVTSMLLLAIYSQTTLGHEVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVY  61

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C++S +     +   +E++EC++ACG+ RKS+G+SSDALLE+ FT KLCS +C+N CPN
Sbjct  62   SCRSSGIE-SDKVTNIIESNECIEACGLDRKSLGISSDALLESRFTQKLCSAKCFNQCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +VDL+FNLAAGEG +LP LCE ++   G  RR M ++
Sbjct  121  VVDLFFNLAAGEGVFLPKLCESQR---GKTRRAMSEI  154



>emb|CDY27075.1| BnaA02g10950D [Brassica napus]
Length=401

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 5/159 (3%)
 Frame = +1

Query  52   MASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV  231
            MA   F  V +LLLA  L    +  ++ CE L  + CAF+VSS GKRCVLE SIK +G  
Sbjct  1    MAMKTFFVVSMLLLAVYLQ-TTLGNEVKCEKLDKDTCAFAVSSTGKRCVLEQSIKRSGIE  59

Query  232  EYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNC  411
             Y C++SE+     +   +E+DEC+KACG+ RKS+G+SSDALLE+ FT KLCS +C   C
Sbjct  60   GYTCRSSEIE-ADKVTNIIESDECIKACGLDRKSLGISSDALLESRFTQKLCSVKCLTQC  118

Query  412  PNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            PN+VDL+FNLAAGEG YLP LCE ++   G  RR M +L
Sbjct  119  PNVVDLFFNLAAGEGVYLPKLCESQE---GQSRRAMSEL  154



>ref|XP_010923169.1| PREDICTED: uncharacterized protein LOC105046307 isoform X3 [Elaeis 
guineensis]
Length=169

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            +ICE+LP + CAF++SS  KRCVLE+   + G  EY+C+TSEVVV   M++++ETDECVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGE-GAY  462
            ACGV R +VG+SSD+LLE  FT K+CSP C+ NCPNI+DLYFNLAA E G Y
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAEDGRY  143



>gb|EYU38454.1| hypothetical protein MIMGU_mgv1a024144mg [Erythranthe guttata]
Length=174

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
             +++CE LP+  C+FS++S GKRCVLE        + Y+CKTSEV V   M  Y+E D+C
Sbjct  16   GELVCEELPVEVCSFSIASSGKRCVLETWESSLPGI-YQCKTSEVAVAIGMQGYIENDDC  74

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            V ACGV R +VG+SSD+L+E  FT  LCSP+CY+NCPNIVDLY+NLA  EG  L +LC  
Sbjct  75   VSACGVDRNTVGISSDSLMETQFTFNLCSPQCYDNCPNIVDLYYNLALAEGVVLGELC--  132

Query  484  KQKEVGPGRRDMIQL  528
            K +     RR  IQL
Sbjct  133  KSQRTTSSRRSAIQL  147



>ref|XP_010923170.1| PREDICTED: uncharacterized protein LOC105046307 isoform X4 [Elaeis 
guineensis]
Length=157

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            +ICE+LP + CAF++SS  KRCVLE+   + G  EY+C+TSEVVV   M++++ETDECVK
Sbjct  33   VICEDLPQDLCAFAISSSSKRCVLESIPHNGGPTEYQCRTSEVVV-ERMSDWIETDECVK  91

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGE  453
            ACGV R +VG+SSD+LLE  FT K+CSP C+ NCPNI+DLYFNLAA E
Sbjct  92   ACGVDRNTVGISSDSLLEPQFTEKICSPSCHQNCPNIIDLYFNLAAAE  139



>ref|XP_010482599.1| PREDICTED: uncharacterized protein LOC104761248 isoform X1 [Camelina 
sativa]
Length=195

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 108/157 (69%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            +MK   V  +LL    S   +  ++ CENL  + CAF+VSS GKRCVLE S++ +G   Y
Sbjct  2    AMKTVFVTSMLLLAIYSQTTLGHEVKCENLDEDTCAFAVSSTGKRCVLEKSLRRSGIEVY  61

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C++S +     +   +E++EC++ACG+ RKS+G+SSDALLE+ FT KLCS +C+N CPN
Sbjct  62   SCRSSGIE-SDKVTNIIESNECIEACGLDRKSLGISSDALLESRFTQKLCSAKCFNQCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +VDL+FNLAAGEG +LP LCE ++   G  RR M ++
Sbjct  121  VVDLFFNLAAGEGVFLPKLCESQR---GKTRRAMSEI  154



>ref|XP_008234242.1| PREDICTED: uncharacterized protein LOC103333213 [Prunus mume]
Length=200

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 98/139 (71%), Gaps = 4/139 (3%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
               L  I CE+L  + CAF+VSS  KRCVLE  ++ +G+  Y C+TSE+     + +++E
Sbjct  22   QATLGAISCEDLDQDTCAFAVSSSSKRCVLEKHVRRSGEEAYTCRTSEIE-ADKLKDWVE  80

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            +++C+K+CG+ RKS G+ SD+LLE+ FT KLCSP+CY+ CPNIVDLYFNLAAGEG +LP 
Sbjct  81   SEQCIKSCGLDRKSYGICSDSLLESRFTQKLCSPQCYDTCPNIVDLYFNLAAGEGVFLPK  140

Query  472  LCEKKQKEVGPGRRDMIQL  528
            LCE +       RR M ++
Sbjct  141  LCEAQGAN---ARRQMSEI  156



>gb|KDO52035.1| hypothetical protein CISIN_1g029827mg [Citrus sinensis]
Length=158

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +1

Query  82   VLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVV  261
            V+ LA        L ++ CE+L  NACAF+VS+ GKRCVLE  +K +G+  Y CKTSE+ 
Sbjct  14   VVALAIAFCVQATLGEVTCESLDQNACAFAVSASGKRCVLEKQVKRSGQETYTCKTSEIE  73

Query  262  VGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNL  441
                +  ++ETD+C+K+CG+ RKS+G+SSD+LLE+ FT KLCS  CY +CPNIVDLYFNL
Sbjct  74   A-EKLNNWIETDQCIKSCGLDRKSLGISSDSLLESGFTQKLCSSPCYGSCPNIVDLYFNL  132

Query  442  AAGEG  456
            AAGEG
Sbjct  133  AAGEG  137



>gb|KFK26839.1| hypothetical protein AALP_AA8G300600 [Arabis alpina]
Length=196

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            ++ CENL  + CAF+VSS GKRCVLE S++ +G   Y C+ SE+     +   +E+DEC+
Sbjct  25   EVKCENLNKDTCAFAVSSTGKRCVLEKSVRRSGIEMYTCRASEIE-ADKITNIIESDECI  83

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
             +CG+ R+S+G+SSDALLE+ FT KLCS +C N CPN+VDL+FNLAAGEG +LP LCE +
Sbjct  84   NSCGLDRRSLGISSDALLESRFTQKLCSAKCLNQCPNVVDLFFNLAAGEGVFLPKLCESQ  143

Query  487  QKEVGPGRRDMIQL  528
            +   G  RR M ++
Sbjct  144  E---GKSRRVMSEI  154



>ref|XP_006401831.1| hypothetical protein EUTSA_v10014733mg [Eutrema salsugineum]
 gb|ESQ43284.1| hypothetical protein EUTSA_v10014733mg [Eutrema salsugineum]
Length=195

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
            V +LLLA  L    +  ++ CENL  + CAF+VS+ GKRCVLE S+K +G   Y C+ SE
Sbjct  9    VSMLLLAVYLQTT-LGHEVKCENLDKDTCAFAVSAAGKRCVLEKSVKRSGIEVYMCRASE  67

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            +     +   +E+DEC+KACG+ RKS+G+SSD  LE+ FT KLCS +C   CPNIVDL++
Sbjct  68   IE-ADKVTNIIESDECIKACGLDRKSLGISSDGFLESRFTQKLCSVKCLTQCPNIVDLFY  126

Query  436  NLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            NLAAGEG YLP LCE +Q   G  RR M ++
Sbjct  127  NLAAGEGVYLPKLCESQQ---GKSRRAMSEI  154



>gb|AFG47202.1| hypothetical protein 0_8609_01, partial [Pinus taeda]
Length=142

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 5/121 (4%)
 Frame = +1

Query  160  CAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVG  339
            CAFSVSS G RCVLE SI  +G ++YEC++SEV+   +M E++ETDEC+ ACGV R +VG
Sbjct  3    CAFSVSSSGARCVLEKSILRDGNMQYECQSSEVIA-ENMKEWIETDECMNACGVERMTVG  61

Query  340  MSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            MS+D++ E  F   LC P CYN CPNI+DLYFNLAAGEG YLP LC+  +     G R M
Sbjct  62   MSTDSIAERGFIGNLCLPRCYNKCPNIIDLYFNLAAGEGVYLPRLCQAHRS----GDRRM  117

Query  520  I  522
            +
Sbjct  118  M  118



>ref|XP_009763986.1| PREDICTED: uncharacterized protein LOC104215785 isoform X2 [Nicotiana 
sylvestris]
Length=204

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 11/153 (7%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLA--DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            L++ L  +   HG L   +I+CE+L +  CA+SV+  GKRC LE      G   Y+CKTS
Sbjct  3    LIIFLVFSFLIHGALGNGEIVCEDLSVGKCAYSVAFSGKRCTLETYESSEGTTGYQCKTS  62

Query  253  EVVVG-SSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDL  429
            EVVV  + +A ++E+DEC+ ACG  R SVG+SSD+LLE++FT+KLCS +CY  CPNIVDL
Sbjct  63   EVVVAINGIANWIESDECISACGANRDSVGISSDSLLESSFTSKLCSQQCYQKCPNIVDL  122

Query  430  YFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            Y+NLA GE       C+ K      GRR+M Q+
Sbjct  123  YYNLALGEA-----FCKGKNLN---GRREMSQI  147



>ref|XP_009629076.1| PREDICTED: uncharacterized protein LOC104119315 [Nicotiana tomentosiformis]
Length=177

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 3/154 (2%)
 Frame = +1

Query  61   MKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYE  240
            M F++   L LA  L   GVL D+ICE LP   C FS++S GKRC+LE+ +   G +E E
Sbjct  1    MNFTT---LFLALCLFLQGVLGDLICEELPEEMCTFSIASSGKRCLLESHVSSEGNLEME  57

Query  241  CKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNI  420
            C+TSEV   + M EY+ETDEC+ ACGV R+S+G+SSD+LL++ F AKLCS +CYNNCPNI
Sbjct  58   CQTSEVFATNKMQEYIETDECIGACGVDRQSLGLSSDSLLDSKFIAKLCSAQCYNNCPNI  117

Query  421  VDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMI  522
            VDLY NLA+ EG  L  LC  ++     G   ++
Sbjct  118  VDLYSNLASAEGISLHGLCLSQKTRAHHGTSQLL  151



>gb|ABK22647.1| unknown [Picea sitchensis]
 gb|ABK27026.1| unknown [Picea sitchensis]
 gb|ABR18111.1| unknown [Picea sitchensis]
 gb|ACN40842.1| unknown [Picea sitchensis]
Length=202

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = +1

Query  82   VLLLACTLSFHGVL-ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            + +++  ++  GV  A + CE LP+  CAFSVSS G RCVLE ++  +G ++++C++S V
Sbjct  19   LFIISMAIAVRGVHSAFMTCEELPVEVCAFSVSSSGNRCVLEKALMMDGTLQFQCQSS-V  77

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            VV   +AE++E++EC+ ACG+ R +VGMS+D+LLE  F+ KLCS +C N+CPNIVDLY N
Sbjct  78   VVAEKLAEWIESEECINACGLERMAVGMSTDSLLEPEFSRKLCSSQCRNSCPNIVDLYVN  137

Query  439  LAAGEGAYLPDLCEKKQ  489
            LAAGEG  LP +CE ++
Sbjct  138  LAAGEGISLPRMCESQK  154



>ref|XP_006281102.1| hypothetical protein CARUB_v10027132mg [Capsella rubella]
 gb|EOA14000.1| hypothetical protein CARUB_v10027132mg [Capsella rubella]
Length=210

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 105/148 (71%), Gaps = 4/148 (3%)
 Frame = +1

Query  85   LLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVV  264
            +LL    S   + +++ CENL  + CAF+VS+ GKRCVLE S++ +G   Y C++S +  
Sbjct  11   MLLFAIYSQTALGSEVKCENLDEDTCAFAVSATGKRCVLEKSMRRSGIEVYSCRSSGIE-  69

Query  265  GSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLA  444
               +   +E++EC+ ACG+GRKS+G+SSDALLE+ FT KLCS +C N+CPN+VDL+FNLA
Sbjct  70   SDKVTNIVESNECINACGLGRKSLGISSDALLESRFTQKLCSVKCLNHCPNVVDLFFNLA  129

Query  445  AGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            AGEG +LP LCE ++   G  RR M ++
Sbjct  130  AGEGVFLPKLCESQE---GKTRRAMSEI  154



>gb|ABK27044.1| unknown [Picea sitchensis]
Length=190

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADII-CENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKT  249
            S+L++L+A T+   GV + II CE LP   CAFS+SS G RCVLE  +  +G ++++C++
Sbjct  18   SLLIILMAITVP--GVQSAIIKCEELPAELCAFSISSSGNRCVLEKDLMMDGTLQFQCQS  75

Query  250  SEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDL  429
            S V V   + E++E++EC+ ACG+ R +VGMS+D+LLE  F+AKLCS EC NNCPNIVDL
Sbjct  76   SVVSV-EKLVEWIESEECINACGLERMAVGMSTDSLLEPEFSAKLCSSECRNNCPNIVDL  134

Query  430  YFNLAAGEGAYLPDLC  477
            Y NLAAGEG  L  +C
Sbjct  135  YVNLAAGEGISLSSMC  150



>ref|XP_006358727.1| PREDICTED: uncharacterized protein LOC102598423 [Solanum tuberosum]
Length=208

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGS-SMAEYLETDE  300
             +I+CE+L +  CA+SV+S GKRC LE+     G   Y+CKTSEV+V +  +   +E+DE
Sbjct  38   GEIVCEDLSVGLCAYSVASSGKRCSLESYESIEGTRGYQCKTSEVLVSNIDITNLIESDE  97

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCE  480
            C+ ACG  R S+G+SSD+LLE+TFT+KLCS +C   CPNIVDLY+NLA GEG YLP  C+
Sbjct  98   CISACGADRNSLGISSDSLLESTFTSKLCSQQCNQKCPNIVDLYYNLALGEGVYLPSFCK  157

Query  481  KKQKEVGPGRRDMIQL  528
             +      GRR+M Q+
Sbjct  158  GRNLN---GRREMSQI  170



>ref|XP_010671873.1| PREDICTED: uncharacterized protein LOC104888552 [Beta vulgaris 
subsp. vulgaris]
Length=214

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            S++ L    +L     L ++ CE L   ACAF+VSSIGKRCVLE  ++ +G   Y+C TS
Sbjct  9    SLITLAFLSSLLVQCTLGEVTCEQLNKEACAFAVSSIGKRCVLEKYVRRSGLEAYKCTTS  68

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
             +     + + +E++ C++ACG+ R ++G+SSD+LLE+ FT KLCSP+CY  CPN++DLY
Sbjct  69   AIDT-DELKDMVESNHCIEACGLDRDTLGISSDSLLESRFTRKLCSPQCYQKCPNVIDLY  127

Query  433  FNLAAGEGAYLPDLCEKKQK  492
            FNLAAGEG +LP LC  +++
Sbjct  128  FNLAAGEGVFLPKLCASQRE  147



>ref|XP_002314136.2| hypothetical protein POPTR_0009s04480g [Populus trichocarpa]
 gb|EEE88091.2| hypothetical protein POPTR_0009s04480g [Populus trichocarpa]
Length=179

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            +VL     C   ++  L +++CE LP++ C++S+++ GKRC+LEN    +G V+Y+CKTS
Sbjct  3    AVLNCFFYCLTWYY--LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTS  60

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            EVVV   + E++E DEC+ ACG+ R +VG+SSD+LL+  F  KLCS  C   CPNIVDLY
Sbjct  61   EVVV-DKLNEWIEIDECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLY  119

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRD  516
             NLA  EG YLP+LC   ++ +   R +
Sbjct  120  SNLALAEGVYLPNLCASPRRAMYQTRSN  147



>ref|XP_008439231.1| PREDICTED: uncharacterized protein LOC103484081 [Cucumis melo]
Length=206

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 108/165 (65%), Gaps = 13/165 (8%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLAD--------IICENLPINACAFSVSSIGKRCVLENSI  213
            M +S+   ++LL   +SF   L D        I C++L  N CAF+VS  GKRCVLE S+
Sbjct  1    MNYSTFGFIILLLLPISFQITLGDSRTSDSNMIKCKSLEKNKCAFAVSWSGKRCVLEKSV  60

Query  214  KDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSP  393
            K +G+  + C+TSE+     +   +ET+ECVK CG+ R ++G+SSD+LL+ +FT KLCS 
Sbjct  61   KRSGEEAFTCRTSEIE-ADRLQNIVETEECVKGCGLDRNTLGISSDSLLDTSFTRKLCSS  119

Query  394  ECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
             CYN+C N+VDL+FNLAAGEG +LP LCE +   V   RR M ++
Sbjct  120  RCYNHCANVVDLFFNLAAGEGVFLPKLCEVQGGNV---RRGMSEI  161



>ref|XP_010444786.1| PREDICTED: uncharacterized protein LOC104727386 [Camelina sativa]
Length=195

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 107/157 (68%), Gaps = 4/157 (3%)
 Frame = +1

Query  58   SMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEY  237
            ++K   V  +LL    S   +  ++ CENL  + CAF+VSS GKRCVLE S++ +G   Y
Sbjct  2    ALKTVFVTSMLLLAIYSQTTLGHEVKCENLDEDTCAFAVSSTGKRCVLEKSVRRSGIEVY  61

Query  238  ECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPN  417
             C++S +     +   +E++EC++ACG+ RKS+G+SSDALLE+ FT KLCS +C+  CPN
Sbjct  62   SCRSSGIE-SDKVTNIIESNECIEACGLDRKSLGISSDALLESRFTQKLCSDKCFKQCPN  120

Query  418  IVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            +VDL++NLAAGEG +LP LCE ++   G  RR M ++
Sbjct  121  VVDLFYNLAAGEGVFLPKLCESQE---GKTRRAMSEI  154



>ref|XP_009103900.1| PREDICTED: uncharacterized protein LOC103829961 isoform X2 [Brassica 
rapa]
Length=183

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 97/137 (71%), Gaps = 6/137 (4%)
 Frame = +1

Query  61   MKFSSV-LVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVE  234
            M +SS+ L + L  +   H  L  DI+CENLP N CAFS+S+ GKRC+LE +   N   E
Sbjct  1    MSYSSLKLPIFLILSSLLHAALGEDIVCENLPTNMCAFSISASGKRCLLETA---NVTGE  57

Query  235  YECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCP  414
            Y C+TS V V   +  ++E+DECV ACGV RK+VG+SSDA++EA F AKLCSP C + CP
Sbjct  58   YTCRTSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMMEAGFAAKLCSPACLDYCP  116

Query  415  NIVDLYFNLAAGEGAYL  465
            NI+DLYFNLAAGEG  L
Sbjct  117  NILDLYFNLAAGEGTIL  133



>ref|XP_010255408.1| PREDICTED: uncharacterized protein LOC104596085 [Nelumbo nucifera]
Length=172

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
              I CENLP   CAFSVSS G RCVLE        V+  CK+S+V+V  + A ++E D+C
Sbjct  28   GGITCENLPNEYCAFSVSSAGFRCVLEKYEAGADGVKLGCKSSDVLV-ENTASWVEIDDC  86

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            +++CG+ RKSVG+SSD+LLE  F  KLCSP+C+  CPNIVDLYFNLAA EG YLP LC+K
Sbjct  87   IESCGLKRKSVGISSDSLLEPNFLHKLCSPKCFQFCPNIVDLYFNLAAAEGVYLPKLCQK  146

Query  484  KQKEVG  501
             + + G
Sbjct  147  MRSKFG  152



>ref|XP_006388432.1| hypothetical protein POPTR_0187s00220g [Populus trichocarpa]
 gb|ERP47346.1| hypothetical protein POPTR_0187s00220g [Populus trichocarpa]
Length=179

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 99/148 (67%), Gaps = 3/148 (2%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            +VL     C   ++  L +++CE LP++ C++S+++ GKRC+LEN    +G V+Y+CKTS
Sbjct  3    AVLNCFFYCLTWYY--LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTS  60

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            EVVV   + E +E DEC+ ACG+ R +VG+SSD+LL+  F  KLCS  C   CPNIVDLY
Sbjct  61   EVVV-DKLNELIEIDECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLY  119

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRD  516
             NLA  EG YLP+LC   ++ +   R +
Sbjct  120  SNLALAEGVYLPNLCASPRRAMYQTRSN  147



>emb|CDY13175.1| BnaC04g26600D [Brassica napus]
Length=203

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 103/155 (66%), Gaps = 13/155 (8%)
 Frame = +1

Query  4    RDQINDKLKKIKESRSMASMKFSSVLVLLLACTLSFHGVLAD-IICENLPINACAFSVSS  180
            R +IN K     E+ S +S+K    L+L    +   H  L + IICENLP + CAFS+S+
Sbjct  14   RRRINKK----TEAMSYSSLKLPIFLIL----SSLLHAALGEEIICENLPTSICAFSISA  65

Query  181  IGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALL  360
             GKRC+LE +   N   EY C+ S V V   +  ++E+DECV ACGV RK+VG+SSDA++
Sbjct  66   TGKRCLLETA---NVAGEYTCRNSAVEV-EGIVNHVESDECVAACGVDRKTVGISSDAMM  121

Query  361  EATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYL  465
            E  F AKLCSP C++ CPNI+DLYFNLAAGEG  L
Sbjct  122  EPGFAAKLCSPACFDYCPNILDLYFNLAAGEGKIL  156



>ref|XP_008806881.1| PREDICTED: uncharacterized protein LOC103719421 [Phoenix dactylifera]
Length=191

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 104/160 (65%), Gaps = 8/160 (5%)
 Frame = +1

Query  52   MASMKFSSV-LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGK  228
            MAS  F S+ LVLL   + +  G    I CE+L  + CA++VSS G RCVLE  ++  G+
Sbjct  1    MASKAFISLALVLLFFVSGALGG---GITCESLEKSTCAYAVSSAGMRCVLEKRVRRGGQ  57

Query  229  VEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNN  408
              Y C TS++     +   +ETD CV+ACG+ R ++G+SSD+LL++ F  KLCSP CY  
Sbjct  58   EVYTCGTSDIQA-DGVKNRVETDACVEACGLDRGTLGISSDSLLDSNFRQKLCSPACYRG  116

Query  409  CPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            CPN+VDLYFNLAAGEG +LP LCE ++      RR M ++
Sbjct  117  CPNVVDLYFNLAAGEGVFLPKLCEVQETNA---RRAMAEI  153



>ref|XP_010934761.1| PREDICTED: uncharacterized protein LOC105054842 [Elaeis guineensis]
Length=233

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            I CE+L  + CA++VSS G RC+LE  ++  G+  Y C TS++     + + +ETDECV+
Sbjct  70   ITCESLGKSTCAYAVSSAGMRCLLEKHVRRGGQEVYTCGTSDIEA-DGIKDRVETDECVE  128

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
            ACG+ R ++G+SSD+LL++ F  KLCSP CY  CPN+VDLYFNLAAGEG +LP LCE ++
Sbjct  129  ACGLNRGTLGISSDSLLDSNFRQKLCSPACYRGCPNVVDLYFNLAAGEGVFLPKLCEAQE  188

Query  490  KEVGPGRRDMIQL  528
              V   RR M ++
Sbjct  189  TNV---RRAMAEI  198



>ref|XP_006388431.1| hypothetical protein POPTR_0187s00210g, partial [Populus trichocarpa]
 gb|ERP47345.1| hypothetical protein POPTR_0187s00210g, partial [Populus trichocarpa]
Length=184

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 99/148 (67%), Gaps = 3/148 (2%)
 Frame = +1

Query  73   SVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            +VL     C   ++  L +++CE LP++ C++S+++ GKRC+LEN    +G V+Y+CKTS
Sbjct  8    AVLNCFFYCLTWYY--LGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTS  65

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            EVVV   + E +E DEC+ ACG+ R +VG+SSD+LL+  F  KLCS  C   CPNIVDLY
Sbjct  66   EVVV-DKLNELIEIDECITACGLSRNTVGISSDSLLQPQFLTKLCSKSCSQACPNIVDLY  124

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRD  516
             NL+  EG YLP+LC   ++ +   R +
Sbjct  125  SNLSLAEGVYLPNLCASPRRAMYQTRSN  152



>ref|XP_004157197.1| PREDICTED: uncharacterized protein LOC101225828 [Cucumis sativus]
Length=206

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            I CE+L  N CAF+VS  GKRCVLE S+K +G+  + C+TSE+     +   +ET+ECV+
Sbjct  33   IKCESLEKNKCAFAVSWSGKRCVLEKSVKRSGEDAFTCRTSEIEA-DRLQNIVETEECVE  91

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
             CGV R ++G+SSD+LL+ +FT KLCS  CYN+C N+VDL+FNLAAGEG +LP LCE + 
Sbjct  92   GCGVDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEVQG  151

Query  490  KEVGPGRRDMIQL  528
              V   RR M ++
Sbjct  152  GNV---RRGMSEI  161



>ref|XP_010537178.1| PREDICTED: LOW QUALITY PROTEIN: sulfated surface glycoprotein 
185 [Tarenaya hassleriana]
Length=229

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 11/152 (7%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            V  LL+  TLSF  VL  ++ CE+L  + CAF+VSS GKR         +G   Y C+ S
Sbjct  12   VASLLVLTTLSFQTVLGHEVTCESLSEDTCAFAVSSTGKR-------XRSGVEVYTCRAS  64

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E+     +A  +E++ CVK CG+ RK++G+SSDALLE  FT KLCSP+C+N+CPN+VDLY
Sbjct  65   EIE-ADKVANVIESERCVKDCGLDRKTLGISSDALLEPRFTRKLCSPQCFNHCPNVVDLY  123

Query  433  FNLAAGEGAYLPDLCEKKQKEVGPGRRDMIQL  528
            FNLAAGEG +LP LCE + ++    RR+M ++
Sbjct  124  FNLAAGEGVFLPKLCEAQNEKN--KRREMSEI  153



>ref|XP_007152257.1| hypothetical protein PHAVU_004G1144000g, partial [Phaseolus vulgaris]
 gb|ESW24251.1| hypothetical protein PHAVU_004G1144000g, partial [Phaseolus vulgaris]
Length=134

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 87/126 (69%), Gaps = 4/126 (3%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSE  255
            V +L  A   +  G L ++ CE L  + CAF+VS  GKRCVLE  +K +G+  Y C++SE
Sbjct  13   VAILFFA---TLQGTLGEVECERLSKDTCAFAVSWEGKRCVLEKRVKRSGEEAYTCRSSE  69

Query  256  VVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYF  435
            +   S    ++ET+EC+K CG+ RKS G+SSD+LLE  FT  LCSP CY NCPNIVDLYF
Sbjct  70   IETESEKG-HIETEECIKGCGLNRKSFGISSDSLLEVGFTQNLCSPRCYQNCPNIVDLYF  128

Query  436  NLAAGE  453
            NLAAGE
Sbjct  129  NLAAGE  134



>ref|XP_004140776.1| PREDICTED: uncharacterized protein LOC101216404 [Cucumis sativus]
 gb|KGN57379.1| hypothetical protein Csa_3G182150 [Cucumis sativus]
Length=206

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVK  309
            I CE+L  N CAF+VS  GKRCVLE S+K +G+  + C+TSE+     +   +ET+ECV+
Sbjct  33   IKCESLEKNKCAFAVSWSGKRCVLEKSVKRSGEDAFTCRTSEIEA-DRLQNIVETEECVE  91

Query  310  ACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQ  489
             CG+ R ++G+SSD+LL+ +FT KLCS  CYN+C N+VDL+FNLAAGEG +LP LCE + 
Sbjct  92   GCGIDRNTLGISSDSLLDTSFTRKLCSSRCYNHCANVVDLFFNLAAGEGVFLPKLCEVQG  151

Query  490  KEVGPGRRDMIQL  528
               G  RR M ++
Sbjct  152  ---GNARRGMSEI  161



>ref|XP_009788534.1| PREDICTED: uncharacterized protein LOC104236325 [Nicotiana sylvestris]
Length=176

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             GVL D+ICE LP   C+FS++S GKRC+LE+ +   G +E EC+TSEV   + M EY+E
Sbjct  14   QGVLGDLICEELPEEMCSFSIASSGKRCLLESHVSAEGNLEMECQTSEVFATNKMQEYIE  73

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            TDEC+ ACGV R+S+G+SSD+LL+  F AK+CS +CYNNCPNIVDLY NLA+ EG  L  
Sbjct  74   TDECIGACGVDRQSLGLSSDSLLDPKFIAKICSAQCYNNCPNIVDLYSNLASAEGVSLHG  133

Query  472  LC  477
            LC
Sbjct  134  LC  135



>ref|XP_006403624.1| hypothetical protein EUTSA_v10010808mg [Eutrema salsugineum]
 gb|ESQ45077.1| hypothetical protein EUTSA_v10010808mg [Eutrema salsugineum]
Length=140

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 7/123 (6%)
 Frame = +1

Query  160  CAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVG  339
            CAFS+S+ GKRC+LE +   N   EY C+TS V V   +  ++E+D CV ACGV RK+VG
Sbjct  2    CAFSISASGKRCLLETA---NVAGEYTCRTSTVEV-EGIVNHVESDACVSACGVDRKTVG  57

Query  340  MSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            +SSD ++EA F AKLCSP C + CPNI+DLYFNLAAGEGA+LPDLC+ ++  + P RR M
Sbjct  58   ISSDTMMEAGFAAKLCSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAQR--INP-RRSM  114

Query  520  IQL  528
            + +
Sbjct  115  LDI  117



>ref|XP_010504193.1| PREDICTED: uncharacterized protein LOC104781266 [Camelina sativa]
Length=149

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +1

Query  160  CAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVG  339
            CAFS+S+ GKRC+LE +   N   EY C+TS V V   +  ++E+DECV ACGV RK+VG
Sbjct  2    CAFSISASGKRCLLETA---NVAGEYTCRTSAVDV-EGIVNHVESDECVAACGVDRKTVG  57

Query  340  MSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGRRDM  519
            +SSD+L+EA F AK+CSP C + CPNI+DLYFNLAAGEGA+LPDLC+  +       R M
Sbjct  58   ISSDSLMEAGFAAKICSPACLDYCPNILDLYFNLAAGEGAFLPDLCDAHRMNP---HRSM  114

Query  520  IQL  528
            +++
Sbjct  115  LEI  117



>ref|XP_010040888.1| PREDICTED: uncharacterized protein LOC104429762 [Eucalyptus grandis]
Length=217

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  103  LSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAE  282
                G L DI CENL   +CAF+VSS GKRCVLE  ++ +G+  Y C++SE+    ++ +
Sbjct  17   FGVQGTLGDIACENLDQGSCAFAVSSTGKRCVLEKQVRRSGEEGYTCRSSEIEA-DNLKD  75

Query  283  YLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLA  444
            ++ETDEC+ ACG+ RK++G+SSD+LLE+ FT KLCS  CY NCPNIVDLYF+LA
Sbjct  76   HIETDECIAACGLDRKTLGVSSDSLLESRFTQKLCSSGCYENCPNIVDLYFSLA  129



>ref|XP_006848035.1| hypothetical protein AMTR_s00029p00186480 [Amborella trichopoda]
 gb|ERN09616.1| hypothetical protein AMTR_s00029p00186480 [Amborella trichopoda]
Length=150

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKV-EYECKTSEVVVGSSMAEYL  288
            H   A+I+CENL    CAFS+SS GKRCVLE    ++G+  E++C +SEV V   ++E++
Sbjct  33   HVFAAEIVCENLSKEECAFSISSAGKRCVLEKYTGNDGEEGEFKCTSSEVEV-ERLSEWI  91

Query  289  ETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEG  456
            E +EC+++CG+ R SVG+SSD+LL+  FTAKLC+  C++NCPN+VDLYFNLAAGEG
Sbjct  92   EIEECIQSCGLDRNSVGISSDSLLDPQFTAKLCASPCFDNCPNVVDLYFNLAAGEG  147



>ref|XP_001775001.1| predicted protein [Physcomitrella patens]
 gb|EDQ60108.1| predicted protein [Physcomitrella patens]
Length=120

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDEC  303
             ++ CE+LPI  CAFSV+S G RCVLE     +G + YEC++S + +     E++E+DEC
Sbjct  1    GNLECEDLPIEYCAFSVASSGTRCVLEKYRGKDGIILYECQSS-MTMAEREEEWIESDEC  59

Query  304  VKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEK  483
            + +CG+ R SVG+S+D L+++ FT  LCS EC NNCPN++DLY +LAAGEG YLP LC++
Sbjct  60   IISCGMERISVGLSTDLLMDSHFTKMLCSSECLNNCPNLIDLYTSLAAGEGMYLPQLCKE  119

Query  484  K  486
            +
Sbjct  120  Q  120



>emb|CDP09132.1| unnamed protein product [Coffea canephora]
Length=188

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 90/139 (65%), Gaps = 3/139 (2%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G   ++ICE LP   CAFS+SS GKRC+LE     +    Y+CKTSEV    +M  ++E
Sbjct  14   QGAFGELICEELPAEMCAFSISSSGKRCLLETYAPTDATTTYQCKTSEVAANINMNGHVE  73

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPD  471
            T+EC+KACG+ R  VG+SSD LL++ F ++LCS +C  NCPNIVDLY +LA  EG  L +
Sbjct  74   TEECIKACGLQRNVVGISSDTLLDSGFASELCSQDCSENCPNIVDLYNDLALAEGLNLSE  133

Query  472  LCEKKQKEVGPGRRDMIQL  528
            +C+  +      RR M Q+
Sbjct  134  MCKALKNS---PRRIMAQV  149



>ref|XP_008439229.1| PREDICTED: uncharacterized protein LOC103484080 [Cucumis melo]
Length=174

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  121  LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDE  300
            +  I CE+L IN CAF+VS  GKRCVLE ++K +G+  + C+ S+++    +   +ETD+
Sbjct  1    MKKIKCEDLGINMCAFAVSWWGKRCVLEKTVKHDGEEGFTCQISKIMEVKKLRNRVETDK  60

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCE  480
            CV+ CG+ R ++G+SSD+LL+  FT  LC   CYN+CPNIV L+ NLAA EG YLP LC 
Sbjct  61   CVRRCGLDRNTLGISSDSLLDTRFTCNLCFSHCYNHCPNIVHLFTNLAAAEGLYLPKLC-  119

Query  481  KKQKEVGPGRRDM  519
                E G  RR+M
Sbjct  120  --NAEGGNVRREM  130



>ref|XP_009420109.1| PREDICTED: uncharacterized protein LOC103999932 [Musa acuminata 
subsp. malaccensis]
Length=233

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 89/126 (71%), Gaps = 4/126 (3%)
 Frame = +1

Query  151  INACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRK  330
            +  CAF+VSS   RC+LE+S    G   Y+C+ SE+VV   + +++ET++CV  CGV R 
Sbjct  87   LEVCAFAVSSSSNRCLLESSQDSGGNTVYQCRASEIVV-ERLRDWIETEQCVSVCGVDRN  145

Query  331  SVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKKQKEVGPGR  510
            +VG+SSDALLE  FT +LCS  C+ NCPNI+DL+ +LAA EG +LPDLCE ++  V P  
Sbjct  146  AVGISSDALLEPHFTQQLCSAACHQNCPNIIDLHLDLAAAEGIFLPDLCEAQR--VNP-H  202

Query  511  RDMIQL  528
            R M+++
Sbjct  203  RAMVEI  208



>ref|XP_010108343.1| hypothetical protein L484_006498 [Morus notabilis]
 gb|EXC19134.1| hypothetical protein L484_006498 [Morus notabilis]
Length=227

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  112  HGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLE  291
             G L  I CE L  + CAF+VSS GKRCVLE  +K +GK  Y C+ S++     + + +E
Sbjct  20   QGTLGGITCEKLDQDTCAFAVSSSGKRCVLEKHVKRSGKEAYTCRASDIE-ADKLKDVIE  78

Query  292  TDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGE  453
            +DEC+KACG+ R+++G+SSD+LLE+ FT +LCSP CY+ C N+VDLYFNLAAGE
Sbjct  79   SDECIKACGLDRRTLGISSDSLLESRFTRQLCSPNCYDACHNVVDLYFNLAAGE  132



>ref|XP_004962356.1| PREDICTED: uncharacterized protein LOC101785352 [Setaria italica]
Length=191

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVV-GSSMAEYLETDE  300
            A ++CE L    CAF+VSS  +RCVLEN+        Y+C+TSEVVV    +A  +ETD 
Sbjct  29   ARVVCEQLAAELCAFAVSSTSRRCVLENTHCAGRPTAYQCRTSEVVVEDGRLAGTVETDR  88

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCE  480
            CV+ACGV R +VG+SSD+LL+      +CSP C   CPNIV+LY NLAAGEG    +LCE
Sbjct  89   CVRACGVDRATVGISSDSLLDPRVAGAVCSPACLQGCPNIVNLYANLAAGEGVAFSELCE  148

Query  481  KKQKEVGPGRRDMIQL  528
              +      RR M QL
Sbjct  149  VHRAN---PRRAMAQL  161



>ref|XP_002439633.1| hypothetical protein SORBIDRAFT_09g017290 [Sorghum bicolor]
 gb|EES18063.1| hypothetical protein SORBIDRAFT_09g017290 [Sorghum bicolor]
Length=182

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 86/134 (64%), Gaps = 4/134 (3%)
 Frame = +1

Query  130  IICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVV-GSSMAEYLETDECV  306
            ++CE L    CAF+VSS  +RCVLEN+       EY+C+TSEVVV    ++  +ETD CV
Sbjct  30   VVCEQLTAELCAFAVSSTSRRCVLENTHCAGRATEYQCRTSEVVVEDGRLSGLVETDGCV  89

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
            +ACGV R +VG+SSD+LL+      +CSP C   CPNIVDLY NLAAGEG    +LCE  
Sbjct  90   RACGVDRATVGISSDSLLDPRVAGAVCSPACLRGCPNIVDLYSNLAAGEGVAFSELCEVH  149

Query  487  QKEVGPGRRDMIQL  528
            +      RR + QL
Sbjct  150  RSNP---RRALAQL  160



>ref|XP_002971753.1| hypothetical protein SELMODRAFT_412334 [Selaginella moellendorffii]
 gb|EFJ27502.1| hypothetical protein SELMODRAFT_412334 [Selaginella moellendorffii]
Length=196

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 93/145 (64%), Gaps = 3/145 (2%)
 Frame = +1

Query  43   SRSMASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDN  222
            +RS  S+ F S  V+LL  + +  G  + + CE+LP   CAF+VS++G RCVLE  I  +
Sbjct  2    ARSSRSLAFVSSFVILLCISGAIAG--SRLECEDLPPQDCAFAVSTMGNRCVLEKFIAQD  59

Query  223  GKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECY  402
                YEC+TS V+     A ++E+DECVK CGV R  VG SSD L    F  +LCSP C 
Sbjct  60   TSAIYECQTSNVMAEKQEA-WIESDECVKECGVERMWVGFSSDGLANRNFVNRLCSPVCQ  118

Query  403  NNCPNIVDLYFNLAAGEGAYLPDLC  477
            NNCPNIV+L+ +LAAGEG  L ++C
Sbjct  119  NNCPNIVNLFESLAAGEGVNLAEVC  143



>ref|XP_004140837.1| PREDICTED: uncharacterized protein LOC101212311 [Cucumis sativus]
Length=202

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  121  LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDE  300
            L  I CE+L IN CAF+VS  G RCVLE ++K +G+  + C+TS+++    +   +ET++
Sbjct  28   LKKIKCEDLEINMCAFAVSWWGNRCVLEKTVKLDGEEGFTCRTSKIMEVKKLRNRVETEK  87

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            CV+ CG+ R ++G+SSD+LL+  FT  LCS  CYN+CPNIV L+ NLAA EG  LP LC
Sbjct  88   CVRRCGLDRNTLGISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC  146



>ref|XP_004157223.1| PREDICTED: uncharacterized protein LOC101232096 [Cucumis sativus]
Length=199

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  121  LADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDE  300
            L  I CE+L IN CAF+VS  G RCVLE ++K +G+  + C+TS+++    +   +ET++
Sbjct  25   LKKIKCEDLEINMCAFAVSWWGNRCVLEKTVKLDGEEGFTCRTSKIMEVKKLRNRVETEK  84

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLC  477
            CV+ CG+ R ++G+SSD+LL+  FT  LCS  CYN+CPNIV L+ NLAA EG  LP LC
Sbjct  85   CVRRCGLDRNTLGISSDSLLDTRFTQNLCSSRCYNHCPNIVHLFTNLAAAEGLSLPKLC  143



>ref|XP_008649530.1| PREDICTED: uncharacterized protein LOC103630240 [Zea mays]
 gb|AFW77700.1| hypothetical protein ZEAMMB73_689082 [Zea mays]
Length=178

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = +1

Query  124  ADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSS-MAEYLETDE  300
            A ++CE L    CAF+VSS  +RCVLE +       EYEC+TSEVV     ++  +ETD 
Sbjct  26   ARVVCEQLTAEVCAFAVSSTSRRCVLETTHCAGRPTEYECRTSEVVAADGRLSGLVETDA  85

Query  301  CVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCE  480
            CV+ACGV R +VG+SSD+LL+      +CS  C   CPNIVDLY NLAAGEG    +LCE
Sbjct  86   CVRACGVDRATVGISSDSLLDPRVAGAVCSAACLRGCPNIVDLYANLAAGEGVAFSELCE  145

Query  481  KKQKEVGPGRRDMIQL  528
              +      RR M QL
Sbjct  146  VHRANP---RRAMSQL  158



>ref|XP_002527887.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34518.1| conserved hypothetical protein [Ricinus communis]
Length=109

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 67/85 (79%), Gaps = 3/85 (4%)
 Frame = +1

Query  274  MAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGE  453
            MA+Y+E+DECVKACGV R SVG+SSDALLE  FTAKLCSP CY  C NIVDLYFNLAAGE
Sbjct  1    MADYIESDECVKACGVDRNSVGISSDALLEPQFTAKLCSPACYQKCSNIVDLYFNLAAGE  60

Query  454  GAYLPDLCEKKQKEVGPGRRDMIQL  528
            GA+LPDLC+  +       R MIQL
Sbjct  61   GAFLPDLCDASRTNP---HRSMIQL  82



>ref|XP_002993093.1| hypothetical protein SELMODRAFT_431237 [Selaginella moellendorffii]
 gb|EFJ05841.1| hypothetical protein SELMODRAFT_431237 [Selaginella moellendorffii]
Length=196

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 93/145 (64%), Gaps = 3/145 (2%)
 Frame = +1

Query  43   SRSMASMKFSSVLVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDN  222
            +RS  S+ F S  V+LL  + +  G  + + CE+LP   CAF+VS++G RCVLE  I  +
Sbjct  2    ARSSRSLAFVSSFVILLCISGAIAG--SRLECEDLPPQDCAFAVSTMGNRCVLEKFIAQD  59

Query  223  GKVEYECKTSEVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECY  402
                YEC+TS V+     A ++E+D+CVK CGV R  VG SSD L    F  +LCSP C 
Sbjct  60   SSAIYECQTSNVMAEKQEA-WIESDKCVKECGVERMWVGFSSDGLANRNFVNRLCSPVCQ  118

Query  403  NNCPNIVDLYFNLAAGEGAYLPDLC  477
            NNCPNIV+L+ +LAAGEG  L ++C
Sbjct  119  NNCPNIVNLFESLAAGEGVNLAEVC  143



>emb|CDP09118.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 91/133 (68%), Gaps = 5/133 (4%)
 Frame = +1

Query  76   VLVLLLACTLSFHGVLA-DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTS  252
            V+++ LA +L   G LA ++IC+ LP+  CAFS+SS GKRC LE S  D   V ++CKTS
Sbjct  2    VMIIFLALSLLLQGALAGELICDELPVGMCAFSISSSGKRCSLETS--DEPGV-FQCKTS  58

Query  253  EVVVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLY  432
            E++V   + E++ETDEC+ ACG  R   G+SSD L +  FTAKLCS  C NNCPN+VDLY
Sbjct  59   EILV-HKIREHIETDECITACGADRNVTGISSDFLFDPIFTAKLCSNRCLNNCPNMVDLY  117

Query  433  FNLAAGEGAYLPD  471
             NLA  EG  + D
Sbjct  118  SNLALAEGELICD  130


 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +1

Query  127  DIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEVVVGSSMAEYLETDECV  306
            ++IC+ LP+  CAFS+SS GKRC LE S  D   V ++CKTSE++V   + E++ETDEC+
Sbjct  126  ELICDELPVGMCAFSISSSGKRCSLETS--DEPGV-FQCKTSEILV-HKIREHIETDECI  181

Query  307  KACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFNLAAGEGAYLPDLCEKK  486
             ACG  R   G+SSD L +  FTAKLCS  C NNCPN+VDLY NLA  EG  L   C K 
Sbjct  182  TACGADRNVTGISSDFLFDPIFTAKLCSNRCLNNCPNMVDLYSNLALAEGKLLSKRC-KA  240

Query  487  QKEVGPGRRDMIQL  528
            Q+  G  RR M + 
Sbjct  241  QETHGTPRRAMSEF  254



>ref|XP_011032294.1| PREDICTED: uncharacterized protein LOC105131157 [Populus euphratica]
Length=170

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 94/146 (64%), Gaps = 10/146 (7%)
 Frame = +1

Query  79   LVLLLACTLSFHGVLADIICENLPINACAFSVSSIGKRCVLENSIKDNGKVEYECKTSEV  258
            L+  LA +L  +G L +++CE LP++ C++S+++ GKRC+LEN    +G V+Y+CKTSEV
Sbjct  3    LIAFLALSLLLNGALGELVCEQLPVDLCSYSIATSGKRCLLENYATKDGGVKYQCKTSEV  62

Query  259  VVGSSMAEYLETDECVKACGVGRKSVGMSSDALLEATFTAKLCSPECYNNCPNIVDLYFN  438
            VVG  + E++E DEC+ ACG+ R +VG+SSD+LL+  F  KLCS  C   C         
Sbjct  63   VVG-ILNEWIEIDECITACGLSRNTVGISSDSLLQPQFLTKLCSQSCSQAC--------G  113

Query  439  LAAGEGAYLPDLCEKKQKEVGPGRRD  516
            LA G   YLP+LC   ++ +   R +
Sbjct  114  LAYGR-VYLPNLCANPRRAMYQTRSN  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2157395784052