BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24675_g2_i7 len=1227 path=[6881:0-507 7389:508-772 2854:773-781
10167:782-805 6448:806-862 6505:863-891 6534:892-947 6589:948-966
6608:967-1007 10774:1008-1025 10814:1026-1026 10815:1027-1049
10838:1050-1226]

Length=1227
                                                                      Score     E

ref|XP_002282343.2|  PREDICTED: protein YIPF1 homolog                   324   2e-105   Vitis vinifera
emb|CDP00144.1|  unnamed protein product                                325   2e-105   
ref|XP_011085009.1|  PREDICTED: protein YIPF1 homolog                   324   2e-105   
ref|XP_009767138.1|  PREDICTED: protein YIPF1 homolog isoform X2        323   5e-105   
ref|XP_009767137.1|  PREDICTED: protein YIPF1 homolog isoform X1        323   6e-105   
ref|XP_009614280.1|  PREDICTED: protein YIPF1 homolog isoform X2        323   8e-105   
ref|XP_009614279.1|  PREDICTED: protein YIPF1 homolog isoform X1        322   1e-104   
emb|CBI31611.3|  unnamed protein product                                317   1e-102   
gb|EYU35249.1|  hypothetical protein MIMGU_mgv1a012028mg                315   4e-102   
ref|NP_001241169.1|  uncharacterized protein LOC100813483               310   9e-100   
ref|XP_003519363.1|  PREDICTED: protein YIPF1 homolog isoform X1        309   2e-99    
gb|KHG12116.1|  Protein YIPF1                                           308   3e-99    
ref|XP_006355685.1|  PREDICTED: protein YIPF1 homolog isoform X1        306   2e-98    
ref|XP_006575515.1|  PREDICTED: protein YIPF1 homolog isoform X2        304   6e-98    
ref|XP_006595617.1|  PREDICTED: uncharacterized protein LOC100813...    303   7e-98    
ref|XP_004239916.1|  PREDICTED: protein YIPF1 homolog isoform X1        305   1e-97    
ref|XP_006355686.1|  PREDICTED: protein YIPF1 homolog isoform X2        303   3e-97    
ref|XP_007009198.1|  Integral membrane Yip1 family protein              304   3e-97    
ref|XP_010321437.1|  PREDICTED: protein YIPF1 homolog isoform X2        301   2e-96    
ref|XP_010532964.1|  PREDICTED: protein YIPF1 homolog                   301   3e-96    
ref|XP_007141842.1|  hypothetical protein PHAVU_008G230200g             300   6e-96    
gb|KDO69191.1|  hypothetical protein CISIN_1g024346mg                   300   8e-96    
ref|XP_006435607.1|  hypothetical protein CICLE_v10032419mg             300   9e-96    
gb|KHG16339.1|  Protein YIPF1                                           298   3e-95    
ref|XP_010262637.1|  PREDICTED: protein YIPF1 homolog isoform X3        296   2e-94    
ref|XP_010108392.1|  Protein YIPF1-like protein                         295   5e-94    
ref|NP_850322.1|  Integral membrane Yip1 family protein                 295   8e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138449.1|  PREDICTED: protein YIPF1 homolog                   294   1e-93    
ref|XP_003616495.1|  YIPF1-like protein                                 294   1e-93    
ref|XP_004159789.1|  PREDICTED: LOW QUALITY PROTEIN: protein YIPF...    293   2e-93    
ref|XP_010505670.1|  PREDICTED: protein YIPF1 homolog isoform X1        293   5e-93    
ref|XP_008441401.1|  PREDICTED: protein YIPF1 homolog isoform X1        293   5e-93    
ref|XP_010517344.1|  PREDICTED: protein YIPF1 homolog                   292   7e-93    
ref|XP_010256786.1|  PREDICTED: protein YIPF1 homolog                   292   8e-93    
ref|NP_001078024.1|  Integral membrane Yip1 family protein              290   6e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881680.1|  integral membrane Yip1 family protein              290   9e-92    
ref|XP_002524232.1|  Protein YIPF1, putative                            289   1e-91    Ricinus communis
ref|XP_006411218.1|  hypothetical protein EUTSA_v10017061mg             289   2e-91    
ref|XP_010508966.1|  PREDICTED: protein YIPF1 homolog                   289   2e-91    
ref|XP_008233494.1|  PREDICTED: protein YIPF1 homolog                   288   2e-91    
ref|XP_007218809.1|  hypothetical protein PRUPE_ppa009988mg             288   3e-91    
ref|XP_007163472.1|  hypothetical protein PHAVU_001G237000g             288   3e-91    
ref|XP_010067458.1|  PREDICTED: protein YIPF1 homolog                   287   5e-91    
gb|KFK36871.1|  hypothetical protein AALP_AA4G182600                    286   2e-90    
ref|XP_008441402.1|  PREDICTED: protein YIPF1 homolog isoform X2        285   2e-90    
ref|XP_004307579.1|  PREDICTED: protein YIPF1 homolog                   285   4e-90    
emb|CDY61783.1|  BnaC03g72610D                                          285   5e-90    
ref|XP_011035517.1|  PREDICTED: protein YIPF1 homolog                   284   9e-90    
emb|CDY07634.1|  BnaA03g18770D                                          284   1e-89    
gb|KFK36870.1|  hypothetical protein AALP_AA4G182600                    284   2e-89    
ref|XP_004490910.1|  PREDICTED: protein YIPF1 homolog                   283   2e-89    
gb|AFK40844.1|  unknown                                                 283   2e-89    
ref|XP_009133386.1|  PREDICTED: protein YIPF1 homolog                   281   2e-88    
ref|XP_006411217.1|  hypothetical protein EUTSA_v10017061mg             279   3e-88    
gb|AES71016.2|  integral membrane Yip1 family protein                   276   8e-87    
ref|XP_009141838.1|  PREDICTED: protein YIPF1 homolog                   276   1e-86    
gb|EPS71712.1|  hypothetical protein M569_03049                         276   1e-86    
emb|CDX93232.1|  BnaC04g46640D                                          276   2e-86    
emb|CDY07035.1|  BnaA04g22800D                                          276   2e-86    
ref|XP_002315201.1|  integral membrane Yip1 family protein              273   2e-85    Populus trichocarpa [western balsam poplar]
ref|XP_003600765.1|  YIPF1-like protein                                 278   2e-85    
ref|XP_010691541.1|  PREDICTED: protein YIPF1 homolog                   272   4e-85    
gb|KDP44878.1|  hypothetical protein JCGZ_01378                         271   1e-84    
ref|XP_009343971.1|  PREDICTED: protein YIPF1 homolog                   271   1e-84    
ref|XP_010262635.1|  PREDICTED: uncharacterized protein LOC104601...    273   1e-84    
gb|KEH28265.1|  integral membrane Yip1 family protein                   268   4e-84    
gb|KHG01637.1|  Protein YIPF1                                           268   2e-83    
ref|XP_008372128.1|  PREDICTED: protein YIPF1 homolog                   268   2e-83    
ref|XP_002312118.1|  integral membrane Yip1 family protein              263   6e-82    Populus trichocarpa [western balsam poplar]
ref|XP_011036065.1|  PREDICTED: protein YIPF1 homolog                   260   2e-80    
ref|XP_009351350.1|  PREDICTED: protein YIPF1 homolog                   253   9e-78    
ref|XP_008785510.1|  PREDICTED: protein YIPF1 homolog                   246   7e-75    
gb|AES71018.2|  integral membrane Yip1 family protein                   244   3e-74    
ref|XP_010923217.1|  PREDICTED: protein YIPF1 homolog                   241   3e-73    
ref|XP_003600767.1|  YIPF1-like protein                                 244   8e-73    
gb|KDO69190.1|  hypothetical protein CISIN_1g024346mg                   231   1e-69    
ref|XP_009407515.1|  PREDICTED: protein YIPF1 homolog isoform X1        229   2e-68    
ref|XP_009402311.1|  PREDICTED: protein YIPF1 homolog                   225   6e-67    
ref|XP_010231311.1|  PREDICTED: protein YIPF1 homolog isoform X1        224   1e-66    
ref|XP_008777628.1|  PREDICTED: protein YIPF1 homolog                   223   3e-66    
gb|AFW78235.1|  hypothetical protein ZEAMMB73_057796                    222   8e-66    
ref|XP_003568324.1|  PREDICTED: protein YIPF1 homolog isoform X2        222   1e-65    
ref|XP_008647603.1|  PREDICTED: uncharacterized protein LOC100274...    221   2e-65    
gb|ACF81573.1|  unknown                                                 221   3e-65    Zea mays [maize]
ref|XP_010262636.1|  PREDICTED: protein YIPF1-like isoform X2           221   5e-65    
ref|XP_010931204.1|  PREDICTED: protein YIPF1 homolog                   219   1e-64    
ref|NP_001142205.1|  uncharacterized protein LOC100274373               218   3e-64    Zea mays [maize]
ref|XP_006655373.1|  PREDICTED: protein YIPF1 homolog                   217   7e-64    
gb|KEH34763.1|  integral membrane Yip1 family protein                   216   1e-63    
ref|XP_002439908.1|  hypothetical protein SORBIDRAFT_09g022330          213   2e-62    Sorghum bicolor [broomcorn]
ref|XP_004961883.1|  PREDICTED: protein YIPF1 homolog                   213   3e-62    
ref|NP_001055726.1|  Os05g0455800                                       213   5e-62    Oryza sativa Japonica Group [Japonica rice]
gb|EEC79336.1|  hypothetical protein OsI_20193                          212   5e-62    Oryza sativa Indica Group [Indian rice]
gb|EMS58318.1|  Protein YIPF1-like protein                              203   1e-58    
gb|EMT09397.1|  hypothetical protein F775_31600                         202   4e-58    
gb|ABR17353.1|  unknown                                                 202   5e-58    Picea sitchensis
ref|XP_008343575.1|  PREDICTED: protein YIPF1 homolog                   178   3e-50    
ref|XP_007163471.1|  hypothetical protein PHAVU_001G237000g             177   2e-49    
ref|XP_009407517.1|  PREDICTED: protein YIPF1 homolog isoform X2        170   1e-46    
ref|XP_006846377.1|  hypothetical protein AMTR_s00012p00263140          170   3e-46    
gb|ABK26328.1|  unknown                                                 170   7e-46    Picea sitchensis
ref|XP_002986407.1|  hypothetical protein SELMODRAFT_157954             166   2e-44    
ref|XP_002988663.1|  hypothetical protein SELMODRAFT_447419             166   3e-44    
ref|XP_001778988.1|  predicted protein                                  154   1e-39    
gb|ABK21160.1|  unknown                                                 153   3e-39    Picea sitchensis
gb|ACN40317.1|  unknown                                                 152   5e-39    Picea sitchensis
emb|CDY18767.1|  BnaAnng02320D                                          148   9e-38    
ref|XP_006855284.1|  hypothetical protein AMTR_s00057p00035800          149   1e-37    
ref|XP_009147256.1|  PREDICTED: protein YIPF1 homolog                   147   3e-37    
emb|CDY05155.1|  BnaC05g46480D                                          146   6e-37    
ref|XP_001779018.1|  predicted protein                                  144   8e-37    
gb|KHG03382.1|  Protein YIPF1                                           145   9e-37    
ref|XP_008789655.1|  PREDICTED: protein YIPF1 homolog                   145   1e-36    
ref|XP_009124072.1|  PREDICTED: protein YIPF1 homolog                   144   6e-36    
ref|XP_010917577.1|  PREDICTED: protein YIPF1 homolog                   143   1e-35    
emb|CDY27779.1|  BnaA05g31880D                                          142   2e-35    
ref|XP_008809417.1|  PREDICTED: protein YIPF1 homolog isoform X1        143   3e-35    
ref|XP_008450652.1|  PREDICTED: protein YIPF1 homolog                   142   3e-35    
ref|XP_008809425.1|  PREDICTED: protein YIPF1 homolog isoform X2        142   3e-35    
emb|CDY40704.1|  BnaC03g34200D                                          141   4e-35    
ref|XP_007205696.1|  hypothetical protein PRUPE_ppa009732mg             141   5e-35    
ref|XP_010494004.1|  PREDICTED: protein YIPF1 homolog                   140   7e-35    
gb|KFK37932.1|  hypothetical protein AALP_AA3G048900                    140   7e-35    
ref|XP_010255944.1|  PREDICTED: protein YIPF1 homolog                   140   8e-35    
ref|XP_009416090.1|  PREDICTED: protein YIPF1 homolog isoform X2        140   9e-35    
ref|XP_009416088.1|  PREDICTED: protein YIPF1 homolog isoform X1        140   1e-34    
ref|XP_002872269.1|  integral membrane Yip1 family protein              140   1e-34    
ref|XP_006408092.1|  hypothetical protein EUTSA_v10021283mg             140   1e-34    
ref|XP_003535342.1|  PREDICTED: protein YIPF1 homolog                   140   1e-34    
ref|XP_004494622.1|  PREDICTED: protein YIPF1 homolog                   140   1e-34    
ref|XP_004302434.1|  PREDICTED: protein YIPF1 homolog                   140   2e-34    
ref|XP_010674762.1|  PREDICTED: protein YIPF1 homolog                   139   2e-34    
ref|XP_010925137.1|  PREDICTED: protein YIPF1 homolog isoform X3        139   2e-34    
ref|XP_010925136.1|  PREDICTED: protein YIPF1 homolog isoform X2        139   2e-34    
ref|XP_008370491.1|  PREDICTED: protein YIPF1 homolog                   139   4e-34    
ref|XP_006382606.1|  integral membrane Yip1 family protein              139   5e-34    
ref|XP_010278010.1|  PREDICTED: protein YIPF1 homolog                   138   5e-34    
ref|XP_001777312.1|  predicted protein                                  138   5e-34    
ref|XP_009134819.1|  PREDICTED: protein YIPF1 homolog                   138   6e-34    
ref|XP_010925135.1|  PREDICTED: protein YIPF1 homolog isoform X1        140   6e-34    
ref|NP_198101.2|  Integral membrane Yip1 family protein                 138   7e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036777.1|  PREDICTED: protein YIPF1 homolog isoform X1        137   2e-33    
ref|XP_011036779.1|  PREDICTED: protein YIPF1 homolog isoform X3        137   2e-33    
ref|XP_010421605.1|  PREDICTED: protein YIPF1 homolog isoform X2        136   2e-33    
ref|XP_010421604.1|  PREDICTED: protein YIPF1 homolog isoform X1        137   3e-33    
gb|AAR23733.1|  At5g27490                                               136   4e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004171192.1|  PREDICTED: LOW QUALITY PROTEIN: protein YIPF...    135   1e-32    
emb|CDY66983.1|  BnaAnng23320D                                          135   1e-32    
ref|XP_004135620.1|  PREDICTED: protein YIPF1 homolog                   134   1e-32    
ref|XP_010025180.1|  PREDICTED: protein YIPF1 homolog                   134   2e-32    
ref|XP_010455117.1|  PREDICTED: protein YIPF1 homolog                   134   2e-32    
ref|XP_006606513.1|  PREDICTED: protein YIPF1 homolog isoform X2        133   3e-32    
ref|XP_011073419.1|  PREDICTED: protein YIPF1 homolog                   133   4e-32    
ref|XP_003521710.1|  PREDICTED: protein YIPF1 homolog                   132   6e-32    
ref|XP_007030858.1|  Integral membrane Yip1 family protein              132   6e-32    
ref|XP_009387501.1|  PREDICTED: protein YIPF1 homolog                   132   9e-32    
ref|XP_007144735.1|  hypothetical protein PHAVU_007G180400g             132   1e-31    
gb|ACU19300.1|  unknown                                                 131   2e-31    Glycine max [soybeans]
ref|XP_003554661.1|  PREDICTED: protein YIPF1 homolog                   131   2e-31    
gb|EYU21656.1|  hypothetical protein MIMGU_mgv1a011469mg                130   3e-31    
ref|XP_006394963.1|  hypothetical protein EUTSA_v10004745mg             130   4e-31    
ref|XP_010659840.1|  PREDICTED: protein YIPF1 homolog                   130   4e-31    
ref|XP_007147056.1|  hypothetical protein PHAVU_006G092500g             130   5e-31    
ref|XP_006361852.1|  PREDICTED: protein YIPF1 homolog                   129   7e-31    
dbj|BAE99567.1|  hypothetical protein                                   128   8e-31    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010312639.1|  PREDICTED: protein YIPF1 homolog                   129   8e-31    
ref|XP_010524878.1|  PREDICTED: protein YIPF1 homolog                   129   9e-31    
ref|XP_008359872.1|  PREDICTED: protein YIPF1 homolog                   129   9e-31    
ref|XP_008366844.1|  PREDICTED: protein YIPF1 homolog                   129   9e-31    
ref|XP_008350748.1|  PREDICTED: protein YIPF1 homolog                   129   9e-31    
ref|XP_009625699.1|  PREDICTED: protein YIPF1 homolog                   129   1e-30    
ref|XP_003555600.1|  PREDICTED: protein YIPF1 homolog isoform X1        129   1e-30    
gb|ACU23194.1|  unknown                                                 129   1e-30    Glycine max [soybeans]
ref|XP_009393619.1|  PREDICTED: protein YIPF1 homolog                   129   2e-30    
ref|XP_003626299.1|  Protein YIPF2                                      128   2e-30    
ref|XP_002512371.1|  Protein YIPF1, putative                            128   2e-30    Ricinus communis
ref|XP_006433316.1|  hypothetical protein CICLE_v10002100mg             128   3e-30    
gb|AFK48180.1|  unknown                                                 127   3e-30    
ref|XP_009784693.1|  PREDICTED: protein YIPF1 homolog                   127   6e-30    
ref|XP_009349382.1|  PREDICTED: protein YIPF1 homolog                   127   6e-30    
ref|XP_006298278.1|  hypothetical protein CARUB_v10014343mg             127   6e-30    
ref|NP_187179.2|  Integral membrane Yip1 family protein                 127   7e-30    Arabidopsis thaliana [mouse-ear cress]
gb|AAF27034.1|AC009177_24  unknown protein                              127   8e-30    Arabidopsis thaliana [mouse-ear cress]
emb|CDM83410.1|  unnamed protein product                                127   8e-30    
dbj|BAJ95908.1|  predicted protein                                      127   8e-30    
gb|KHG11614.1|  Protein YIPF1                                           127   9e-30    
ref|XP_010485960.1|  PREDICTED: protein YIPF1 homolog isoform X1        126   9e-30    
ref|XP_003569338.1|  PREDICTED: protein YIPF1 homolog                   127   9e-30    
ref|XP_010425236.1|  PREDICTED: protein YIPF1 homolog                   126   1e-29    
ref|XP_010464047.1|  PREDICTED: protein YIPF1 homolog                   126   1e-29    
gb|EPS57867.1|  hypothetical protein M569_16950                         125   3e-29    
emb|CDP15523.1|  unnamed protein product                                125   3e-29    
ref|NP_001043545.1|  Os01g0610500                                       125   3e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644358.1|  PREDICTED: protein YIPF1 homolog                   125   4e-29    
gb|ACN36567.1|  unknown                                                 120   9e-29    Zea mays [maize]
ref|XP_002319021.2|  integral membrane Yip1 family protein              123   2e-28    Populus trichocarpa [western balsam poplar]
ref|XP_002884498.1|  integral membrane Yip1 family protein              122   4e-28    
gb|AFW83225.1|  yip1 domain family member 1                             121   6e-28    
ref|XP_004969136.1|  PREDICTED: protein YIPF1 homolog                   120   1e-27    
ref|NP_001132699.1|  uncharacterized protein LOC100194180               120   2e-27    Zea mays [maize]
gb|ACF81650.1|  unknown                                                 120   2e-27    Zea mays [maize]
ref|XP_002458142.1|  hypothetical protein SORBIDRAFT_03g027600          120   2e-27    Sorghum bicolor [broomcorn]
gb|ACG28584.1|  yip1 domain family member 1                             120   2e-27    Zea mays [maize]
ref|XP_011023592.1|  PREDICTED: protein YIPF1 homolog isoform X1        119   2e-27    
ref|XP_011023593.1|  PREDICTED: protein YIPF1 homolog isoform X2        119   2e-27    
gb|EMS51941.1|  hypothetical protein TRIUR3_20926                       119   6e-27    
ref|NP_001132111.1|  uncharacterized protein LOC100193527               118   8e-27    Zea mays [maize]
gb|KDN64706.1|  putative Yip1 domain-containing protein                 114   2e-25    
gb|KFH44583.1|  hypothetical protein ACRE_046540                        114   3e-25    
gb|AFW83223.1|  hypothetical protein ZEAMMB73_666256                    110   5e-25    
gb|EQB45472.1|  Yip1 domain-containing protein                          112   1e-24    
ref|XP_007286275.1|  yip1 domain family                                 111   2e-24    
emb|CAN77029.1|  hypothetical protein VITISV_015340                     111   5e-24    Vitis vinifera
gb|KID90742.1|  Yip1 domain family                                      108   1e-23    
gb|KIE01055.1|  Yip1 domain family                                      108   2e-23    
gb|KEZ40983.1|  hypothetical protein SAPIO_CDS7003                      108   3e-23    
gb|KID80626.1|  Yip1 domain family                                      107   3e-23    
ref|XP_009650037.1|  YIPF1 protein                                      107   4e-23    
gb|AFK38668.1|  unknown                                                 106   4e-23    
emb|CCE31449.1|  uncharacterized protein CPUR_05302                     107   4e-23    
ref|XP_001224040.1|  hypothetical protein CHGG_04826                    107   4e-23    Chaetomium globosum CBS 148.51
ref|XP_007814974.1|  Yip1 domain family                                 107   5e-23    
ref|XP_006433315.1|  hypothetical protein CICLE_v10002100mg             106   6e-23    
ref|XP_007918655.1|  putative yip1 domain family protein                106   8e-23    
ref|XP_007779007.1|  hypothetical protein W97_02918                     106   1e-22    
ref|XP_003660668.1|  hypothetical protein MYCTH_2299238                 106   1e-22    
ref|XP_003040087.1|  predicted protein                                  105   2e-22    
gb|EHK48329.1|  hypothetical protein TRIATDRAFT_238084                  105   2e-22    
ref|XP_007817296.1|  Yip1 domain family                                 105   2e-22    
ref|XP_003348689.1|  hypothetical protein SMAC_01712                    105   3e-22    
ref|XP_961913.1|  hypothetical protein NCU05276                         105   3e-22    Neurospora crassa OR74A
ref|XP_009850098.1|  hypothetical protein NEUTE1DRAFT_116694            105   3e-22    
gb|KHN97882.1|  Yip1 domain family                                      103   7e-22    
ref|XP_006693433.1|  hypothetical protein CTHT_0029780                  103   7e-22    
ref|XP_003600768.1|  YIPF1-like protein                                 102   1e-21    
ref|XP_001597676.1|  hypothetical protein SS1G_01872                    103   1e-21    Sclerotinia sclerotiorum 1980 UF-70
gb|EWG47046.1|  hypothetical protein FVEG_07285                         102   2e-21    
ref|XP_006965951.1|  predicted protein                                  102   3e-21    
gb|EFQ27592.1|  Yip1 domain-containing protein                          102   3e-21    
gb|AFW83224.1|  hypothetical protein ZEAMMB73_666256                    101   3e-21    
ref|XP_006668176.1|  Yip1 domain family                                 102   4e-21    
emb|CDP26954.1|  Putative protein of unknown function similar to ...    102   4e-21    
gb|EKG14194.1|  hypothetical protein MPH_08647                          102   5e-21    
gb|EHK20260.1|  hypothetical protein TRIVIDRAFT_68943                   101   5e-21    
ref|XP_007294574.1|  Yip1 domain family                                 101   5e-21    
ref|XP_003009071.1|  YIPF1                                              101   5e-21    
emb|CCF40575.1|  Yip1 domain-containing protein                         101   5e-21    
emb|CCT72417.1|  probable YIP5 Protein that interacts with Rab GT...    101   6e-21    
ref|XP_003299862.1|  hypothetical protein PTT_10950                     100   6e-21    
gb|EWZ00911.1|  hypothetical protein FOYG_00631                         101   6e-21    
gb|EGU78281.1|  hypothetical protein FOXB_11193                         101   6e-21    
gb|KEQ71258.1|  Yip1-domain-containing protein                          100   7e-21    
ref|XP_008087434.1|  hypothetical protein GLAREA_02027                  101   7e-21    
gb|ENH78509.1|  yip1 domain family                                      100   9e-21    
ref|XP_002847965.1|  YIP5                                               100   1e-20    Arthroderma otae CBS 113480
ref|XP_001551514.1|  hypothetical protein BC1G_09784                    100   1e-20    Botrytis cinerea B05.10
ref|XP_003175554.1|  YIP5                                               100   1e-20    
gb|EQK98004.1|  Yip1 domain family                                      100   1e-20    
ref|XP_001935539.1|  Yip1 domain containing family                      100   1e-20    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007597934.1|  Yip1 domain-containing protein                     100   2e-20    
ref|XP_003036150.1|  hypothetical protein SCHCODRAFT_66152            99.8    2e-20    
gb|EFX05512.1|  yip1 domain family protein                            99.8    2e-20    
ref|XP_007922864.1|  hypothetical protein MYCFIDRAFT_82636            99.8    2e-20    
gb|KEQ63028.1|  Yip1-domain-containing protein                        99.4    2e-20    
ref|XP_004342519.1|  Yip1 domain containing protein                   99.8    3e-20    
ref|XP_008600172.1|  Yip1 domain-containing protein                   99.4    3e-20    
emb|CEJ80312.1|  Putative Yip1 domain family                          99.4    3e-20    
dbj|GAM38184.1|  hypothetical protein TCE0_033r08712                  99.8    3e-20    
ref|XP_011124788.1|  hypothetical protein AOL_s00109g5                99.0    3e-20    
gb|KEQ83687.1|  Yip1-domain-containing protein                        98.6    3e-20    
ref|XP_008026167.1|  hypothetical protein SETTUDRAFT_131452           99.4    3e-20    
ref|XP_004357313.1|  Yip1 domain-containing protein                     100   4e-20    
ref|XP_003020811.1|  hypothetical protein TRV_05087                   99.0    4e-20    
ref|XP_003009882.1|  hypothetical protein ARB_03808                   99.0    4e-20    
gb|EGD98539.1|  Yip1 domain family protein                            99.0    4e-20    
ref|XP_003234309.1|  Yip1 domain family protein                       99.0    4e-20    
gb|EHA26281.1|  hypothetical protein ASPNIDRAFT_170718                98.6    5e-20    
ref|XP_002626032.1|  Yip1 family protein                              99.0    5e-20    Blastomyces gilchristii SLH14081
gb|EMF15737.1|  Yip1 domain family                                    98.6    5e-20    
gb|KFX43636.1|  Protein YIP5                                          98.6    6e-20    
gb|EPQ66931.1|  hypothetical protein BGT96224_5134                    97.1    6e-20    
ref|XP_002583584.1|  conserved hypothetical protein                   98.6    6e-20    
emb|CAK43653.1|  unnamed protein product                              99.0    6e-20    
ref|XP_002483962.1|  Yip1 domain family                               98.6    6e-20    
emb|CCU76965.1|  Yip1 domain family member                            97.1    7e-20    
ref|XP_002150297.1|  Yip1 domain family                               98.6    7e-20    
ref|XP_001388721.2|  Yip1 domain family                               98.2    7e-20    
gb|EEH05934.1|  Yip1 domain-containing protein                        98.2    8e-20    
ref|XP_009260571.1|  hypothetical protein FPSE_09179                  97.8    8e-20    
gb|KEQ93187.1|  hypothetical protein AUEXF2481DRAFT_7134              97.8    9e-20    
ref|XP_003842596.1|  similar to Yip1 domain family protein            97.8    1e-19    
gb|EPZ35209.1|  hypothetical protein O9G_005176                       97.4    1e-19    
ref|XP_007701768.1|  hypothetical protein COCSADRAFT_94745            97.8    1e-19    
gb|KEY70877.1|  hypothetical protein S7711_00723                      97.1    1e-19    
gb|EEQ92390.1|  Yip1 domain family                                    97.8    1e-19    
gb|EGC49664.1|  Yip1 domain-containing family                         97.4    1e-19    
gb|EGE85593.1|  Yip1 domain family protein                            97.8    2e-19    
ref|XP_001820064.1|  Yip1 domain family                               97.1    2e-19    
gb|EQL35083.1|  hypothetical protein BDFG_03073                       97.8    2e-19    
ref|XP_001732999.1|  Yip1 domain-containing protein                   96.7    3e-19    
ref|XP_007676545.1|  hypothetical protein BAUCODRAFT_576140           96.7    3e-19    
gb|KEP49720.1|  Yip1 domain protein                                   96.3    4e-19    
ref|XP_007691098.1|  hypothetical protein COCMIDRAFT_39544            96.3    4e-19    
ref|XP_382133.1|  hypothetical protein FG01957.1                      95.9    4e-19    
ref|XP_009220152.1|  hypothetical protein GGTG_04098                  95.9    5e-19    
ref|XP_007713921.1|  hypothetical protein COCCADRAFT_100400           95.9    6e-19    
ref|XP_640517.1|  Yip1 domain-containing protein                      96.3    6e-19    
gb|EMD86028.1|  hypothetical protein COCHEDRAFT_1187149               95.9    6e-19    
ref|XP_005645624.1|  Yip1 domain-containing protein                   94.0    6e-19    
dbj|GAD92746.1|  Yip1 domain family                                   95.5    7e-19    
gb|EFW14848.1|  Yip1 domain family                                    95.5    8e-19    
ref|XP_003071355.1|  Yip1 domain containing protein                   95.5    8e-19    
ref|XP_001245553.1|  hypothetical protein CIMG_04994                  95.5    8e-19    
emb|CCX05144.1|  Similar to Protein YIP5; acc. no. Q9UTD3             95.1    8e-19    
ref|XP_008035796.1|  Yip1-domain-containing protein                   94.7    9e-19    
ref|XP_003855469.1|  hypothetical protein MYCGRDRAFT_99185            95.1    1e-18    
ref|XP_003653350.1|  hypothetical protein THITE_2075765               95.1    1e-18    
gb|EME47738.1|  hypothetical protein DOTSEDRAFT_69620                 94.4    2e-18    
gb|EPE03425.1|  yip1 domain family                                    94.0    2e-18    
ref|XP_750151.1|  Yip1 domain family                                  93.6    3e-18    
ref|XP_001269752.1|  Yip1 domain family                               93.6    3e-18    
ref|XP_005846411.1|  hypothetical protein CHLNCDRAFT_24956            92.0    3e-18    
ref|XP_003711896.1|  hypothetical protein MGG_06045                   93.6    3e-18    
ref|XP_007583724.1|  putative yip1 domain family protein              94.0    3e-18    
ref|XP_002841843.1|  hypothetical protein                             93.6    3e-18    
gb|KEY77094.1|  hypothetical protein Yip1                             93.2    4e-18    
gb|KDD74167.1|  hypothetical protein H632_c1515p0                     93.6    6e-18    
gb|EWG47047.1|  hypothetical protein FVEG_07285                       91.3    7e-18    
ref|NP_494439.1|  Protein Y25C1A.7, isoform b                         92.4    8e-18    
ref|XP_005994229.1|  PREDICTED: protein YIPF2 isoform X1              92.4    1e-17    
dbj|GAM26248.1|  hypothetical protein SAMD00019534_094230             92.8    1e-17    
ref|NP_494438.2|  Protein Y25C1A.7, isoform a                         91.7    1e-17    
gb|ELT94599.1|  hypothetical protein CAPTEDRAFT_178563                93.6    2e-17    
ref|XP_003293746.1|  hypothetical protein DICPUDRAFT_51115            92.0    2e-17    
gb|ESZ98665.1|  hypothetical protein SBOR_0903                        91.3    3e-17    
ref|XP_007907158.1|  PREDICTED: LOW QUALITY PROTEIN: protein YIPF1    91.3    3e-17    
ref|XP_001265258.1|  Yip1 domain family                               90.9    3e-17    
gb|EPS27903.1|  hypothetical protein PDE_02847                        90.5    3e-17    
ref|XP_001456462.1|  hypothetical protein                             89.7    3e-17    
ref|XP_010749347.1|  PREDICTED: protein YIPF2                         90.9    4e-17    
ref|XP_661621.1|  hypothetical protein AN4017.2                       90.5    4e-17    
gb|KDQ18414.1|  hypothetical protein BOTBODRAFT_171259                90.5    5e-17    
gb|KFM26108.1|  YIPF1-like protein                                    90.9    6e-17    
gb|EMD40551.1|  hypothetical protein CERSUDRAFT_111150                89.4    8e-17    
ref|NP_001022420.1|  Protein Y25C1A.7, isoform c                      91.3    8e-17    
ref|NP_001008078.1|  Yip1 domain family, member 2                     89.7    9e-17    
ref|XP_008721395.1|  hypothetical protein HMPREF1541_08855            89.0    1e-16    
gb|AFW78236.1|  hypothetical protein ZEAMMB73_057796                  85.1    2e-16    
ref|XP_002422682.1|  protein YIPF1, putative                          88.6    2e-16    
ref|XP_006455173.1|  hypothetical protein AGABI2DRAFT_194825          88.2    2e-16    
ref|XP_005994230.1|  PREDICTED: protein YIPF2 isoform X2              88.2    2e-16    
gb|KFA61584.1|  hypothetical protein S40285_03988                     87.8    3e-16    
gb|KGO44742.1|  hypothetical protein PEXP_020140                      88.2    3e-16    
ref|XP_002561160.1|  Pc16g08390                                       88.2    3e-16    
gb|EKC21886.1|  Protein YIPF1                                         89.0    3e-16    
ref|XP_011115439.1|  hypothetical protein H072_9908                   87.8    3e-16    
emb|CDO74036.1|  hypothetical protein BN946_scf185043.g86             87.4    3e-16    
ref|XP_007379467.1|  Yip1-domain-containing protein                   87.8    3e-16    
gb|KFH72788.1|  hypothetical protein MVEG_00014                       87.8    4e-16    
ref|NP_001088236.1|  Yip1 domain family, member 2                     87.8    4e-16    
gb|EGE02147.1|  Yip1 family protein                                   87.4    4e-16    
gb|EYE94430.1|  Yip1 domain family                                    87.4    5e-16    
gb|ERT02623.1|  hypothetical protein HMPREF1624_00924                 87.4    5e-16    
ref|XP_003083121.1|  putative integral membrane Yip1 family prote...  87.0    5e-16    
gb|KEF57541.1|  hypothetical protein A1O9_05458                       87.0    7e-16    
gb|EKV11189.1|  hypothetical protein PDIG_52010                       87.0    7e-16    
ref|NP_001088769.1|  Yip1 domain family, member 1                     87.0    8e-16    
gb|KIH88946.1|  hypothetical protein SPBR_07534                       86.7    8e-16    
ref|XP_004517227.1|  PREDICTED: protein YIPF1 homolog                 84.7    9e-16    
ref|XP_002505459.1|  predicted protein                                85.1    9e-16    
ref|XP_010763226.1|  hypothetical protein PADG_07892                  87.0    9e-16    
ref|XP_009859347.1|  PREDICTED: protein YIPF1 isoform X2              86.7    1e-15    
ref|XP_007750548.1|  hypothetical protein A1O5_11788                  86.3    1e-15    
ref|XP_002120651.1|  PREDICTED: protein YIPF1 isoform X1              86.7    1e-15    
gb|EFA77607.1|  Yip1 domain-containing protein                        87.4    1e-15    
ref|XP_001443405.1|  hypothetical protein                             85.5    1e-15    
gb|ELR09212.1|  hypothetical protein GMDG_03786                       85.9    2e-15    
emb|CCG81500.1|  Putative uncharacterized protein                     85.5    2e-15    
ref|XP_007752827.1|  hypothetical protein A1O7_00596                  85.9    2e-15    
ref|XP_002646928.1|  Hypothetical protein CBG19633                    85.1    2e-15    
gb|KDR16819.1|  Protein YIPF1                                         85.9    2e-15    
gb|KFH63471.1|  hypothetical protein MVEG_10880                       85.5    2e-15    
gb|EER41837.1|  Yip1 domain family                                    84.7    2e-15    
ref|XP_007267295.1|  Yip1 domain family protein                       85.1    3e-15    
ref|XP_007797720.1|  putative yip1 domain family protein              84.7    3e-15    
ref|XP_007831179.1|  hypothetical protein PFICI_04407                 85.1    3e-15    
ref|XP_001440676.1|  hypothetical protein                             84.3    3e-15    
ref|XP_005326099.1|  PREDICTED: protein YIPF1                         85.1    3e-15    
gb|EEH16351.1|  hypothetical protein PABG_06438                       85.5    3e-15    
ref|XP_010370638.1|  PREDICTED: protein YIPF1                         85.1    4e-15    
ref|XP_003110163.1|  hypothetical protein CRE_06677                   84.3    5e-15    
ref|XP_007870733.1|  Yip1-domain-containing protein                   84.3    5e-15    
ref|XP_005607095.1|  PREDICTED: protein YIPF1 isoform X1              84.7    5e-15    
ref|XP_007944118.1|  PREDICTED: protein YIPF1                         84.7    5e-15    
ref|XP_004031921.1|  Yip1 domain protein                              83.6    5e-15    
ref|XP_001442839.1|  hypothetical protein                             84.0    5e-15    
ref|XP_002715131.1|  PREDICTED: protein YIPF1 isoform X1              84.7    5e-15    
emb|CDQ84484.1|  unnamed protein product                              84.3    6e-15    
ref|XP_006806274.1|  PREDICTED: protein YIPF1-like                    84.3    6e-15    
ref|XP_001212988.1|  conserved hypothetical protein                   84.3    6e-15    
ref|XP_005543371.1|  PREDICTED: protein YIPF1 isoform X2              84.3    6e-15    
gb|KDR77022.1|  hypothetical protein GALMADRAFT_225171                84.3    6e-15    
ref|NP_001187280.1|  protein YIPF2                                    84.3    7e-15    
ref|XP_001112998.1|  PREDICTED: protein YIPF1-like                    84.3    7e-15    
gb|KFY23495.1|  hypothetical protein V493_05824                       84.0    7e-15    
gb|KFX88018.1|  hypothetical protein V490_07888                       84.0    8e-15    
ref|XP_008580087.1|  PREDICTED: protein YIPF1 isoform X1              84.3    8e-15    
ref|XP_005543370.1|  PREDICTED: protein YIPF1 isoform X1              84.3    8e-15    
ref|XP_006631592.1|  PREDICTED: protein YIPF2-like                    83.6    8e-15    
ref|XP_008580090.1|  PREDICTED: protein YIPF1 isoform X2              84.0    8e-15    
ref|XP_004371770.1|  PREDICTED: protein YIPF1 isoform 1               84.0    8e-15    
ref|XP_003891965.1|  PREDICTED: protein YIPF1 isoform X1              84.0    8e-15    
gb|KFY70666.1|  hypothetical protein V499_09010                       83.6    9e-15    
gb|KDQ56707.1|  hypothetical protein JAAARDRAFT_36198                 83.6    1e-14    
ref|XP_003446487.1|  PREDICTED: protein YIPF1-like                    84.0    1e-14    
ref|XP_008263443.1|  PREDICTED: protein YIPF1 isoform X2              83.6    1e-14    
ref|XP_007719490.1|  hypothetical protein A1O1_00381                  84.3    1e-14    
gb|KFZ23746.1|  hypothetical protein V502_01776                       83.6    1e-14    
ref|XP_003815053.1|  PREDICTED: protein YIPF1 isoform X1              83.6    1e-14    
gb|KFY91043.1|  hypothetical protein V500_04823                       83.6    1e-14    
ref|XP_004568662.1|  PREDICTED: protein YIPF1-like                    83.6    1e-14    
ref|XP_007316952.1|  hypothetical protein SERLADRAFT_464185           83.2    1e-14    
ref|XP_004365237.1|  asparaginyl-tRNA synthetase                      85.9    1e-14    
ref|XP_004438638.1|  PREDICTED: protein YIPF1 isoform 3               82.8    1e-14    
gb|ENN70727.1|  hypothetical protein YQE_12557                        83.6    2e-14    
ref|XP_007128225.1|  PREDICTED: protein YIPF1                         83.2    2e-14    
emb|CEG02187.1|  Yip1 domain                                          83.2    2e-14    
ref|XP_004312441.1|  PREDICTED: protein YIPF1 isoform 1               82.8    2e-14    
gb|KFY75971.1|  hypothetical protein V498_09809                       82.8    2e-14    
ref|XP_008072453.1|  PREDICTED: protein YIPF1 isoform X2              82.8    2e-14    
emb|CCM02837.1|  predicted protein                                    82.4    2e-14    
ref|XP_003390844.1|  PREDICTED: protein YIPF1-like                    82.4    2e-14    
ref|XP_004438636.1|  PREDICTED: protein YIPF1 isoform 1               82.8    2e-14    
ref|XP_004923817.1|  PREDICTED: protein YIPF2-like isoform X1         82.8    2e-14    
ref|XP_005747335.1|  PREDICTED: protein YIPF1-like isoform X1         82.8    2e-14    
gb|KFX91033.1|  hypothetical protein O988_07946                       82.4    3e-14    
ref|XP_005398610.1|  PREDICTED: protein YIPF1 isoform X1              82.8    3e-14    
ref|XP_006002613.1|  PREDICTED: protein YIPF1 isoform X1              82.8    3e-14    
gb|ELR50670.1|  Protein YIPF1                                         82.4    3e-14    
ref|NP_001125485.1|  protein YIPF1                                    82.4    3e-14    
ref|XP_005678445.1|  PREDICTED: protein YIPF1 isoform X1              82.4    3e-14    
gb|KFY34145.1|  hypothetical protein V494_07023                       82.0    3e-14    
ref|XP_004639154.1|  PREDICTED: protein YIPF1                         82.4    3e-14    
ref|XP_008831240.1|  PREDICTED: protein YIPF1 isoform X2              82.0    3e-14    
ref|XP_003411117.1|  PREDICTED: protein YIPF1 isoform X1              82.0    4e-14    
ref|XP_005903654.1|  PREDICTED: protein YIPF1 isoform X1              82.0    4e-14    
ref|XP_008478548.1|  PREDICTED: protein YIPF1                         81.6    4e-14    
ref|XP_004002046.1|  PREDICTED: protein YIPF1 isoform 1               82.0    4e-14    
ref|XP_003464113.1|  PREDICTED: protein YIPF1 isoform X1              82.0    4e-14    
ref|XP_003356507.1|  PREDICTED: protein YIPF1 isoform X1              82.0    4e-14    
ref|XP_006149424.1|  PREDICTED: protein YIPF1 isoform X1              82.0    4e-14    
ref|XP_003308164.1|  PREDICTED: protein YIPF1 isoform X1              82.0    5e-14    
ref|XP_010608667.1|  PREDICTED: protein YIPF1                         82.0    5e-14    
ref|XP_004908854.1|  PREDICTED: protein YIPF1 isoform X1              82.0    5e-14    
emb|CCA68397.1|  hypothetical protein PIIN_02261                      81.3    5e-14    
ref|NP_061855.1|  protein YIPF1                                       81.6    5e-14    
ref|XP_006180201.1|  PREDICTED: protein YIPF1 isoform X1              81.6    5e-14    
gb|EPY26970.1|  protein YIPF2                                         81.6    5e-14    
ref|NP_001193241.1|  protein YIPF1                                    81.6    5e-14    
dbj|BAH13241.1|  unnamed protein product                              82.0    5e-14    
ref|XP_007730838.1|  hypothetical protein A1O3_02508                  81.3    5e-14    
ref|XP_008722266.1|  hypothetical protein G647_00641                  81.3    6e-14    
ref|XP_006919283.1|  PREDICTED: protein YIPF1 isoform X1              81.6    6e-14    
ref|NP_001003500.1|  protein YIPF2                                    81.6    6e-14    
ref|XP_010845452.1|  PREDICTED: protein YIPF1                         81.6    6e-14    
ref|XP_008072452.1|  PREDICTED: protein YIPF1 isoform X1              81.6    6e-14    
ref|XP_006067268.1|  PREDICTED: protein YIPF1 isoform X1              82.0    6e-14    
ref|XP_006067272.1|  PREDICTED: protein YIPF1 isoform X5              82.0    7e-14    
ref|XP_005878716.1|  PREDICTED: protein YIPF1                         81.3    7e-14    
ref|XP_003793154.1|  PREDICTED: protein YIPF1                         81.3    7e-14    
ref|XP_008137506.1|  PREDICTED: protein YIPF1                         81.3    8e-14    
gb|EDL30780.1|  Yip1 domain family, member 1, isoform CRA_d           80.9    8e-14    
ref|XP_006087402.1|  PREDICTED: protein YIPF1                         81.3    8e-14    
ref|XP_008831239.1|  PREDICTED: protein YIPF1 isoform X1              81.3    8e-14    
ref|XP_006503031.1|  PREDICTED: protein YIPF1 isoform X1              80.9    8e-14    
ref|NP_955415.1|  protein YIPF1                                       81.3    8e-14    
ref|XP_010589553.1|  PREDICTED: protein YIPF1 isoform X2              81.3    8e-14    
ref|XP_006238567.1|  PREDICTED: protein YIPF1 isoform X2              81.3    9e-14    
ref|XP_006768409.1|  PREDICTED: protein YIPF1                         80.9    1e-13    
ref|XP_006023441.1|  PREDICTED: protein YIPF2 isoform X1              80.9    1e-13    
ref|XP_004588747.1|  PREDICTED: protein YIPF1 isoform X1              80.9    1e-13    
ref|NP_663525.1|  protein YIPF1 isoform 1                             80.9    1e-13    
ref|XP_009456463.1|  PREDICTED: protein YIPF1 isoform X2              80.5    1e-13    
ref|XP_008332826.1|  PREDICTED: protein YIPF1                         80.9    1e-13    
ref|XP_006265636.1|  PREDICTED: protein YIPF2 isoform X1              80.9    1e-13    
ref|XP_004679084.1|  PREDICTED: protein YIPF1                         80.5    1e-13    
ref|XP_004448366.1|  PREDICTED: protein YIPF1 isoform 4               80.5    1e-13    
ref|XP_852598.1|  PREDICTED: protein YIPF1 isoformX2                  80.5    1e-13    
ref|XP_003495774.1|  PREDICTED: protein YIPF1                         80.5    1e-13    
gb|KFV74512.1|  Protein YIPF1                                         80.5    1e-13    
ref|XP_004400400.1|  PREDICTED: protein YIPF1 isoform 1               80.5    1e-13    
ref|XP_005978271.1|  PREDICTED: protein YIPF1 isoform X1              80.5    2e-13    
ref|XP_007534257.1|  PREDICTED: protein YIPF1                         80.5    2e-13    
ref|XP_009906375.1|  PREDICTED: protein YIPF1                         80.1    2e-13    
emb|CAP36843.2|  Protein CBG19633                                     81.6    2e-13    
ref|XP_006737727.1|  PREDICTED: protein YIPF1                         80.1    2e-13    
gb|EFN80328.1|  Protein YIPF1                                         79.7    2e-13    
ref|XP_008999512.1|  PREDICTED: protein YIPF1 isoform X2              80.1    2e-13    
ref|XP_006934819.1|  PREDICTED: protein YIPF1 isoform X1              80.1    2e-13    
ref|XP_005543373.1|  PREDICTED: protein YIPF1 isoform X4              79.3    2e-13    



>ref|XP_002282343.2| PREDICTED: protein YIPF1 homolog [Vitis vinifera]
Length=270

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 200/240 (83%), Gaps = 3/240 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDG-QQSTNNWKGVFSISSYTQYFNVDTDV  860
               PEANLQIFPPNNG   GQG  TP  P+EGDG QQS +NWKGVFSISSYTQYFNVDTDV
Sbjct  31    EVPEANLQIFPPNNGARGGQGYQTPGSPAEGDGPQQSASNWKGVFSISSYTQYFNVDTDV  90

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             VLNRL+ SL+P   DFF KIDANPDLYGLIW STTL+  I++ GN ATYL  KQS +++T
Sbjct  91    VLNRLISSLHPIGGDFFSKIDANPDLYGLIWTSTTLIFVIAALGNCATYLTKKQSSSSTT  150

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfll  500
              +FDVGY+++AA S+YGYA +VP+ FYFLLQYLGSNA+LVRFWCLW YSLFIFILSS LL
Sbjct  151   WSFDVGYLNLAACSIYGYALVVPVAFYFLLQYLGSNASLVRFWCLWGYSLFIFILSSVLL  210

Query  499   iIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IIPVEF++W++I+L G  S  FV LNL++++Q ND+ +V +A+FVLQMGLA+FIK+ FFP
Sbjct  211   IIPVEFLRWLIIVLAGGASACFVALNLRTYIQGNDITLVIVASFVLQMGLALFIKICFFP  270



>emb|CDP00144.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 201/242 (83%), Gaps = 6/242 (2%)
 Frame = -3

Query  1027  APEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTN----NWKGVFSISSYTQYFNVDT  866
             AP ANLQIFPPNNGGN  +G  T  G SE DG+QS N    NWKG FSISSYTQYFNVDT
Sbjct  34    APGANLQIFPPNNGGNNWRGYQTLGGQSEADGEQSVNESANNWKGFFSISSYTQYFNVDT  93

Query  865   DVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTT  686
             D+VLNR++ S  P+S DFF KIDANPDLYGLIWISTTL+  I+S GN ATYLMHK++D+T
Sbjct  94    DIVLNRILSSFYPSSGDFFSKIDANPDLYGLIWISTTLIFVIASLGNCATYLMHKRTDST  153

Query  685   STRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssf  506
             +  +FDV Y++VA F++YGYA +VPLGFYFLLQY+GSNA+LVRFWCLW YSLFIFILSSF
Sbjct  154   TAWSFDVSYVNVATFAIYGYALLVPLGFYFLLQYMGSNASLVRFWCLWGYSLFIFILSSF  213

Query  505   lliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWF  326
             LLIIP EF++W+VILL+GA S  FV LNLKS+  TND+  V +AAF LQ+GLAIF+KMWF
Sbjct  214   LLIIPNEFLRWVVILLSGAASAGFVALNLKSYTPTNDMTFVSVAAFGLQIGLAIFLKMWF  273

Query  325   FP  320
             FP
Sbjct  274   FP  275



>ref|XP_011085009.1| PREDICTED: protein YIPF1 homolog [Sesamum indicum]
Length=269

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/245 (69%), Positives = 205/245 (84%), Gaps = 2/245 (1%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-TPAGP-SEGDGQQSTNNWKGVFSISSYTQYF  878
             +  A  +  P ANLQIFPPNN G+ GQG  P G  S+G GQ +TNNW GVFSISSYTQYF
Sbjct  24    EKKATNNEVPGANLQIFPPNNAGSGGQGYQPIGSTSDGGGQPATNNWTGVFSISSYTQYF  83

Query  877   NVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQ  698
             NVDTD+VLNRL+ SL PT+ DF  KIDANPDLYGL+WISTTLV AI+S GN ATYLMH++
Sbjct  84    NVDTDIVLNRLISSLYPTTGDFVNKIDANPDLYGLVWISTTLVFAIASLGNCATYLMHRR  143

Query  697   SDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifi  518
             SD +++  FDV Y++VAA S+YGYA IVPLG+YF+LQYLGS+ +L+RFWCLW YSLFIFI
Sbjct  144   SDHSTSWTFDVNYLNVAAGSIYGYALIVPLGYYFVLQYLGSSVSLIRFWCLWGYSLFIFI  203

Query  517   lssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFI  338
             L+SFLL+IPVEF++W +IL+ GA S +FV LNL+S++Q+NDL IV I+AFVLQMGL+IFI
Sbjct  204   LTSFLLVIPVEFLRWTIILIAGAASASFVGLNLRSYIQSNDLTIVAISAFVLQMGLSIFI  263

Query  337   KMWFF  323
             KMWFF
Sbjct  264   KMWFF  268



>ref|XP_009767138.1| PREDICTED: protein YIPF1 homolog isoform X2 [Nicotiana sylvestris]
Length=266

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 201/241 (83%), Gaps = 2/241 (1%)
 Frame = -3

Query  1039  RLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDT  866
             + ++ P+ANLQIFPPN+G + G G  T  G SE +GQQS N WKGVFS+SSYTQYFNVD 
Sbjct  25    KSTTNPQANLQIFPPNSGASTGSGYQTLGGTSEANGQQSANTWKGVFSVSSYTQYFNVDE  84

Query  865   DVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTT  686
             D+V+NRLM SLNP S DFF KIDANPDLYGL+W+S TL+  ISS GN ATYLMHK+SD++
Sbjct  85    DIVMNRLMSSLNPLSGDFFSKIDANPDLYGLVWVSATLIFVISSLGNCATYLMHKRSDSS  144

Query  685   STRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssf  506
             S+ +FDV Y++VAA SVYGYA +VP+GFYFLLQYLGS+A+L+RFWCLW YSLF+  LSSF
Sbjct  145   SSWSFDVNYVNVAASSVYGYALLVPMGFYFLLQYLGSSASLIRFWCLWGYSLFVLTLSSF  204

Query  505   lliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWF  326
             LL+IP+EF++W + LL GA S +FV  NLK ++Q+NDLAIV +AAFVLQMGL IFIKMWF
Sbjct  205   LLVIPIEFLRWTITLLAGAASASFVAANLKMYIQSNDLAIVLVAAFVLQMGLTIFIKMWF  264

Query  325   F  323
             F
Sbjct  265   F  265



>ref|XP_009767137.1| PREDICTED: protein YIPF1 homolog isoform X1 [Nicotiana sylvestris]
Length=269

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 205/262 (78%), Gaps = 7/262 (3%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQS  929
             H + S   V   ++    P      AP ANLQIFPPN+G + G G  T  G SE +GQQS
Sbjct  12    HLIGSVPAVVTEEKSTTNP-----QAPAANLQIFPPNSGASTGSGYQTLGGTSEANGQQS  66

Query  928   TNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLV  749
              N WKGVFS+SSYTQYFNVD D+V+NRLM SLNP S DFF KIDANPDLYGL+W+S TL+
Sbjct  67    ANTWKGVFSVSSYTQYFNVDEDIVMNRLMSSLNPLSGDFFSKIDANPDLYGLVWVSATLI  126

Query  748   AAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNA  569
               ISS GN ATYLMHK+SD++S+ +FDV Y++VAA SVYGYA +VP+GFYFLLQYLGS+A
Sbjct  127   FVISSLGNCATYLMHKRSDSSSSWSFDVNYVNVAASSVYGYALLVPMGFYFLLQYLGSSA  186

Query  568   NLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLA  389
             +L+RFWCLW YSLF+  LSSFLL+IP+EF++W + LL GA S +FV  NLK ++Q+NDLA
Sbjct  187   SLIRFWCLWGYSLFVLTLSSFLLVIPIEFLRWTITLLAGAASASFVAANLKMYIQSNDLA  246

Query  388   IVPIAAFVLQMGLAIFIKMWFF  323
             IV +AAFVLQMGL IFIKMWFF
Sbjct  247   IVLVAAFVLQMGLTIFIKMWFF  268



>ref|XP_009614280.1| PREDICTED: protein YIPF1 homolog isoform X2 [Nicotiana tomentosiformis]
Length=266

 Score =   323 bits (827),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = -3

Query  1039  RLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDT  866
             + ++ P+ANLQIFPPNNG + G G  T  G SE +GQQS N WKGVFS+SSYTQYFNVD 
Sbjct  25    KSTTNPQANLQIFPPNNGASTGNGYQTLGGTSEANGQQSANTWKGVFSVSSYTQYFNVDE  84

Query  865   DVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTT  686
             D+V+NRLM SLNP S DFF KIDANPDLYGL+W+S TL+  ISS GN ATYLMHK+SD++
Sbjct  85    DIVMNRLMSSLNPLSGDFFSKIDANPDLYGLVWVSATLIFVISSLGNCATYLMHKRSDSS  144

Query  685   STRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssf  506
             S+ +FDV Y++VAA SVYGYA +VPLGFYFLLQYLGS+A+L+RFWCLW YSLF+  LSSF
Sbjct  145   SSWSFDVNYVNVAAGSVYGYALLVPLGFYFLLQYLGSSASLIRFWCLWGYSLFVLTLSSF  204

Query  505   lliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWF  326
             LL+IP+EF++W + +L GA S +FV  NLK ++Q+NDL IV +AAFVLQMGL IFIKMWF
Sbjct  205   LLVIPIEFLRWTITILAGATSASFVAANLKMYIQSNDLTIVLVAAFVLQMGLTIFIKMWF  264

Query  325   F  323
             F
Sbjct  265   F  265



>ref|XP_009614279.1| PREDICTED: protein YIPF1 homolog isoform X1 [Nicotiana tomentosiformis]
Length=269

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/237 (70%), Positives = 197/237 (83%), Gaps = 2/237 (1%)
 Frame = -3

Query  1027  APEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             AP ANLQIFPPNNG + G G  T  G SE +GQQS N WKGVFS+SSYTQYFNVD D+V+
Sbjct  32    APAANLQIFPPNNGASTGNGYQTLGGTSEANGQQSANTWKGVFSVSSYTQYFNVDEDIVM  91

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             NRLM SLNP S DFF KIDANPDLYGL+W+S TL+  ISS GN ATYLMHK+SD++S+ +
Sbjct  92    NRLMSSLNPLSGDFFSKIDANPDLYGLVWVSATLIFVISSLGNCATYLMHKRSDSSSSWS  151

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y++VAA SVYGYA +VPLGFYFLLQYLGS+A+L+RFWCLW YSLF+  LSSFLL+I
Sbjct  152   FDVNYVNVAAGSVYGYALLVPLGFYFLLQYLGSSASLIRFWCLWGYSLFVLTLSSFLLVI  211

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             P+EF++W + +L GA S +FV  NLK ++Q+NDL IV +AAFVLQMGL IFIKMWFF
Sbjct  212   PIEFLRWTITILAGATSASFVAANLKMYIQSNDLTIVLVAAFVLQMGLTIFIKMWFF  268



>emb|CBI31611.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQG--TPAGPSEGDG-QQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             PEANLQIFPPNNG   GQG  TP  P+ GDG QQS +NWKGVFSISSYTQYFNVDTDVVL
Sbjct  33    PEANLQIFPPNNGARGGQGYQTPGSPA-GDGPQQSASNWKGVFSISSYTQYFNVDTDVVL  91

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             NRL+ SL+P   DFF KIDANPDLYGLIW STTL+  I++ GN ATYL  KQS +++T +
Sbjct  92    NRLISSLHPIGGDFFSKIDANPDLYGLIWTSTTLIFVIAALGNCATYLTKKQSSSSTTWS  151

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDVGY+++AA S+YGYA +VP+ FYFLLQYLGSNA+LVRFWCLW YSLFIFILSS LLII
Sbjct  152   FDVGYLNLAACSIYGYALVVPVAFYFLLQYLGSNASLVRFWCLWGYSLFIFILSSVLLII  211

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVEF++W++I+L G  S  FV LNL++++Q ND+ +V +A+FVLQMGLA+FIK+ FFP
Sbjct  212   PVEFLRWLIIVLAGGASACFVALNLRTYIQGNDITLVIVASFVLQMGLALFIKICFFP  269



>gb|EYU35249.1| hypothetical protein MIMGU_mgv1a012028mg [Erythranthe guttata]
Length=263

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 201/241 (83%), Gaps = 5/241 (2%)
 Frame = -3

Query  1039  RLSSAPE--ANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDT  866
             + +S+PE  ANLQIFPPN+    G  T   PS+G  QQ +NNWKG FSISSYTQYFNVDT
Sbjct  25    KKTSSPEVPANLQIFPPNS---QGYQTLVAPSDGGEQQPSNNWKGFFSISSYTQYFNVDT  81

Query  865   DVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTT  686
             D+VLNRL+ SL PTS DF  KIDANPDLYGL+WISTTLV  I+S GN ATYLM ++SD  
Sbjct  82    DIVLNRLISSLYPTSGDFVSKIDANPDLYGLVWISTTLVFVIASLGNCATYLMSRRSDPN  141

Query  685   STRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssf  506
             ++ AFDV Y++VAA S+YGYA IVPLG+YFLLQYLGSN +LVRFWCLW YSLFIFIL+SF
Sbjct  142   TSWAFDVNYLNVAAGSIYGYALIVPLGYYFLLQYLGSNVSLVRFWCLWGYSLFIFILTSF  201

Query  505   lliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWF  326
             LLIIP+EFI+WI+IL+ GA S +FV LNL+S++Q+NDL IV I+AFVLQ+GL+IFIKMWF
Sbjct  202   LLIIPIEFIRWIIILIGGAASASFVGLNLRSYIQSNDLMIVAISAFVLQLGLSIFIKMWF  261

Query  325   F  323
             F
Sbjct  262   F  262



>ref|NP_001241169.1| uncharacterized protein LOC100813483 [Glycine max]
 gb|ACU21164.1| unknown [Glycine max]
 gb|KHN20901.1| Protein YIPF1 like [Glycine soja]
Length=270

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 195/238 (82%), Gaps = 2/238 (1%)
 Frame = -3

Query  1027  APEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             A  AN+QIFPPNNGG+ G G  T   P+E   QQ  NNW+GVFSISSY++YFNVDTDVVL
Sbjct  33    ATSANMQIFPPNNGGDRGPGYNTLGSPTEAFEQQPANNWRGVFSISSYSEYFNVDTDVVL  92

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
              RL+ SLNP + DFF KIDANPDLYGLIWISTTLV  ++S GNLAT+LM K  D +++ +
Sbjct  93    IRLISSLNPVAGDFFSKIDANPDLYGLIWISTTLVFVLASLGNLATFLMQKHVDNSTSWS  152

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y++VAA S+YGYA +VPL +YF LQY+GSNA+L+RFWC+W YSL IFI+SSFLLII
Sbjct  153   FDVSYVNVAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCMWGYSLTIFIMSSFLLII  212

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVEF++W++ILLTG  S +FV LNL+S+++ N+L++  IAAF LQM LAIFIK+WFFP
Sbjct  213   PVEFLRWVIILLTGVASASFVALNLRSYIEGNELSVAIIAAFFLQMALAIFIKVWFFP  270



>ref|XP_003519363.1| PREDICTED: protein YIPF1 homolog isoform X1 [Glycine max]
 gb|KHN13111.1| Protein YIPF1 like [Glycine soja]
Length=270

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 196/238 (82%), Gaps = 2/238 (1%)
 Frame = -3

Query  1027  APEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             A  AN+Q FPPNNGG+ G G  T   P+E   QQ  NNW+G+FS+SSY++YFNVDTDVVL
Sbjct  33    ATGANMQTFPPNNGGDRGPGHQTLGSPTEAFEQQPANNWRGIFSMSSYSEYFNVDTDVVL  92

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
              RL+ SLNP +ADFF KIDANPDLYGLIWISTTLV  ++S GNLAT+LM K +D +++ +
Sbjct  93    IRLISSLNPVAADFFSKIDANPDLYGLIWISTTLVFVLASLGNLATFLMQKHADNSTSWS  152

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y++VAA S+YGYA +VPL +YF LQY+GSNA+L+RFWCLW YSL IFI+SSFLLII
Sbjct  153   FDVSYVNVAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCLWGYSLTIFIMSSFLLII  212

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVEF++W++ILLTG  S +FV LNL+S+++ N+L++  IAAF LQM LAIFIK+WFFP
Sbjct  213   PVEFLRWVIILLTGVASASFVALNLRSYIEGNELSVAIIAAFFLQMALAIFIKVWFFP  270



>gb|KHG12116.1| Protein YIPF1 [Gossypium arboreum]
Length=268

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 194/238 (82%), Gaps = 1/238 (0%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLN  851
             +APEA++Q FPPN+G   G  T   P+E   QQ  NNWKGVF+ISSYTQYFNVDTDVV+N
Sbjct  31    AAPEASMQNFPPNSGSGRGYQTLEAPAESFEQQPPNNWKGVFNISSYTQYFNVDTDVVIN  90

Query  850   RLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAF  671
             RL+ S +PT+ DFF KI+ANPDLYGLIWI+TTLV  +S FGN ATYLM K +D T+T +F
Sbjct  91    RLISSFHPTAGDFFNKIEANPDLYGLIWITTTLVFMLSCFGNFATYLMQKHTDGTTTWSF  150

Query  670   DVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIP  491
             DVGY++VAA  +YGYA +VP+ FYFLLQYLGSNA+L+RFWC+W YSL IF+ ++FLL+IP
Sbjct  151   DVGYVNVAASGIYGYAIVVPMAFYFLLQYLGSNASLIRFWCMWGYSLSIFVPTAFLLLIP  210

Query  490   VEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             VE ++WI+IL+TG  S  FV LNL+S+++  NDL I+ IAAF+LQM L+IFIK+WFFP
Sbjct  211   VELLRWIIILITGTASSCFVALNLRSYIEGGNDLTIIVIAAFLLQMALSIFIKVWFFP  268



>ref|XP_006355685.1| PREDICTED: protein YIPF1 homolog isoform X1 [Solanum tuberosum]
Length=265

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/260 (62%), Positives = 198/260 (76%), Gaps = 7/260 (3%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN  923
             H V S   V   ++  Y+P      AP AN  I PPNNG NAG+G      EGDG+QSTN
Sbjct  12    HLVGSVPAVVTEEKNSYKP-----QAPTANSPILPPNNGSNAGRGYQTLGGEGDGEQSTN  66

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
              W GVFS+SSYT+YFNVDTD+VLNRLM SLNPT+ DFF KIDANPDLYGLIWISTTLV  
Sbjct  67    KWNGVFSVSSYTEYFNVDTDLVLNRLMSSLNPTTGDFFSKIDANPDLYGLIWISTTLVFV  126

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             +SS GN ATYLM  QSD+ S+  FDV Y++VAA SVYGYA +VPLGFYFL++Y+G +A+L
Sbjct  127   LSSIGNCATYLM--QSDSNSSWNFDVNYVNVAACSVYGYALLVPLGFYFLIRYMGISASL  184

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             +RFWCLW YSLF+ +LSSFLLIIPVEF++W + +     S +FV LNL+++VQ++DL I+
Sbjct  185   IRFWCLWGYSLFVLVLSSFLLIIPVEFLRWTITIAAATTSASFVALNLRTYVQSDDLMII  244

Query  382   PIAAFVLQMGLAIFIKMWFF  323
              +A+F LQ  L IFIKMWFF
Sbjct  245   LVASFALQAALTIFIKMWFF  264



>ref|XP_006575515.1| PREDICTED: protein YIPF1 homolog isoform X2 [Glycine max]
Length=233

 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 193/233 (83%), Gaps = 2/233 (1%)
 Frame = -3

Query  1012  LQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMC  839
             +Q FPPNNGG+ G G  T   P+E   QQ  NNW+G+FS+SSY++YFNVDTDVVL RL+ 
Sbjct  1     MQTFPPNNGGDRGPGHQTLGSPTEAFEQQPANNWRGIFSMSSYSEYFNVDTDVVLIRLIS  60

Query  838   SLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGY  659
             SLNP +ADFF KIDANPDLYGLIWISTTLV  ++S GNLAT+LM K +D +++ +FDV Y
Sbjct  61    SLNPVAADFFSKIDANPDLYGLIWISTTLVFVLASLGNLATFLMQKHADNSTSWSFDVSY  120

Query  658   MSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFI  479
             ++VAA S+YGYA +VPL +YF LQY+GSNA+L+RFWCLW YSL IFI+SSFLLIIPVEF+
Sbjct  121   VNVAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCLWGYSLTIFIMSSFLLIIPVEFL  180

Query  478   KWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             +W++ILLTG  S +FV LNL+S+++ N+L++  IAAF LQM LAIFIK+WFFP
Sbjct  181   RWVIILLTGVASASFVALNLRSYIEGNELSVAIIAAFFLQMALAIFIKVWFFP  233



>ref|XP_006595617.1| PREDICTED: uncharacterized protein LOC100813483 isoform X1 [Glycine 
max]
Length=233

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 192/233 (82%), Gaps = 2/233 (1%)
 Frame = -3

Query  1012  LQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMC  839
             +QIFPPNNGG+ G G  T   P+E   QQ  NNW+GVFSISSY++YFNVDTDVVL RL+ 
Sbjct  1     MQIFPPNNGGDRGPGYNTLGSPTEAFEQQPANNWRGVFSISSYSEYFNVDTDVVLIRLIS  60

Query  838   SLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGY  659
             SLNP + DFF KIDANPDLYGLIWISTTLV  ++S GNLAT+LM K  D +++ +FDV Y
Sbjct  61    SLNPVAGDFFSKIDANPDLYGLIWISTTLVFVLASLGNLATFLMQKHVDNSTSWSFDVSY  120

Query  658   MSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFI  479
             ++VAA S+YGYA +VPL +YF LQY+GSNA+L+RFWC+W YSL IFI+SSFLLIIPVEF+
Sbjct  121   VNVAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCMWGYSLTIFIMSSFLLIIPVEFL  180

Query  478   KWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             +W++ILLTG  S +FV LNL+S+++ N+L++  IAAF LQM LAIFIK+WFFP
Sbjct  181   RWVIILLTGVASASFVALNLRSYIEGNELSVAIIAAFFLQMALAIFIKVWFFP  233



>ref|XP_004239916.1| PREDICTED: protein YIPF1 homolog isoform X1 [Solanum lycopersicum]
Length=265

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 198/260 (76%), Gaps = 7/260 (3%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN  923
             H V S   V   ++  Y+P      AP AN  I PPNNG NAG+G      EGDGQQSTN
Sbjct  12    HLVGSVPAVLTEEKNSYKP-----QAPAANSPILPPNNGPNAGRGYQTLGGEGDGQQSTN  66

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
              W GVFS+SSYT+YFNVDTD+VLNRLM SLNPT+ DFF KIDANPDLYGL+WISTTLV  
Sbjct  67    RWNGVFSVSSYTEYFNVDTDLVLNRLMSSLNPTTGDFFSKIDANPDLYGLVWISTTLVFV  126

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             +SS GN ATYLM  QSD+ S+  FDV Y++VAA SVYGYA +VPLGFYFL++Y+G +A+L
Sbjct  127   LSSIGNCATYLM--QSDSNSSWNFDVNYVNVAACSVYGYALLVPLGFYFLIRYMGISASL  184

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             +RFWCLW YSLF+ +LSSFLLIIPVEF++W + +     S +FV LNL+++VQ++DL ++
Sbjct  185   IRFWCLWGYSLFVLVLSSFLLIIPVEFLRWTITIAAATTSASFVALNLRTYVQSDDLMMI  244

Query  382   PIAAFVLQMGLAIFIKMWFF  323
              +A+F LQ  L IFIKMWFF
Sbjct  245   LVASFALQAALTIFIKMWFF  264



>ref|XP_006355686.1| PREDICTED: protein YIPF1 homolog isoform X2 [Solanum tuberosum]
Length=264

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 162/260 (62%), Positives = 198/260 (76%), Gaps = 8/260 (3%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN  923
             H V S   V   ++  Y+P      AP AN  I PPNNG NAG+G      EGDG+QSTN
Sbjct  12    HLVGSVPAVVTEEKNSYKP-----QAPTANSPILPPNNGSNAGRGYQT-LGEGDGEQSTN  65

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
              W GVFS+SSYT+YFNVDTD+VLNRLM SLNPT+ DFF KIDANPDLYGLIWISTTLV  
Sbjct  66    KWNGVFSVSSYTEYFNVDTDLVLNRLMSSLNPTTGDFFSKIDANPDLYGLIWISTTLVFV  125

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             +SS GN ATYLM  QSD+ S+  FDV Y++VAA SVYGYA +VPLGFYFL++Y+G +A+L
Sbjct  126   LSSIGNCATYLM--QSDSNSSWNFDVNYVNVAACSVYGYALLVPLGFYFLIRYMGISASL  183

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             +RFWCLW YSLF+ +LSSFLLIIPVEF++W + +     S +FV LNL+++VQ++DL I+
Sbjct  184   IRFWCLWGYSLFVLVLSSFLLIIPVEFLRWTITIAAATTSASFVALNLRTYVQSDDLMII  243

Query  382   PIAAFVLQMGLAIFIKMWFF  323
              +A+F LQ  L IFIKMWFF
Sbjct  244   LVASFALQAALTIFIKMWFF  263



>ref|XP_007009198.1| Integral membrane Yip1 family protein [Theobroma cacao]
 gb|EOY18008.1| Integral membrane Yip1 family protein [Theobroma cacao]
Length=288

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 191/236 (81%), Gaps = 4/236 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG----TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTD  863
               PEAN+QIFPPNNGG  G G    T   P+EG  QQS NNWKGVFSISSYTQYFNVDTD
Sbjct  31    EVPEANMQIFPPNNGGGGGSGRGYQTLEAPTEGFEQQSPNNWKGVFSISSYTQYFNVDTD  90

Query  862   VVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTS  683
             VV+NRLM S  P S DFF KIDANPDLYGLIWI+TTLV  +SSFGN ATYLM K +D+T+
Sbjct  91    VVINRLMSSFYPASGDFFSKIDANPDLYGLIWITTTLVFMLSSFGNCATYLMQKHTDSTA  150

Query  682   TRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfl  503
             +  FDVGY++VAA  +YGYA +VP+ FYFLLQYLGSNA+L+RFWC+W YSL IFIL++FL
Sbjct  151   SWNFDVGYVNVAACGIYGYAIVVPMAFYFLLQYLGSNASLIRFWCMWGYSLSIFILTAFL  210

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIK  335
             L+IPVE ++WI+IL+ G +S  FV LNLKS++  NDL ++ +AAF+LQM LAIFIK
Sbjct  211   LLIPVEILRWIIILIAGTVSACFVALNLKSYIVGNDLTMMVVAAFLLQMALAIFIK  266



>ref|XP_010321437.1| PREDICTED: protein YIPF1 homolog isoform X2 [Solanum lycopersicum]
Length=264

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 198/260 (76%), Gaps = 8/260 (3%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN  923
             H V S   V   ++  Y+P      AP AN  I PPNNG NAG+G      EGDGQQSTN
Sbjct  12    HLVGSVPAVLTEEKNSYKP-----QAPAANSPILPPNNGPNAGRGYQT-LGEGDGQQSTN  65

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
              W GVFS+SSYT+YFNVDTD+VLNRLM SLNPT+ DFF KIDANPDLYGL+WISTTLV  
Sbjct  66    RWNGVFSVSSYTEYFNVDTDLVLNRLMSSLNPTTGDFFSKIDANPDLYGLVWISTTLVFV  125

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             +SS GN ATYLM  QSD+ S+  FDV Y++VAA SVYGYA +VPLGFYFL++Y+G +A+L
Sbjct  126   LSSIGNCATYLM--QSDSNSSWNFDVNYVNVAACSVYGYALLVPLGFYFLIRYMGISASL  183

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             +RFWCLW YSLF+ +LSSFLLIIPVEF++W + +     S +FV LNL+++VQ++DL ++
Sbjct  184   IRFWCLWGYSLFVLVLSSFLLIIPVEFLRWTITIAAATTSASFVALNLRTYVQSDDLMMI  243

Query  382   PIAAFVLQMGLAIFIKMWFF  323
              +A+F LQ  L IFIKMWFF
Sbjct  244   LVASFALQAALTIFIKMWFF  263



>ref|XP_010532964.1| PREDICTED: protein YIPF1 homolog [Tarenaya hassleriana]
Length=269

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 189/240 (79%), Gaps = 1/240 (0%)
 Frame = -3

Query  1036  LSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
             L   P+AN+QIFPPNNG NA G  T   P+EG  QQ  NNW GVFS+SSY QYFNVDTDV
Sbjct  30    LRQGPDANMQIFPPNNGSNARGYQTLETPTEGFEQQPANNWNGVFSVSSYVQYFNVDTDV  89

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             VLNRLM S  PTS DFF KIDANPDLYGL+WISTTLV  ++S GN ATYLM+K++D+T  
Sbjct  90    VLNRLMSSFYPTSGDFFSKIDANPDLYGLVWISTTLVFVLASLGNCATYLMNKRTDSTVP  149

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfll  500
               FDV Y+++AA S+YGY  IVPL FYF L Y+GS ++L+RFWCLW YSLFIFI +SF L
Sbjct  150   WTFDVNYVNLAASSIYGYVIIVPLAFYFALHYMGSKSDLLRFWCLWGYSLFIFIPTSFPL  209

Query  499   iIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             +IPVEF++W++ LL G+ S  FV+LNL+S+++ NDL +V  AAF LQM ++IFIK+WFFP
Sbjct  210   LIPVEFLRWVITLLAGSASSCFVSLNLRSYLEGNDLTVVMAAAFALQMAISIFIKVWFFP  269



>ref|XP_007141842.1| hypothetical protein PHAVU_008G230200g [Phaseolus vulgaris]
 gb|ESW13836.1| hypothetical protein PHAVU_008G230200g [Phaseolus vulgaris]
Length=269

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 193/237 (81%), Gaps = 1/237 (0%)
 Frame = -3

Query  1027  APEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLN  851
             A +A++ +FPPNNG    G  T   P+E   QQ  NNW+GVFSISSY+QYF+VDTDVVL 
Sbjct  33    ATDASVHVFPPNNGDRGTGYQTVGRPTESFEQQPANNWRGVFSISSYSQYFDVDTDVVLI  92

Query  850   RLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAF  671
             RL+ SLNP + DFF KIDANPDLYGLIWISTTLV  +++ GNLAT+LM K +D +++ +F
Sbjct  93    RLISSLNPVAGDFFSKIDANPDLYGLIWISTTLVFVLAALGNLATFLMQKHADNSTSWSF  152

Query  670   DVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIP  491
             DV YM+VAA S+YGYA +VPL +YF LQY+GSNA+L+RFWC+W YSL IFI+SSFLLIIP
Sbjct  153   DVSYMNVAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCMWGYSLTIFIMSSFLLIIP  212

Query  490   VEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             VEF++W++ILLTG  S +FV LNL+S+++ N+L++  IAAF LQ+ LAIFIK+WFFP
Sbjct  213   VEFLRWVIILLTGVASASFVALNLRSYIEGNELSVAIIAAFFLQIALAIFIKVWFFP  269



>gb|KDO69191.1| hypothetical protein CISIN_1g024346mg [Citrus sinensis]
Length=269

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 192/239 (80%), Gaps = 2/239 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNA--GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              APEA +Q FPP NGG +  G  +    SEG  QQ  NNWKG FSISSYTQYFNVDTD+V
Sbjct  31    EAPEATMQTFPPGNGGGSRPGYQSLGSSSEGFEQQPANNWKGFFSISSYTQYFNVDTDIV  90

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             +NRL  SL+P S DFF KIDANPDLYGLIWISTTLV  ++SFGN ATYLM K ++++++ 
Sbjct  91    INRLFSSLHPLSGDFFSKIDANPDLYGLIWISTTLVFMLASFGNCATYLMQKYTNSSASW  150

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +FDV +++VAA +VYGYA +VPL +YFLLQY+GS+A+LVRFWCLW YSLFIF+++SFLL+
Sbjct  151   SFDVSFVNVAACTVYGYAIVVPLAYYFLLQYMGSSASLVRFWCLWGYSLFIFVVTSFLLL  210

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IP+E ++WI+ILL G  S  FV  NLKS+++ NDL ++ +A+F LQM LAIFIK+WFFP
Sbjct  211   IPIELLRWIIILLAGTTSSCFVAFNLKSYMEGNDLTVLVVASFCLQMALAIFIKVWFFP  269



>ref|XP_006435607.1| hypothetical protein CICLE_v10032419mg [Citrus clementina]
 ref|XP_006486421.1| PREDICTED: protein YIPF1 homolog isoform X1 [Citrus sinensis]
 ref|XP_006486422.1| PREDICTED: protein YIPF1 homolog isoform X2 [Citrus sinensis]
 gb|ESR48847.1| hypothetical protein CICLE_v10032419mg [Citrus clementina]
Length=269

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 192/239 (80%), Gaps = 2/239 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNA--GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              APEA +Q FPP NGG +  G  +    SEG  QQ  NNWKG FSISSYTQYFNVDTD+V
Sbjct  31    EAPEATMQTFPPGNGGASRPGYQSLGSSSEGFEQQPANNWKGFFSISSYTQYFNVDTDIV  90

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             +NRL  SL+P S DFF KIDANPDLYGLIWISTTLV  ++SFGN ATYLM K ++++++ 
Sbjct  91    INRLFSSLHPLSGDFFSKIDANPDLYGLIWISTTLVFMLASFGNCATYLMQKYTNSSASW  150

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +FDV +++VAA +VYGYA +VPL +YFLLQY+GS+A+LVRFWCLW YSLFIF+++SFLL+
Sbjct  151   SFDVSFVNVAACTVYGYAIVVPLAYYFLLQYMGSSASLVRFWCLWGYSLFIFVVTSFLLL  210

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IP+E ++WI+ILL G  S  FV  NLKS+++ NDL ++ +A+F LQM LAIFIK+WFFP
Sbjct  211   IPIELLRWIIILLAGTTSSCFVAFNLKSYMEGNDLTVLVVASFCLQMALAIFIKVWFFP  269



>gb|KHG16339.1| Protein YIPF1 [Gossypium arboreum]
Length=272

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/240 (63%), Positives = 187/240 (78%), Gaps = 5/240 (2%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQG----TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
             PEAN+QIFPPNN    G+G    T   P+E   QQ  NNW GVFSISSYTQYFNVDTDVV
Sbjct  33    PEANMQIFPPNNASGGGRGRGYQTLEAPTEEFEQQPPNNWSGVFSISSYTQYFNVDTDVV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             + RL+ S  P + DFF KIDANPDLYGLIWI+TTLV  ++SFGN ATYLM K SD T++ 
Sbjct  93    IYRLISSFYPVTGDFFSKIDANPDLYGLIWITTTLVFMLASFGNWATYLMQKHSDGTTSW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +FDVGY++ AA  +YGYA +VP+ F FLLQYLGSNA+LVRFWC+W YS  IFI ++ LL+
Sbjct  153   SFDVGYINAAAVGIYGYAVVVPMAFNFLLQYLGSNASLVRFWCMWGYSFSIFIPTALLLL  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IPVE ++WI+IL+ G+ S  FV LNLKS+++  NDL ++ +AAF+LQM LAIFIK+WFFP
Sbjct  213   IPVEILRWIIILIAGSASSCFVALNLKSYIEGANDLKMMVVAAFLLQMALAIFIKVWFFP  272



>ref|XP_010262637.1| PREDICTED: protein YIPF1 homolog isoform X3 [Nelumbo nucifera]
Length=269

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 193/239 (81%), Gaps = 2/239 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQGTPAGPS--EGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
               PEANLQIFPP  G + G G  +  S   GD QQ+TNNWKG+FSISSYTQYFNVD D+V
Sbjct  31    EVPEANLQIFPPAIGADRGHGYQSLGSLNGGDEQQATNNWKGLFSISSYTQYFNVDADIV  90

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             ++R++ S+NPTS +FF KI+ANPDLYGLIWIS TLV  ++S GN ATYL+HKQ++ +++ 
Sbjct  91    VDRIIGSMNPTSGNFFDKIEANPDLYGLIWISATLVFLLASLGNCATYLIHKQTNHSTSW  150

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +FDV Y+SVAA +VYGY  +VP  FYFLLQYLG +A+LVRFWC+W YSLFIFI +SFLLI
Sbjct  151   SFDVSYVSVAACTVYGYVLVVPTAFYFLLQYLGISASLVRFWCMWGYSLFIFIPTSFLLI  210

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IPVE I+WI+I+L    S  FVTLNLKS++Q NDL ++ +++FVLQ+ LA+FIK+WFFP
Sbjct  211   IPVELIRWIIIILVSVASACFVTLNLKSYIQGNDLMLMLVSSFVLQVALALFIKIWFFP  269



>ref|XP_010108392.1| Protein YIPF1-like protein [Morus notabilis]
 gb|EXC19383.1| Protein YIPF1-like protein [Morus notabilis]
Length=271

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 187/239 (78%), Gaps = 2/239 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              AP AN+QIFPP NGG+ G+G  T    +EG  QQ  NNWKGVFSISSY QYFNVDTD+V
Sbjct  33    EAPGANMQIFPPTNGGDRGRGYQTLGSSTEGFEQQPANNWKGVFSISSYIQYFNVDTDIV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             LNRL+ SL P   DF   IDANPDLYGLIWISTTLV  ++S GN ATYL+ K +D  ++ 
Sbjct  93    LNRLLSSLYPIGGDFLSNIDANPDLYGLIWISTTLVFVLASLGNCATYLIQKHTDKGTSW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +F+V YM+VAA S+YGYA +VPL FYFLLQY+GSN +LVRFWC+W YSLFIF+ +SFLL+
Sbjct  153   SFNVSYMNVAAGSIYGYAAVVPLAFYFLLQYVGSNPSLVRFWCMWGYSLFIFVPASFLLL  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IPVEF++WI+I+ TGA S  FV  NLKS ++  DL I+ +AAFVLQ  LA+FIK+WFFP
Sbjct  213   IPVEFLRWIIIITTGAASAGFVASNLKSSIEGGDLTILMVAAFVLQFALAVFIKVWFFP  271



>ref|NP_850322.1| Integral membrane Yip1 family protein [Arabidopsis thaliana]
 gb|AAL87303.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41379.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09732.1| Integral membrane Yip1 family protein [Arabidopsis thaliana]
Length=275

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 192/245 (78%), Gaps = 2/245 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             P+A ++  P A++QIFPPN G N  G  T   P+EG  QQ +NNWKG F++ SYTQYF+V
Sbjct  31    PIASVNEGPSASMQIFPPNLGNNTKGYQTLESPTEGPAQQPSNNWKGFFNVYSYTQYFDV  90

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  ++S GN ATYL+ K++D
Sbjct  91    DTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVWICTTLVFVLASLGNCATYLVKKRTD  150

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
             + +   FDV YM++AA  +YGYA IVPLGFYF L+Y+GS A+L+RFWCLW YSLFIF+ +
Sbjct  151   SNAPWIFDVNYMNLAASIIYGYAIIVPLGFYFALRYMGSKADLLRFWCLWGYSLFIFVPT  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFIK  335
             S  L+IPVEF++W++ILL G+ S  FV LNL+S+++T ND+ +V  AAF LQM L+IFIK
Sbjct  211   SLPLLIPVEFLRWVIILLAGSASSCFVALNLRSYLETNNDITVVMAAAFGLQMVLSIFIK  270

Query  334   MWFFP  320
             +WFFP
Sbjct  271   VWFFP  275



>ref|XP_004138449.1| PREDICTED: protein YIPF1 homolog [Cucumis sativus]
 gb|KGN45748.1| hypothetical protein Csa_6G008790 [Cucumis sativus]
Length=270

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 191/238 (80%), Gaps = 1/238 (0%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQGTPAGPSEGDG-QQSTNNWKGVFSISSYTQYFNVDTDVVL  854
               PEA +Q FPP NGG+ G+G     S  D  QQ +N+WKGVFS+SSY+QYFNVDTD+V+
Sbjct  33    ETPEAIMQTFPPTNGGDRGRGYQTLESPSDSHQQPSNDWKGVFSVSSYSQYFNVDTDIVM  92

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             NRL+ SL P   DF  KIDANPDLYGL+WI+TTLV  +++ GN ATYLM K+SD  +  +
Sbjct  93    NRLISSLYPIGGDFSSKIDANPDLYGLVWITTTLVFVLAALGNCATYLMQKRSDQGAAWS  152

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV YM+VAA SVYGYA +VP+ FYF LQYLGSN++L+RFWCLW YSLFIFIL+SFLL+I
Sbjct  153   FDVSYMNVAAGSVYGYAIVVPMAFYFSLQYLGSNSSLIRFWCLWGYSLFIFILASFLLLI  212

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVE ++W +ILL+GA S +FV+LNL++++  NDL+++ IAAF LQM LAIFIK+WFFP
Sbjct  213   PVEILRWFIILLSGAASASFVSLNLRAYIDGNDLSVLIIAAFFLQMALAIFIKVWFFP  270



>ref|XP_003616495.1| YIPF1-like protein [Medicago truncatula]
 gb|AES99453.1| integral membrane Yip1 family protein [Medicago truncatula]
Length=273

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 191/238 (80%), Gaps = 4/238 (2%)
 Frame = -3

Query  1024  PEANLQIFPPN-NGGNAGQG---TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
             PEAN+QIFPP  NGG+ G+G   T   P+E   QQ TNNW+G FS+SSY+QYF+VDTD V
Sbjct  35    PEANMQIFPPAANGGDRGRGGYQTVGTPTEAFEQQPTNNWRGFFSVSSYSQYFDVDTDAV  94

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             + RL+ S NP   DFF KIDANPDLYGLIWISTTLV  ++S GNLAT+LM + +D+ ++ 
Sbjct  95    MTRLISSFNPVGGDFFSKIDANPDLYGLIWISTTLVFVLASLGNLATFLMQQHADSATSW  154

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +FDV YM+ AA+S+YGYA +VP+ +YF LQY+GSNANLVRFWC+W YSL IFI+SSFLLI
Sbjct  155   SFDVSYMNTAAWSIYGYAIVVPMAYYFFLQYMGSNANLVRFWCMWGYSLSIFIISSFLLI  214

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             IPVE ++W + L+TG  S +FV LNL+S+++ ND+++  +AAF LQ+GLA+FIK+WFF
Sbjct  215   IPVEILRWFITLITGVASASFVALNLRSYIEGNDISVAIMAAFFLQIGLAVFIKVWFF  272



>ref|XP_004159789.1| PREDICTED: LOW QUALITY PROTEIN: protein YIPF1 homolog [Cucumis 
sativus]
Length=270

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 190/238 (80%), Gaps = 1/238 (0%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQGTPAGPSEGDG-QQSTNNWKGVFSISSYTQYFNVDTDVVL  854
               PEA +Q FPP NGG+ G+G     S  D  QQ +N+WKGVFS+SSY+QYFNVDTD+V+
Sbjct  33    ETPEAIMQTFPPTNGGDRGRGYQTLESPSDSHQQPSNDWKGVFSVSSYSQYFNVDTDIVM  92

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             NRL+ SL P   DF  KIDANPDLYGL+WI+TTLV  +++ GN ATYLM K+SD  +  +
Sbjct  93    NRLISSLYPIGGDFSSKIDANPDLYGLVWITTTLVFVLAALGNCATYLMQKRSDQGAAWS  152

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV YM+VAA SVYGYA +VP+ FYF LQYLGSN++L+RFWCLW YSLFIFIL+SFLL+I
Sbjct  153   FDVSYMNVAAGSVYGYAIVVPMAFYFSLQYLGSNSSLIRFWCLWGYSLFIFILASFLLLI  212

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVE ++W +ILL+GA S +FV LNL++++  NDL+++ IAAF LQM LAIFIK+WFFP
Sbjct  213   PVEILRWFIILLSGAASASFVXLNLRAYIDGNDLSVLIIAAFFLQMALAIFIKVWFFP  270



>ref|XP_010505670.1| PREDICTED: protein YIPF1 homolog isoform X1 [Camelina sativa]
 ref|XP_010505671.1| PREDICTED: protein YIPF1 homolog isoform X2 [Camelina sativa]
Length=275

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 191/245 (78%), Gaps = 2/245 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             P+A ++  P AN+QIFPPN G N+ G  T   P+EG  QQ +NNWKG F++ SYTQYF+V
Sbjct  31    PIASVNEGPSANMQIFPPNLGNNSKGYQTLESPTEGPDQQPSNNWKGFFNVYSYTQYFDV  90

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  ++S GN ATYL+ K++ 
Sbjct  91    DTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVWICTTLVFVLASLGNCATYLVKKRTQ  150

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
             + +   FDV YM++AA  +YGYA IVPLGFYF L+Y+GS A+L+RFWCLW YSLFIFI  
Sbjct  151   SDAPWIFDVNYMNLAASVIYGYAIIVPLGFYFSLRYMGSKADLLRFWCLWGYSLFIFIPI  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFIK  335
             S  L+IPVEF++W++ILL G  S +FV LNL+S+++T ND+ +V  AAF LQM L+IFIK
Sbjct  211   SLPLLIPVEFLRWVIILLAGGASSSFVALNLQSYLETNNDITVVMCAAFGLQMVLSIFIK  270

Query  334   MWFFP  320
             +WFFP
Sbjct  271   VWFFP  275



>ref|XP_008441401.1| PREDICTED: protein YIPF1 homolog isoform X1 [Cucumis melo]
Length=270

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 193/237 (81%), Gaps = 3/237 (1%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLN  851
             PEA++Q FPP NGG+ G+G  T   PS+   QQ +N+WKGVFS+SSY+QYFNVDTD+V+N
Sbjct  35    PEASMQTFPPTNGGDRGRGYRTLETPSDSQ-QQPSNDWKGVFSVSSYSQYFNVDTDIVMN  93

Query  850   RLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAF  671
             RL+ SL P   DF  KIDANPDLYGL+WI+TTLV  +++ GN AT+LM K+S   +  +F
Sbjct  94    RLISSLYPVGGDFSSKIDANPDLYGLVWITTTLVFVLAALGNCATFLMQKRSAQGAAWSF  153

Query  670   DVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIP  491
             DV YM+VAA SVYGYA +VP+ FYF LQYLGSN++L+RFWCLW YSLFIFIL+SFLL+IP
Sbjct  154   DVSYMNVAAGSVYGYAIVVPMAFYFSLQYLGSNSSLIRFWCLWGYSLFIFILASFLLLIP  213

Query  490   VEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             VE ++W +ILL+GA S +FV+LNL+S++  NDL+++ IAAF LQM LAIFIK+WFFP
Sbjct  214   VEILRWFIILLSGAASASFVSLNLRSYIDRNDLSVLIIAAFFLQMALAIFIKVWFFP  270



>ref|XP_010517344.1| PREDICTED: protein YIPF1 homolog [Camelina sativa]
Length=275

 Score =   292 bits (748),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 191/245 (78%), Gaps = 2/245 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             P+A ++  P AN+QIFPPN G N+ G  T   P+EG  QQ +NNWKG F++ SYTQYF+V
Sbjct  31    PIASVNEGPSANMQIFPPNRGSNSKGYQTLESPTEGPEQQPSNNWKGFFNVYSYTQYFDV  90

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  ++S GN ATYL+ K++ 
Sbjct  91    DTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVWICTTLVFVLASLGNCATYLVKKRTQ  150

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
             + +   FDV YM++AA  +YGYA IVPLGFYF L+Y+GS A+L+RFWCLW YSLFIFI  
Sbjct  151   SDAPWIFDVNYMNLAASVIYGYAIIVPLGFYFSLRYMGSKADLLRFWCLWGYSLFIFIPI  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFIK  335
             S  L+IPVEF++W++ILL G  S +FV LNL+S+++T ND+ +V  AAF LQM L+IFIK
Sbjct  211   SLPLLIPVEFLRWVIILLAGGASSSFVALNLQSYLETNNDITVVMGAAFGLQMVLSIFIK  270

Query  334   MWFFP  320
             +WFFP
Sbjct  271   VWFFP  275



>ref|XP_010256786.1| PREDICTED: protein YIPF1 homolog [Nelumbo nucifera]
 ref|XP_010256787.1| PREDICTED: protein YIPF1 homolog [Nelumbo nucifera]
Length=270

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 191/238 (80%), Gaps = 3/238 (1%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQGTPA---GPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             PEA LQIFPP N  + G G  A    P+ GD Q +TNNWKGV SISSY QYFNVDTD+V+
Sbjct  33    PEAKLQIFPPANRADRGHGYQALDDSPNGGDEQPATNNWKGVLSISSYKQYFNVDTDIVV  92

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             +R++ SLNPTS +FF KI+ NPDLYG++WISTTLV  ++S GN ATYLM K+S  +++ +
Sbjct  93    DRIISSLNPTSGNFFDKIETNPDLYGMVWISTTLVFLLASLGNCATYLMQKRSSNSTSWS  152

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y+++AA  +YGYA +VP+ FYFLLQYLGSNA+L+RFWC+W YSLFIFI +SFLLII
Sbjct  153   FDVSYVNLAACVLYGYALVVPVAFYFLLQYLGSNASLLRFWCMWGYSLFIFIPTSFLLII  212

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVEFI+WI+I+LT A S  FV LNLKS++Q NDL +V +A+F LQ+ +A+FIK+ FFP
Sbjct  213   PVEFIRWIIIILTAAASSTFVALNLKSYIQGNDLMLVVVASFALQVAMALFIKISFFP  270



>ref|NP_001078024.1| Integral membrane Yip1 family protein [Arabidopsis thaliana]
 gb|AEC09733.1| Integral membrane Yip1 family protein [Arabidopsis thaliana]
Length=276

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 192/246 (78%), Gaps = 3/246 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNA-GQGTPAGPS-EGDGQQSTNNWKGVFSISSYTQYFN  875
             P+A ++  P A++QIFPPN G N  G  T   P+ EG  QQ +NNWKG F++ SYTQYF+
Sbjct  31    PIASVNEGPSASMQIFPPNLGNNTKGYQTLESPTVEGPAQQPSNNWKGFFNVYSYTQYFD  90

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  ++S GN ATYL+ K++
Sbjct  91    VDTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVWICTTLVFVLASLGNCATYLVKKRT  150

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             D+ +   FDV YM++AA  +YGYA IVPLGFYF L+Y+GS A+L+RFWCLW YSLFIF+ 
Sbjct  151   DSNAPWIFDVNYMNLAASIIYGYAIIVPLGFYFALRYMGSKADLLRFWCLWGYSLFIFVP  210

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFI  338
             +S  L+IPVEF++W++ILL G+ S  FV LNL+S+++T ND+ +V  AAF LQM L+IFI
Sbjct  211   TSLPLLIPVEFLRWVIILLAGSASSCFVALNLRSYLETNNDITVVMAAAFGLQMVLSIFI  270

Query  337   KMWFFP  320
             K+WFFP
Sbjct  271   KVWFFP  276



>ref|XP_002881680.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57939.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   290 bits (741),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 192/246 (78%), Gaps = 3/246 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNA-GQGTPAGPS-EGDGQQSTNNWKGVFSISSYTQYFN  875
             P+A ++  P AN+QIFPPN G N  G  T   P+ +G  QQ +NNWKG F++ SYTQYF+
Sbjct  31    PIASVNEGPSANMQIFPPNLGNNTKGYQTLESPTVQGPEQQPSNNWKGFFNVYSYTQYFD  90

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  ++S GN ATYL+ K++
Sbjct  91    VDTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVWICTTLVFVLASLGNCATYLVKKRT  150

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             D+ +   FDV YM++AA  +YGYA IVPLGFYF L+Y+GS A+L+RFWCLW YSLFIF+ 
Sbjct  151   DSNAPWIFDVNYMNLAASIIYGYAIIVPLGFYFSLRYMGSKADLLRFWCLWGYSLFIFVP  210

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFI  338
             +S  L+IPVEF++W++ILL G+ S  FV LNL+S+++T ND+ +V  AAF LQM L+IFI
Sbjct  211   TSLPLLIPVEFLRWVIILLAGSASSCFVALNLRSYLETNNDITVVMAAAFGLQMVLSIFI  270

Query  337   KMWFFP  320
             K+WFFP
Sbjct  271   KVWFFP  276



>ref|XP_002524232.1| Protein YIPF1, putative [Ricinus communis]
 gb|EEF38156.1| Protein YIPF1, putative [Ricinus communis]
Length=271

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 183/239 (77%), Gaps = 3/239 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPN-NGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
               PEAN+Q FPPN NGG   +G  T   P EG  QQ+ NNWKGVFSISSYTQYFNVDTD+
Sbjct  32    EVPEANMQTFPPNSNGGGTTRGYQTLGTPPEGFEQQAPNNWKGVFSISSYTQYFNVDTDI  91

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             V+NR+M S  P   DFFRKIDA+PDLYGLIWISTTL+  ++  GN ATYLM K ++++++
Sbjct  92    VINRIMSSFYPIGGDFFRKIDAHPDLYGLIWISTTLICLLAGLGNCATYLMQKHTESSAS  151

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfll  500
               FDVGY++VA F++YGYA +VPL FYFL QYLG+NA+L+RFWC+W YSL IF++SSFLL
Sbjct  152   WNFDVGYVNVATFAIYGYAILVPLAFYFLFQYLGANASLIRFWCMWGYSLVIFVISSFLL  211

Query  499   iIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             ++PVE  +WI+IL  G  S  FV  NLK  +  NDL IV ++AF LQ+ LAIFIK WFF
Sbjct  212   VVPVEAFRWIIILAAGIDSACFVATNLKFCIGGNDLTIVVVSAFCLQLALAIFIKAWFF  270



>ref|XP_006411218.1| hypothetical protein EUTSA_v10017061mg [Eutrema salsugineum]
 gb|ESQ52671.1| hypothetical protein EUTSA_v10017061mg [Eutrema salsugineum]
Length=276

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 190/246 (77%), Gaps = 3/246 (1%)
 Frame = -3

Query  1048  PLARLSSA-PEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFN  875
             P+A ++ A P AN+QIFPPN G NA G  T   P EG  QQ  NNWKG F++ SYTQYF+
Sbjct  31    PIASVNEASPSANMQIFPPNQGNNARGYQTLETPIEGPEQQPPNNWKGFFNVYSYTQYFD  90

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV   +S GN ATYL+ K++
Sbjct  91    VDTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVWICTTLVFVFASLGNCATYLVKKRT  150

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             D+ +   FDV Y+++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFIF+ 
Sbjct  151   DSNARWDFDVNYINLAASIIYGYAIIVPLAFYFSLRYMGSKADLLRFWCLWGYSLFIFVP  210

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFI  338
             +S  L+IPVEF++W++ILL G+ S  FV LNL+S+++T NDL +V  AAF LQM L+IFI
Sbjct  211   ASLPLLIPVEFLRWVIILLAGSASSCFVALNLRSYLETNNDLTVVMAAAFGLQMILSIFI  270

Query  337   KMWFFP  320
             K+WFFP
Sbjct  271   KVWFFP  276



>ref|XP_010508966.1| PREDICTED: protein YIPF1 homolog [Camelina sativa]
Length=275

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 190/245 (78%), Gaps = 2/245 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             P+A ++  P AN+QIFPPN G N+ G  T   P+E   QQ +NNWKG F++ SYTQYF+V
Sbjct  31    PIASVNEGPSANMQIFPPNRGNNSKGYQTLESPTEVPEQQPSNNWKGFFNVYSYTQYFDV  90

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  ++S GN ATYL+ K++ 
Sbjct  91    DTDVVLNRLMSSLFPTSGDFFNKIDANPDLYGLVWICTTLVFVLASLGNCATYLVKKRTQ  150

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
             + +   FDV YM++AA  +YGYA IVPLGFYF L+Y+GS A+L+RFWCLW YSLFIFI  
Sbjct  151   SDAPWIFDVNYMNLAASVIYGYAIIVPLGFYFSLRYMGSKADLLRFWCLWGYSLFIFIPI  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFIK  335
             S  L+IPVEF++W++ILL G  S +FV LNL+S+++T ND+ +V  AAF LQM L+IFIK
Sbjct  211   SLPLLIPVEFLRWVIILLAGGASSSFVALNLQSYLETNNDITVVMGAAFGLQMVLSIFIK  270

Query  334   MWFFP  320
             +WFFP
Sbjct  271   VWFFP  275



>ref|XP_008233494.1| PREDICTED: protein YIPF1 homolog [Prunus mume]
Length=269

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 193/239 (81%), Gaps = 4/239 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              APEANLQIFPPNNGG  G+G  T    SE   QQ  NNW+GVF+ISSYTQYFNVDTDVV
Sbjct  33    EAPEANLQIFPPNNGGEKGRGYQTVGSTSETFEQQPANNWRGVFNISSYTQYFNVDTDVV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             LNRL+ SL P   DFF KIDANPDLYGLIWISTTLV  +++ GN ATYLM K SD++++ 
Sbjct  93    LNRLLSSLYPHGGDFFSKIDANPDLYGLIWISTTLVFVLAALGNCATYLMEKHSDSSTSW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             AF+V YM++AAFSVYGYA +VPL FYFLL YLGSNA+LVRFWC+W YSLFIF+L+SFLL+
Sbjct  153   AFNVSYMNLAAFSVYGYAILVPLAFYFLLHYLGSNASLVRFWCMWGYSLFIFVLASFLLL  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IPVE  +WI+I+L GA S  FV  NLK++++ ND  IV IAAF+LQ+ LAIF K++FFP
Sbjct  213   IPVEAFRWIIIILAGAASSCFVAFNLKTYIEGND--IVVIAAFLLQLALAIFFKVYFFP  269



>ref|XP_007218809.1| hypothetical protein PRUPE_ppa009988mg [Prunus persica]
 gb|EMJ20008.1| hypothetical protein PRUPE_ppa009988mg [Prunus persica]
Length=269

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 193/239 (81%), Gaps = 4/239 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              APEANLQIFPPNNGG  G+G  T    SE   QQ  NNW+GVF+ISSYTQYFNVDTDVV
Sbjct  33    EAPEANLQIFPPNNGGEKGRGYQTVGSTSETFEQQPANNWRGVFNISSYTQYFNVDTDVV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             LNRL+ SL P   DFF KIDANPDLYGLIWISTTLV  +++ GN ATYLM K SD++++ 
Sbjct  93    LNRLLSSLYPHGGDFFSKIDANPDLYGLIWISTTLVFVLAALGNCATYLMEKHSDSSTSW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             AF+V YM++AAFSVYGYA +VPL FYFLL YLGSNA+LVRFWC+W YSLFIF+L+SFLL+
Sbjct  153   AFNVSYMNLAAFSVYGYAILVPLAFYFLLHYLGSNASLVRFWCMWGYSLFIFVLASFLLL  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IPVE  +WI+I+L GA S  FV  NLK++++ ND  +V IAAF+LQ+ LAIF K++FFP
Sbjct  213   IPVEAFRWIIIILVGAASSCFVAFNLKTYIEGND--VVVIAAFLLQLALAIFFKVYFFP  269



>ref|XP_007163472.1| hypothetical protein PHAVU_001G237000g [Phaseolus vulgaris]
 gb|ESW35466.1| hypothetical protein PHAVU_001G237000g [Phaseolus vulgaris]
Length=270

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLN  851
             P A++Q FPP NG   GQ   T   P+E  GQQST+ W+ +FS+SSYTQYFNVDTDVV+N
Sbjct  34    PYASMQTFPPANGVGRGQAYQTAGTPTEASGQQSTSYWQVIFSVSSYTQYFNVDTDVVVN  93

Query  850   RLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAF  671
             RLM SLNP   DFF KIDANPDLYGLIWISTTLV  ++  GNLATYL  K +D T++ +F
Sbjct  94    RLMSSLNPVGGDFFNKIDANPDLYGLIWISTTLVFVLALLGNLATYLTQKHADNTTSWSF  153

Query  670   DVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIP  491
             DV +++ AA+S+YGY  +VPL +YF LQY+GSNAN++RFWC+W YSL IFI+SSFLL++P
Sbjct  154   DVSFVNTAAWSIYGYVIVVPLAYYFFLQYMGSNANIIRFWCMWGYSLTIFIMSSFLLLVP  213

Query  490   VEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             V F++WI+I+L+G  S +FV LNL+SF++ ND+++  IAAF LQ+ LA+FIK+ FF
Sbjct  214   VGFLRWIIIILSGVASASFVALNLRSFIEGNDVSVAVIAAFFLQIALAVFIKVRFF  269



>ref|XP_010067458.1| PREDICTED: protein YIPF1 homolog [Eucalyptus grandis]
 gb|KCW65599.1| hypothetical protein EUGRSUZ_G02991 [Eucalyptus grandis]
Length=269

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 198/261 (76%), Gaps = 13/261 (5%)
 Frame = -3

Query  1096  VVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTN  923
             VV DG+      P Y+       APEAN+Q FPPNN G+ G+G  + AGPSE   QQ  +
Sbjct  20    VVDDGK----SSPRYE-------APEANMQTFPPNNRGDKGRGYQSLAGPSETFEQQPAS  68

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
             NW+GVF+ISSYTQYFNVDTD+VLNRL+ SL PT  DFF KIDANPDLYG IWISTTL+  
Sbjct  69    NWRGVFNISSYTQYFNVDTDIVLNRLLASLFPTGGDFFSKIDANPDLYGPIWISTTLIFV  128

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             I++ GN ATYLM K SD +++ +FDVGY+++A +S+YGYA +VPLGFYFLL+YL SNA+L
Sbjct  129   IAALGNCATYLMEKNSDASTSWSFDVGYVNLAVWSIYGYAIVVPLGFYFLLKYLESNASL  188

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             + FWC+W YSLFIFI SS LL+IP+E ++W +ILL G  S  FV  NL+S+   ++L I+
Sbjct  189   IGFWCMWGYSLFIFIPSSLLLLIPLEVLRWFIILLVGGASACFVASNLRSYAGGSELTII  248

Query  382   PIAAFVLQMGLAIFIKMWFFP  320
              +AAF+LQM LAIF K+WFFP
Sbjct  249   VVAAFLLQMALAIFFKVWFFP  269



>gb|KFK36871.1| hypothetical protein AALP_AA4G182600 [Arabis alpina]
Length=279

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 191/248 (77%), Gaps = 6/248 (2%)
 Frame = -3

Query  1045  LARLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGD---GQQSTNNWKGVFSISSYTQY  881
             +A +S  P AN+QIFPP+ GGN  +G  T   P EG     QQ++NNWKG F++ SYTQY
Sbjct  32    IASVSEGPSANMQIFPPHQGGNNSKGYQTLESPIEGRPVPEQQTSNNWKGFFNVYSYTQY  91

Query  880   FNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHK  701
             F+VDTDVVLNRLM SL PTS DFF KIDANPD+YGL+WI TTLV  ++S GN ATYL+ K
Sbjct  92    FDVDTDVVLNRLMSSLYPTSGDFFNKIDANPDMYGLVWICTTLVFVLASLGNCATYLVKK  151

Query  700   QSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfif  521
             Q+D+ +   FDV Y+++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFIF
Sbjct  152   QTDSAAPWIFDVNYINLAASIIYGYAIIVPLVFYFSLRYMGSKADLLRFWCLWGYSLFIF  211

Query  520   ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAI  344
             I +S  L+IPVEFI+W++ILL G+ S  FV LNL+S+++T ND+ +V   AF LQM L+I
Sbjct  212   IPTSLPLLIPVEFIRWVIILLAGSASSCFVALNLRSYLETSNDVTVVVAVAFGLQMFLSI  271

Query  343   FIKMWFFP  320
             FIK+WFFP
Sbjct  272   FIKVWFFP  279



>ref|XP_008441402.1| PREDICTED: protein YIPF1 homolog isoform X2 [Cucumis melo]
 ref|XP_008441403.1| PREDICTED: protein YIPF1 homolog isoform X2 [Cucumis melo]
Length=232

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 189/233 (81%), Gaps = 3/233 (1%)
 Frame = -3

Query  1012  LQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMC  839
             +Q FPP NGG+ G+G  T   PS+   QQ +N+WKGVFS+SSY+QYFNVDTD+V+NRL+ 
Sbjct  1     MQTFPPTNGGDRGRGYRTLETPSDSQ-QQPSNDWKGVFSVSSYSQYFNVDTDIVMNRLIS  59

Query  838   SLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGY  659
             SL P   DF  KIDANPDLYGL+WI+TTLV  +++ GN AT+LM K+S   +  +FDV Y
Sbjct  60    SLYPVGGDFSSKIDANPDLYGLVWITTTLVFVLAALGNCATFLMQKRSAQGAAWSFDVSY  119

Query  658   MSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFI  479
             M+VAA SVYGYA +VP+ FYF LQYLGSN++L+RFWCLW YSLFIFIL+SFLL+IPVE +
Sbjct  120   MNVAAGSVYGYAIVVPMAFYFSLQYLGSNSSLIRFWCLWGYSLFIFILASFLLLIPVEIL  179

Query  478   KWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             +W +ILL+GA S +FV+LNL+S++  NDL+++ IAAF LQM LAIFIK+WFFP
Sbjct  180   RWFIILLSGAASASFVSLNLRSYIDRNDLSVLIIAAFFLQMALAIFIKVWFFP  232



>ref|XP_004307579.1| PREDICTED: protein YIPF1 homolog [Fragaria vesca subsp. vesca]
Length=271

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 196/239 (82%), Gaps = 2/239 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              APEANLQIFPPNNGG  G+G  T  GPSE   +Q  NNW+GVF+++SYTQYFNVDTD+V
Sbjct  33    EAPEANLQIFPPNNGGGKGRGYQTVGGPSETFEEQPANNWRGVFNVASYTQYFNVDTDIV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             LNRL+ SL P + DFF KIDANPDLYGL+WISTTLV  +++ GN ATYLM K SDT++  
Sbjct  93    LNRLLSSLFPHTGDFFSKIDANPDLYGLVWISTTLVFILAALGNCATYLMDKHSDTSTAW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
              F+V YMS+AA SVYGYA +VPL FYFLLQY+G+N++L++ WC+W YSLFIF+L+SF+L+
Sbjct  153   GFNVSYMSLAACSVYGYAILVPLAFYFLLQYMGANSSLIQLWCMWGYSLFIFVLASFVLL  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IPVE ++WI+I+L GA S +FV LNL+S ++ +D+ IV IAAF+LQ+ LAIF K++FFP
Sbjct  213   IPVEALRWIIIVLVGAASASFVALNLRSHMEGSDITIVVIAAFLLQLALAIFFKVYFFP  271



>emb|CDY61783.1| BnaC03g72610D [Brassica napus]
Length=276

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 188/244 (77%), Gaps = 2/244 (1%)
 Frame = -3

Query  1045  LARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVD  869
             +A ++  P AN+QIFPP+ G N+ G  T   P+EG  QQ +NNWKG F++ SY QYFNVD
Sbjct  33    IASVNEGPSANMQIFPPHQGNNSKGYQTLESPTEGPEQQPSNNWKGYFNVYSYAQYFNVD  92

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             TDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  +SS GN ATYL+ K++D+
Sbjct  93    TDVVLNRLMSSLYPTSGDFFSKIDANPDLYGLVWICTTLVFVLSSLGNCATYLVKKRTDS  152

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
              +   FDV Y+++AA  ++GYA IVP+ FYF L+Y+GS A+L+RFWCLW YSLF+FI ++
Sbjct  153   EAPWVFDVNYINLAASLIFGYAIIVPVAFYFSLRYMGSRADLLRFWCLWGYSLFVFIPTT  212

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIKM  332
               L+IPVEF++W++ILL G  S  FV LNL+S+++ +NDL +V   AF LQM L+IFIK+
Sbjct  213   LPLLIPVEFLRWVIILLAGGASSCFVALNLRSYLEASNDLTVVLAVAFGLQMVLSIFIKV  272

Query  331   WFFP  320
             WFFP
Sbjct  273   WFFP  276



>ref|XP_011035517.1| PREDICTED: protein YIPF1 homolog [Populus euphratica]
 ref|XP_011035588.1| PREDICTED: protein YIPF1 homolog [Populus euphratica]
Length=271

 Score =   284 bits (727),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 183/238 (77%), Gaps = 2/238 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
               PEA++Q FPPN  G +G+G  T   P EG  QQ  NNWKGVFSISSY QYFNVDTD+V
Sbjct  33    EVPEASMQTFPPNINGGSGRGYQTLGSPPEGFEQQPPNNWKGVFSISSYMQYFNVDTDIV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             +NRLM S  P   DFF KIDANPDLYGL+W+STTL+ A++S GNLATYL+ K++D  S+ 
Sbjct  93    VNRLMSSFYPIGGDFFSKIDANPDLYGLVWVSTTLIFALASLGNLATYLIQKRTDHKSSW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +FDVGY++VA  SVYGYA +VPL FYFL +YL SN  L++FWC+  YSLFIF+ SSFLL+
Sbjct  153   SFDVGYVNVAVLSVYGYAIVVPLAFYFLFRYLESNPKLIQFWCMRGYSLFIFVPSSFLLV  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             +PVE  +WI+IL+ G  SG FV  NLK+ V+ NDLAI+ IAAF LQ+ LAIF K+WFF
Sbjct  213   VPVEAFRWIIILVAGVDSGMFVASNLKTLVEGNDLAIMVIAAFFLQLALAIFFKVWFF  270



>emb|CDY07634.1| BnaA03g18770D [Brassica napus]
Length=276

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 188/244 (77%), Gaps = 2/244 (1%)
 Frame = -3

Query  1045  LARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVD  869
             +A ++  P AN+QIFPP+ G N+ G  T   P+EG  QQ +NNWKG F++ SY QYFNVD
Sbjct  33    IASVNEGPSANMQIFPPHQGNNSKGYQTLESPTEGPEQQPSNNWKGYFNVYSYAQYFNVD  92

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             TDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  +SS GN ATYL+ K++++
Sbjct  93    TDVVLNRLMSSLYPTSGDFFSKIDANPDLYGLVWICTTLVFVLSSLGNCATYLVKKRTNS  152

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
              +   FDV Y+++AA  +YGYA IVP+ FYF L+Y+GS A+L+RFWCLW YSLF+F+ ++
Sbjct  153   EAPWVFDVNYINLAASLIYGYAIIVPVAFYFSLRYMGSRADLLRFWCLWGYSLFVFVPTT  212

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIKM  332
               L+IPVEF++W++ILL G  S  FV LNL+S+++ +NDL +V   AF LQM L+IFIK+
Sbjct  213   LPLLIPVEFLRWVIILLAGGGSSCFVALNLRSYLEASNDLTVVLAVAFGLQMVLSIFIKV  272

Query  331   WFFP  320
             WFFP
Sbjct  273   WFFP  276



>gb|KFK36870.1| hypothetical protein AALP_AA4G182600 [Arabis alpina]
Length=280

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 192/249 (77%), Gaps = 7/249 (3%)
 Frame = -3

Query  1045  LARLSSA-PEANLQIFPPNNGGNAGQG--TPAGPSEGD---GQQSTNNWKGVFSISSYTQ  884
             +A +S A P AN+QIFPP+ GGN  +G  T   P EG     QQ++NNWKG F++ SYTQ
Sbjct  32    IASVSEAGPSANMQIFPPHQGGNNSKGYQTLESPIEGRPVPEQQTSNNWKGFFNVYSYTQ  91

Query  883   YFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMH  704
             YF+VDTDVVLNRLM SL PTS DFF KIDANPD+YGL+WI TTLV  ++S GN ATYL+ 
Sbjct  92    YFDVDTDVVLNRLMSSLYPTSGDFFNKIDANPDMYGLVWICTTLVFVLASLGNCATYLVK  151

Query  703   KQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfi  524
             KQ+D+ +   FDV Y+++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFI
Sbjct  152   KQTDSAAPWIFDVNYINLAASIIYGYAIIVPLVFYFSLRYMGSKADLLRFWCLWGYSLFI  211

Query  523   filssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLA  347
             FI +S  L+IPVEFI+W++ILL G+ S  FV LNL+S+++T ND+ +V   AF LQM L+
Sbjct  212   FIPTSLPLLIPVEFIRWVIILLAGSASSCFVALNLRSYLETSNDVTVVVAVAFGLQMFLS  271

Query  346   IFIKMWFFP  320
             IFIK+WFFP
Sbjct  272   IFIKVWFFP  280



>ref|XP_004490910.1| PREDICTED: protein YIPF1 homolog [Cicer arietinum]
Length=273

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
             P+AN+QIFPP   G   +G     T   P+E   QQ TNNW+G FS+SSY+QYF+VDTD 
Sbjct  34    PDANMQIFPPTTNGGGDRGRGGYQTLGSPTEAFEQQPTNNWRGFFSVSSYSQYFDVDTDA  93

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             V+ RL+ S NP   DFF KIDANPDLYGLIWISTTLV  +++ GNLAT+LM K +D+ ++
Sbjct  94    VMTRLISSFNPVGGDFFSKIDANPDLYGLIWISTTLVFVLAALGNLATFLMQKHADSGTS  153

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfll  500
              +FDV YM+ AA+S+YGYA +VP+ +YF LQY+GSNA+LVRFWC+W YSL IFI+SSFLL
Sbjct  154   WSFDVSYMNTAAWSIYGYAIVVPVAYYFFLQYMGSNASLVRFWCMWGYSLSIFIISSFLL  213

Query  499   iIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             IIPVE ++WI+ LLTG  S +FV LNL+S+++ NDL++  IAAF LQ+GLA+FIK+WFF
Sbjct  214   IIPVEILRWIITLLTGVASASFVALNLRSYIEGNDLSLSIIAAFFLQIGLAVFIKVWFF  272



>gb|AFK40844.1| unknown [Lotus japonicus]
Length=275

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 185/233 (79%), Gaps = 2/233 (1%)
 Frame = -3

Query  1015  NLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLM  842
             N+Q FPP NGG+ G+G  T   P+E   QQ  NNW+G F++SSY+QYFN+DTD V+ RL+
Sbjct  42    NMQNFPPRNGGDGGRGYQTIGSPTEAFEQQPANNWRGFFNVSSYSQYFNIDTDDVITRLI  101

Query  841   CSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVG  662
              SLNP + DFF KIDANPDLYGL+WISTTLV  ++S GNL TYLM K +D +S+ +FDV 
Sbjct  102   SSLNPVAGDFFSKIDANPDLYGLVWISTTLVFILASLGNLGTYLMQKHADKSSSWSFDVS  161

Query  661   YMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEF  482
             Y+++AA S+YGY  +VP+ +YF LQY+GSNA+LVRFWC+W YSL IF +SSFLLIIPVE 
Sbjct  162   YVNMAACSIYGYTIVVPVAYYFFLQYMGSNASLVRFWCMWGYSLTIFNISSFLLIIPVEI  221

Query  481   IKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             ++W++ILL+G  S +FV LNL+S++++ DL +  +AAF LQ+ LA+FIK+WFF
Sbjct  222   LRWLIILLSGGASASFVALNLRSYIESVDLQVAVVAAFFLQIALAVFIKVWFF  274



>ref|XP_009133386.1| PREDICTED: protein YIPF1 homolog [Brassica rapa]
Length=276

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 188/244 (77%), Gaps = 2/244 (1%)
 Frame = -3

Query  1045  LARLSSAPEANLQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVD  869
             ++ ++  P AN+QIFPP+ G ++ G  T   P+EG  QQ +NNWKG F++ SY QYFNVD
Sbjct  33    ISTVNEGPSANMQIFPPHQGNSSKGYQTLESPTEGPEQQPSNNWKGYFNVYSYAQYFNVD  92

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             TDVVLNRLM SL PTS DFF KIDANPDLYGL+WI TTLV  +SS GN ATYL+ K++++
Sbjct  93    TDVVLNRLMSSLYPTSGDFFSKIDANPDLYGLVWICTTLVFVLSSLGNCATYLVKKRTNS  152

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
              +   FDV Y+++AA  +YGYA IVP+ FYF L+Y+GS A+L+RFWCLW YSLF+F+ ++
Sbjct  153   EAPWVFDVNYINLAASLIYGYAIIVPVAFYFSLRYMGSRADLLRFWCLWGYSLFVFVPTT  212

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIKM  332
               L+IPVEF++W++ILL G  S  FV LNL+S+++ +NDL +V   AF LQM L+IFIK+
Sbjct  213   LPLLIPVEFLRWVIILLAGGGSSCFVALNLRSYLEASNDLTVVLAVAFGLQMVLSIFIKV  272

Query  331   WFFP  320
             WFFP
Sbjct  273   WFFP  276



>ref|XP_006411217.1| hypothetical protein EUTSA_v10017061mg [Eutrema salsugineum]
 gb|ESQ52670.1| hypothetical protein EUTSA_v10017061mg [Eutrema salsugineum]
Length=233

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 181/233 (78%), Gaps = 2/233 (1%)
 Frame = -3

Query  1012  LQIFPPNNGGNA-GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCS  836
             +QIFPPN G NA G  T   P EG  QQ  NNWKG F++ SYTQYF+VDTDVVLNRLM S
Sbjct  1     MQIFPPNQGNNARGYQTLETPIEGPEQQPPNNWKGFFNVYSYTQYFDVDTDVVLNRLMSS  60

Query  835   LNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYM  656
             L PTS DFF KIDANPDLYGL+WI TTLV   +S GN ATYL+ K++D+ +   FDV Y+
Sbjct  61    LYPTSGDFFNKIDANPDLYGLVWICTTLVFVFASLGNCATYLVKKRTDSNARWDFDVNYI  120

Query  655   SVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIK  476
             ++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFIF+ +S  L+IPVEF++
Sbjct  121   NLAASIIYGYAIIVPLAFYFSLRYMGSKADLLRFWCLWGYSLFIFVPASLPLLIPVEFLR  180

Query  475   WIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             W++ILL G+ S  FV LNL+S+++T NDL +V  AAF LQM L+IFIK+WFFP
Sbjct  181   WVIILLAGSASSCFVALNLRSYLETNNDLTVVMAAAFGLQMILSIFIKVWFFP  233



>gb|AES71016.2| integral membrane Yip1 family protein [Medicago truncatula]
Length=273

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 190/248 (77%), Gaps = 6/248 (2%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYT  887
             Q  A  +  P AN+Q FPPN+GG  G G     T   P++  GQQ  NNW+G FS+SSYT
Sbjct  26    QKNASNNQVPYANMQTFPPNSGGGGGGGQQGYQTLGTPTDAFGQQPANNWQGFFSVSSYT  85

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
             QYFNVDTDVV+NRL+ SLNP   DFF KIDANPDLYGLIWISTTLV  ++  GN ATYLM
Sbjct  86    QYFNVDTDVVVNRLISSLNPVGDDFFAKIDANPDLYGLIWISTTLVFVLALLGNFATYLM  145

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
              K ++  ++ +FDV Y++ AA+S+YGY  +VPL +YF LQY+GSNANLVRFWCLW YSL 
Sbjct  146   EKHTNNRTSWSFDVSYVNTAAWSIYGYVIVVPLAYYFFLQYMGSNANLVRFWCLWGYSLT  205

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLA  347
             IFILSSFLL+IPVE ++WI+I+LTG  S +FV+LNL+SF+  NDL++  IAAF LQ+ LA
Sbjct  206   IFILSSFLLLIPVEILRWIIIILTGGASASFVSLNLRSFIG-NDLSVAIIAAFFLQIALA  264

Query  346   IFIKMWFF  323
             +FIK+ FF
Sbjct  265   VFIKVQFF  272



>ref|XP_009141838.1| PREDICTED: protein YIPF1 homolog [Brassica rapa]
Length=276

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 186/245 (76%), Gaps = 3/245 (1%)
 Frame = -3

Query  1045  LARLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +  ++  P AN QIFPP+ G N  +G  T   P+E   QQ +NNWKG F++ SYTQYF+V
Sbjct  32    ITSVTEGPSANNQIFPPHQGNNNAKGYQTLETPTERLEQQPSNNWKGFFNVYSYTQYFDV  91

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVV+NRLM SL PTS DFF KIDANPD+YGL+WI TTLV  +SS GN ATYL+ K++D
Sbjct  92    DTDVVVNRLMSSLYPTSGDFFNKIDANPDMYGLVWICTTLVFVLSSLGNCATYLVKKRTD  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
             + +   FDV Y+++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFIFI +
Sbjct  152   SEAPWVFDVNYINLAASIIYGYAIIVPLAFYFSLRYMGSRADLLRFWCLWGYSLFIFIPT  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIK  335
             S  L+IPVEF++W++IL  G+ S  FV LNL+S+++ +NDL +V   AF LQM L++FIK
Sbjct  212   SLPLLIPVEFLRWVIILSAGSASSCFVALNLRSYLEGSNDLTVVMAVAFGLQMVLSLFIK  271

Query  334   MWFFP  320
             +WFFP
Sbjct  272   VWFFP  276



>gb|EPS71712.1| hypothetical protein M569_03049 [Genlisea aurea]
Length=269

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 187/238 (79%), Gaps = 4/238 (2%)
 Frame = -3

Query  1024  PE-ANLQIFPPNNGGNA--GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             PE ANLQIFPP   G+   G  T    +    QQ T+NWKGVFSISSY QYFNVDTD+VL
Sbjct  31    PEGANLQIFPPIVSGSRINGYQTLNDNTNRTEQQPTSNWKGVFSISSYMQYFNVDTDLVL  90

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             NRL+ SLNPTS DF  KIDANPDLYGL+WISTTLV  +++ GN A YLMH++SD ++T A
Sbjct  91    NRLLSSLNPTSGDFVTKIDANPDLYGLVWISTTLVFCMAALGNCAAYLMHRRSDGSTTWA  150

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYL-GSNANLVRFWCLWAYslfifilssflli  497
             FDV Y++VAA ++YGYA +VPLG+YFL+QY+ GS  +L+RFWCLW YSLF+FIL+SFLL+
Sbjct  151   FDVNYVNVAASTIYGYALVVPLGYYFLVQYMGGSTVSLIRFWCLWGYSLFVFILASFLLV  210

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             IP+E ++WI+IL+ G  S  FV LNLKS+VQ  D  +V  +AF+LQ+ L+IFIK+WFF
Sbjct  211   IPIELLRWILILVAGLASATFVALNLKSYVQNADFPVVAGSAFLLQLALSIFIKVWFF  268



>emb|CDX93232.1| BnaC04g46640D [Brassica napus]
Length=276

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 186/244 (76%), Gaps = 3/244 (1%)
 Frame = -3

Query  1042  ARLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVD  869
             A ++  P AN+QIFPP+ G N  +G  T   P+E   QQ +N+WKG F++ SYTQYF+VD
Sbjct  33    ASVNEGPSANIQIFPPHQGNNNAKGYQTLDTPTERPEQQPSNSWKGFFNVYSYTQYFDVD  92

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             TDVV+NRLM SL PTS DFF KIDANPD+YGL+WI TTLV  +SS GN ATYL+ K++D 
Sbjct  93    TDVVVNRLMSSLYPTSGDFFNKIDANPDMYGLVWICTTLVFVLSSLGNCATYLVKKRTDG  152

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
              +   FDV Y+++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFIFI +S
Sbjct  153   EAPWVFDVNYINLAASIIYGYAIIVPLAFYFSLRYMGSRADLLRFWCLWGYSLFIFIPTS  212

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIKM  332
               L+IPVEF++W++IL  G+ S  FV LNL+S+++ +NDL +V  AA  LQM L+IFIK+
Sbjct  213   LPLLIPVEFLRWVIILSAGSASSCFVALNLRSYLEGSNDLTVVVAAAVGLQMVLSIFIKV  272

Query  331   WFFP  320
             WFFP
Sbjct  273   WFFP  276



>emb|CDY07035.1| BnaA04g22800D [Brassica napus]
Length=276

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 185/245 (76%), Gaps = 3/245 (1%)
 Frame = -3

Query  1045  LARLSSAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +  ++  P AN QIFPP+ G N  +G  T   P+E   QQ  NNWKG F++ SYTQYF+V
Sbjct  32    ITSVTEGPSANNQIFPPHQGNNNAKGYQTLDTPTERPEQQPPNNWKGFFNVYSYTQYFDV  91

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVV+NRLM SL PTS DFF KIDANPD+YGL+WI TTLV  +SS GN ATYL+ K++D
Sbjct  92    DTDVVVNRLMSSLYPTSGDFFNKIDANPDMYGLVWICTTLVFVLSSLGNCATYLVKKRTD  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
             + +   FDV Y+++AA  +YGYA IVPL FYF L+Y+GS A+L+RFWCLW YSLFIFI +
Sbjct  152   SEAPWVFDVNYINLAASIIYGYAIIVPLAFYFSLRYMGSRADLLRFWCLWGYSLFIFIPT  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQ-TNDLAIVPIAAFVLQMGLAIFIK  335
             S  L+IPVEF++W++IL  G+ S  FV LNL+S+++ +ND+ +V   AF LQM L+IFIK
Sbjct  212   SLPLLIPVEFLRWVIILSAGSASSCFVALNLRSYLEGSNDMTVVMAVAFGLQMVLSIFIK  271

Query  334   MWFFP  320
             +WFFP
Sbjct  272   VWFFP  276



>ref|XP_002315201.1| integral membrane Yip1 family protein [Populus trichocarpa]
 gb|ABK94438.1| unknown [Populus trichocarpa]
 gb|EEF01372.1| integral membrane Yip1 family protein [Populus trichocarpa]
Length=271

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 178/238 (75%), Gaps = 2/238 (1%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
               PEAN+Q FP N  G  G+G  T     E   QQ  NNWKG+FS+SSYTQYFNVDTD V
Sbjct  33    EVPEANMQTFPTNINGGGGRGYQTLGSLPEEFEQQPPNNWKGIFSVSSYTQYFNVDTDTV  92

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             +NRLM S  P   DFF +IDANPDLYG +W+STTL+  ++S GNLATYL+ K +D  ++ 
Sbjct  93    INRLMSSFYPFGGDFFSRIDANPDLYGPVWVSTTLIFVLASLGNLATYLIQKHTDHKASW  152

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
             +F+VGY++VA FSVYGYA +VPL FYFLL+YL SN  L++FWC+W YSLFIF+ SSFLL+
Sbjct  153   SFEVGYVNVAVFSVYGYAIVVPLAFYFLLRYLESNPKLLQFWCMWGYSLFIFVPSSFLLV  212

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             IPVE ++WI+IL  G  SG FV  NLK+ V+ NDL I+ +AAF LQ+ LAIF K+WFF
Sbjct  213   IPVEVLRWIIILAAGIDSGMFVATNLKTLVEPNDLTIMVVAAFFLQLALAIFFKVWFF  270



>ref|XP_003600765.1| YIPF1-like protein [Medicago truncatula]
Length=405

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 190/249 (76%), Gaps = 6/249 (2%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYT  887
             Q  A  +  P AN+Q FPPN+GG  G G     T   P++  GQQ  NNW+G FS+SSYT
Sbjct  158   QKNASNNQVPYANMQTFPPNSGGGGGGGQQGYQTLGTPTDAFGQQPANNWQGFFSVSSYT  217

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
             QYFNVDTDVV+NRL+ SLNP   DFF KIDANPDLYGLIWISTTLV  ++  GN ATYLM
Sbjct  218   QYFNVDTDVVVNRLISSLNPVGDDFFAKIDANPDLYGLIWISTTLVFVLALLGNFATYLM  277

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
              K ++  ++ +FDV Y++ AA+S+YGY  +VPL +YF LQY+GSNANLVRFWCLW YSL 
Sbjct  278   EKHTNNRTSWSFDVSYVNTAAWSIYGYVIVVPLAYYFFLQYMGSNANLVRFWCLWGYSLT  337

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLA  347
             IFILSSFLL+IPVE ++WI+I+LTG  S +FV+LNL+SF+  NDL++  IAAF LQ+ LA
Sbjct  338   IFILSSFLLLIPVEILRWIIIILTGGASASFVSLNLRSFI-GNDLSVAIIAAFFLQIALA  396

Query  346   IFIKMWFFP  320
             +FIK+ FF 
Sbjct  397   VFIKVQFFE  405



>ref|XP_010691541.1| PREDICTED: protein YIPF1 homolog [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 184/238 (77%), Gaps = 7/238 (3%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
             +AP+A LQ FPP+ GG+ G G       SEG G   TN W+GVF+I SYTQYFNVDTD+V
Sbjct  31    TAPQATLQSFPPHQGGDRGPGYQNLGNSSEGGGPPPTNTWQGVFNIYSYTQYFNVDTDIV  90

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             +NRL+ SL+P S DFF KI+ANPDLYGLIW+STTLV  I++ GNLATYL+       S+ 
Sbjct  91    INRLLSSLDPRSGDFFSKIEANPDLYGLIWVSTTLVFVIAALGNLATYLIGN-----SSW  145

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
              FDV +MS+AA +VYGYA +VPL FYFLLQYLGS A++VRFWC+W YSLFIF+LS FLL+
Sbjct  146   NFDVSFMSLAASTVYGYAIVVPLAFYFLLQYLGSPASVVRFWCMWGYSLFIFVLSCFLLV  205

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             IP+EF++W++ILL   +S  FV  NL+++V+ NDL +V IAAF+LQ  L +FIK+WFF
Sbjct  206   IPLEFLRWVIILLASGVSACFVASNLRTYVEGNDLMVVLIAAFLLQFALGLFIKVWFF  263



>gb|KDP44878.1| hypothetical protein JCGZ_01378 [Jatropha curcas]
Length=272

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 186/238 (78%), Gaps = 3/238 (1%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQG---TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             PEAN+Q FPPNNGG        T   P E   QQS NNWKGVFS+SSYTQYFNVDTD+V+
Sbjct  35    PEANMQTFPPNNGGGGSNRGYQTLGSPPEAFEQQSPNNWKGVFSVSSYTQYFNVDTDIVI  94

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             NR+M S  P   DFF KIDANPDLYGLIW+STTLV  ++S GN ATYLM K +D++++ +
Sbjct  95    NRMMSSFYPIGGDFFSKIDANPDLYGLIWVSTTLVFVLASLGNCATYLMQKHTDSSASWS  154

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDVGY++VAA ++YGYA +VPL FYFLLQYLG+NA+L+R+WC+W YSL IFILSSFLL+I
Sbjct  155   FDVGYVNVAAAAIYGYAILVPLAFYFLLQYLGTNASLIRYWCMWGYSLVIFILSSFLLVI  214

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVE ++WI+IL  G  S  FV +NLKS +  NDL IV +AAF LQ+ LAIFIK WFFP
Sbjct  215   PVEVLRWIIILAAGIDSACFVAMNLKSCIDGNDLTIVLVAAFFLQLALAIFIKAWFFP  272



>ref|XP_009343971.1| PREDICTED: protein YIPF1 homolog [Pyrus x bretschneideri]
Length=272

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 192/241 (80%), Gaps = 4/241 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNG-GNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
              APEANLQIFPPNN  G  G G  T    SE   QQ  NNW+GVF+I+SYTQYFNVDTDV
Sbjct  32    EAPEANLQIFPPNNNRGEKGGGYQTVGSTSETFEQQPANNWRGVFNIASYTQYFNVDTDV  91

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             VLNR++ SL P + DFF KIDANPDLYGL+WISTTLV  +++ GN ATYLM K++D+++ 
Sbjct  92    VLNRMLSSLYPHNGDFFSKIDANPDLYGLVWISTTLVFVLAALGNCATYLMDKRTDSSTA  151

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLG-SNANLVRFWCLWAYslfifilssfl  503
               F+V YM++AAFSVYGYA +VPL FYFL+QY+G SNA+LVRFWC+W YSLFIFI +SFL
Sbjct  152   WDFNVSYMNMAAFSVYGYAILVPLAFYFLIQYMGTSNASLVRFWCMWGYSLFIFIAASFL  211

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             L+IPVE ++WI+ILL G  S  FV  NL+S ++ N+L++V IAAF+LQ+ LAIF K++FF
Sbjct  212   LLIPVEALRWIIILLVGGYSACFVAFNLRSNMEGNELSVVVIAAFLLQLALAIFFKVYFF  271

Query  322   P  320
             P
Sbjct  272   P  272



>ref|XP_010262635.1| PREDICTED: uncharacterized protein LOC104601124 isoform X1 [Nelumbo 
nucifera]
Length=320

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/290 (52%), Positives = 193/290 (67%), Gaps = 53/290 (18%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQGTPAGPS--EGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
               PEANLQIFPP  G + G G  +  S   GD QQ+TNNWKG+FSISSYTQYFNVD D+V
Sbjct  31    EVPEANLQIFPPAIGADRGHGYQSLGSLNGGDEQQATNNWKGLFSISSYTQYFNVDADIV  90

Query  856   LNRLMCSLNPTSADFFRKIDANPDL-----------------------------------  782
             ++R++ S+NPTS +FF KI+ANPDL                                   
Sbjct  91    VDRIIGSMNPTSGNFFDKIEANPDLKLGLNRLATSCGETHLQPKREQQNSQIPSAKEQES  150

Query  781   ----------------YGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSV  650
                             YGLIWIS TLV  ++S GN ATYL+HKQ++ +++ +FDV Y+SV
Sbjct  151   NKRDRDSPLARQRKQIYGLIWISATLVFLLASLGNCATYLIHKQTNHSTSWSFDVSYVSV  210

Query  649   AAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWI  470
             AA +VYGY  +VP  FYFLLQYLG +A+LVRFWC+W YSLFIFI +SFLLIIPVE I+WI
Sbjct  211   AACTVYGYVLVVPTAFYFLLQYLGISASLVRFWCMWGYSLFIFIPTSFLLIIPVELIRWI  270

Query  469   VILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             +I+L    S  FVTLNLKS++Q NDL ++ +++FVLQ+ LA+FIK+WFFP
Sbjct  271   IIILVSVASACFVTLNLKSYIQGNDLMLMLVSSFVLQVALALFIKIWFFP  320



>gb|KEH28265.1| integral membrane Yip1 family protein [Medicago truncatula]
Length=213

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = -3

Query  952  SEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGL  773
            +E   QQ TNNW+G FS+SSY+QYF+VDTD V+ RL+ S NP   DFF KIDANPDLYGL
Sbjct  3    AEAFEQQPTNNWRGFFSVSSYSQYFDVDTDAVMTRLISSFNPVGGDFFSKIDANPDLYGL  62

Query  772  IWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFL  593
            IWISTTLV  ++S GNLAT+LM + +D+ ++ +FDV YM+ AA+S+YGYA +VP+ +YF 
Sbjct  63   IWISTTLVFVLASLGNLATFLMQQHADSATSWSFDVSYMNTAAWSIYGYAIVVPMAYYFF  122

Query  592  LQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKS  413
            LQY+GSNANLVRFWC+W YSL IFI+SSFLLIIPVE ++W + L+TG  S +FV LNL+S
Sbjct  123  LQYMGSNANLVRFWCMWGYSLSIFIISSFLLIIPVEILRWFITLITGVASASFVALNLRS  182

Query  412  FVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
            +++ ND+++  +AAF LQ+GLA+FIK+WFF
Sbjct  183  YIEGNDISVAIMAAFFLQIGLAVFIKVWFF  212



>gb|KHG01637.1| Protein YIPF1 [Gossypium arboreum]
Length=258

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 174/213 (82%), Gaps = 1/213 (0%)
 Frame = -3

Query  955  PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYG  776
            P+EG  QQS NNWKGVFSISSYTQYF+VDTDVV+NRL+ S  P   DFF KI ANPDLYG
Sbjct  46   PTEGFDQQSQNNWKGVFSISSYTQYFDVDTDVVVNRLISSFYPAGGDFFNKIGANPDLYG  105

Query  775  LIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYF  596
            LIWI+TTLV  +++FGN ATYL+ K++D T++ +FDVGY++ AA  +YGY+ +VP+ FYF
Sbjct  106  LIWITTTLVFMLAAFGNCATYLIQKRTDRTTSWSFDVGYVNAAACGIYGYSLVVPVAFYF  165

Query  595  LLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLK  416
            LL+YLGSNA+LVRF C+W YSL IFI ++FLL+IPVE ++WI+IL+ G  S  FVTLNL 
Sbjct  166  LLRYLGSNASLVRFLCMWGYSLSIFIPTAFLLLIPVEILRWIIILIAGTASSCFVTLNLT  225

Query  415  SFV-QTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
            S++  +NDL ++ IAAF+LQM LAIFIK WFFP
Sbjct  226  SYIGGSNDLRMMMIAAFLLQMALAIFIKAWFFP  258



>ref|XP_008372128.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
Length=272

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 192/241 (80%), Gaps = 4/241 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPN-NGGNAGQG--TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
              AP+ANLQIFPPN NGG  G G  T    SE   QQ  NNW+GVF+I+SYTQYFNVDTDV
Sbjct  32    EAPDANLQIFPPNINGGEKGGGYQTVGSTSETFEQQPANNWRGVFNIASYTQYFNVDTDV  91

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             VL RL+ SL P + DFF KIDANPDLYGLIWISTTLV  +++ GN ATYLM K++D++++
Sbjct  92    VLTRLLSSLYPHTGDFFSKIDANPDLYGLIWISTTLVFVLAALGNCATYLMDKRTDSSNS  151

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssfl  503
               F+V YMS+AA+SVYGYA +VPL FYFL+QYLG+ NA+LVR+WC+W YSLFIF+ +SFL
Sbjct  152   WEFNVSYMSLAAYSVYGYAILVPLAFYFLIQYLGTANASLVRYWCMWGYSLFIFVAASFL  211

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             L+IPVE ++WI+I+L G  S  FV  NL+S ++ +D ++V +AAF+LQ+ LAIF K++FF
Sbjct  212   LLIPVEALRWIIIVLIGGYSACFVAFNLRSSMEGSDFSLVVVAAFLLQLALAIFFKVYFF  271

Query  322   P  320
             P
Sbjct  272   P  272



>ref|XP_002312118.1| integral membrane Yip1 family protein [Populus trichocarpa]
 gb|EEE89485.1| integral membrane Yip1 family protein [Populus trichocarpa]
Length=255

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -3

Query  946  GDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIW  767
            G  QQ  NNWKGVFSISSY QYFNVDTD+V+NRLM S  P   DFF KIDANPDLYGL+W
Sbjct  47   GFEQQPPNNWKGVFSISSYMQYFNVDTDIVVNRLMSSFYPIGGDFFSKIDANPDLYGLVW  106

Query  766  ISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQ  587
            +STTL+  ++S GNLATYL+ K++D  S+ +FDVGY++VA FSVYGYA +VPL FYFL +
Sbjct  107  VSTTLIFVLASLGNLATYLIQKRTDHKSSWSFDVGYVNVAVFSVYGYAIVVPLAFYFLFR  166

Query  586  YLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
            YL SN  L++FWC+W YSLFIF+ SSFLL++PVE  +WI+IL+ G  SG FV  NLK+ V
Sbjct  167  YLESNPKLIQFWCMWGYSLFIFVPSSFLLVVPVEAFRWIIILVAGVDSGMFVASNLKTLV  226

Query  406  QTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
            + NDLAI+ +AAF LQ+ LAIF K+WFF
Sbjct  227  EGNDLAIIVVAAFFLQLALAIFFKVWFF  254



>ref|XP_011036065.1| PREDICTED: protein YIPF1 homolog [Populus euphratica]
Length=271

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 178/239 (74%), Gaps = 4/239 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAG---QGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
               PEAN+Q FP N  G  G   Q   + P E + QQ+ NNWKG+FS+SSY QYFNVDTD 
Sbjct  33    EVPEANMQAFPRNINGGGGRGYQTLGSVPEEFE-QQAPNNWKGMFSVSSYMQYFNVDTDT  91

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             V+NRLM S  P    FF K DANPDLYG +W+STTL+  ++S GNLATYL+ K +D  ++
Sbjct  92    VINRLMSSFYPIGGGFFSKHDANPDLYGPVWVSTTLIFVLASLGNLATYLIEKHTDHKAS  151

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfll  500
              +FDVGY++VA FSVYGYA +VPL FYFLL+YL SN  L++FWC+W YSLFIF+ SSFLL
Sbjct  152   WSFDVGYVNVAVFSVYGYAIVVPLAFYFLLRYLESNPKLLQFWCMWGYSLFIFVPSSFLL  211

Query  499   iIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             +IP+E ++WI+IL  G  SG FV +NLK+FV+ ND  I+ +AAF LQ+ LAIF K+WFF
Sbjct  212   VIPIEVLRWIIILAAGIDSGMFVAMNLKTFVEGNDPKIMVVAAFFLQLALAIFFKVWFF  270



>ref|XP_009351350.1| PREDICTED: protein YIPF1 homolog [Pyrus x bretschneideri]
Length=272

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 187/241 (78%), Gaps = 4/241 (2%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNAGQG---TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDV  860
              AP ANLQIFPPN+ G    G   T    SE   QQ  NNW+GVF+I+SYTQYFNVDTDV
Sbjct  32    EAPNANLQIFPPNSNGGGKGGGYQTVGSTSETFEQQPGNNWRGVFNIASYTQYFNVDTDV  91

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             +L RL+ SL P + DFF KIDANPDLYGLIWISTTLV  + + GN ATYLM K++D++++
Sbjct  92    ILTRLLSSLYPHTGDFFSKIDANPDLYGLIWISTTLVFVLGALGNCATYLMDKRTDSSTS  151

Query  679   RAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssfl  503
               F+V YMS+AA+SVYGYA +VPL FYFL+QYLG+ NA+LVR+WC+W YSLFIF+ +SFL
Sbjct  152   WVFNVSYMSLAAYSVYGYAILVPLAFYFLIQYLGTANASLVRYWCMWGYSLFIFVAASFL  211

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             L+IPVE ++WI+I+L G  S  FV  NL+S ++ +  ++V +AAF+LQ+ LAIF K++FF
Sbjct  212   LLIPVEALRWIIIVLVGGYSACFVAFNLRSNMEGSGFSLVVVAAFLLQLALAIFFKVYFF  271

Query  322   P  320
             P
Sbjct  272   P  272



>ref|XP_008785510.1| PREDICTED: protein YIPF1 homolog [Phoenix dactylifera]
Length=263

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 175/237 (74%), Gaps = 5/237 (2%)
 Frame = -3

Query  1033  SSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             S +  ANLQIFPP NGG    G+P G   GD  Q+T++WKGV SISSY  YFNVDTD+V+
Sbjct  31    SESSSANLQIFPPANGGYQAPGSPYG---GD-DQATSSWKGVCSISSYAPYFNVDTDIVV  86

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
              RL+ S+ P + DF  KID NPDLYG IWISTTLV  +++ GN ATYLMHK+++     A
Sbjct  87    GRLISSVYPMN-DFTGKIDGNPDLYGPIWISTTLVFMLAALGNCATYLMHKRNEPDIAWA  145

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y++ AA  +YGYA  VP+ FYFLL+Y G NA+L+R WC+W YSLFIF+ SS LLI 
Sbjct  146   FDVTYVNWAACIIYGYALAVPVAFYFLLRYFGCNASLIRLWCMWGYSLFIFVPSSLLLIA  205

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             PVE  +WI+I+L GA S  FV LNLKS+ + +DL ++ ++A +LQ+ LA+FIK++FF
Sbjct  206   PVEIFRWIIIILAGAASSWFVALNLKSYTEGSDLMVLIVSALLLQIVLALFIKIFFF  262



>gb|AES71018.2| integral membrane Yip1 family protein [Medicago truncatula]
Length=248

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 167/222 (75%), Gaps = 5/222 (2%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYT  887
             Q  A  +  P AN+Q FPPN+GG  G G     T   P++  GQQ  NNW+G FS+SSYT
Sbjct  26    QKNASNNQVPYANMQTFPPNSGGGGGGGQQGYQTLGTPTDAFGQQPANNWQGFFSVSSYT  85

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
             QYFNVDTDVV+NRL+ SLNP   DFF KIDANPDLYGLIWISTTLV  ++  GN ATYLM
Sbjct  86    QYFNVDTDVVVNRLISSLNPVGDDFFAKIDANPDLYGLIWISTTLVFVLALLGNFATYLM  145

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
              K ++  ++ +FDV Y++ AA+S+YGY  +VPL +YF LQY+GSNANLVRFWCLW YSL 
Sbjct  146   EKHTNNRTSWSFDVSYVNTAAWSIYGYVIVVPLAYYFFLQYMGSNANLVRFWCLWGYSLT  205

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
             IFILSSFLL+IPVE ++WI+I+LTG  S +FV+LN  +  +T
Sbjct  206   IFILSSFLLLIPVEILRWIIIILTGGASASFVSLNNYAIFKT  247



>ref|XP_010923217.1| PREDICTED: protein YIPF1 homolog [Elaeis guineensis]
Length=263

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 173/237 (73%), Gaps = 5/237 (2%)
 Frame = -3

Query  1033  SSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             S +  ANLQIFPP NGG    G+P G   GD  Q+ N+W+GV SISSYT YFNVDTD+V+
Sbjct  31    SESSSANLQIFPPANGGYQAPGSPYG---GD-DQAANSWRGVCSISSYTPYFNVDTDIVV  86

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
              R + S+ P + DF  KID NPDLYG IWISTTLV  +++ GN ATYLM K+++  +   
Sbjct  87    GRFISSVYPMN-DFTGKIDVNPDLYGPIWISTTLVFMLAALGNCATYLMRKRNEPDTMWT  145

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y++ AA  +YGYA  VP+ FYFLL+Y G NA+L+R WC+W YSLFIF+ SS LLI 
Sbjct  146   FDVTYVNWAACIIYGYALAVPVAFYFLLRYFGCNASLIRLWCMWGYSLFIFVPSSLLLIA  205

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             PVE  +WI+I+L GA S  FV LNLKS+++ +DL ++ ++A +LQ  LA+FIK++FF
Sbjct  206   PVEIFRWIIIILAGAASSWFVALNLKSYIEGSDLMVLIVSALLLQFVLALFIKIFFF  262



>ref|XP_003600767.1| YIPF1-like protein [Medicago truncatula]
Length=388

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 167/222 (75%), Gaps = 5/222 (2%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYT  887
             Q  A  +  P AN+Q FPPN+GG  G G     T   P++  GQQ  NNW+G FS+SSYT
Sbjct  166   QKNASNNQVPYANMQTFPPNSGGGGGGGQQGYQTLGTPTDAFGQQPANNWQGFFSVSSYT  225

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
             QYFNVDTDVV+NRL+ SLNP   DFF KIDANPDLYGLIWISTTLV  ++  GN ATYLM
Sbjct  226   QYFNVDTDVVVNRLISSLNPVGDDFFAKIDANPDLYGLIWISTTLVFVLALLGNFATYLM  285

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
              K ++  ++ +FDV Y++ AA+S+YGY  +VPL +YF LQY+GSNANLVRFWCLW YSL 
Sbjct  286   EKHTNNRTSWSFDVSYVNTAAWSIYGYVIVVPLAYYFFLQYMGSNANLVRFWCLWGYSLT  345

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
             IFILSSFLL+IPVE ++WI+I+LTG  S +FV+LN  +  +T
Sbjct  346   IFILSSFLLLIPVEILRWIIIILTGGASASFVSLNNYAIFKT  387



>gb|KDO69190.1| hypothetical protein CISIN_1g024346mg [Citrus sinensis]
Length=229

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 159/239 (67%), Gaps = 42/239 (18%)
 Frame = -3

Query  1030  SAPEANLQIFPPNNGGNA--GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVV  857
              APEA +Q FPP NGG +  G  +    SEG  QQ  NNWKG FSISSYTQYFNVDTD+V
Sbjct  31    EAPEATMQTFPPGNGGGSRPGYQSLGSSSEGFEQQPANNWKGFFSISSYTQYFNVDTDIV  90

Query  856   LNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR  677
             +NRL  SL+P S DFF KIDANPDL+                                  
Sbjct  91    INRLFSSLHPLSGDFFSKIDANPDLF----------------------------------  116

Query  676   AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflli  497
                   ++VAA +VYGYA +VPL +YFLLQY+GS+A+LVRFWCLW YSLFIF+++SFLL+
Sbjct  117   ------VNVAACTVYGYAIVVPLAYYFLLQYMGSSASLVRFWCLWGYSLFIFVVTSFLLL  170

Query  496   IPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             IP+E ++WI+ILL G  S  FV  NLKS+++ NDL ++ +A+F LQM LAIFIK+WFFP
Sbjct  171   IPIELLRWIIILLAGTTSSCFVAFNLKSYMEGNDLTVLVVASFCLQMALAIFIKVWFFP  229



>ref|XP_009407515.1| PREDICTED: protein YIPF1 homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407516.1| PREDICTED: protein YIPF1 homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=264

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 173/238 (73%), Gaps = 5/238 (2%)
 Frame = -3

Query  1033  SSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
              +A  ANL +FPP+NGG    GTP+G  E    Q+T++W+GVFSISSY+ YFNVDTDVV+
Sbjct  32    EAASTANLHLFPPSNGGYQAPGTPSGADE----QTTSSWQGVFSISSYSSYFNVDTDVVV  87

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
              R++ S+ P + DF+RKID NPDLYG IWIS TL+  +++ GN  TYLM K++D+++T  
Sbjct  88    ERIISSVYPMN-DFYRKIDGNPDLYGPIWISATLMFMLAALGNFGTYLMKKRNDSSTTWT  146

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV Y+  +A +++GY   VP  FYFLLQY G   +LVR WC+W YSLFIF+    LL++
Sbjct  147   FDVTYVEWSACAIFGYMLAVPAAFYFLLQYFGFRTSLVRLWCMWGYSLFIFMPICLLLVV  206

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
             PVE  +WI+ILL G  S  F+ +NLK++ Q++DL ++ + A VLQ  LA+FIKM+FFP
Sbjct  207   PVELFRWIIILLAGIASSWFIAVNLKAYTQSSDLMMLIVGAMVLQFALALFIKMFFFP  264



>ref|XP_009402311.1| PREDICTED: protein YIPF1 homolog [Musa acuminata subsp. malaccensis]
Length=263

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 164/243 (67%), Gaps = 5/243 (2%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +P A  S +  ANLQ+FPP NGG     +P G  E    Q+ NNWKG  S+SSYT YFNV
Sbjct  25    KPSAGASQSLPANLQVFPPGNGGYIPPESPLGGEE----QAANNWKGFCSLSSYTPYFNV  80

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DTDVV++R++ S+ P   +F RKID +PDLYG +WIS TLV  +++ GN  TYL+ K+S+
Sbjct  81    DTDVVVDRIISSVYPMD-EFSRKIDGSPDLYGPVWISATLVFMLAALGNYGTYLIRKRSE  139

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   FDV Y+  AA  V+GYA  VP  FYFLLQY G NANLVR WC+W YSLF+FI +
Sbjct  140   PNGDWEFDVSYVDWAACVVFGYAVAVPAAFYFLLQYFGLNANLVRLWCMWGYSLFVFIPA  199

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKM  332
             S  L++P E  +WI+I+L G+ S  FV LNLK   + +D   + ++A VLQ  LA+FIK+
Sbjct  200   SLFLVVPSEIFRWIIIILAGSASSWFVYLNLKVSTEGSDTRPLVVSALVLQFALALFIKI  259

Query  331   WFF  323
             +FF
Sbjct  260   FFF  262



>ref|XP_010231311.1| PREDICTED: protein YIPF1 homolog isoform X1 [Brachypodium distachyon]
Length=270

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 175/261 (67%), Gaps = 4/261 (2%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAG-PSEGDGQQST  926
             H + S   V   ++ P  P    ++A  + LQ FPP  G   G   P G P +GD +  T
Sbjct  12    HLLGSVPAVTPEERKPAGPAEVGNAAATSRLQQFPPAPGATGGGYQPPGSPLDGDVETQT  71

Query  925   NNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVA  746
             N WKG F+++SY  YFNVDTDVV++RL+ S+ P    FFRKIDANPD+YG +WI+TTL+ 
Sbjct  72    N-WKGYFNVASYAPYFNVDTDVVVDRLISSVYPMDG-FFRKIDANPDMYGPLWITTTLIF  129

Query  745   AISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNAN  566
              +++FGN ATYLM +++D  +   FDVGY + AA  +YGYA +VP  F+FL QY GS  +
Sbjct  130   MLAAFGNFATYLMQRKTDL-NIWNFDVGYFNWAATVMYGYAIVVPAAFFFLFQYFGSRPS  188

Query  565   LVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAI  386
             LVRFWC+W YSLFIFI +S LL+IPVEF++W++I   G  S  F+ LNLK   +  D+ +
Sbjct  189   LVRFWCMWGYSLFIFIPASILLLIPVEFLRWVIIAGAGGASSWFIALNLKECTEGADMMV  248

Query  385   VPIAAFVLQMGLAIFIKMWFF  323
             +  +A VLQ  LA+FIK++FF
Sbjct  249   LIASASVLQFALALFIKVFFF  269



>ref|XP_008777628.1| PREDICTED: protein YIPF1 homolog [Phoenix dactylifera]
Length=263

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 175/240 (73%), Gaps = 7/240 (3%)
 Frame = -3

Query  1042  ARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTD  863
             AR SS   ANLQ  PP NGG    G+P G   GD +Q+T++WKG  SISSYT YFNVD+D
Sbjct  30    ARESST--ANLQNSPPANGGYQAPGSPYG---GD-EQTTSSWKGACSISSYTPYFNVDSD  83

Query  862   VVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTS  683
             +V++RL+ S+ P + DF RKID NPDLYG +WISTTLV  +++ GN ATYLM K+++   
Sbjct  84    IVVDRLITSVYPMN-DFTRKIDGNPDLYGPVWISTTLVFMLAALGNCATYLMRKRNEPDI  142

Query  682   TRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfl  503
                FDV Y+  AA  +YGYA  VP+ FYFLLQY+G NA+L+R WC+W YSLFIF+ SS L
Sbjct  143   VWNFDVTYVDWAACVIYGYALAVPVAFYFLLQYVGCNASLIRLWCMWGYSLFIFLPSSLL  202

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             L+ PVE ++WIVI+L GA S  FV LNLK++   +DL ++ ++A +LQ  LA+FIK++FF
Sbjct  203   LVAPVEIVRWIVIILAGAASSWFVALNLKAYTDGSDLMVLIVSALLLQFALALFIKIFFF  262



>gb|AFW78235.1| hypothetical protein ZEAMMB73_057796 [Zea mays]
Length=269

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 173/260 (67%), Gaps = 3/260 (1%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN  923
             H + S   V Q  +    P A+  +A  + LQ FPP  G   G   P GP++GD  ++  
Sbjct  12    HLLGSVPAVTQDDRKLGPPAAQGYAAATSRLQEFPPGGGNVGGYRPPGGPADGD-VENQA  70

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
             +WKG F+++SY  YFNVDTDVV++RL+ S+ P    F+RKIDANPD+YG +WI+TTL+  
Sbjct  71    DWKGYFNVASYAPYFNVDTDVVVDRLISSVYPMDG-FYRKIDANPDMYGPLWITTTLIFM  129

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             ++ FGN ATYL+  + D      FDVGY S AA  +Y YA IVP+ F+FL QY GS  +L
Sbjct  130   LAVFGNYATYLVQTKKDM-DIWNFDVGYFSWAASVMYSYAIIVPVVFFFLFQYFGSRPSL  188

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             VRFWC+W YSLFIFI +S LL+IPV F++W++I L G  S  F+TLNLK   +  DL ++
Sbjct  189   VRFWCMWGYSLFIFIPASVLLLIPVGFLQWVIIALAGGASSWFITLNLKECTEGADLMVL  248

Query  382   PIAAFVLQMGLAIFIKMWFF  323
               +A VLQ  LA+FIK++FF
Sbjct  249   MASASVLQFALALFIKVYFF  268



>ref|XP_003568324.1| PREDICTED: protein YIPF1 homolog isoform X2 [Brachypodium distachyon]
Length=266

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 174/261 (67%), Gaps = 8/261 (3%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAG-PSEGDGQQST  926
             H + S   V   ++ P  P    + A  + LQ FPP  G   G   P G P +GD +  T
Sbjct  12    HLLGSVPAVTPEERKPAGP----AEAATSRLQQFPPAPGATGGGYQPPGSPLDGDVETQT  67

Query  925   NNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVA  746
             N WKG F+++SY  YFNVDTDVV++RL+ S+ P    FFRKIDANPD+YG +WI+TTL+ 
Sbjct  68    N-WKGYFNVASYAPYFNVDTDVVVDRLISSVYPMDG-FFRKIDANPDMYGPLWITTTLIF  125

Query  745   AISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNAN  566
              +++FGN ATYLM +++D  +   FDVGY + AA  +YGYA +VP  F+FL QY GS  +
Sbjct  126   MLAAFGNFATYLMQRKTDL-NIWNFDVGYFNWAATVMYGYAIVVPAAFFFLFQYFGSRPS  184

Query  565   LVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAI  386
             LVRFWC+W YSLFIFI +S LL+IPVEF++W++I   G  S  F+ LNLK   +  D+ +
Sbjct  185   LVRFWCMWGYSLFIFIPASILLLIPVEFLRWVIIAGAGGASSWFIALNLKECTEGADMMV  244

Query  385   VPIAAFVLQMGLAIFIKMWFF  323
             +  +A VLQ  LA+FIK++FF
Sbjct  245   LIASASVLQFALALFIKVFFF  265



>ref|XP_008647603.1| PREDICTED: uncharacterized protein LOC100274373 isoform X1 [Zea 
mays]
 gb|AFW78237.1| hypothetical protein ZEAMMB73_057796 [Zea mays]
Length=268

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 165/242 (68%), Gaps = 3/242 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVD  869
             P A   +A  + LQ FPP  G   G   P GP++GD +   + WKG F+++SY  YFNVD
Sbjct  29    PPAAQDAAATSRLQEFPPGGGNVGGYRPPGGPADGDVENQAD-WKGYFNVASYAPYFNVD  87

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             TDVV++RL+ S+ P    F+RKIDANPD+YG +WI+TTL+  ++ FGN ATYL+  + D 
Sbjct  88    TDVVVDRLISSVYPMDG-FYRKIDANPDMYGPLWITTTLIFMLAVFGNYATYLVQTKKDM  146

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
                  FDVGY S AA  +Y YA IVP+ F+FL QY GS  +LVRFWC+W YSLFIFI +S
Sbjct  147   -DIWNFDVGYFSWAASVMYSYAIIVPVVFFFLFQYFGSRPSLVRFWCMWGYSLFIFIPAS  205

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMW  329
              LL+IPV F++W++I L G  S  F+TLNLK   +  DL ++  +A VLQ  LA+FIK++
Sbjct  206   VLLLIPVGFLQWVIIALAGGASSWFITLNLKECTEGADLMVLMASASVLQFALALFIKVY  265

Query  328   FF  323
             FF
Sbjct  266   FF  267



>gb|ACF81573.1| unknown [Zea mays]
Length=268

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 165/242 (68%), Gaps = 3/242 (1%)
 Frame = -3

Query  1048  PLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVD  869
             P A   +A  + LQ FPP  G   G   P GP++GD +   + WKG F+++SY  YFNVD
Sbjct  29    PPAAQDAAATSRLQEFPPGGGNVGGYRPPGGPADGDVENQAD-WKGYFNVASYAPYFNVD  87

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             TDVV++RL+ S+ P    F+RKIDANPD+YG +WI+TTL+  ++ FGN ATYL+  + D 
Sbjct  88    TDVVVDRLISSVYPMDG-FYRKIDANPDVYGPLWITTTLIFMLAVFGNYATYLVQTKKDM  146

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
                  FDVGY S AA  +Y YA IVP+ F+FL QY GS  +LVRFWC+W YSLFIFI +S
Sbjct  147   -DIWNFDVGYFSWAASVMYSYAIIVPVVFFFLFQYFGSRPSLVRFWCMWGYSLFIFIPAS  205

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMW  329
              LL+IPV F++W++I L G  S  F+TLNLK   +  DL ++  +A VLQ  LA+FIK++
Sbjct  206   VLLLIPVGFLQWVIIALAGGASSWFITLNLKECTEGADLMVLMASASVLQFALALFIKVY  265

Query  328   FF  323
             FF
Sbjct  266   FF  267



>ref|XP_010262636.1| PREDICTED: protein YIPF1-like isoform X2 [Nelumbo nucifera]
Length=285

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 164/288 (57%), Gaps = 88/288 (31%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQGTPAGPS--EGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLN  851
             PEANLQIFPP  G + G G  +  S   GD QQ+TNNWKG+FSISSYTQYFNVD D+V++
Sbjct  33    PEANLQIFPPAIGADRGHGYQSLGSLNGGDEQQATNNWKGLFSISSYTQYFNVDADIVVD  92

Query  850   RLMCSLNPTSADFFRKIDANPDL-------------------------------------  782
             R++ S+NPTS +FF KI+ANPDL                                     
Sbjct  93    RIIGSMNPTSGNFFDKIEANPDLKLGLNRLATSCGETHLQPKREQQNSQIPSAKEQESNK  152

Query  781   --------------YGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAA  644
                           YGLIWIS TLV  ++S GN ATYL+HKQ++ +++ +FDV Y+SVAA
Sbjct  153   RDRDSPLARQRKQIYGLIWISATLVFLLASLGNCATYLIHKQTNHSTSWSFDVSYVSVAA  212

Query  643   FSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
              +VYGY  +VP  FYFLLQYLG +A+LVRFWC+W YSL                  +I I
Sbjct  213   CTVYGYVLVVPTAFYFLLQYLGISASLVRFWCMWGYSL------------------FIFI  254

Query  463   LLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
               +G                 NDL ++ +++FVLQ+ LA+FIK+WFFP
Sbjct  255   PTSG-----------------NDLMLMLVSSFVLQVALALFIKIWFFP  285



>ref|XP_010931204.1| PREDICTED: protein YIPF1 homolog [Elaeis guineensis]
 ref|XP_010931205.1| PREDICTED: protein YIPF1 homolog [Elaeis guineensis]
 ref|XP_010931206.1| PREDICTED: protein YIPF1 homolog [Elaeis guineensis]
Length=263

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 173/237 (73%), Gaps = 5/237 (2%)
 Frame = -3

Query  1033  SSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
             S +  ANLQ FPP NGG    G+  G   GD +Q+T++WKGV SISSYT YFN+DTD+V+
Sbjct  31    SESSSANLQSFPPANGGYQAPGSAYG---GD-EQATSSWKGVCSISSYTPYFNIDTDIVV  86

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
             +RL+ S+ P + DF RKID NPD+YG +WISTTLV  +++ GN ATYLM K+++  +   
Sbjct  87    DRLITSVYPLN-DFTRKIDGNPDMYGPVWISTTLVFMLAALGNCATYLMRKRNEPDAVWN  145

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliI  494
             FDV ++  AA  +YGYA  VP+ FYFLLQY+G NA+L+  WC+W YSLFIF+ SS LL+ 
Sbjct  146   FDVTFVDWAACVIYGYALAVPVAFYFLLQYVGCNASLIHLWCMWGYSLFIFLPSSLLLVA  205

Query  493   PVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             PVE  +W++I+L GA S  FV  NLK++ + +DL ++ ++A +LQ  LA+FIK++FF
Sbjct  206   PVEIFRWVIIILAGAASSWFVAQNLKAYTEGSDLMVLIVSALLLQFALALFIKIFFF  262



>ref|NP_001142205.1| uncharacterized protein LOC100274373 [Zea mays]
 gb|ACF82846.1| unknown [Zea mays]
 gb|ACF87881.1| unknown [Zea mays]
 gb|AFW78238.1| hypothetical protein ZEAMMB73_057796 [Zea mays]
Length=270

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 162/232 (70%), Gaps = 3/232 (1%)
 Frame = -3

Query  1018  ANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMC  839
             + LQ FPP  G   G   P GP++GD  ++  +WKG F+++SY  YFNVDTDVV++RL+ 
Sbjct  41    SRLQEFPPGGGNVGGYRPPGGPADGD-VENQADWKGYFNVASYAPYFNVDTDVVVDRLIS  99

Query  838   SLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGY  659
             S+ P    F+RKIDANPD+YG +WI+TTL+  ++ FGN ATYL+  + D      FDVGY
Sbjct  100   SVYPMDG-FYRKIDANPDMYGPLWITTTLIFMLAVFGNYATYLVQTKKDM-DIWNFDVGY  157

Query  658   MSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFI  479
              S AA  +Y YA IVP+ F+FL QY GS  +LVRFWC+W YSLFIFI +S LL+IPV F+
Sbjct  158   FSWAASVMYSYAIIVPVVFFFLFQYFGSRPSLVRFWCMWGYSLFIFIPASVLLLIPVGFL  217

Query  478   KWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             +W++I L G  S  F+TLNLK   +  DL ++  +A VLQ  LA+FIK++FF
Sbjct  218   QWVIIALAGGASSWFITLNLKECTEGADLMVLMASASVLQFALALFIKVYFF  269



>ref|XP_006655373.1| PREDICTED: protein YIPF1 homolog [Oryza brachyantha]
Length=270

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 175/249 (70%), Gaps = 6/249 (2%)
 Frame = -3

Query  1060  PPYQPLARLSSAPEANLQIFPPNNGGNAGQGT--PAG-PSEGDGQQSTNNWKGVFSISSY  890
             P  +  A ++ A  + LQ FPP  G N G G   PAG P +GD +  TN W+G F+I+SY
Sbjct  24    PEERKPAPVADAGTSRLQQFPPVLGANGGGGGYQPAGTPLDGDVEPQTN-WRGYFNIASY  82

Query  889   TQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYL  710
               YFNVDTD V++RL+ S+ P    FFRKIDANPD+YG +WI+TTL+  +++FGN ATYL
Sbjct  83    APYFNVDTDAVVDRLISSVYPMDG-FFRKIDANPDMYGPLWITTTLIFMLAAFGNFATYL  141

Query  709   MHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYsl  530
             M +++D  +   FDVGY + AA  +YGYA +VP  F+FL QY GS  +LVRFWC+W YSL
Sbjct  142   MQRKTDL-NIWNFDVGYFNWAASVMYGYAAVVPAVFFFLFQYFGSRPSLVRFWCMWGYSL  200

Query  529   fifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGL  350
             FIFI +S LL+IPVEF++W++I+L G  S  F++ NLK   +  D+ ++ ++A VLQ  L
Sbjct  201   FIFIPASVLLLIPVEFLRWVIIILAGGASSWFISSNLKECTEGADMMVLIVSAAVLQFAL  260

Query  349   AIFIKMWFF  323
             A+FIK++FF
Sbjct  261   ALFIKVFFF  269



>gb|KEH34763.1| integral membrane Yip1 family protein [Medicago truncatula]
Length=258

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 5/177 (3%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYT  887
             Q  A  +  P AN+Q FPPN+GG  G G     T   P++  GQQ  NNW+G FS+SSYT
Sbjct  26    QKNASNNQVPYANMQTFPPNSGGGGGGGQQGYQTLGTPTDAFGQQPANNWQGFFSVSSYT  85

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
             QYFNVDTDVV+NRL+ SLNP   DFF KIDANPDLYGLIWISTTLV  ++  GN ATYLM
Sbjct  86    QYFNVDTDVVVNRLISSLNPVGDDFFAKIDANPDLYGLIWISTTLVFVLALLGNFATYLM  145

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAY  536
              K ++  ++ +FDV Y++ AA+S+YGY  +VPL +YF LQY+GSNANLVRFWCLW Y
Sbjct  146   EKHTNNRTSWSFDVSYVNTAAWSIYGYVIVVPLAYYFFLQYMGSNANLVRFWCLWGY  202



>ref|XP_002439908.1| hypothetical protein SORBIDRAFT_09g022330 [Sorghum bicolor]
 gb|EES18338.1| hypothetical protein SORBIDRAFT_09g022330 [Sorghum bicolor]
Length=269

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 156/214 (73%), Gaps = 3/214 (1%)
 Frame = -3

Query  964  PAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPD  785
            P+GP++GD +   + WKG F+++SY  YFNVDTDVV++RL+ S+ P    F+RKIDANPD
Sbjct  58   PSGPADGDVENQAD-WKGYFNVASYAPYFNVDTDVVVDRLISSIYPMDG-FYRKIDANPD  115

Query  784  LYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLG  605
            +YG +WI+TTLV  +++FGN ATYLM  + D      FDVGY S AA  +YGYA IVP  
Sbjct  116  MYGPLWITTTLVFMLAAFGNYATYLMQNKKDL-DIWNFDVGYFSWAASVMYGYAIIVPAL  174

Query  604  FYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTL  425
            F+FL QY GS  +LVRFWC+W YSLF+FI +S LL+IPVEF++W++I L G  S  F+ L
Sbjct  175  FFFLFQYFGSRQSLVRFWCMWGYSLFVFIPASVLLLIPVEFLRWVIIALAGGASSWFIAL  234

Query  424  NLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
            NLK   +  DL ++  +A VLQ+ LA+FIK++FF
Sbjct  235  NLKECTEGADLMVLIASASVLQVALALFIKVFFF  268



>ref|XP_004961883.1| PREDICTED: protein YIPF1 homolog [Setaria italica]
Length=267

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 175/260 (67%), Gaps = 5/260 (2%)
 Frame = -3

Query  1102  HRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN  923
             H + S   V Q  + P  P A+ + A  + LQ FPP  GGN G   P G  +GD +   N
Sbjct  12    HLLGSVPAVTQDDRKPVAPAAQDAGA-TSRLQEFPPAPGGNGGGYRPPGAPDGDVENQAN  70

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
              WKG F+++SY  YFNVDTDVV++RL+ S+ P    F+RKIDANPD+YG +WI+TTL+  
Sbjct  71    -WKGYFNVASYAPYFNVDTDVVVDRLISSVYPMDG-FYRKIDANPDMYGPLWITTTLIFM  128

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
             +++FGN ATYLM K+ D      FDVGY + AA  +YGY  +VP  F+FL QY GS  +L
Sbjct  129   LAAFGNFATYLMQKKKDLDIW--FDVGYFNWAASVMYGYVIVVPAVFFFLFQYFGSRPSL  186

Query  562   VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
             VRFWC+W YSLF+FI +S LL+IPVEF++W++I L G +S  F+ LNLK   +  DL ++
Sbjct  187   VRFWCMWGYSLFVFIPASVLLLIPVEFLRWVIIALAGGVSSWFIALNLKECTEGADLMVL  246

Query  382   PIAAFVLQMGLAIFIKMWFF  323
               +A VLQ  LA+FIK++FF
Sbjct  247   IASAAVLQFALALFIKVFFF  266



>ref|NP_001055726.1| Os05g0455800 [Oryza sativa Japonica Group]
 gb|AAU90216.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF17640.1| Os05g0455800 [Oryza sativa Japonica Group]
 gb|EEE63957.1| hypothetical protein OsJ_18782 [Oryza sativa Japonica Group]
Length=273

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 177/257 (69%), Gaps = 15/257 (6%)
 Frame = -3

Query  1072  QHQQPPYQPLARLSSAPEANLQIFPP-------NNGGNAGQGTPAGPSEGDGQQSTNNWK  914
             + ++P   P+A + ++    LQ FPP         GG  G   P  P++GD +  TN WK
Sbjct  24    EERKP--SPVAEVGTS---RLQQFPPALGGTGGVGGGGGGYQPPGTPADGDVETQTN-WK  77

Query  913   GVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISS  734
             G F+++SY  YFNVDTDVV++RL+ S+ P    FFRKIDANPD+YG +WI+TTL+  +++
Sbjct  78    GYFNVASYAPYFNVDTDVVVDRLISSVYPMDG-FFRKIDANPDMYGPLWITTTLIFMLAA  136

Query  733   FGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRF  554
             FGN ATYLM +++D  +  +FDVGY + AA  +YGYA  VP  F+FL QY GS  +LVRF
Sbjct  137   FGNFATYLMQRKTDL-NIWSFDVGYFNWAASVMYGYAAAVPAIFFFLFQYFGSRPSLVRF  195

Query  553   WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIA  374
             WC+W YSLFIFI +S LL+IPVEF++W++I+L G  S  F++LNLK   +  D+ ++  +
Sbjct  196   WCMWGYSLFIFIPASVLLLIPVEFLRWVIIILVGGASSWFISLNLKECTEGADMMVLIAS  255

Query  373   AFVLQMGLAIFIKMWFF  323
             A VLQ  LA+FIK++FF
Sbjct  256   AAVLQFTLALFIKVFFF  272



>gb|EEC79336.1| hypothetical protein OsI_20193 [Oryza sativa Indica Group]
Length=249

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 159/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  964  PAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPD  785
            P  P++GD +  TN WKG F+++SY  YFNVDTDVV++RL+ S+ P    FFRKIDANPD
Sbjct  38   PGTPADGDVETQTN-WKGYFNVASYAPYFNVDTDVVVDRLISSVYPMDG-FFRKIDANPD  95

Query  784  LYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLG  605
            +YG +WI+TTL+  +++FGN ATYLM +++D  +  +FDVGY + AA  +YGYA  VP  
Sbjct  96   MYGPLWITTTLIFMLAAFGNFATYLMQRKTDL-NIWSFDVGYFNWAASVMYGYAAAVPAI  154

Query  604  FYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTL  425
            F+FL QY GS  +LVRFWC+W YSLFIFI +S LL+IPVEF++W++I+L G  S  F++L
Sbjct  155  FFFLFQYFGSRPSLVRFWCMWGYSLFIFIPASVLLLIPVEFLRWVIIILVGGASSWFISL  214

Query  424  NLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
            NLK   +  D+ ++  +A VLQ  LA+FIK++FF
Sbjct  215  NLKECTEGADMMVLIASAAVLQFTLALFIKVFFF  248



>gb|EMS58318.1| Protein YIPF1-like protein [Triticum urartu]
Length=262

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 162/252 (64%), Gaps = 12/252 (5%)
 Frame = -3

Query  1078  VFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSI  899
             V   ++ P  P    ++A  + LQ FPP    N G   P G   G   ++  NWKG F++
Sbjct  22    VAPDERKPGAPAEVGNAAATSRLQQFPPAPAANGGGYQPPGSPLGGDVETQTNWKGYFNV  81

Query  898   SSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLA  719
             +SYT YFNVDTDVV++RL+ S+ P    FFRKIDANPD+YG +WI+TTL+  +++FGN A
Sbjct  82    ASYTPYFNVDTDVVVDRLISSVYPMEG-FFRKIDANPDMYGPLWITTTLIFMLAAFGNFA  140

Query  718   TYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWA  539
             TYLM ++SD  +   FDV Y S+AA  +YGYA +          Y GS  +L+RFWC+W 
Sbjct  141   TYLMQRKSDL-NIWNFDVSYFSLAASVMYGYAIV----------YFGSRPSLIRFWCMWG  189

Query  538   YslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQ  359
             YSLFIF+ +S LL+IPVEF++W++I   G  S  F+ LNLK   +  D+  +  +A VLQ
Sbjct  190   YSLFIFVPASILLLIPVEFLRWVIIAGAGGASSWFIFLNLKECTEGADMMALIASASVLQ  249

Query  358   MGLAIFIKMWFF  323
               LA+FIK++FF
Sbjct  250   FALALFIKVFFF  261



>gb|EMT09397.1| hypothetical protein F775_31600 [Aegilops tauschii]
Length=262

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 161/252 (64%), Gaps = 12/252 (5%)
 Frame = -3

Query  1078  VFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSI  899
             V   ++ P  P    ++A  + LQ FPP    N G   P G   G   ++  NWKG F++
Sbjct  22    VAPDERKPGAPAEVGNAAATSRLQQFPPAPAANGGGYQPPGSPLGGDVETQTNWKGYFNV  81

Query  898   SSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLA  719
             +SYT YFNVDTDVV++RL+ S+ P    FFRKID NPD+YG +WI+TTL+  +++FGN A
Sbjct  82    ASYTPYFNVDTDVVVDRLISSVYPMEG-FFRKIDVNPDMYGPLWITTTLIFMLAAFGNFA  140

Query  718   TYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWA  539
             TYLM ++SD  +   FDV Y S+AA  +YGYA +          Y GS  +L+RFWC+W 
Sbjct  141   TYLMQRKSDL-NIWNFDVSYFSLAASVMYGYAIV----------YFGSRPSLIRFWCMWG  189

Query  538   YslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQ  359
             YSLFIF+ +S LL+IPVEF++W++I   G  S  F+ LNLK   +  D+  +  +A VLQ
Sbjct  190   YSLFIFVPASILLLIPVEFLRWVIIAGAGGASSWFIFLNLKECTEGADMMALIASASVLQ  249

Query  358   MGLAIFIKMWFF  323
               LA+FIK++FF
Sbjct  250   FALALFIKVFFF  261



>gb|ABR17353.1| unknown [Picea sitchensis]
Length=277

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 162/252 (64%), Gaps = 14/252 (6%)
 Frame = -3

Query  1039  RLSSAPEANLQIFPPNNGGNAGQG------------TPAGPSEGDGQQSTNNWKGVFSIS  896
             + S   E NLQIFPP+N  +   G             P    EG  +QS + WKG+FSI+
Sbjct  26    KASQFEEENLQIFPPSNAQDGTWGYRPPTDGYDPYAQPGAEDEGV-EQSQSGWKGLFSIA  84

Query  895   SYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLAT  716
             +Y  YF++DT  V++R MC+L P   DF  K+  NPD+YG +WISTTLV A+++ GN A+
Sbjct  85    TYRPYFDIDTSDVIDRAMCTLYPHRGDFCEKVQHNPDMYGPLWISTTLVFAVTALGNYAS  144

Query  715   YLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAY  536
             YL   QS+      +D+ YMS AA  +YGY  +VPLGFYF+L+YLG +  LV+ WCL+ Y
Sbjct  145   YLSFIQSEHKPDWYYDINYMSWAACLIYGYICLVPLGFYFILRYLGISTPLVQLWCLYGY  204

Query  535   slfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVP-IAAFVLQ  359
             SLF+FI +S LLI P EF++W VI L G  + +FV LN++S +  +D  +   I+AF++Q
Sbjct  205   SLFLFIPASILLIFPTEFLRWTVIALAGLAAASFVALNMRSCMNGSDKWMTAGISAFLMQ  264

Query  358   MGLAIFIKMWFF  323
             + LA+ IK+ FF
Sbjct  265   ICLALVIKLCFF  276



>ref|XP_008343575.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
Length=158

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  781  YGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGF  602
            YGL+WISTTLV  +++ GN ATYLM K++D+++   F+V YM++AAFSVYGYA +VPL F
Sbjct  4    YGLVWISTTLVFVLAALGNCATYLMDKRTDSSTAWDFNVSYMNMAAFSVYGYAILVPLAF  63

Query  601  YFLLQYLG-SNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTL  425
            YFL+QY+G SNA+LVRFWC+W YSLFIFI +SFLL+IPVE ++WI ILL G  S  FV  
Sbjct  64   YFLIQYMGTSNASLVRFWCMWGYSLFIFIAASFLLLIPVEALRWIFILLVGGYSACFVAF  123

Query  424  NLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFFP  320
            NL+S ++ N+L+IV IAAF+LQ+GLAIF K++FFP
Sbjct  124  NLRSNMEGNELSIVVIAAFLLQLGLAIFFKVYFFP  158



>ref|XP_007163471.1| hypothetical protein PHAVU_001G237000g [Phaseolus vulgaris]
 gb|ESW35465.1| hypothetical protein PHAVU_001G237000g [Phaseolus vulgaris]
Length=203

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  781  YGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGF  602
            YGLIWISTTLV  ++  GNLATYL  K +D T++ +FDV +++ AA+S+YGY  +VPL +
Sbjct  50   YGLIWISTTLVFVLALLGNLATYLTQKHADNTTSWSFDVSFVNTAAWSIYGYVIVVPLAY  109

Query  601  YFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLN  422
            YF LQY+GSNAN++RFWC+W YSL IFI+SSFLL++PV F++WI+I+L+G  S +FV LN
Sbjct  110  YFFLQYMGSNANIIRFWCMWGYSLTIFIMSSFLLLVPVGFLRWIIIILSGVASASFVALN  169

Query  421  LKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
            L+SF++ ND+++  IAAF LQ+ LA+FIK+ FF
Sbjct  170  LRSFIEGNDVSVAVIAAFFLQIALAVFIKVRFF  202



>ref|XP_009407517.1| PREDICTED: protein YIPF1 homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=214

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 5/166 (3%)
 Frame = -3

Query  1033  SSAPEANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVL  854
              +A  ANL +FPP+NGG    GTP+G  E    Q+T++W+GVFSISSY+ YFNVDTDVV+
Sbjct  32    EAASTANLHLFPPSNGGYQAPGTPSGADE----QTTSSWQGVFSISSYSSYFNVDTDVVV  87

Query  853   NRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRA  674
              R++ S+ P + DF+RKID NPDLYG IWIS TL+  +++ GN  TYLM K++D+++T  
Sbjct  88    ERIISSVYPMN-DFYRKIDGNPDLYGPIWISATLMFMLAALGNFGTYLMKKRNDSSTTWT  146

Query  673   FDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAY  536
             FDV Y+  +A +++GY   VP  FYFLLQY G   +LVR WC+W Y
Sbjct  147   FDVTYVEWSACAIFGYMLAVPAAFYFLLQYFGFRTSLVRLWCMWGY  192



>ref|XP_006846377.1| hypothetical protein AMTR_s00012p00263140 [Amborella trichopoda]
 gb|ERN08052.1| hypothetical protein AMTR_s00012p00263140 [Amborella trichopoda]
Length=244

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = -3

Query  850  RLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAF  671
             L+    PT      KI ANPDLYG +WISTTLV  +++ GN ATYLM K++ + +  +F
Sbjct  68   ELLIQFIPTMEVSSEKIGANPDLYGPVWISTTLVFMLAALGNCATYLMLKRTSSETLWSF  127

Query  670  DVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIP  491
            DV Y++ AA ++YGY  +VP+ FYFLLQYLG+++NL   WC+W YSL +F+LSS L+I+P
Sbjct  128  DVSYINWAACAIYGYVIVVPVAFYFLLQYLGTSSNLTCLWCMWGYSLSVFLLSSLLMIVP  187

Query  490  VEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             E  +W+VI++TG++S  FV LN+K + +  +LA+V I++F+LQ+ LA+FIK+ FF
Sbjct  188  TEIFRWLVIIITGSVSACFVALNMKFYTEGRNLAVVVISSFLLQIALALFIKICFF  243



>gb|ABK26328.1| unknown [Picea sitchensis]
Length=261

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 144/221 (65%), Gaps = 5/221 (2%)
 Frame = -3

Query  970  GTPAGPSEGDGQ---QSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKI  800
            G P+   +  G+   Q +N WKG+ SI+SY  YFNVDT VV+ R++ SL P   DF  K 
Sbjct  40   GGPSALPDVGGEHNAQPSNGWKGLCSIASYRPYFNVDTYVVVERIIGSLYPHKGDFIEKS  99

Query  799  DANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAF  620
              NPD+YG +WISTTLV   +  GN A YL  + S T +   +D+ Y++ AA   Y Y  
Sbjct  100  AHNPDMYGPVWISTTLVFLATVLGNFAAYLSFEPSTTITEWVYDINYVNWAAAIFYAYIC  159

Query  619  IVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSG  440
            +VPLG YFLLQYL  + +LV+ WCL+ YSLFIFI +SFLLIIP E ++WIVI L G  S 
Sbjct  160  LVPLGCYFLLQYLDMSLSLVQVWCLYGYSLFIFIPASFLLIIPTEILRWIVISLAGLASA  219

Query  439  AFVTLNLKSFVQ-TNDLAIVP-IAAFVLQMGLAIFIKMWFF  323
             FV LNL+S +  T+D   +P +++F++Q+ LA+ +K  FF
Sbjct  220  FFVALNLQSHIMATSDKWTIPVVSSFIVQIALALLMKFCFF  260



>ref|XP_002986407.1| hypothetical protein SELMODRAFT_157954 [Selaginella moellendorffii]
 gb|EFJ12616.1| hypothetical protein SELMODRAFT_157954 [Selaginella moellendorffii]
Length=276

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 139/242 (57%), Gaps = 9/242 (4%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGD------GQQSTNNWKGVFSISSYTQYFNVDTDV  860
             ++NLQ FPP +      G+   P + D       +     W G F++ SY  YFNVDT  
Sbjct  30    DSNLQTFPPTDARGKLTGSSKPPRDADDTFSRPAEPEQFGWHGYFNLLSYRPYFNVDTSD  89

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             V+ R+  SL P   DF  K   NPD+YG  WI TTL+   ++ GN A YL HK S    T
Sbjct  90    VVQRVGDSLVPFKGDFVEKTATNPDMYGPFWICTTLIFVTAALGNFAAYLAHKTSSAGDT  149

Query  679   R-AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfl  503
                +D+  +S +A   YGY  ++PLG YF+L+YLG    LV+ WCL+ YSLFIFI +SFL
Sbjct  150   HWHYDINKVSWSAGLFYGYVGLLPLGLYFVLKYLGVATGLVQLWCLYGYSLFIFIPTSFL  209

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLA--IVPIAAFVLQMGLAIFIKMW  329
              ++PVE  KW V+     +S  F+ LNL++ ++T      ++    FVLQ+GL + +K++
Sbjct  210   SVVPVEKFKWAVVAAAAGLSATFLALNLRTHIKTASERWFLIVCGCFVLQLGLGLLMKLY  269

Query  328   FF  323
             FF
Sbjct  270   FF  271



>ref|XP_002988663.1| hypothetical protein SELMODRAFT_447419 [Selaginella moellendorffii]
 gb|EFJ10174.1| hypothetical protein SELMODRAFT_447419 [Selaginella moellendorffii]
Length=276

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 139/242 (57%), Gaps = 9/242 (4%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGD------GQQSTNNWKGVFSISSYTQYFNVDTDV  860
             ++NLQ FPP +      G+   P + D       +     W G F++ SY  YFNVDT  
Sbjct  30    DSNLQTFPPTDARGKLTGSSKPPRDADDTFSRPAEPEQFGWHGYFNLLSYRPYFNVDTSD  89

Query  859   VLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTST  680
             V+ R+  SL P   DF  K   NPD+YG  WI TTL+   ++ GN A YL HK S    T
Sbjct  90    VVQRVGDSLVPFKGDFVEKTATNPDMYGPFWICTTLIFVTAALGNFAAYLAHKTSSAGDT  149

Query  679   R-AFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssfl  503
                +D+  +S +A   YGY  ++PLG YF+L+YLG    LV+ WCL+ YSLFIFI +SFL
Sbjct  150   NWHYDINKVSWSAGLFYGYVGLLPLGLYFVLKYLGVATGLVQLWCLYGYSLFIFIPTSFL  209

Query  502   liIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLA--IVPIAAFVLQMGLAIFIKMW  329
              ++PVE  KW V+     +S  F+ LNL++ ++T      ++    FVLQ+GL + +K++
Sbjct  210   SVVPVEKFKWAVVAAAAGLSATFLALNLRTHIKTASERWFLIVCGCFVLQLGLGLLMKLY  269

Query  328   FF  323
             FF
Sbjct  270   FF  271



>ref|XP_001778988.1| predicted protein [Physcomitrella patens]
 gb|EDQ56134.1| predicted protein [Physcomitrella patens]
Length=287

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 144/250 (58%), Gaps = 21/250 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGD---------------GQQSTNNWKGVFSISSYT  887
             E+NLQ FPP++      G+   P + D               G  + + W+  F+  SY 
Sbjct  31    ESNLQTFPPSDTRGKLSGSFQPPRDADDSFSNPGSGSQGGANGSSTGSGWQSYFNAVSYR  90

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
              YFNVDT  V+ R+  SL P   DF  K   NPD+YG  WI +TLV   ++ GN A +L 
Sbjct  91    PYFNVDTADVVERIRDSLFPFKGDFVEKTSHNPDMYGPFWICSTLVFVTAALGNFAAFL-  149

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
                S  + +  +DV  +S AAF  YGY  ++PLG YF+L+YLG  + LV+ WCL+ YSLF
Sbjct  150   ---SAQSGSWHYDVNKVSWAAFMFYGYVAVIPLGLYFVLKYLGVVSGLVQLWCLYGYSLF  206

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLA--IVPIAAFVLQMG  353
             +FI +SFL ++P + ++W V+ +   MS  F+ +N++S V+T      ++  ++  LQ+G
Sbjct  207   VFIPASFLCVVPWDIMRWAVVGVAAVMSAGFLAINIRSHVKTASERWFLIVTSSAALQLG  266

Query  352   LAIFIKMWFF  323
             LA+ +K++FF
Sbjct  267   LALVVKLYFF  276



>gb|ABK21160.1| unknown [Picea sitchensis]
Length=284

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/248 (38%), Positives = 137/248 (55%), Gaps = 16/248 (6%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQGTPAGPSEGD---------GQQSTNN---WKGVFSISSYTQY  881
             PE NLQ FPP+       GT   P++ D         G Q  N    W+  F ++ Y  Y
Sbjct  32    PENNLQTFPPSQTQGKITGTFQPPTDADDSFSKPGPGGDQDDNQSSGWQRYFGVAPYQPY  91

Query  880   FNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHK  701
             FNVDT  VL R+  SL P    F  +   NPDLYG  WI TTL+   ++ GN   Y+ HK
Sbjct  92    FNVDTSDVLERIRDSLLPYKGTFSERTIHNPDLYGPFWICTTLILVAAALGNFVGYIAHK  151

Query  700   QSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfif  521
             +        +D+  ++ +A   YGY  ++PL  YF+L+Y    + LV  WCL+ YSLF+F
Sbjct  152   KHHKHWN--YDINQVTWSAGLFYGYVSVIPLAVYFVLKYFSVPSGLVNLWCLYGYSLFVF  209

Query  520   ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLA--IVPIAAFVLQMGLA  347
             I +S L +IP+E  +W+V+   G MS  F+ +NL+S ++T      ++    F+LQ+GLA
Sbjct  210   IPASCLSVIPLEIFRWVVVGAAGFMSATFLAINLRSHIKTASERWFLIVSGIFLLQLGLA  269

Query  346   IFIKMWFF  323
             + +K++FF
Sbjct  270   VILKLYFF  277



>gb|ACN40317.1| unknown [Picea sitchensis]
 gb|ACN40643.1| unknown [Picea sitchensis]
Length=284

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/248 (38%), Positives = 137/248 (55%), Gaps = 16/248 (6%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQGTPAGPSEGD---------GQQSTNN---WKGVFSISSYTQY  881
             PE NLQ FPP+       GT   P++ D         G Q  N    W+  F ++ Y  Y
Sbjct  32    PENNLQTFPPSQTQGKITGTFQPPTDADDSFSKPGPGGDQDDNQSSGWQRYFGVAPYQPY  91

Query  880   FNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHK  701
             FNVDT  VL R+  SL P    F  +   NPDLYG  WI TTL+   ++ GN   Y+ HK
Sbjct  92    FNVDTSDVLERIRDSLLPYKGTFSERTIHNPDLYGPFWICTTLILVAAALGNFVGYIAHK  151

Query  700   QSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfif  521
             +        +D+  ++ +A   YGY  ++PL  YF+L+Y    + LV  WCL+ YSLF+F
Sbjct  152   KHHKHWN--YDINQVTWSAGLFYGYVSVIPLAVYFVLKYFSVPSGLVNLWCLYGYSLFVF  209

Query  520   ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLA--IVPIAAFVLQMGLA  347
             I +S L +IP+E  +W+V+   G MS  F+ +NL+S ++T      ++    F+LQ+GLA
Sbjct  210   IPASCLSVIPLEIFRWVVVGGAGFMSATFLAINLRSHIKTASERWFLIVSGIFLLQLGLA  269

Query  346   IFIKMWFF  323
             + +K++FF
Sbjct  270   VILKLYFF  277



>emb|CDY18767.1| BnaAnng02320D [Brassica napus]
Length=278

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 139/243 (57%), Gaps = 12/243 (5%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNVDT  866
             E+NLQ FPP+ G  +G   P        +GP     +  +  W   F++ +Y  +F+VDT
Sbjct  34    ESNLQTFPPSQGKISGGSNPPRDADDTFSGPGSSTDEPQSGGWLHKFTVGAYKPFFDVDT  93

Query  865   DVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTT  686
               V++RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK     
Sbjct  94    SDVVDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKWKK--  151

Query  685   STRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssf  506
                 +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLFIFI +  
Sbjct  152   QEWNYDINLVTWSAGVFYGYVTLVPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIPALC  211

Query  505   lliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAIFIKM  332
             L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+ +K+
Sbjct  212   LSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVVLKL  271

Query  331   WFF  323
             + F
Sbjct  272   YLF  274



>ref|XP_006855284.1| hypothetical protein AMTR_s00057p00035800 [Amborella trichopoda]
 gb|ERN16751.1| hypothetical protein AMTR_s00057p00035800 [Amborella trichopoda]
Length=282

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 141/248 (57%), Gaps = 16/248 (6%)
 Frame = -3

Query  1024  PEANLQIFPPNNGGNAGQGTPAGPSEGD------GQQSTNN------WKGVFSISSYTQY  881
             PE+NLQ FPP+       GT   P++ D         +TNN      W  +F++++Y  Y
Sbjct  32    PESNLQTFPPSETQGKISGTFRPPTDADDTFSKPASGNTNNESQPSGWLRMFTVAAYKPY  91

Query  880   FNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHK  701
             F+VDT  VL R+  SL P    F  KI  NPDLYG  WI T+L+   +S G   TYL HK
Sbjct  92    FDVDTSDVLERIKESLIPFKGSFSEKIVDNPDLYGPFWICTSLIFVAASIGTFITYLAHK  151

Query  700   QSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfif  521
              +       +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ WCL+ YSLF+F
Sbjct  152   LNK--KEWNYDINLVTWSAGLFYGYVTIVPLLLYVILKYFSAPSGLVQLWCLYGYSLFVF  209

Query  520   ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLA  347
             I +S L IIP+E  +W+V  +TG MS +FV LNL++ + +      ++    F++Q  LA
Sbjct  210   IPASCLSIIPLELFRWVVAGVTGFMSASFVALNLRTHIMSAGERWFLLVAGIFLIQAALA  269

Query  346   IFIKMWFF  323
             +  K++FF
Sbjct  270   VIWKLYFF  277



>ref|XP_009147256.1| PREDICTED: protein YIPF1 homolog [Brassica rapa]
Length=283

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 143/247 (58%), Gaps = 16/247 (6%)
 Frame = -3

Query  1021  EANLQIFPPN-NGGNAGQGTPAGPSEGD------GQQSTNN-----WKGVFSISSYTQYF  878
             E+NLQ FPP+   G    GT   P + D      G+ ST+      W   F++ +Y  +F
Sbjct  35    ESNLQTFPPSATQGKISGGTSNPPRDADDTFSGPGRSSTDEPHSGGWLHKFTVGAYKPFF  94

Query  877   NVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQ  698
             +VDT  V++RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK 
Sbjct  95    DVDTSDVVDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKW  154

Query  697   SDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifi  518
             +       +D+  ++ +A   YGY  IVPLG Y +L+Y  + + LV+ +CL+ YSLFIFI
Sbjct  155   NK--QEWNYDINLVTWSAGVFYGYVMIVPLGLYVVLKYFSAPSGLVQLFCLYGYSLFIFI  212

Query  517   lssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAI  344
              +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+
Sbjct  213   PALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAV  272

Query  343   FIKMWFF  323
              +K++ F
Sbjct  273   VLKLYLF  279



>emb|CDY05155.1| BnaC05g46480D [Brassica napus]
Length=280

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 139/244 (57%), Gaps = 13/244 (5%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTP--------AGPSEGDGQQ-STNNWKGVFSISSYTQYFNVD  869
             E+NLQ FPP+ G  +G   P        +GP  G   +  +  W   F++ +Y  +F+VD
Sbjct  35    ESNLQTFPPSQGKISGGSNPLRDADDTFSGPGNGSTDEPHSGGWLHKFTVGAYKPFFDVD  94

Query  868   TDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDT  689
             T  V++RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK    
Sbjct  95    TSDVMDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKWKK-  153

Query  688   TSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilss  509
                  +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLFIFI + 
Sbjct  154   -QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIPAL  212

Query  508   flliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAIFIK  335
              L ++PVE  +W +  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+ +K
Sbjct  213   CLSVVPVEIFRWAIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVVLK  272

Query  334   MWFF  323
             ++ F
Sbjct  273   LYLF  276



>ref|XP_001779018.1| predicted protein [Physcomitrella patens]
 gb|EDQ56164.1| predicted protein [Physcomitrella patens]
Length=212

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 132/219 (60%), Gaps = 12/219 (5%)
 Frame = -3

Query  973  QGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDA  794
            QG   G S G G      W+  F+  SY  YFNVDT  V+ R+  SL P   DF  K   
Sbjct  3    QGGANGSSTGSG------WQSYFNAVSYRPYFNVDTADVVERIRDSLFPFKGDFVEKTSH  56

Query  793  NPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIV  614
            NPD+YG  WI +TLV   ++ GN A +L    S  + +  +DV  +S AAF  YGY  ++
Sbjct  57   NPDMYGPFWICSTLVFVTAALGNFAAFL----SAQSGSWHYDVNKVSWAAFMFYGYVAVI  112

Query  613  PLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAF  434
            PLG YF+L+YLG  + LV+ WCL+ YSLF+FI +SFL ++P + ++W V+ +   MS  F
Sbjct  113  PLGLYFVLKYLGVVSGLVQLWCLYGYSLFVFIPASFLCVVPWDIMRWAVVGVAAVMSAGF  172

Query  433  VTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIFIKMWFF  323
            + +N++S V+T      ++  ++  LQ+GLA+ +K++FF
Sbjct  173  LAINIRSHVKTASERWFLIVTSSAALQLGLALVVKLYFF  211



>gb|KHG03382.1| Protein YIPF1 [Gossypium arboreum]
Length=271

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 131/229 (57%), Gaps = 4/229 (2%)
 Frame = -3

Query  1003  FPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPT  824
              PP++  ++      G S G  +   + W   F++++Y  YF+VDT  VL+RL  SL P 
Sbjct  41    LPPSDADDSFSRPAGGSSSGSDEPQASGWLHKFTVAAYKPYFDVDTTDVLDRLKESLYPF  100

Query  823   SADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAA  644
                F  K   NPDLYG  WI TTL+   +S G   TY+ HK  D      +D+  ++ +A
Sbjct  101   RGTFTEKTATNPDLYGPFWICTTLIFVAASIGTFVTYVAHKLRD--KEWNYDINLVTWSA  158

Query  643   FSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
                YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLFIFI +  L ++P+E  +WI+ 
Sbjct  159   GVFYGYVTVVPLVLYVILKYFSAPSGLVQLFCLYGYSLFIFIPALCLSVVPLEIFRWIIA  218

Query  463   LLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFIKMWFF  323
              + G MS  FV LNLK+ + +     V I A  F+LQ+GLA+ +K++ F
Sbjct  219   AVAGFMSATFVALNLKAHITSAGERWVLIVAGIFLLQLGLAVVLKLYLF  267



>ref|XP_008789655.1| PREDICTED: protein YIPF1 homolog [Phoenix dactylifera]
Length=284

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 132/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------QQSTNNWKGVFSISSYTQYFN  875
             E+NLQ FPP+            PS+ D            +     W   F++ +Y  YF+
Sbjct  34    ESNLQTFPPSEAQGKISAVFRPPSDADDTFSKPARGSSDESQPAGWMHKFTVGAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL P    F  K   NPDLYG  WI TTL+   ++ G   TYL HK  
Sbjct  94    VDTSDVLERIRDSLFPFKGSFTEKTAENPDLYGPFWICTTLIFVAAAIGTFVTYLAHKLE  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             +      +D+  ++ +A   YGY   VPLG Y +L+Y  + + LV+ WCL+ YSLFIFI 
Sbjct  154   NKEWN--YDINLVTWSAGLFYGYVTFVPLGLYIILKYFSAPSGLVQLWCLYGYSLFIFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIF  341
             +  L I+PVE  +W+++ + G MS  FV LNL++ +++       I A  F+LQ+ LA+ 
Sbjct  212   ALCLSIVPVEIFRWVIVGVAGFMSATFVALNLRTHIKSAGERWFFIVAGIFLLQLALAVI  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYVF  277



>ref|XP_009124072.1| PREDICTED: protein YIPF1 homolog [Brassica rapa]
 emb|CDY18789.1| BnaAnng02540D [Brassica napus]
Length=282

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 139/249 (56%), Gaps = 20/249 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG--------------QQSTNNWKGVFSISSYTQ  884
             E+NLQ FPP+ G  +G   P  P + D               +  +  W   F++ +Y  
Sbjct  34    ESNLQTFPPSQGKISGGSNP--PRDADDTFSGPGNGSSSSTDEPQSGGWLHKFTVGAYKP  91

Query  883   YFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMH  704
             +F+VDT  VL+RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ H
Sbjct  92    FFDVDTSDVLDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAH  151

Query  703   KQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfi  524
             K         +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLFI
Sbjct  152   KWKK--QEWNYDINLVTWSAGVFYGYVTLVPLALYVVLKYFSAPSGLVQLFCLYGYSLFI  209

Query  523   filssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGL  350
             FI +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GL
Sbjct  210   FIPALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGL  269

Query  349   AIFIKMWFF  323
             A+ +K++ F
Sbjct  270   AVVLKLYLF  278



>ref|XP_010917577.1| PREDICTED: protein YIPF1 homolog [Elaeis guineensis]
Length=284

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA----------GQGTPAGPSEGDGQQST-NNWKGVFSISSYTQYFN  875
             ++NLQ FPP+                  T + PS G   +S    W   F++ +Y  YF+
Sbjct  34    DSNLQTFPPSEAQGKISAVFRPPSDADDTFSKPSRGSSDESQPAGWVHKFTVGAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL P    F  K   NPDLYG  WI TTL+   ++ G   TYL HK  
Sbjct  94    VDTSDVLERVRDSLFPFKGSFTEKTAENPDLYGPFWICTTLIFVAAAIGTFVTYLAHKLE  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY   VPLG Y +L+Y  + + LV+ WCL+ YSLF+FI 
Sbjct  154   KKEWN--YDINLVTWSAGLFYGYVTFVPLGLYIILKYFSAPSGLVQLWCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIF  341
             +  L I+PVE  +W+++ + G +S  FV LNL++ +++       I A  F+LQ+ LA+ 
Sbjct  212   ALCLSIVPVEIFRWVIVGVAGFLSATFVALNLRTHIKSAGERWFFIVAGIFLLQLALAVI  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYVF  277



>emb|CDY27779.1| BnaA05g31880D [Brassica napus]
Length=282

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 142/246 (58%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G+ ST+      W   F++ +Y  +F+
Sbjct  35    ESNLQTFPPSATQGKISGGSNPPRDADDTFSGPGRSSTDEPHSGGWLHKFTVGAYKPFFD  94

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V++RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  95    VDTSDVVDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKWK  154

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  I+PL  Y +L+Y  + + LV+ +CL+ YSLFIFI 
Sbjct  155   K--QEWNYDINLVTWSAGVFYGYVTIIPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIP  212

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAIF  341
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+ 
Sbjct  213   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVV  272

Query  340   IKMWFF  323
             +K++ F
Sbjct  273   LKLYLF  278



>ref|XP_008809417.1| PREDICTED: protein YIPF1 homolog isoform X1 [Phoenix dactylifera]
Length=321

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 133/252 (53%), Gaps = 21/252 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------------QQSTNNWKGVFSISS  893
             +++LQ FPP             PS+ DG                 +     W   F++ +
Sbjct  65    DSSLQTFPPAEAQGKISAVFRPPSDADGFGFLIDTFSKPARGSSDESQPTGWMHKFTVGA  124

Query  892   YTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATY  713
             Y  YF+VDT  VL R+  SL P    F  K   NPDLYG  WI TTL+   ++ G   TY
Sbjct  125   YKPYFDVDTSDVLERIRDSLFPFKGSFTEKTVDNPDLYGPFWICTTLIFVAAAIGTFVTY  184

Query  712   LMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYs  533
             L HK  +      +D+  ++ +A   YGYA  VPLG Y +L+Y  + + LV+ WCL+ YS
Sbjct  185   LAHKLQNKEWN--YDINLVTWSAGLFYGYATFVPLGLYIILKYFSAPSGLVQLWCLYGYS  242

Query  532   lfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQ  359
             LF+FI +  L I+PVE  +W+++ + G MS  FV LNL++ +++       I A  F+LQ
Sbjct  243   LFVFIPALCLSIVPVEIFRWVIVGVAGFMSATFVALNLRTHIKSAGERWFFIVAGIFLLQ  302

Query  358   MGLAIFIKMWFF  323
             + LA+ +K++ F
Sbjct  303   LALAVILKLYVF  314



>ref|XP_008450652.1| PREDICTED: protein YIPF1 homolog [Cucumis melo]
Length=283

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 132/248 (53%), Gaps = 17/248 (7%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-------------QQSTNNWKGVFSISSYTQY  881
             ++NLQ FPP+       G    P + D              QQ    W   F++SSY QY
Sbjct  34    DSNLQTFPPSGTQGKISGGSQPPRDADDTFSKPISGSDESTQQGGGGWLRTFAVSSYKQY  93

Query  880   FNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHK  701
             F+VDT  VL R+  SL P    F  +    PDLYG  WI TTL+   +S G   TYL HK
Sbjct  94    FDVDTSDVLERIKDSLFPFRGTFNERTADTPDLYGPFWICTTLIFVAASIGTFVTYLAHK  153

Query  700   QSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfif  521
                      +D+  ++ +A   YGY  IVPLG Y +L+Y    + LV+  CL+ YSLF+F
Sbjct  154   LQK--KDWNYDINLVTWSAGLFYGYVTIVPLGLYVILKYFSVPSGLVQLLCLYGYSLFVF  211

Query  520   ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLA  347
             I +  L ++P+E  +W++  + G MS  FV LNL++ +++      ++  + F+LQ+ LA
Sbjct  212   IPALCLSVVPLEIFRWVIAGVAGFMSATFVALNLRAHIKSAGERWFLIVASIFLLQLALA  271

Query  346   IFIKMWFF  323
             + +K++ F
Sbjct  272   VILKLYLF  279



>ref|XP_008809425.1| PREDICTED: protein YIPF1 homolog isoform X2 [Phoenix dactylifera]
Length=315

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 134/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA----------GQGTPAGPSEGDGQQST-NNWKGVFSISSYTQYFN  875
             +++LQ FPP                   T + P+ G   +S    W   F++ +Y  YF+
Sbjct  65    DSSLQTFPPAEAQGKISAVFRPPSDADDTFSKPARGSSDESQPTGWMHKFTVGAYKPYFD  124

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL P    F  K   NPDLYG  WI TTL+   ++ G   TYL HK  
Sbjct  125   VDTSDVLERIRDSLFPFKGSFTEKTVDNPDLYGPFWICTTLIFVAAAIGTFVTYLAHKLQ  184

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             +      +D+  ++ +A   YGYA  VPLG Y +L+Y  + + LV+ WCL+ YSLF+FI 
Sbjct  185   NKEWN--YDINLVTWSAGLFYGYATFVPLGLYIILKYFSAPSGLVQLWCLYGYSLFVFIP  242

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIF  341
             +  L I+PVE  +W+++ + G MS  FV LNL++ +++       I A  F+LQ+ LA+ 
Sbjct  243   ALCLSIVPVEIFRWVIVGVAGFMSATFVALNLRTHIKSAGERWFFIVAGIFLLQLALAVI  302

Query  340   IKMWFF  323
             +K++ F
Sbjct  303   LKLYVF  308



>emb|CDY40704.1| BnaC03g34200D [Brassica napus]
Length=281

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 141/246 (57%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G+G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDTFSGNGNSSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTLVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAIF  341
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+ 
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVV  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYLF  277



>ref|XP_007205696.1| hypothetical protein PRUPE_ppa009732mg [Prunus persica]
 ref|XP_008246478.1| PREDICTED: protein YIPF1 homolog [Prunus mume]
 gb|EMJ06895.1| hypothetical protein PRUPE_ppa009732mg [Prunus persica]
Length=280

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 135/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNG-GNAGQG---------TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G    G         T + P  G  +   + W  VFS+SSY  YF+V
Sbjct  34    DSNLQTFPPSEAHGKIASGARPPRDADDTFSKPVSGSDESQQSGWLRVFSVSSYKSYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   +PDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  94    DTSDVLERIKDSLLPFSGTFNEKTSNSPDLYGPFWICTTLIFVAAAIGTFVTYVAHKIK-  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  153   -SKDWEYDINVVQWSAGLFYGYVTIVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L I+P+E  +W+V  + G MS  FV +NL++ + +       I A  F+LQ+ L++ +
Sbjct  212   LCLSIVPIEIFRWVVAGVAGVMSATFVAVNLRAHIVSAGERWFLIVAGIFLLQLALSVVL  271

Query  337   KMWFF  323
             K++ F
Sbjct  272   KLYLF  276



>ref|XP_010494004.1| PREDICTED: protein YIPF1 homolog [Camelina sativa]
Length=280

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 135/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +  +  W   F++ +Y  YF+V
Sbjct  34    DSNLQTFPPSATLGKISGGTNPPRDADDTFSRPVNGTDEPQSGGWLHRFTVGAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  94    DTSDVLERLKESLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKK  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  154   --QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIFI  338
               L ++P+E  +W++  L G MS  FV LNLK+ + +      ++ ++ F+LQ+ L++ +
Sbjct  212   LCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSAGERWFLIVVSIFLLQLALSVVL  271

Query  337   KMWFF  323
             K++ F
Sbjct  272   KLYLF  276



>gb|KFK37932.1| hypothetical protein AALP_AA3G048900 [Arabis alpina]
Length=281

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 93/246 (38%), Positives = 140/246 (57%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDTFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLFIFI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTLVPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAIF  341
             +  L I+PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+ 
Sbjct  212   ALCLSIVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVV  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYLF  277



>ref|XP_010255944.1| PREDICTED: protein YIPF1 homolog [Nelumbo nucifera]
Length=281

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 134/247 (54%), Gaps = 16/247 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG------------QQSTNNWKGVFSISSYTQYF  878
             E+NLQ FPP        G    P + D             +   + W  +FS+++Y  YF
Sbjct  33    ESNLQTFPPTETQGKISGGFRPPRDADDTFSKPVSGSSSDESQPSGWLRIFSVAAYKPYF  92

Query  877   NVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQ  698
             +VDT  VL R+  SL P   +F  KI +NPDLYG  WI TTL+   +S     TYL  K 
Sbjct  93    DVDTSDVLERVKESLFPFKGNFSEKIASNPDLYGPFWICTTLIFVAASIATFVTYLARKL  152

Query  697   SDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifi  518
              +      +D+  ++ +A   YGY  IVPL  YF+L+Y  +    V   CL+ YSLF+FI
Sbjct  153   QN--KEWDYDIQLITWSAGLFYGYVTIVPLAVYFILKYFSAPFGFVHLLCLYGYSLFVFI  210

Query  517   lssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAI  344
              +S L +IP+E  +W V  + G MS AFV+LNL++ + ++    + I A  F+LQ+ LA+
Sbjct  211   PASCLSVIPLEVFRWAVAGVAGFMSAAFVSLNLRAHIMSSGERWILIVAGIFLLQLALAV  270

Query  343   FIKMWFF  323
              +K++ F
Sbjct  271   MLKLYLF  277



>ref|XP_009416090.1| PREDICTED: protein YIPF1 homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=291

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 137/250 (55%), Gaps = 22/250 (9%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAG----PSEGDG-----------QQSTNNWKGVFSISSYT  887
             E+ L  FPP++     QG  A     PS+ D            +  +  W   F++ +Y 
Sbjct  40    ESKLHTFPPSS---ESQGKIAAVFRPPSDADDSFSKPARGISDEPRSTGWMHAFTVGAYK  96

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
              YF+VDT  VL R+  SL P    F      NPDLYG  WI TTL+  +++ G   TY+ 
Sbjct  97    PYFDVDTSDVLQRIRDSLFPFRGTFTENTADNPDLYGPFWICTTLIFVVAAIGTFVTYVA  156

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
             H+         +D+  ++ +A   YGY  +VPLG Y +L+Y  + + LV+ WCL+ YSLF
Sbjct  157   HELQKKEWN--YDINLVTWSAGLFYGYVTLVPLGLYAILKYFSAPSGLVQLWCLYGYSLF  214

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMG  353
             +FI +S L I+PVE  +W++  + G MS  FV LNL++ +++       I A  F+LQ+G
Sbjct  215   VFIPASCLSIVPVEIFRWVIAGVAGFMSATFVALNLRTHIKSAGERWFLIVAGIFLLQLG  274

Query  352   LAIFIKMWFF  323
             LA+ +K++FF
Sbjct  275   LAVVLKLYFF  284



>ref|XP_009416088.1| PREDICTED: protein YIPF1 homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=290

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 137/250 (55%), Gaps = 22/250 (9%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAG----PSEGDG-----------QQSTNNWKGVFSISSYT  887
             E+ L  FPP++     QG  A     PS+ D            +  +  W   F++ +Y 
Sbjct  39    ESKLHTFPPSS---ESQGKIAAVFRPPSDADDSFSKPARGISDEPRSTGWMHAFTVGAYK  95

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLM  707
              YF+VDT  VL R+  SL P    F      NPDLYG  WI TTL+  +++ G   TY+ 
Sbjct  96    PYFDVDTSDVLQRIRDSLFPFRGTFTENTADNPDLYGPFWICTTLIFVVAAIGTFVTYVA  155

Query  706   HKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslf  527
             H+         +D+  ++ +A   YGY  +VPLG Y +L+Y  + + LV+ WCL+ YSLF
Sbjct  156   HELQKKEWN--YDINLVTWSAGLFYGYVTLVPLGLYAILKYFSAPSGLVQLWCLYGYSLF  213

Query  526   ifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMG  353
             +FI +S L I+PVE  +W++  + G MS  FV LNL++ +++       I A  F+LQ+G
Sbjct  214   VFIPASCLSIVPVEIFRWVIAGVAGFMSATFVALNLRTHIKSAGERWFLIVAGIFLLQLG  273

Query  352   LAIFIKMWFF  323
             LA+ +K++FF
Sbjct  274   LAVVLKLYFF  283



>ref|XP_002872269.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48528.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 135/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +  +  W   F++ +Y  YF+V
Sbjct  34    DSNLQTFPPSATQGKISGGTNPPRDVDDTFSRPVNGTDEPQSGGWLHRFTVGAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  V+ RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  94    DTSDVVERLKESLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKK  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  154   --QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIFI  338
               L ++P+E  +W++  L G MS  FV LNLK+ + +      ++ ++ F+LQ+ L++ +
Sbjct  212   LCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSAGERWFLIVVSIFLLQLALSVVL  271

Query  337   KMWFF  323
             K++ F
Sbjct  272   KLYLF  276



>ref|XP_006408092.1| hypothetical protein EUTSA_v10021283mg [Eutrema salsugineum]
 gb|ESQ49545.1| hypothetical protein EUTSA_v10021283mg [Eutrema salsugineum]
Length=281

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 140/246 (57%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  S++      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDTFSGHGNGSSDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  I+PL  Y +L+Y  + + LV+ +CL+ YSLFIFI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTIIPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAIF  341
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GLA+ 
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLAVV  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYLF  277



>ref|XP_003535342.1| PREDICTED: protein YIPF1 homolog [Glycine max]
 gb|KHN16129.1| Protein YIPF1 like [Glycine soja]
Length=277

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/279 (36%), Positives = 148/279 (53%), Gaps = 24/279 (9%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNG-GNAGQG--------  968
             +++ D  +V   G V     PP+Q         ++NLQ FPP+   G  G G        
Sbjct  6     YTSIDSQKV--SGSVPAVDPPPFQ-------FSDSNLQTFPPSGAQGKIGGGSRHPRDVD  56

Query  967   -TPAGPSEG-DGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDA  794
              T + P  G D  Q  + W   FS++SY  YF+VDT  VL+R+  SL P +  F  K  +
Sbjct  57    DTFSKPVSGSDEPQQQSGWFKAFSLASYKPYFDVDTIDVLDRIKDSLYPFNGTFNEKTAS  116

Query  793   NPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIV  614
             +PDLYG  WI TTL+   +S G   TY+ HK  D      +D+  ++ +A   YGY  IV
Sbjct  117   HPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKDQEWN--YDINLVTWSAGLFYGYVTIV  174

Query  613   PLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAF  434
             PL  Y +L+Y    +  V+  CL+ YSLF+FI +  + ++P+E  +W+V  + G MS  F
Sbjct  175   PLCLYVILKYFSVPSGFVQLLCLYGYSLFVFIPALCMSVVPLEIFRWMVAGVAGFMSATF  234

Query  433   VTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFIKMWFF  323
             V LNL++ + +     V I A  FVLQ+ LA+ +K+  F
Sbjct  235   VALNLRAHIMSAGERWVLIVASIFVLQLALAVALKVCLF  273



>ref|XP_004494622.1| PREDICTED: protein YIPF1 homolog [Cicer arietinum]
Length=280

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 134/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G   G   P        + P  G  +     W   F++++Y  YF+V
Sbjct  34    DSNLQTFPPSQAQGKITGGSRPPRDADDSFSKPVSGSDEPQQGGWLRNFAVAAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R++ SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK  D
Sbjct  94    DTSDVLERIIDSLFPFRGTFNEKTSTNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKD  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y    A LV+ +CL+ YSLF+FI +
Sbjct  154   --KEWDYDINLVTWSAGLFYGYVTIVPLCLYVILKYFSVPAGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               + I+P++  +W+V  + G MS  FV LNL++ +++       I A  F+LQ+ L++ +
Sbjct  212   LCMSIVPLDIFRWVVAGVAGLMSATFVALNLRAHIKSAGERWFFIVAGIFLLQLALSVVL  271

Query  337   KMWFF  323
             K++ F
Sbjct  272   KIYLF  276



>ref|XP_004302434.1| PREDICTED: protein YIPF1 homolog [Fragaria vesca subsp. vesca]
Length=279

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 135/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNG-GNAGQG---------TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +++LQ FPP+   G    G         T + P  G  +   + W   FS+SSY  YF+V
Sbjct  33    DSHLQTFPPSEAQGKISSGARPPRDADDTFSKPVSGSDEPQQSGWLRTFSVSSYKAYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   NPDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  93    DTSDVLERIKDSLLPYSGAFNEKTTNNPDLYGPFWICTTLIFVAAAIGTFVTYVAHKVKS  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                T  +D+  +  +A   YGY  +VPL  Y +L+Y  + A LV+ +CL+ YSLF+FI +
Sbjct  153   QEWT--YDINVVQWSAGLFYGYVTVVPLLLYVILKYFSAPAGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L ++P+E  +W++  + G MS  FV +NL++ + +   +   I A  F+LQ+ L++ +
Sbjct  211   LCLSVVPLEIFRWVIAGVAGIMSATFVAINLRAHIVSAGESWFLIVAGIFLLQLALSVVL  270

Query  337   KMWFF  323
             K++ F
Sbjct  271   KLYLF  275



>ref|XP_010674762.1| PREDICTED: protein YIPF1 homolog [Beta vulgaris subsp. vulgaris]
Length=280

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 141/246 (57%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPN-------NGGNA----GQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFN  875
             E++LQ FPP+       +GG+        T + P  G     ++ W G+FSI++Y  YF+
Sbjct  33    ESSLQTFPPSETSGKIASGGSRPPRDADDTFSKPGGGSDAPQSSGWFGIFSIAAYKPYFD  92

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL P    F   I  +PDLYG  WI TTL+   ++ G   TYL +K  
Sbjct  93    VDTSDVLERIKESLFPWKGTFTELISNSPDLYGPFWICTTLIFIAAAIGTFVTYLSNKIQ  152

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
               +    +D+  ++ +A   YGY  IVPLG Y +L+Y  + +  V+  CL+ YSLF+F+ 
Sbjct  153   --SKEYNYDISLVTWSAGLFYGYVTIVPLGLYLVLKYFSAPSGFVQLLCLYGYSLFVFVP  210

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIF  341
             +  L ++P++  +W++  + G MS +FV LNLK+ +++      ++ +A F+LQ+ LAI 
Sbjct  211   ALCLSVVPLDIFRWVIAGVAGFMSASFVALNLKAHIESAGERWFLIVVAIFLLQVALAIA  270

Query  340   IKMWFF  323
             +K++ F
Sbjct  271   LKIYLF  276



>ref|XP_010925137.1| PREDICTED: protein YIPF1 homolog isoform X3 [Elaeis guineensis]
Length=284

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA----------GQGTPAGPSEGDGQQST-NNWKGVFSISSYTQYFN  875
             +++LQ FPP+                  T + P+ G   +S    W   F++ +Y  YF+
Sbjct  34    DSSLQTFPPSEAQGKISAVFRPPSDADDTFSKPARGSSDESQPTGWMHKFTVGAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL      F  K   NPDLYG  WI TTL+   +S G   TYL HK  
Sbjct  94    VDTSDVLERIRDSLFSFKGSFTEKTADNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLQ  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             +      +D+  ++ +A   YGY   VPLG Y +L+Y  + + LV+ WCL+ YSLFIFI 
Sbjct  154   NKDWN--YDINLVTWSAGLFYGYVTFVPLGLYIILKYFSAPSGLVQLWCLYGYSLFIFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIF  341
             +  L I+PVE  +W+++ + G MS  FV LNL++ +++       I A  F+LQ+ LA+ 
Sbjct  212   ALCLSIVPVEIFRWVIVGVAGFMSATFVALNLRTHIKSAGERWFFIVAGIFLLQLALAVI  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYVF  277



>ref|XP_010925136.1| PREDICTED: protein YIPF1 homolog isoform X2 [Elaeis guineensis]
Length=288

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA----------GQGTPAGPSEGDGQQST-NNWKGVFSISSYTQYFN  875
             +++LQ FPP+                  T + P+ G   +S    W   F++ +Y  YF+
Sbjct  34    DSSLQTFPPSEAQGKISAVFRPPSDADDTFSKPARGSSDESQPTGWMHKFTVGAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL      F  K   NPDLYG  WI TTL+   +S G   TYL HK  
Sbjct  94    VDTSDVLERIRDSLFSFKGSFTEKTADNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLQ  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             +      +D+  ++ +A   YGY   VPLG Y +L+Y  + + LV+ WCL+ YSLFIFI 
Sbjct  154   NKDWN--YDINLVTWSAGLFYGYVTFVPLGLYIILKYFSAPSGLVQLWCLYGYSLFIFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIF  341
             +  L I+PVE  +W+++ + G MS  FV LNL++ +++       I A  F+LQ+ LA+ 
Sbjct  212   ALCLSIVPVEIFRWVIVGVAGFMSATFVALNLRTHIKSAGERWFFIVAGIFLLQLALAVI  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYVF  277



>ref|XP_008370491.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
 ref|XP_008363979.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
Length=280

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 135/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNG-GNAGQG---------TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++ LQ FPP+   G   +G         T + P  G  +     W  +FS++SY QYF+V
Sbjct  34    DSTLQTFPPSETRGKIARGALPPSDADDTFSKPVSGSDEPQQGGWLRIFSVASYKQYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   +PDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  94    DTSDVLERIKDSLLPFSGTFNEKTSNSPDLYGPFWICTTLIFVAAAIGTFVTYVAHKMK-  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  153   -SKDWEYDINVVQWSAGLFYGYVTIVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L ++P+E  +W++  + G MS  FV +NL++ + +       I A  F+LQ+ L++ +
Sbjct  212   LCLSVVPLEIFRWVIAGVAGVMSATFVAVNLRAHIVSAGERWFLIVAGIFLLQLALSVVL  271

Query  337   KMWFF  323
             K++ F
Sbjct  272   KLYLF  276



>ref|XP_006382606.1| integral membrane Yip1 family protein [Populus trichocarpa]
 gb|ERP60403.1| integral membrane Yip1 family protein [Populus trichocarpa]
Length=284

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +     W   F+I++Y  YF+V
Sbjct  38    DSNLQTFPPSGSQGKISGGSRPPRDADDTFSKPISGSDEPQQGGWFRTFTIAAYKPYFDV  97

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  98    DTTEVLERIKDSLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLQK  157

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  158   KEWN--YDINLVTWSAGVFYGYVLLVPLALYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  215

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L ++P+E  +W++  + G MS  FV LNL++ + +       I A  F+LQ+ L++ +
Sbjct  216   LCLSVVPLEIFRWVIAGVAGFMSATFVALNLRAHIMSAGERWFLIVAGIFLLQLALSVVL  275

Query  337   KMWFF  323
             K++ F
Sbjct  276   KLYLF  280



>ref|XP_010278010.1| PREDICTED: protein YIPF1 homolog [Nelumbo nucifera]
Length=281

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 132/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQG----------TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             E+NLQ FPP+       G          T   P+ G  +   + W    ++++Y  YF+V
Sbjct  35    ESNLQTFPPSQAQGKITGGFQPPRDADDTFLKPASGSDESQPSGWFRALTVTAYKPYFDV  94

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P  A F  K   NPDLYG  WI TTL+   +S     TYL HK   
Sbjct  95    DTSDVLERIKDSLFPFKASFSEKTANNPDLYGPFWICTTLIFVAASIATFVTYLAHKLQK  154

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGYA IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  155   KEWN--YDINLVTWSAGLFYGYATIVPLILYIILKYFSAPSGLVQLFCLYGYSLFVFIPA  212

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L +IP+E  +W ++ + G MS  FV LNL++ +++       I A  F+LQ+ LA+ +
Sbjct  213   LCLSVIPIEVFRWAIVGVAGFMSATFVALNLRNHIRSAGERWFLIVAGIFLLQVALAVVL  272

Query  337   KMWFF  323
             K + F
Sbjct  273   KFYLF  277



>ref|XP_001777312.1| predicted protein [Physcomitrella patens]
 gb|EDQ57842.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 136/252 (54%), Gaps = 21/252 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTP-AGPSEGDGQQS---------------TNNWKGVFSISSY  890
             ++NLQIFPP         +    P++ D   S                  W+G F++ SY
Sbjct  8     DSNLQIFPPAYDTRENMTSLFRPPNDADETFSQPGHGGQGGQGIPGPNQAWQGYFNVLSY  67

Query  889   TQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYL  710
               YFNVDT  V +R+  SL      F  K   NPD+YG  WI +TLV   +S GNLA YL
Sbjct  68    RPYFNVDTVDVTDRIKDSLK-VDVGFVEKTSQNPDMYGPFWICSTLVFVTASLGNLAAYL  126

Query  709   MHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYsl  530
              +K   T     +D+  MS AA   YGY  +VPL  YFLL+YLG  + + + WCL+ YSL
Sbjct  127   SYKSKTTGGHWHYDINLMSSAALVFYGYVGLVPLALYFLLRYLGVTSGVFQLWCLYGYSL  186

Query  529   fifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-ND--LAIVPIAAFVLQ  359
             F+FI +SFL ++P E ++W+V+     MS  FV  N+++ ++T ND  LAIV I      
Sbjct  187   FVFIPASFLSVVPWEIVRWLVVGAASFMSAIFVGGNIRTQIRTANDRWLAIV-IGTVATH  245

Query  358   MGLAIFIKMWFF  323
             + L + +K +FF
Sbjct  246   LALGLVLKFYFF  257



>ref|XP_009134819.1| PREDICTED: protein YIPF1 homolog [Brassica rapa]
Length=282

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 142/247 (57%), Gaps = 16/247 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN------WKGVFSISSYTQYF  878
             E+NLQ FPP+   G  +G   P   ++    G+G  S+ +      W   F++ +Y  +F
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDTFSGNGNGSSTDEPQSGGWLHKFTVGAYKPFF  93

Query  877   NVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQ  698
             +VDT  V++RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK 
Sbjct  94    DVDTSDVVDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYVAHKW  153

Query  697   SDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifi  518
                     +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI
Sbjct  154   KK--QEWNYDINLVTWSAGVFYGYVTLVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFI  211

Query  517   lssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA-FVLQMGLAI  344
              +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+ F+LQ+GL++
Sbjct  212   PALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIASIFLLQLGLSV  271

Query  343   FIKMWFF  323
              +K++ F
Sbjct  272   VLKLYLF  278



>ref|XP_010925135.1| PREDICTED: protein YIPF1 homolog isoform X1 [Elaeis guineensis]
Length=372

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA----------GQGTPAGPSEGDGQQST-NNWKGVFSISSYTQYFN  875
             +++LQ FPP+                  T + P+ G   +S    W   F++ +Y  YF+
Sbjct  34    DSSLQTFPPSEAQGKISAVFRPPSDADDTFSKPARGSSDESQPTGWMHKFTVGAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL      F  K   NPDLYG  WI TTL+   +S G   TYL HK  
Sbjct  94    VDTSDVLERIRDSLFSFKGSFTEKTADNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLQ  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             +      +D+  ++ +A   YGY   VPLG Y +L+Y  + + LV+ WCL+ YSLFIFI 
Sbjct  154   NKDWN--YDINLVTWSAGLFYGYVTFVPLGLYIILKYFSAPSGLVQLWCLYGYSLFIFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIF  341
             +  L I+PVE  +W+++ + G MS  FV LNL++ +++       I A  F+LQ+ LA+ 
Sbjct  212   ALCLSIVPVEIFRWVIVGVAGFMSATFVALNLRTHIKSAGERWFFIVAGIFLLQLALAVI  271

Query  340   IKMWFF  323
             +K++ F
Sbjct  272   LKLYVF  277



>ref|NP_198101.2| Integral membrane Yip1 family protein [Arabidopsis thaliana]
 gb|AED93693.1| Integral membrane Yip1 family protein [Arabidopsis thaliana]
Length=282

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 133/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------QQSTNNWKGVFSISSYTQYFN  875
             ++NLQ FPP+       G    P + D            +  ++ W   F++ +Y  YF+
Sbjct  35    DSNLQTFPPSATQGKISGGTNPPRDADDTFSRPVNGTTDEPQSSGWLHRFTVGAYKPYFD  94

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  95    VDTSDVVERLKESLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLK  154

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  155   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  212

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIF  341
             +  L ++P+E  +W++  L G MS  FV LNLK+ + +      ++ ++ F+LQ+ L++ 
Sbjct  213   ALCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSAGERWFLIVVSIFLLQLALSVV  272

Query  340   IKMWFF  323
             +K++ F
Sbjct  273   LKLYLF  278



>ref|XP_011036777.1| PREDICTED: protein YIPF1 homolog isoform X1 [Populus euphratica]
 ref|XP_011036778.1| PREDICTED: protein YIPF1 homolog isoform X2 [Populus euphratica]
Length=284

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +     W   F+I++Y  YF+V
Sbjct  38    DSNLQTFPPSGSQGKISGGSHPPRDADDTFSKPISGSDEPQQGGWFRTFTIAAYKPYFDV  97

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  98    DTTDVLERIKDSLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLQK  157

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + L++ +CL+ YSLF+FI +
Sbjct  158   KEWN--YDINLVTWSAGVFYGYVLLVPLALYVILKYFSAPSGLIQLFCLYGYSLFVFIPA  215

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L ++P+E  +W++  + G MS  FV LNL++ + +       I A  F+LQ+ L++ +
Sbjct  216   LCLSVVPLEIFRWVIAGVAGFMSATFVALNLRAHIMSAGERWFLIVAGIFLLQLALSVVL  275

Query  337   KMWFF  323
             K++ F
Sbjct  276   KLYLF  280



>ref|XP_011036779.1| PREDICTED: protein YIPF1 homolog isoform X3 [Populus euphratica]
 ref|XP_011036780.1| PREDICTED: protein YIPF1 homolog isoform X4 [Populus euphratica]
Length=283

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +     W   F+I++Y  YF+V
Sbjct  37    DSNLQTFPPSGSQGKISGGSHPPRDADDTFSKPISGSDEPQQGGWFRTFTIAAYKPYFDV  96

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  97    DTTDVLERIKDSLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLQK  156

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + L++ +CL+ YSLF+FI +
Sbjct  157   --KEWNYDINLVTWSAGVFYGYVLLVPLALYVILKYFSAPSGLIQLFCLYGYSLFVFIPA  214

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L ++P+E  +W++  + G MS  FV LNL++ + +       I A  F+LQ+ L++ +
Sbjct  215   LCLSVVPLEIFRWVIAGVAGFMSATFVALNLRAHIMSAGERWFLIVAGIFLLQLALSVVL  274

Query  337   KMWFF  323
             K++ F
Sbjct  275   KLYLF  279



>ref|XP_010421605.1| PREDICTED: protein YIPF1 homolog isoform X2 [Camelina sativa]
Length=271

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
              +NLQ FPP+   G  +G   P        + P  G  +  +  W   F++ +Y  YF+V
Sbjct  12    HSNLQTFPPSATLGKISGGTNPPRDADDTFSRPVNGTDEPQSGGWLHRFTVGAYKPYFDV  71

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  V+ RL  SL P    F  K   NPDLY   WI TTL+   +S G   TY+ HK   
Sbjct  72    DTSDVVERLKESLFPFRGTFTEKTANNPDLYRPFWICTTLIFVAASIGTFVTYIAHKLKK  131

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  132   QEWN--YDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  189

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIFI  338
               L ++P+E  +W++  L G MS  FV LNLK+ + +      ++ ++ F+LQ+ L++ +
Sbjct  190   LCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSAGERWFLIVVSIFLLQLALSVVL  249

Query  337   KMWFF  323
             K++ F
Sbjct  250   KLYLF  254



>ref|XP_010421604.1| PREDICTED: protein YIPF1 homolog isoform X1 [Camelina sativa]
Length=293

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 134/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +  +  W   F++ +Y  YF+V
Sbjct  34    DSNLQTFPPSATLGKISGGTNPPRDADDTFSRPVNGTDEPQSGGWLHRFTVGAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  V+ RL  SL P    F  K   NPDLY   WI TTL+   +S G   TY+ HK   
Sbjct  94    DTSDVVERLKESLFPFRGTFTEKTANNPDLYRPFWICTTLIFVAASIGTFVTYIAHKLKK  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  154   --QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIFI  338
               L ++P+E  +W++  L G MS  FV LNLK+ + +      ++ ++ F+LQ+ L++ +
Sbjct  212   LCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSAGERWFLIVVSIFLLQLALSVVL  271

Query  337   KMWFF  323
             K++ F
Sbjct  272   KLYLF  276



>gb|AAR23733.1| At5g27490 [Arabidopsis thaliana]
 gb|AAR24768.1| At5g27490 [Arabidopsis thaliana]
Length=282

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 132/246 (54%), Gaps = 15/246 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------QQSTNNWKGVFSISSYTQYFN  875
             ++NLQ FPP+       G    P + D            +  ++ W   F++ +Y  YF+
Sbjct  35    DSNLQTFPPSATQGKISGGTNPPRDADDTFSRPVNGTTDEPQSSGWLHRFTVGAYKPYFD  94

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  95    VDTSDVVERLKESLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLK  154

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  155   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFYAPSGLVQLFCLYGYSLFVFIP  212

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIF  341
             +  L ++P+E  +W++  L G MS  FV LNLK+ +        ++ ++ F+LQ+ L++ 
Sbjct  213   ALCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINPAGERWFLIVVSIFLLQLALSVV  272

Query  340   IKMWFF  323
             +K++ F
Sbjct  273   LKLYLF  278



>ref|XP_004171192.1| PREDICTED: LOW QUALITY PROTEIN: protein YIPF1 homolog [Cucumis 
sativus]
Length=286

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 132/251 (53%), Gaps = 20/251 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQST----------------NNWKGVFSISSY  890
             ++NLQ FPP+       G    P + D   S                   W   F++SSY
Sbjct  34    DSNLQTFPPSGTQGKISGGSQPPRDADDTFSKPISSSDEPQQGGGGGGGGWLRTFAVSSY  93

Query  889   TQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYL  710
              QYF+VDT  VL R+  SL P    F  +    PDLYG  WI TTL+   +S G   TY+
Sbjct  94    KQYFDVDTSDVLERIKDSLFPFRGTFNERTADTPDLYGPFWICTTLIFVAASIGTFVTYV  153

Query  709   MHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYsl  530
              HK  +      +D+  ++ +A   YGY  IVPLG Y +L+Y    + LV+  CL+ YSL
Sbjct  154   AHKLHN--KDWNYDINLVTWSAGLFYGYVTIVPLGLYVILKYFSVPSGLVQLLCLYGYSL  211

Query  529   fifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQM  356
             F+FI +  L ++P+E  +W++  + G MS  FV LNL++ +++      ++  + F+LQ+
Sbjct  212   FVFIPALCLSVVPLESFRWVIAGVAGFMSATFVALNLRAHIKSAGERWFLIVASIFLLQL  271

Query  355   GLAIFIKMWFF  323
              LA+ +K++ F
Sbjct  272   ALAVILKLYLF  282



>emb|CDY66983.1| BnaAnng23320D [Brassica napus]
Length=295

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 137/260 (53%), Gaps = 29/260 (11%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-------------------------QQSTNNW  917
             E+NLQ FPP+       G    P + DG                         +  +  W
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADGSYNVETCSYHLTAYWCRYIFWECTDEPQSGGW  93

Query  916   KGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAIS  737
                F++ +Y  +F+VDT  V++RL  SL P    F  K    PDLYG  WI TTL+   +
Sbjct  94    LHKFTVGAYKPFFDVDTSDVVDRLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAA  153

Query  736   SFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVR  557
             S G   TY+ HK         +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+
Sbjct  154   SIGTFVTYVAHKWKK--QEWNYDINLVTWSAGVFYGYVTLVPLALYVVLKYFSAPSGLVQ  211

Query  556   FWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVP  380
              +CL+ YSLF+FI +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ 
Sbjct  212   LFCLYGYSLFVFIPALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILI  271

Query  379   IAA-FVLQMGLAIFIKMWFF  323
             IA+ F+LQ+GL++ +K++ F
Sbjct  272   IASIFLLQLGLSVVLKLYLF  291



>ref|XP_004135620.1| PREDICTED: protein YIPF1 homolog [Cucumis sativus]
 gb|KGN66083.1| hypothetical protein Csa_1G570080 [Cucumis sativus]
Length=287

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 132/252 (52%), Gaps = 21/252 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQST-----------------NNWKGVFSISS  893
             ++NLQ FPP+       G    P + D   S                    W   F++SS
Sbjct  34    DSNLQTFPPSGTQGKISGGSQPPRDADDTFSKPISSSDESPQQGGGGGGGGWLRTFAVSS  93

Query  892   YTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATY  713
             Y QYF+VDT  VL R+  SL P    F  +    PDLYG  WI TTL+   +S G   TY
Sbjct  94    YKQYFDVDTSDVLERIKDSLFPFRGTFNERTADTPDLYGPFWICTTLIFVAASIGTFVTY  153

Query  712   LMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYs  533
             + HK  +      +D+  ++ +A   YGY  IVPLG Y +L+Y    + LV+  CL+ YS
Sbjct  154   VAHKLHN--KDWNYDINLVTWSAGLFYGYVTIVPLGLYVILKYFSVPSGLVQLLCLYGYS  211

Query  532   lfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQ  359
             LF+FI +  L ++P+E  +W++  + G MS  FV LNL++ +++      ++  + F+LQ
Sbjct  212   LFVFIPALCLSVVPLESFRWVIAGVAGFMSATFVALNLRAHIKSAGERWFLIVASIFLLQ  271

Query  358   MGLAIFIKMWFF  323
             + LA+ +K++ F
Sbjct  272   LALAVILKLYLF  283



>ref|XP_010025180.1| PREDICTED: protein YIPF1 homolog [Eucalyptus grandis]
 gb|KCW61775.1| hypothetical protein EUGRSUZ_H04483 [Eucalyptus grandis]
Length=279

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 120/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNN----------WKGVFSISSYTQYFNV  872
             ++NLQ FPP++      G    P + D   S +           W G FS++SY  YF+V
Sbjct  33    DSNLQTFPPSDAKGKISGGSGPPRDADDTFSKSTVGSDDSQPSGWFGWFSVASYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K  +NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLERIKDSLFPFRGSFNEKTSSNPDLYGPFWICTTLIFVAASIGTFVTYVAHKLKK  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPLG Y +L+Y  + + L++  CL+ YSLF+FI +
Sbjct  153   --EQWNYDINLVTWSAGLFYGYVTIVPLGLYVILKYFSAPSGLIQLLCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L I+P++  +W+V  + G MS  FV LNL++ +++
Sbjct  211   LCLSIVPLDIFRWVVAGVAGFMSATFVALNLRAHIKS  247



>ref|XP_010455117.1| PREDICTED: protein YIPF1 homolog [Camelina sativa]
Length=278

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ  PP+   G  +G   P        + P  G  +  +  W   F++ +Y  YF+V
Sbjct  32    DSNLQTIPPSATLGKISGGTNPPRDADDTFSRPVNGTDESQSGGWLHRFTVGAYKPYFDV  91

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  V+ R+  SL P    F      NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  92    DTSDVVERIKESLFPFRGTFTENTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKK  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  I+PL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  152   --QEWNYDINLVTWSAGVFYGYVTIIPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  209

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAIFI  338
               L ++P+E  +W++  L G MS  FV LNLK+ + +      ++ ++ F+LQ+ L++ +
Sbjct  210   LCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSAGERWFLIVVSIFLLQLALSVVL  269

Query  337   KMWFF  323
             K++ F
Sbjct  270   KLYLF  274



>ref|XP_006606513.1| PREDICTED: protein YIPF1 homolog isoform X2 [Glycine max]
Length=271

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 131/245 (53%), Gaps = 16/245 (7%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGD  941
             +++ D  +V   G V   + PP++         ++NLQ FPP+       G    P + D
Sbjct  6     YTSIDNQKV--SGSVPAVEPPPFK-------FSDSNLQTFPPSGAQGKISGGSRPPRDVD  56

Query  940   GQ-----QSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYG  776
             G      Q  + W   FS++SY  YF+VDT  VL+R+  SL P S  F  K  ++PDLYG
Sbjct  57    GSGSDEPQRQSGWFQAFSLASYKPYFDVDTIDVLDRIKDSLCPFSGTFNEKTASHPDLYG  116

Query  775   LIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYF  596
               WI TTL+   +S G   TY+ HK  D      +D+  ++ +A   YGY  +VPL  Y 
Sbjct  117   PFWICTTLIFVAASIGTFVTYIAHKLKDQEWN--YDINLVTWSAGLFYGYVTVVPLCLYV  174

Query  595   LLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLK  416
             +L+Y    +  V+  CL+ YSLF+FI +  + ++P+E  +W+V  + G MS  FV LNL+
Sbjct  175   ILKYFSVPSGFVQLLCLYGYSLFVFIPALCMSVVPLEIFRWVVAGVAGFMSATFVALNLR  234

Query  415   SFVQT  401
             + + +
Sbjct  235   AHIMS  239



>ref|XP_011073419.1| PREDICTED: protein YIPF1 homolog [Sesamum indicum]
Length=280

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 116/217 (53%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGN--AGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP  G    +G   P          P+ G  +   + W   F+I++Y  YF+V
Sbjct  34    DSNLQTFPPTGGQGKISGAARPPRDADDTFGKPNSGSEEPQQSGWFRSFTIAAYRPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TYL HK   
Sbjct  94    DTSDVLERIKDSLFPFRGTFSEKTANNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLQK  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  M+ +A   YGY  IVPLG Y +L+Y  + A  V+  CL+ YSLF+F+ +
Sbjct  154   --KEWDYDINLMTWSAGLFYGYVTIVPLGLYIILKYFSAPAGFVQLLCLYGYSLFVFVPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L ++P E  +W++  + G MS  FV LNLK+ + +
Sbjct  212   LCLSVVPQEIFRWVIAGVAGFMSATFVALNLKNHISS  248



>ref|XP_003521710.1| PREDICTED: protein YIPF1 homolog [Glycine max]
 gb|KHN04000.1| Protein YIPF1 like [Glycine soja]
Length=279

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 120/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGG---NAGQGTP-------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+       A  G P       + P  G  +     W   F+I++Y  YF+V
Sbjct  33    DSNLQTFPPSGAQGKITAASGPPRDADDSFSKPVSGSDEPQQGGWFQTFTIAAYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R++ SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLERIIDSLFPFRGSFNEKTATNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  ++ +A   YGY  IVPL  Y +L+Y  + A LV+ +CL+ YSLF+FI +
Sbjct  152   -SKEWDYDINLVTWSAGLFYGYVTIVPLCLYVILKYFSAPAGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               + ++P++  +W+V  + G MS  FV LNL++ +++
Sbjct  211   LCMSVVPLDIFRWVVAGVAGFMSATFVALNLRAHIKS  247



>ref|XP_007030858.1| Integral membrane Yip1 family protein [Theobroma cacao]
 gb|EOY11360.1| Integral membrane Yip1 family protein [Theobroma cacao]
Length=269

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 130/238 (55%), Gaps = 14/238 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNG-GNAGQG---------TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +++LQ FPP    G    G         T + P+ G  +   + W   F++ +Y  YF+V
Sbjct  33    DSSLQTFPPTGAQGKISSGAQPPRDADDTFSRPAGGSDEPQGSGWFRTFTVGAYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL+RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLDRLKESLFPFRGTFTEKTATNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKK  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  153   --KEWDYDINLVTWSAGVFYGYVTVVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAI  344
               L ++P+E  +W++  + G MS  FV LNL++ +++      ++  + F+LQ+ LA+
Sbjct  211   LCLSVVPLEIFRWVIAGVAGFMSATFVALNLRAHIKSAGERWFLIVASIFLLQLALAV  268



>ref|XP_009387501.1| PREDICTED: protein YIPF1 homolog [Musa acuminata subsp. malaccensis]
Length=288

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 122/219 (56%), Gaps = 14/219 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA-----------GQGTPAGPSEGDGQQ-STNNWKGVFSISSYTQYF  878
             E+NLQ FPP++  +               T + P+ G   +     W   F++S+Y  YF
Sbjct  37    ESNLQTFPPSSETHGKLSAVFRPPSDADDTFSKPAAGGSSEPQPTGWMQSFTVSAYKPYF  96

Query  877   NVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQ  698
             +VDT  V+ R+  SL P   +F  K   NPDLYG  WI TTL+   ++ G   +Y+ HK 
Sbjct  97    DVDTADVVERIRDSLFPFRGNFTEKTADNPDLYGPFWICTTLIFVAAAIGTFVSYVAHKL  156

Query  697   SDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifi  518
                     +D+  ++ +A   YGY   VPLG Y +L+Y    + L++ WCL+ YSLFIFI
Sbjct  157   QK--KEWDYDINLVTWSAGLFYGYVTFVPLGLYIILKYFSVPSGLIQLWCLYGYSLFIFI  214

Query  517   lssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
              +S L I+PVE  +W+++ + G MS AFV LNL+S +++
Sbjct  215   PASCLSIVPVEIFRWVIVGVAGFMSAAFVALNLRSHIKS  253



>ref|XP_007144735.1| hypothetical protein PHAVU_007G180400g [Phaseolus vulgaris]
 gb|ESW16729.1| hypothetical protein PHAVU_007G180400g [Phaseolus vulgaris]
Length=280

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 132/248 (53%), Gaps = 17/248 (7%)
 Frame = -3

Query  1021  EANLQIFPPNNGG-------------NAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQY  881
             ++NLQ FPP+                  G  T + P  G  +   + W   FS+++Y  Y
Sbjct  31    DSNLQTFPPSGTQGKIGGGTGGSGPPRDGDDTFSKPVSGSDESQQSGWFQAFSLATYKPY  90

Query  880   FNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHK  701
             F++DT  VL R+  SL P +  F  K  +NPDLYG  WI TTL+   +S G   TY+ HK
Sbjct  91    FDIDTIDVLERIKDSLYPFNGAFNEKTASNPDLYGPFWICTTLIFVAASIGTFVTYISHK  150

Query  700   QSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfif  521
                      +D+  ++ +A   YGY   VPLG Y +L+Y    + LV+  CL+ YSLFIF
Sbjct  151   LKHQEWN--YDINLVTWSAGLFYGYVTFVPLGLYLILKYFSVPSGLVQLLCLYGYSLFIF  208

Query  520   ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLA  347
             I +  L ++P E  +W++  + G MS  FV LNL++ + +     + I A  F+LQ+ L+
Sbjct  209   IPALCLSVVPWEIFRWVIAGVAGFMSATFVALNLRAHILSAGERWLLIVAGIFLLQLALS  268

Query  346   IFIKMWFF  323
             + +K++ F
Sbjct  269   VALKVYLF  276



>gb|ACU19300.1| unknown [Glycine max]
Length=279

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 119/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN---GGNAGQGTP-------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+       A  G P       + P  G  +     W   F+I++Y  YF+V
Sbjct  33    DSNLQTFPPSGPLGKITAASGPPRDADDSFSKPVSGSDEPQQGGWFQTFTIAAYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R++ SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLERIIDSLFPFRGSFNEKTATNPDLYGPFWICTTLIFVAASIGTFVTYVAHKLK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  ++ +A   YGY  IVPL  Y +L+Y  + A LV+ +CL+ YSL +FI +
Sbjct  152   -SKEWDYDINLVAWSAGLFYGYVTIVPLCLYVILKYFSAPAGLVQLFCLYGYSLLVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               + ++P++  +W+V  + G MS  FV LNL++ +++
Sbjct  211   LCMSVVPLDIFRWVVAGVAGFMSATFVALNLRAHIKS  247



>ref|XP_003554661.1| PREDICTED: protein YIPF1 homolog [Glycine max]
 gb|KHN43278.1| Protein YIPF1 like [Glycine soja]
Length=279

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 120/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN---GGNAGQGTP-------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+       A  G P       + P  G  +     W   F+I++Y  YF+V
Sbjct  33    DSNLQTFPPSGPLGKITAASGPPRDADDSFSKPVSGSDEPQQGGWFQTFTIAAYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R++ SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLERIIDSLFPFRGSFNEKTATNPDLYGPFWICTTLIFVAASIGTFVTYVAHKLK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  ++ +A   YGY  IVPL  Y +L+Y  + A LV+ +CL+ YSLF+FI +
Sbjct  152   -SKEWDYDINLVTWSAGLFYGYVTIVPLCLYVILKYFSAPAGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               + ++P++  +W+V  + G MS  FV LNL++ +++
Sbjct  211   LCMSVVPLDIFRWVVAGVAGFMSATFVALNLRAHIKS  247



>gb|EYU21656.1| hypothetical protein MIMGU_mgv1a011469mg [Erythranthe guttata]
Length=280

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 123/238 (52%), Gaps = 15/238 (6%)
 Frame = -3

Query  1084  GRVFQHQQPPYQPLARLSSAPEANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQ  935
             G V     PP   + + +   ++NLQ FPP    G  AG   P          P+ G  +
Sbjct  16    GSVPSVGDPPPHVVVKFN---DSNLQTFPPAGAQGKIAGASRPPRDADDTFGKPASGSDE  72

Query  934   QSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTT  755
                + W   F+I++Y  YF+VDT  VL R+  SL P    F  K   NPDLYG  WI TT
Sbjct  73    PQQSGWFRTFTIAAYRPYFDVDTSDVLERIKDSLFPFRGSFSEKTANNPDLYGPFWICTT  132

Query  754   LVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS  575
             L+   +S G   TYL HK         +D+  M+ +A   YGY  +VPL  Y +L+Y  +
Sbjct  133   LIFVAASIGTFVTYLAHKLQK--KEWDYDINLMTWSAGLFYGYVTVVPLALYIVLKYFSA  190

Query  574   NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
              +  V+  CL+ YSLF+FI +  L +IP E  +W++  + G MS  FV LNL++ +++
Sbjct  191   PSGFVQLLCLYGYSLFVFIPALCLSVIPQEIFRWVIAGVAGLMSATFVALNLRNHIKS  248



>ref|XP_006394963.1| hypothetical protein EUTSA_v10004745mg [Eutrema salsugineum]
 gb|ESQ32249.1| hypothetical protein EUTSA_v10004745mg [Eutrema salsugineum]
Length=280

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 117/217 (54%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             E+NLQ FPP+   G  +G   P        + P  G  +     W   F++ +Y  YF+V
Sbjct  34    ESNLQTFPPSATQGKISGGTNPPRDADDTFSRPVNGTDEPQAGGWLHKFTVGAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  V+ RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  94    DTSDVVERLKESLFPFRGTFTEKTANNPDLYGPFWICTTLIFVAASIGTFVTYIAHKWKR  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLFIFI +
Sbjct  154   --QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFIFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L ++P+E  +W++  L G MS  FV LNLK+ + +
Sbjct  212   LCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINS  248



>ref|XP_010659840.1| PREDICTED: protein YIPF1 homolog [Vitis vinifera]
 emb|CBI36763.3| unnamed protein product [Vitis vinifera]
Length=280

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 122/217 (56%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NL+ FPP+   G  +G   P        + P  G  +   + W   F++++Y  YF+V
Sbjct  34    DSNLETFPPSEAQGKISGASRPPRDADETFSKPVPGSDESPPSGWLRSFTVAAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P +  F  K+ +NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  94    DTSDVLERIKDSLFPFNGSFSEKVASNPDLYGPFWICTTLIFVAASIGTFVTYVAHKIQK  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  I+PLG Y +L+Y  + + L +  CL+ YSLFIFI +
Sbjct  154   --KEWDYDINLVTWSAGLFYGYVTIIPLGLYIILKYFSAPSGLAQLLCLYGYSLFIFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L ++P+E  +W+V  + G +S  FV LNL++ +++
Sbjct  212   LCLSVVPLELFRWVVAGVAGFLSATFVALNLRAHIKS  248



>ref|XP_007147056.1| hypothetical protein PHAVU_006G092500g [Phaseolus vulgaris]
 gb|ESW19050.1| hypothetical protein PHAVU_006G092500g [Phaseolus vulgaris]
Length=279

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 120/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPN---NGGNAGQGTP-------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+       A  G P       + P  G  +     W   F++++Y  YF+V
Sbjct  33    DSNLQTFPPSATQGKITAASGPPRDADDSFSKPISGSDEPQQGGWFRTFTVAAYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R++ SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLERIIDSLFPFRGSFNEKTATNPDLYGPFWICTTLIFVAASIGTFVTYVAHKLK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  ++ +A   YGY  IVPL  Y +L+Y  + A LV+ +CL+ YSLF+FI +
Sbjct  152   -SKEWNYDINLVTWSAGLFYGYVTIVPLCLYVILKYFSAPAGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               + I+P++  +W+V  + G MS  FV LNL++ +++
Sbjct  211   LCMSIVPLDIFRWVVAGVAGFMSATFVALNLRAHIKS  247



>ref|XP_006361852.1| PREDICTED: protein YIPF1 homolog [Solanum tuberosum]
Length=280

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 132/250 (53%), Gaps = 17/250 (7%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNN--GGNAGQGTP-----  962
             ++A D   V   G V     PP Q   + +   E+NLQ FPP++  G  +G   P     
Sbjct  6     YTAIDSQNV--SGSVPAAADPPGQVAVKFT---ESNLQTFPPSSSQGKISGASGPPRDAD  60

Query  961   ---AGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDAN  791
                + P  G  +   + W   F+I++Y  YF+VDT  VL R+  SL P +  F  K    
Sbjct  61    DSFSKPVSGSDEPQQSGWFRAFTIAAYKPYFDVDTSDVLERIKDSLLPFTGSFSEKTADK  120

Query  790   PDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVP  611
             PDLYG  WI +TLV   +S G   TY+ HK  +      +D+  ++ +A   YGY+ IVP
Sbjct  121   PDLYGPFWICSTLVFVAASIGTFITYIAHKLQNKEWN--YDINLVTWSAGLFYGYSTIVP  178

Query  610   LGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFV  431
             L  + +L+Y  + + LV+  CL+ YSLF+FI +  L ++P E ++W+V  + G MS  FV
Sbjct  179   LCLFLVLKYFSAPSGLVQLLCLYGYSLFVFIPALCLSLVPWEIMRWVVAGVAGFMSATFV  238

Query  430   TLNLKSFVQT  401
              LNLK  + +
Sbjct  239   ALNLKHHIAS  248



>dbj|BAE99567.1| hypothetical protein [Arabidopsis thaliana]
Length=223

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 120/207 (58%), Gaps = 4/207 (2%)
 Frame = -3

Query  937  QQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWIST  758
            +  ++ W   F++ +Y  YF+VDT  V+ RL  SL P    F  K   NPDLYG  WI T
Sbjct  15   EPQSSGWLHRFTVGAYKPYFDVDTSDVVERLKESLFPFRGTFTEKTANNPDLYGPFWICT  74

Query  757  TLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLG  578
            TL+   +S G   TY+ HK         +D+  ++ +A   YGY  IVPL  Y +L+Y  
Sbjct  75   TLIFVAASIGTFVTYIAHKLKK--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFS  132

Query  577  SNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-  401
            + + LV+ +CL+ YSLF+FI +  L ++P+E  +W++  L G MS  FV LNLK+ + + 
Sbjct  133  APSGLVQLFCLYGYSLFVFIPALCLSVVPLEIFRWVIAGLAGFMSATFVALNLKAHINSA  192

Query  400  -NDLAIVPIAAFVLQMGLAIFIKMWFF  323
                 ++ ++ F+LQ+ L++ +K++ F
Sbjct  193  GERWFLIVVSIFLLQLALSVVLKLYLF  219



>ref|XP_010312639.1| PREDICTED: protein YIPF1 homolog [Solanum lycopersicum]
Length=280

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 132/250 (53%), Gaps = 17/250 (7%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNN--GGNAGQGTP-----  962
             ++A D   V   G V     PP Q   + +   E+NLQ FPP++  G  +G   P     
Sbjct  6     YTAIDSQNV--SGSVPAAAGPPGQVAVKFT---ESNLQTFPPSSSQGKISGASGPPRDAD  60

Query  961   ---AGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDAN  791
                + P  G  +   + W   F+I++Y  YF+VDT  VL R+  SL P +  F  K    
Sbjct  61    DSFSKPVSGSDEPQQSGWFRAFTIAAYKPYFDVDTSDVLERIKDSLLPFTGSFSEKTADR  120

Query  790   PDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVP  611
             PDLYG  WI +TLV   +S G   TY+ HK  +      +D+  ++ +A   YGY+ IVP
Sbjct  121   PDLYGPFWICSTLVFVAASIGTFITYIAHKLQNKEWN--YDINLITWSAGLFYGYSTIVP  178

Query  610   LGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFV  431
             L  + +L+Y  + + LV+  CL+ YSLF+FI +  L ++P E ++W+V  + G MS  FV
Sbjct  179   LCLFLVLKYFSAPSGLVQLLCLYGYSLFVFIPALCLSLVPWEIVRWVVAGVAGFMSATFV  238

Query  430   TLNLKSFVQT  401
              LNLK  + +
Sbjct  239   ALNLKHHIAS  248



>ref|XP_010524878.1| PREDICTED: protein YIPF1 homolog [Tarenaya hassleriana]
Length=280

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 117/217 (54%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             E+NLQ FPP+   G  +G   P        + P  G  +     W   F+I +Y  YF+V
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDTFSRPVNGTDEPQPGGWLHKFTIGAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL RL  SL P    F  K   +PDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  94    DTSDVLERLRESLFPFRGTFTEKTANSPDLYGPFWICTTLIFVAASIGTFVTYIAHKWKK  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  154   --QEWDYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L I+P+E  +W++  + G MS  FV LNLK+ + +
Sbjct  212   LCLSIVPLEIFRWVIAGVAGFMSATFVALNLKAHINS  248



>ref|XP_008359872.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
Length=279

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 119/215 (55%), Gaps = 12/215 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +++LQ FPP+   G  AG   P        + P  G  +     W  V S++SY QYF+V
Sbjct  33    DSSLQTFPPSGTQGKIAGGALPPRDADDTFSKPVSGSDEPQQGGWLRVXSVASYKQYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   +PDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  93    DTSDVLERIKDSLLPFSGAFNEKTSBSPDLYGPFWICTTLIFVAAAIGTFVTYVAHKVK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  152   -SKDWEYDINVVQWSAGLFYGYVTIVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
               L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  211   LCLSIVPLEIFRWVIAGIAGVMSATFVAVNLRAHI  245



>ref|XP_008366844.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
Length=279

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 119/215 (55%), Gaps = 12/215 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +++LQ FPP+   G  AG   P        + P  G  +     W  V S++SY QYF+V
Sbjct  33    DSSLQTFPPSGTQGKIAGGALPPRDADDTFSKPVSGSDEPQQGGWLRVXSVASYKQYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   +PDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  93    DTSDVLERIKDSLLPFSGAFNEKTSBSPDLYGPFWICTTLIFVAAAIGTFVTYVAHKVK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  152   -SKDWEYDINVVQWSAGLFYGYVTIVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
               L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  211   LCLSIVPLEIFRWVIAGIAGVMSATFVAVNLRAHI  245



>ref|XP_008350748.1| PREDICTED: protein YIPF1 homolog [Malus domestica]
Length=289

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 119/215 (55%), Gaps = 12/215 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +++LQ FPP+   G  AG   P        + P  G  +     W  V S++SY QYF+V
Sbjct  33    DSSLQTFPPSGTQGKIAGGALPPRDADDTFSKPVSGSDEPQQGGWLRVXSVASYKQYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   +PDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  93    DTSDVLERIKDSLLPFSGAFNEKTSBSPDLYGPFWICTTLIFVAAAIGTFVTYVAHKVK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  152   -SKDWEYDINVVQWSAGLFYGYVTIVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
               L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  211   LCLSIVPLEIFRWVIAGIAGVMSATFVAVNLRAHI  245



>ref|XP_009625699.1| PREDICTED: protein YIPF1 homolog [Nicotiana tomentosiformis]
Length=280

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 131/248 (53%), Gaps = 17/248 (7%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNN--GGNAGQGTP-----  962
             ++A D   V   G V     PP Q   + +   ++NLQ FPP++  G  +G   P     
Sbjct  6     YTAIDNQNV--SGSVPAVADPPGQVAVKFT---DSNLQTFPPSSSQGKISGASGPPRDAD  60

Query  961   ---AGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDAN  791
                + P  G  +   + W   F+I++Y  YF+VDT  VL R+  SL P +  F  K   N
Sbjct  61    DTFSKPVSGSDEPQQSGWFRAFTIAAYKPYFDVDTSDVLERIKDSLFPFTGSFSEKTANN  120

Query  790   PDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVP  611
             PDLYG  WI +TLV   +S G   TY+ HK         +D+  ++ +A   YGY+ +VP
Sbjct  121   PDLYGPFWICSTLVFVAASIGTFVTYIAHKLQKKEWN--YDINLVTWSAGLFYGYSTVVP  178

Query  610   LGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFV  431
             L  + +L+Y  + + LV+  CL+ YSLF+FI +  L ++P E ++W+V  + G MS  FV
Sbjct  179   LCLFLVLKYFSAPSGLVQLLCLYGYSLFVFIPALCLSLVPWEIVRWVVAGVAGLMSATFV  238

Query  430   TLNLKSFV  407
              LNLK  +
Sbjct  239   ALNLKHHI  246



>ref|XP_003555600.1| PREDICTED: protein YIPF1 homolog isoform X1 [Glycine max]
 gb|KHN20216.1| Protein YIPF1 like [Glycine soja]
Length=277

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 130/251 (52%), Gaps = 22/251 (9%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGP----  953
             +++ D  +V   G V   + PP++         ++NLQ FPP+       G    P    
Sbjct  6     YTSIDNQKV--SGSVPAVEPPPFK-------FSDSNLQTFPPSGAQGKISGGSRPPRDVD  56

Query  952   -------SEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDA  794
                    S  D  Q  + W   FS++SY  YF+VDT  VL+R+  SL P S  F  K  +
Sbjct  57    DTFSKSGSGSDEPQRQSGWFQAFSLASYKPYFDVDTIDVLDRIKDSLCPFSGTFNEKTAS  116

Query  793   NPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIV  614
             +PDLYG  WI TTL+   +S G   TY+ HK  D      +D+  ++ +A   YGY  +V
Sbjct  117   HPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKDQEWN--YDINLVTWSAGLFYGYVTVV  174

Query  613   PLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAF  434
             PL  Y +L+Y    +  V+  CL+ YSLF+FI +  + ++P+E  +W+V  + G MS  F
Sbjct  175   PLCLYVILKYFSVPSGFVQLLCLYGYSLFVFIPALCMSVVPLEIFRWVVAGVAGFMSATF  234

Query  433   VTLNLKSFVQT  401
             V LNL++ + +
Sbjct  235   VALNLRAHIMS  245



>gb|ACU23194.1| unknown [Glycine max]
Length=279

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 119/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGG---NAGQGTP-------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+       A  G P       + P  G  +     W   F+I++Y  YF+V
Sbjct  33    DSNLQTFPPSGAQGKITAASGPPRDADDSFSKPVSGSDEPQQGGWFQTFTIAAYKPYFDV  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R++ SL P    F  K   +PDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  93    DTSDVLERIIDSLFPFRGSFNEKTATDPDLYGPFWICTTLIFVAASIGTFVTYIAHKLK-  151

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  ++ +A   YGY  IVPL  Y + +Y  + A LV+ +CL+ YSLF+FI +
Sbjct  152   -SKEWDYDINLVTWSAGLFYGYVTIVPLCLYVIPKYFSAPAGLVQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               + ++P++  +W+V  + G MS  FV LNL++ +++
Sbjct  211   LCMSVVPLDIFRWVVAGVAGFMSATFVALNLRAHIKS  247



>ref|XP_009393619.1| PREDICTED: protein YIPF1 homolog [Musa acuminata subsp. malaccensis]
Length=288

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 118/219 (54%), Gaps = 14/219 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNA-----------GQGTPAGPSEGDGQQST-NNWKGVFSISSYTQYF  878
             E+NLQ FPP++                  T + P+ G   +S    W    ++ +Y  YF
Sbjct  37    ESNLQTFPPSSETQGKISVVFRPLSDADDTFSKPASGGSSESQPTGWMQSLTVGAYKPYF  96

Query  877   NVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQ  698
             +VDT  VL R+  SL P   +F  K   NPDLYG  WI TTL+   ++ G   TY+ HK 
Sbjct  97    DVDTSDVLERIRDSLFPFRGNFTEKTADNPDLYGPFWICTTLIFVAAAIGTFVTYVAHKL  156

Query  697   SDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifi  518
                     +D+  ++ +A   YGY   VPLG Y +L+Y    + LV+ WCL+ YSLFIFI
Sbjct  157   EK--KEWDYDINLVNWSAGLFYGYVIFVPLGLYVILKYFSVPSGLVQLWCLYGYSLFIFI  214

Query  517   lssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
              +S L I+PVE  +W+++   G MS AFV +NL + +++
Sbjct  215   PASCLSIVPVEIFRWVIVGGAGFMSAAFVAMNLHTHIKS  253



>ref|XP_003626299.1| Protein YIPF2 [Medicago truncatula]
 gb|AES82517.1| integral membrane Yip1-family protein [Medicago truncatula]
Length=282

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 117/218 (54%), Gaps = 13/218 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------QQSTNNWKGVFSISSYTQYFN  875
             ++NLQ FPP+       G    P + D            +     W   F+I++Y  YF+
Sbjct  35    DSNLQTFPPSQAQGKITGGSRPPRDADDSFSKPASGSSDEPQQGGWLRNFAIATYKPYFD  94

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R++ SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  95    VDTSDVLERIIDSLFPFRGTFNEKTSTNPDLYGPFWICTTLIFVAASMGTFVTYVAHKLK  154

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             D      +D+  ++ +A   YGY  I+PL  Y +L+Y    A LV+ +CL+ YSLF+FI 
Sbjct  155   D--QKWDYDINLVTWSAGLFYGYVTIIPLCLYVILKYFSVPAGLVQLFCLYGYSLFVFIP  212

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
             +  L I+P++  +W++  + G MS  FV LNL++ +++
Sbjct  213   ALCLSIVPLDIFRWVIAGVAGFMSATFVALNLRAHIKS  250



>ref|XP_002512371.1| Protein YIPF1, putative [Ricinus communis]
 gb|EEF49823.1| Protein YIPF1, putative [Ricinus communis]
Length=279

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 119/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++ LQ FPP+   G  +G   P        + P  G  +     W   F+I++Y  YF++
Sbjct  33    DSTLQTFPPSTAQGKISGGSHPPRDADDTFSKPVSGSDEPQQGGWFRTFTIAAYKPYFDI  92

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   ++ G   TY+ HK  +
Sbjct  93    DTTDVLERIKDSLFPFRGTFTEKTAGNPDLYGPFWICTTLIFVAAAIGTFVTYVAHKLQN  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  I+PLG Y +L+Y  + + L + +CL+ YSLF+FI +
Sbjct  153   --KKWEYDINLVTWSAGVFYGYVTIIPLGLYVILKYFSAPSGLAQLFCLYGYSLFVFIPA  210

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L I+P+E  +W++  + G MS  FV LNL++ +++
Sbjct  211   LCLSIVPLEIFRWVIAGVAGFMSATFVALNLRTHIKS  247



>ref|XP_006433316.1| hypothetical protein CICLE_v10002100mg [Citrus clementina]
 ref|XP_006472009.1| PREDICTED: protein YIPF1 homolog [Citrus sinensis]
 gb|ESR46556.1| hypothetical protein CICLE_v10002100mg [Citrus clementina]
 gb|KDO56326.1| hypothetical protein CISIN_1g023517mg [Citrus sinensis]
Length=281

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 121/218 (56%), Gaps = 13/218 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------QQSTNNWKGVFSISSYTQYFN  875
             ++NLQ FPP++      G    PS+ D            +  ++ W   F++++Y  YF+
Sbjct  34    DSNLQTFPPSDTRGKISGVSGPPSDVDDTFSKPASGSSDEAQSSGWFRAFTVAAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL P    F  K   NPDLYG  WI +TL+   +S G   TY+ HK +
Sbjct  94    VDTSDVLERIKDSLFPFRDTFTEKTSDNPDLYGPFWICSTLIFVAASIGTFVTYISHKVN  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             +      +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   NKDWN--YDINLVPWSAGLFYGYVTIVPLCLYIILKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
             +  L ++P+E  +W++  + G MS  FV LNL++ +++
Sbjct  212   ALCLSVVPLEIFRWVIAGVAGFMSATFVALNLRAHIKS  249



>gb|AFK48180.1| unknown [Lotus japonicus]
Length=280

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 116/218 (53%), Gaps = 13/218 (6%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQ-----------QSTNNWKGVFSISSYTQYFN  875
             ++NL+ FPP+       G    P + D             Q    W   F++++Y  YF+
Sbjct  33    DSNLKTFPPSETQGKITGGSRPPRDADDSFSKPVSGSDEPQQQGGWLHTFTVAAYKPYFD  92

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             +D+  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TYL HK  
Sbjct  93    IDSSDVLERIKDSLFPFRGTFNEKTATNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLK  152

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
             D      +D+  ++ +A   YGY  + PL  Y +L+Y  + A+LV+ +CL+ YSLF+FI 
Sbjct  153   DKEWN--YDINLVTWSAGLFYGYVTVAPLCLYVILKYFSAPASLVQLFCLYGYSLFVFIP  210

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
             +  + ++P+E  +W++  + G MS  FV LNL++ + +
Sbjct  211   AMCMSVVPLEIFRWVIAGVAGLMSATFVGLNLRAHIMS  248



>ref|XP_009784693.1| PREDICTED: protein YIPF1 homolog [Nicotiana sylvestris]
Length=280

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/250 (35%), Positives = 131/250 (52%), Gaps = 17/250 (7%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNN--GGNAGQGTP-----  962
             ++A D   V   G V     PP Q   + +   ++NLQ FPP++  G  +G   P     
Sbjct  6     YTAIDNQNV--SGSVPAVADPPGQVAVKFT---DSNLQTFPPSSSQGKISGASGPPRDAD  60

Query  961   ---AGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDAN  791
                + P  G  +   + W   F+I++Y  YF+VDT  VL R+  SL P +  F  K    
Sbjct  61    DTFSKPVSGSDEPQQSGWFRAFTIAAYKPYFDVDTTDVLERIKDSLFPFTGSFSEKTANK  120

Query  790   PDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVP  611
             PDLYG  WI +TLV   +S G   TY+ HK         +D+  ++ +A   YGY+ IVP
Sbjct  121   PDLYGPFWICSTLVFVAASIGTFVTYIAHKLQKKEWN--YDINLVTWSAGLFYGYSTIVP  178

Query  610   LGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFV  431
             L  + +L+Y  + + LV+  CL+ YSLF+FI +  L ++P E ++W+V  + G MS  FV
Sbjct  179   LCLFLVLKYFSAPSGLVQLLCLYGYSLFVFIPALCLSLVPWEIVRWVVAGVAGFMSATFV  238

Query  430   TLNLKSFVQT  401
              LNLK  + +
Sbjct  239   ALNLKHHIAS  248



>ref|XP_009349382.1| PREDICTED: protein YIPF1 homolog [Pyrus x bretschneideri]
Length=280

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 119/215 (55%), Gaps = 12/215 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             +++LQ FPP+   G  AG   P        + P  G  +     W  VFS++SY QYF+V
Sbjct  34    DSSLQTFPPSGTQGKIAGVALPPRDAVDTFSKPVSGPDEPQQGGWLRVFSVASYKQYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P S  F  K   +PDLYG  WI TTL+   ++ G   TY+ HK   
Sbjct  94    DTSDVLERIKDSLLPFSGTFNEKTSNSPDLYGPFWICTTLIFVAAAIGTFVTYVAHKVK-  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
              +    +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  153   -SKDWEYDINVVQWSAGLFYGYVTIVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
               L I+P+E  + ++  + G MS  FV +NL++ +
Sbjct  212   LCLSIVPLEIFRRVIAGIAGVMSATFVAVNLRAHI  246



>ref|XP_006298278.1| hypothetical protein CARUB_v10014343mg [Capsella rubella]
 gb|EOA31176.1| hypothetical protein CARUB_v10014343mg [Capsella rubella]
Length=281

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDSFSGQGNGSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIAS  260



>ref|NP_187179.2| Integral membrane Yip1 family protein [Arabidopsis thaliana]
 dbj|BAC43538.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63894.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74215.1| Integral membrane Yip1 family protein [Arabidopsis thaliana]
Length=281

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDSFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIAS  260



>gb|AAF27034.1|AC009177_24 unknown protein [Arabidopsis thaliana]
Length=280

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  33    ESNLQTFPPSATQGKISGGSNPPRDADDSFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFD  92

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  93    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  152

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  153   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  210

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  211   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIAS  259



>emb|CDM83410.1| unnamed protein product [Triticum aestivum]
 emb|CDM83414.1| unnamed protein product [Triticum aestivum]
Length=290

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 117/225 (52%), Gaps = 22/225 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN--------------------NWKGVFS  902
             E+NLQ FPP+       G    P++ D   S+                      W  +FS
Sbjct  34    ESNLQTFPPSEAKGKISGAYRPPTDSDDTFSSKVGGGGGGRGSDGGSDDAAQGGWFRMFS  93

Query  901   ISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNL  722
             +++Y  YF+VDT  V+ R+  S+ P   +F  K    PDLYG  W  TTL+   +S    
Sbjct  94    VAAYKPYFDVDTSDVVERIWESVFPFRGNFTEKTSDKPDLYGPFWTCTTLIFVAASIATF  153

Query  721   ATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLW  542
              TYL HK      T  +D+  ++ +A   YGY   VPLG Y +L+Y  + A LV+ WCL+
Sbjct  154   VTYLSHKWHKKEWT--YDINLVTWSAGLFYGYVTFVPLGLYVILKYFSAPAGLVQLWCLY  211

Query  541   AYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
              YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   GYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  256



>dbj|BAJ95908.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 117/225 (52%), Gaps = 22/225 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTN--------------------NWKGVFS  902
             E+NLQ FPP+       G    P++ D   S+                      W  +FS
Sbjct  34    ESNLQTFPPSEAKGKISGAYRPPTDSDDTFSSKVGGAGGGRGSDGGSDDAAQGGWFRMFS  93

Query  901   ISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNL  722
             +++Y  YF+VDT  V+ R+  S+ P   +F  K    PDLYG  W  TTL+   +S    
Sbjct  94    VAAYKPYFDVDTSDVVERIWESVFPFRGNFTEKTSDKPDLYGPFWTCTTLIFVAASIATF  153

Query  721   ATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLW  542
              TYL HK      T  +D+  ++ +A   YGY   VPLG Y +L+Y  + A LV+ WCL+
Sbjct  154   VTYLSHKWHKKEWT--YDINLVTWSAGLFYGYVTFVPLGLYVILKYFSAPAGLVQLWCLY  211

Query  541   AYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
              YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   GYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  256



>gb|KHG11614.1| Protein YIPF1 [Gossypium arboreum]
Length=283

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 117/221 (53%), Gaps = 16/221 (7%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG--------------QQSTNNWKGVFSISSYTQ  884
             ++NLQ FPP+       G    P + D               +   + W   F+I++Y  
Sbjct  33    DSNLQTFPPSGAQGKISGGTQPPHDADDTFSKPGGGSQPGSGEPQGSGWFRTFTIAAYKP  92

Query  883   YFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMH  704
             YF+VDT  +++RL  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ H
Sbjct  93    YFDVDTSDIIDRLKESLFPFRGTFTEKTATNPDLYGPFWICTTLIFVAASIGTFVTYIAH  152

Query  703   KQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfi  524
             K         +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+
Sbjct  153   KLKK--KEWDYDINLVTWSAGVFYGYVTVVPLILYVILKYFSAPSGLVQLFCLYGYSLFV  210

Query  523   filssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
             FI +  L ++P+E  +W++  + G MS  FV LNLK+ + +
Sbjct  211   FIPALCLSVVPLEIFRWVIAGVAGFMSATFVALNLKAHINS  251



>ref|XP_010485960.1| PREDICTED: protein YIPF1 homolog isoform X1 [Camelina sativa]
 ref|XP_010485962.1| PREDICTED: protein YIPF1 homolog isoform X1 [Camelina sativa]
 ref|XP_010485963.1| PREDICTED: protein YIPF1 homolog isoform X2 [Camelina sativa]
Length=281

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDSFSGHGNGSTDEPQSGGWLHQFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILLIAS  260



>ref|XP_003569338.1| PREDICTED: protein YIPF1 homolog [Brachypodium distachyon]
Length=289

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 136/254 (54%), Gaps = 23/254 (9%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNN-------------------WKGVFSI  899
             ++NLQ FPP+       G    P++ D   S+                     W  +FS+
Sbjct  34    DSNLQTFPPSEAKGKISGAYRPPTDADDTFSSKTGGGGGGSGGGGSDDAAQGGWFRMFSV  93

Query  898   SSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLA  719
             ++Y  YF+VDT  V+ R+  S+ P   +F  K    PDLYG  W  TTL+   +S     
Sbjct  94    AAYKPYFDVDTSDVVERIWESVFPFRGNFTEKTSEKPDLYGPFWTCTTLIFVAASIATFV  153

Query  718   TYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWA  539
             TYL HK      T  +D+  ++ +A   YGY   VPLG Y +L+Y  + A LV+ WCL+ 
Sbjct  154   TYLSHKWHKKDWT--YDINLVTWSAGLFYGYVTFVPLGLYVILKYFSAPAGLVQLWCLYG  211

Query  538   YslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FV  365
             YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +  +    V I A  F+
Sbjct  212   YSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHILNSGERWVLIVAGIFL  271

Query  364   LQMGLAIFIKMWFF  323
             LQ+GLA+ +K++FF
Sbjct  272   LQLGLAVLLKLYFF  285



>ref|XP_010425236.1| PREDICTED: protein YIPF1 homolog [Camelina sativa]
Length=281

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDSFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + L++ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLIQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIAS  260



>ref|XP_010464047.1| PREDICTED: protein YIPF1 homolog [Camelina sativa]
Length=281

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDSFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTVVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +  L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  212   ALCLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIAS  260



>gb|EPS57867.1| hypothetical protein M569_16950, partial [Genlisea aurea]
Length=269

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 130/238 (55%), Gaps = 14/238 (6%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             E+NLQ FPP+   G  +GQ  P          PS G  +Q    W    +I +Y  YF+V
Sbjct  34    ESNLQSFPPSGSQGKISGQSKPPRDADDTFGKPSSGSDEQQDGGWLRSLTIGAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F+ K   NPDLYG  WI TTL+   +S G   TYL HK  +
Sbjct  94    DTSDVLERIKDSLLPFRGSFYEKTADNPDLYGPFWICTTLIFVAASIGTFVTYLSHKLQN  153

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + L +  CL+ YSLF+FI +
Sbjct  154   --KAWDYDINLVTWSAGLFYGYVSVVPLLLYVVLKYFSAPSGLAQLLCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT--NDLAIVPIAAFVLQMGLAI  344
               L ++P E  +W++  + G MS +FV LNL++ +++       +  A F+LQ+GL++
Sbjct  212   LCLSVVPQEIFRWVLAGVAGGMSASFVALNLRNHIKSAGEKWFFIVAAIFLLQLGLSL  269



>emb|CDP15523.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 119/217 (55%), Gaps = 12/217 (6%)
 Frame = -3

Query  1021  EANLQIFPP---NNGGNAGQGTP-------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP       ++G G P       +  + G        W   FSI++Y  YF+V
Sbjct  34    DSNLQTFPPIAPQGKISSGSGPPRDADDTFSKTASGSDDDQQGGWFRTFSIAAYKPYFDV  93

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  V+ R++ SL P    F  K    PDLYG  WI T+L+   +S G   TYL HK   
Sbjct  94    DTSDVVERIIDSLFPFRGSFNEKTADRPDLYGPFWICTSLIFVAASIGTFVTYLSHKLQ-  152

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  IVP+G Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  153   -KKEWDYDINLVTWSAGLFYGYVTIVPVGLYLILKYFSAPSGLVQLFCLYGYSLFVFIPA  211

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
               L +IP + ++W++  + G MS  FV LNL++ +++
Sbjct  212   LCLSVIPSQIVRWVIAGVAGFMSATFVALNLRNHIKS  248



>ref|NP_001043545.1| Os01g0610500 [Oryza sativa Japonica Group]
 dbj|BAB21287.1| putative integral membrane Yip1 family protein [Oryza sativa 
Japonica Group]
 dbj|BAF05459.1| Os01g0610500 [Oryza sativa Japonica Group]
 gb|EEC71069.1| hypothetical protein OsI_02822 [Oryza sativa Indica Group]
 gb|EEE54971.1| hypothetical protein OsJ_02571 [Oryza sativa Japonica Group]
Length=292

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 115/227 (51%), Gaps = 24/227 (11%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQ----------------------QSTNNWKGV  908
             ++NLQIFPP+       G    P++ D                             W  +
Sbjct  34    DSNLQIFPPSEAKGKISGAYRPPTDADDTFSSSKSGGGGRGGGGGGAGSDDAGQGGWFRM  93

Query  907   FSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFG  728
             FS+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S  
Sbjct  94    FSVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIA  153

Query  727   NLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWC  548
                TYL HK         +D+  ++ +A   YGY   VPLG Y +L+Y  + A LV+ WC
Sbjct  154   TFVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLGLYVILKYFSAPAGLVQLWC  211

Query  547   LWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             L+ YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   LYGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAMNLRAHI  258



>ref|XP_006644358.1| PREDICTED: protein YIPF1 homolog [Oryza brachyantha]
Length=287

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 115/222 (52%), Gaps = 19/222 (9%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQ-----------------QSTNNWKGVFSISS  893
             ++NLQ FPP+       G    P++ D                        W  +FS+++
Sbjct  34    DSNLQTFPPSEAKGKISGAYRPPTDADDSFSSKSAGGRGGGAGSDDAGQGGWFRMFSVAA  93

Query  892   YTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATY  713
             Y +YF+VDT  V+ R+  S+ P    F  K   +PDLYG  W  TTL+   +S     TY
Sbjct  94    YKRYFDVDTSDVVERIWESVFPFRGTFTEKTSEHPDLYGPFWTCTTLIFVAASIATFVTY  153

Query  712   LMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYs  533
             L HK         +D+  ++ +A   YGY   VPLG Y +L+Y  + A LV+ WCL+ YS
Sbjct  154   LSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLGLYVILKYFSAPAGLVQLWCLYGYS  211

Query  532   lfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             LFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   LFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAMNLRAHI  253



>gb|ACN36567.1| unknown [Zea mays]
Length=141

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -3

Query  742  ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
            ++ FGN ATYL+  + D      FDVGY S AA  +Y YA IVP+ F+FL QY GS  +L
Sbjct  2    LAVFGNYATYLVQTKKDM-DIWNFDVGYFSWAASVMYSYAIIVPVVFFFLFQYFGSRPSL  60

Query  562  VRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIV  383
            VRFWC+W YSLFIFI +S LL+IPV F++W++I L G  S  F+TLNLK   +  DL ++
Sbjct  61   VRFWCMWGYSLFIFIPASVLLLIPVGFLQWVIIALAGGASSWFITLNLKECTEGADLMVL  120

Query  382  PIAAFVLQMGLAIFIKMWFF  323
              +A VLQ  LA+FIK++FF
Sbjct  121  MASASVLQFALALFIKVYFF  140



>ref|XP_002319021.2| integral membrane Yip1 family protein [Populus trichocarpa]
 gb|EEE94944.2| integral membrane Yip1 family protein [Populus trichocarpa]
Length=283

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 134/245 (55%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +     W   F++++Y  YF+V
Sbjct  37    DSNLQTFPPSESQGKISGGTRPPRDADDTFSKPVSGSEESQQGGWFRTFTVAAYKPYFDV  96

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K  +NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  97    DTTDVLERIKYSLFPFRGTFTEKTLSNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLQK  156

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  157   KEWN--YDINLVTWSAGVFYGYVLLVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  214

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L +IPVE  +W++  + G MS  FV LNL++ + +       I A  F+LQ+ L++ +
Sbjct  215   LCLSVIPVEIFRWVIAGVAGFMSATFVALNLRAHIMSAGERWFFIVAGIFLLQLALSVVL  274

Query  337   KMWFF  323
             K++ F
Sbjct  275   KLYLF  279



>ref|XP_002884498.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60757.1| integral membrane Yip1 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=283

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 126/231 (55%), Gaps = 16/231 (7%)
 Frame = -3

Query  1021  EANLQIFPPN--NGGNAGQGTPAGPSE----GDGQQSTNN-----WKGVFSISSYTQYFN  875
             E+NLQ FPP+   G  +G   P   ++    G G  ST+      W   F++ +Y  +F+
Sbjct  34    ESNLQTFPPSATQGKISGGSNPPRDADDTFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  V+ RL  SL P    F  K    PDLYG  WI TTL+   +S G   TY+ HK  
Sbjct  94    VDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWK  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifil  515
                    +D+  ++ +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ YSLF+FI 
Sbjct  154   K--QEWNYDINLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIP  211

Query  514   ssf--lliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT-NDLAIVPIAA  371
             +    L ++PVE  +W++  + G MS  FV LNLK+ + +  + +I+ IA+
Sbjct  212   ALVPNLSVVPVEIFRWVIAGVAGFMSATFVALNLKAHINSAGERSILIIAS  262



>gb|AFW83225.1| yip1 domain family member 1 [Zea mays]
Length=291

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 115/226 (51%), Gaps = 23/226 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG---------------------QQSTNNWKGVF  905
             ++NLQ FPP+       G    P++ D                        +   W  +F
Sbjct  34    DSNLQTFPPSEARGKIAGAYRPPTDADDTFSSKGGGAGSGGRGGSAGSDDAAQGGWFRMF  93

Query  904   SISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGN  725
             S+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S   
Sbjct  94    SVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIAT  153

Query  724   LATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCL  545
               TYL HK         +D+  ++ +A   YGY   VPL  Y +L+YL + A LV+ WCL
Sbjct  154   FVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLLLYVILKYLSAPAGLVQLWCL  211

Query  544   WAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             + YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   YGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  257



>ref|XP_004969136.1| PREDICTED: protein YIPF1 homolog [Setaria italica]
Length=292

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 116/227 (51%), Gaps = 24/227 (11%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG----------------------QQSTNNWKGV  908
             ++NLQ FPP++      G    P++ D                         + + W  +
Sbjct  34    DSNLQTFPPSDARGKISGAYRPPTDADDTFSSKAGGGGSGGGRGGSAGSDDAAQSGWFRM  93

Query  907   FSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFG  728
             FS+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S  
Sbjct  94    FSVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIA  153

Query  727   NLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWC  548
                TYL HK         +D+  ++ +A   YGY   VPL  Y +L+Y  + A LV+ WC
Sbjct  154   TFVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLLLYVILKYFSAPAGLVQLWC  211

Query  547   LWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             L+ YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   LYGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  258



>ref|NP_001132699.1| uncharacterized protein LOC100194180 [Zea mays]
 gb|ACG44059.1| yip1 domain family member 1 [Zea mays]
Length=291

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 122/259 (47%), Gaps = 29/259 (11%)
 Frame = -3

Query  1120  FSAADLHRVVSDGRVFQHQQPPYQPLARLSSAPEANLQIFPPNNGGNAGQGTPAGPSEGD  941
             +SA D  R            PP    A      ++NLQ FPP+       G    P++ D
Sbjct  7     YSALDYPRASGSVPAATGTDPPAIRFA------DSNLQTFPPSEARGKISGAYRPPTDAD  60

Query  940   G---------------------QQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPT  824
                                     +   W  +FS+++Y  YF+VDT  V+ R+  S+ P 
Sbjct  61    DTFSSKGGGAGSGGRGGSAGLDDAAQGGWFRMFSVAAYKPYFDVDTSDVVERIWESVFPF  120

Query  823   SADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAA  644
                F  K   NPDLYG  W  TTL+   +S     TYL HK         +D+  ++ +A
Sbjct  121   RGTFTEKTSENPDLYGPFWTCTTLIFVAASIATFVTYLSHKWHKKEWN--YDINLVTWSA  178

Query  643   FSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
                YGY   VPL  Y +L+Y  + A LV+ WCL+ YSLFIFI +S L I+P+E  +W++ 
Sbjct  179   GLFYGYVTFVPLLLYVILKYFSAPAGLVQLWCLYGYSLFIFIPASLLSIVPIEIFRWVIA  238

Query  463   LLTGAMSGAFVTLNLKSFV  407
              + G MS  FV +NL++ +
Sbjct  239   GVAGFMSATFVAVNLRAHI  257



>gb|ACF81650.1| unknown [Zea mays]
 gb|ACF86449.1| unknown [Zea mays]
 gb|ACR38566.1| unknown [Zea mays]
 tpg|DAA58932.1| TPA: yip1 domain family member 1 [Zea mays]
Length=291

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 114/226 (50%), Gaps = 23/226 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG---------------------QQSTNNWKGVF  905
             ++NLQ FPP+       G    P++ D                        +   W  +F
Sbjct  34    DSNLQTFPPSEARGKISGAYRPPTDADDTFSSKGGGAGSGGRGGSAGLDDAAQGGWFRMF  93

Query  904   SISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGN  725
             S+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S   
Sbjct  94    SVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIAT  153

Query  724   LATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCL  545
               TYL HK         +D+  ++ +A   YGY   VPL  Y +L+Y  + A LV+ WCL
Sbjct  154   FVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLLLYVILKYFSAPAGLVQLWCL  211

Query  544   WAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             + YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   YGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  257



>ref|XP_002458142.1| hypothetical protein SORBIDRAFT_03g027600 [Sorghum bicolor]
 gb|EES03262.1| hypothetical protein SORBIDRAFT_03g027600 [Sorghum bicolor]
Length=291

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 114/226 (50%), Gaps = 23/226 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG---------------------QQSTNNWKGVF  905
             ++NLQ FPP+       G    P++ D                        +   W  +F
Sbjct  34    DSNLQTFPPSEARGKIAGAYRPPTDADDTFSSKGGGAGSGGRGSSAGSDDAAQGGWFRMF  93

Query  904   SISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGN  725
             S+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S   
Sbjct  94    SVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIAT  153

Query  724   LATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCL  545
               TYL HK         +D+  ++ +A   YGY   VPL  Y +L+Y  + A LV+ WCL
Sbjct  154   FVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLLLYVILKYFSAPAGLVQLWCL  211

Query  544   WAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             + YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   YGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  257



>gb|ACG28584.1| yip1 domain family member 1 [Zea mays]
Length=291

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 114/226 (50%), Gaps = 23/226 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG---------------------QQSTNNWKGVF  905
             ++NLQ FPP+       G    P++ D                        +   W  +F
Sbjct  34    DSNLQTFPPSEARGKIAGAYRPPTDADDTFSSKGGGAGSGGRGGSAGSDDAAQGGWFRMF  93

Query  904   SISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGN  725
             S+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S   
Sbjct  94    SVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIAT  153

Query  724   LATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCL  545
               TYL HK         +D+  ++ +A   YGY   VPL  Y +L+Y  + A LV+ WCL
Sbjct  154   FVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLLLYVILKYFSAPAGLVQLWCL  211

Query  544   WAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             + YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   YGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  257



>ref|XP_011023592.1| PREDICTED: protein YIPF1 homolog isoform X1 [Populus euphratica]
Length=283

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +     W   F++++Y  YF+V
Sbjct  37    DSNLQTFPPSESQGKISGGTRPPRDADDTFSKPVSGSEESQQGGWFRTFTVAAYKPYFDV  96

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  97    DTIDVLERIKYSLFPFRGTFTEKTVNNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLQK  156

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  157   KEWN--YDINLVTWSAGVFYGYVLLVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  214

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L +IP+E  +W++  + G MS  FV LNL++ + +       I A  F+LQ+ L++ +
Sbjct  215   LCLSVIPLEIFRWVIAGVAGFMSATFVALNLRAHIMSAGERWFFIVAGIFLLQLALSVVL  274

Query  337   KMWFF  323
             K++ F
Sbjct  275   KLYLF  279



>ref|XP_011023593.1| PREDICTED: protein YIPF1 homolog isoform X2 [Populus euphratica]
Length=282

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 133/245 (54%), Gaps = 14/245 (6%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NLQ FPP+   G  +G   P        + P  G  +     W   F++++Y  YF+V
Sbjct  36    DSNLQTFPPSESQGKISGGTRPPRDADDTFSKPVSGSEESQQGGWFRTFTVAAYKPYFDV  95

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  96    DTIDVLERIKYSLFPFRGTFTEKTVNNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLQK  155

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  +VPL  Y +L+Y  + + LV+ +CL+ YSLF+FI +
Sbjct  156   --KEWNYDINLVTWSAGVFYGYVLLVPLVLYVILKYFSAPSGLVQLFCLYGYSLFVFIPA  213

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIAA--FVLQMGLAIFI  338
               L +IP+E  +W++  + G MS  FV LNL++ + +       I A  F+LQ+ L++ +
Sbjct  214   LCLSVIPLEIFRWVIAGVAGFMSATFVALNLRAHIMSAGERWFFIVAGIFLLQLALSVVL  273

Query  337   KMWFF  323
             K++ F
Sbjct  274   KLYLF  278



>gb|EMS51941.1| hypothetical protein TRIUR3_20926 [Triticum urartu]
Length=299

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/234 (34%), Positives = 113/234 (48%), Gaps = 31/234 (13%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGT------PAGPSEGDGQQ---------------------STN  923
             E+NLQ FPP+       G       P  PS G                         +  
Sbjct  34    ESNLQTFPPSEAKGKISGAYRTIPKPPDPSRGCADTFSSKVGGGGGGRGSDGGSDDAAQG  93

Query  922   NWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAA  743
              W  +FS+++Y  YF+VDT  V+ R+  S+ P   +F  K    PDLYG  W  TTL+  
Sbjct  94    GWFRMFSVAAYKPYFDVDTSDVVERIWESVFPFRGNFTEKTSDKPDLYGPFWTCTTLIFV  153

Query  742   ISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANL  563
              +S     TYL HK      T  +D+  ++ +A   YGY   VPLG Y +L+Y  + A L
Sbjct  154   AASIATFVTYLSHKWHKKEWT--YDINLVTWSAGLFYGYVTFVPLGLYVILKYFSAPAGL  211

Query  562   VRFWCLWAYslfif--ilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             V+ WCL+ YSLFIF       L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   VQLWCLYGYSLFIFIPASLDLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  265



>ref|NP_001132111.1| uncharacterized protein LOC100193527 [Zea mays]
 gb|ACF80812.1| unknown [Zea mays]
Length=291

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 114/226 (50%), Gaps = 23/226 (10%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG---------------------QQSTNNWKGVF  905
             ++NLQ FPP+       G    P++ D                        +   W  +F
Sbjct  34    DSNLQTFPPSEARGKIAGAYRPPTDADDTFSSKGGGAGSGGRGGSAGSDDAAQGGWFRMF  93

Query  904   SISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGN  725
             S+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S   
Sbjct  94    SVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIAT  153

Query  724   LATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCL  545
               TYL HK         +D+  ++ +A   YGY   V L  Y +L+YL + A LV+ WCL
Sbjct  154   FVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVSLLLYVILKYLSAPAGLVQLWCL  211

Query  544   WAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
             + YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  212   YGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  257



>gb|KDN64706.1| putative Yip1 domain-containing protein [Colletotrichum sublineola]
Length=288

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 127/235 (54%), Gaps = 12/235 (5%)
 Frame = -3

Query  1003  FPPNNGGNAGQGTPAGPSEG----DGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCS  836
             F  +N  ++  GT   P+ G        S ++ + ++SI+ Y QYF+VDT  VL+R   +
Sbjct  31    FHSSNFQDSAPGTRKAPASGLPPPATASSGSSKRFLWSINFYAQYFDVDTSAVLSRCWAA  90

Query  835   LNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYM  656
             L P  A+F   ++ NPDLYG  WI+TT+V  +   G ++ YL    S+ TS  A+D   +
Sbjct  91    LYP-RANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISQYL---ASNGTSPFAYDFKLL  146

Query  655   SVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFI  479
             S AA  +YGY   VP+  Y  L+Y GS +ANL+  W L+ Y+  I+I  + +   P+  +
Sbjct  147   SGAAGLIYGYTLFVPMALYLALRYFGSESANLLEQWALYGYANLIWIPVALISWSPINIL  206

Query  478   KWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
              W+ + +   +S AF+  NL   +   D     I+ I    L +GL++ IK+ FF
Sbjct  207   NWVFVAVGCGVSVAFLLRNLYPVLSATDHQTSKILLIVVVALHLGLSLAIKILFF  261



>gb|KFH44583.1| hypothetical protein ACRE_046540 [Acremonium chrysogenum ATCC 
11550]
Length=294

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 122/231 (53%), Gaps = 13/231 (6%)
 Frame = -3

Query  997  PNNGGNAG--QGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPT  824
            P+ GG  G   G P   +   G  S    + ++SIS Y Q+F+VDT  VL+R   +L P 
Sbjct  38   PHGGGRKGPSSGLPPPATASSGGSSK---RFLWSISFYAQFFDVDTSAVLSRCWAALYP-  93

Query  823  SADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAA  644
             A+F   ++ NPDLYG  WI+TT+V  +   G ++ YL    +   +  A+D   +S +A
Sbjct  94   RANFLDVLEGNPDLYGPFWIATTVVLILFLGGTVSQYL---SAADKAPFAYDFKLLSGSA  150

Query  643  FSVYGYAFIVPLGFYFLLQYLGSN-ANLVRFWCLWAYslfifilssflliIPVEFIKWIV  467
              VYGY   +P+  +  L+Y GS  ANL+  W L+ Y+  I+I  + +   P+E + W+ 
Sbjct  151  GLVYGYTLFIPVALFLALRYFGSELANLLECWALYGYANLIWIPVALISWSPLEILNWVF  210

Query  466  ILLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
            + +   MS AF+  NL   +   D     I+ I   VL  GLA+ IK+ FF
Sbjct  211  VAVGFGMSVAFLLRNLYPVLSATDRQVSKILLIVVVVLHAGLALAIKILFF  261



>gb|AFW83223.1| hypothetical protein ZEAMMB73_666256 [Zea mays]
Length=200

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 99/168 (59%), Gaps = 2/168 (1%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            +FS+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S 
Sbjct  1    MFSVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASI  60

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFW  551
                TYL HK         +D+  ++ +A   YGY   VPL  Y +L+YL + A LV+ W
Sbjct  61   ATFVTYLSHKWHK--KEWNYDINLVTWSAGLFYGYVTFVPLLLYVILKYLSAPAGLVQLW  118

Query  550  CLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFV  407
            CL+ YSLFIFI +S L I+P+E  +W++  + G MS  FV +NL++ +
Sbjct  119  CLYGYSLFIFIPASLLSIVPIEIFRWVIAGVAGFMSATFVAVNLRAHI  166



>gb|EQB45472.1| Yip1 domain-containing protein [Colletotrichum gloeosporioides 
Cg-14]
Length=288

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 117/207 (57%), Gaps = 8/207 (4%)
 Frame = -3

Query  931  STNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTL  752
            S+++ + ++S++ Y QYF+VDT  VL+R   +L P  A+F   ++ NPDLYG  WI+TT+
Sbjct  58   SSSSKRFLWSLNFYAQYFDVDTSAVLSRCWAALFP-RANFLDVLEGNPDLYGPFWIATTV  116

Query  751  VAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-  575
            V  +   G ++ YL    S  T   A+D   +S AA  +YGY   VP+G Y  L+Y GS 
Sbjct  117  VLILFLGGTISQYL---SSTGTGPFAYDFKLLSGAAGLIYGYTLFVPVGLYVALRYFGSE  173

Query  574  NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTND  395
            +ANL+  W L+ Y+  I+I  + +   P+  + W+ + +   MS AF+  NL   +   D
Sbjct  174  SANLLECWALYGYANLIWIPVALISWSPINILNWVFVAVGCGMSVAFLLRNLYPVLSATD  233

Query  394  L---AIVPIAAFVLQMGLAIFIKMWFF  323
                 I+ I    L +GL++ IK+ FF
Sbjct  234  HQTSKILLIVVVALHLGLSLAIKILFF  260



>ref|XP_007286275.1| yip1 domain family [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA24676.1| yip1 domain family [Colletotrichum gloeosporioides Nara gc5]
Length=288

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 112/200 (56%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++S++ Y QYF+VDT  VL+R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  65   LWSLNFYAQYFDVDTSAVLSRCWAALFP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  123

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL    S  T   A+D   +S AA  +YGY   VP+G Y  L+Y GS +ANL+  
Sbjct  124  GTISQYL---SSTGTGPFAYDFKLLSGAAGLIYGYTLFVPVGLYVALRYFGSESANLLEC  180

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIV  383
            W L+ Y+  I+I  + +   P+  + W+ + +   MS AF+  NL   +   D     I+
Sbjct  181  WALYGYANLIWIPVALISWSPINILNWVFVAVGCGMSVAFLLRNLYPVLSATDHQTSKIL  240

Query  382  PIAAFVLQMGLAIFIKMWFF  323
             I    L +GL++ IK+ FF
Sbjct  241  LIVVVALHLGLSLAIKILFF  260



>emb|CAN77029.1| hypothetical protein VITISV_015340 [Vitis vinifera]
Length=338

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 109/217 (50%), Gaps = 29/217 (13%)
 Frame = -3

Query  1021  EANLQIFPPNN--GGNAGQGTP--------AGPSEGDGQQSTNNWKGVFSISSYTQYFNV  872
             ++NL+ FPP+   G  +G   P        + P  G  +   + W   F++++Y  YF+V
Sbjct  109   DSNLETFPPSEAQGKISGASRPPRDADETFSKPVPGSDESPPSGWLRSFTVAAYKPYFDV  168

Query  871   DTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSD  692
             DT  VL R+  SL P +  F  K+ +NPDLYG  WI TTL+   +S G   TY+ HK   
Sbjct  169   DTSDVLERIKDSLFPFNGSFSEKVASNPDLYGPFWICTTLIFVAASIGTFVTYVAHKIQK  228

Query  691   TTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAYslfifils  512
                   +D+  ++ +A   YGY  I+PLG Y +L+Y  + + L +  CL+ YSL      
Sbjct  229   KEWD--YDINLVTWSAGLFYGYVTIIPLGLYIILKYFSAPSGLAQLLCLYGYSL------  280

Query  511   sflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQT  401
                      FI   +  L G+    FV LNL++ +++
Sbjct  281   ---------FI--FIPALLGSCRQPFVALNLRAHIKS  306



>gb|KID90742.1| Yip1 domain family [Metarhizium guizhouense ARSEF 977]
Length=286

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 126/230 (55%), Gaps = 10/230 (4%)
 Frame = -3

Query  994  NNGGNAGQGTPAG--PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            +   +A +G P+G  P       S+++ + +++IS Y+Q+F+VDT  VL+R   +L P  
Sbjct  36   DTSHSARKGPPSGLPPPATAPSGSSSSKRFLWTISFYSQFFDVDTSAVLSRCWAALYP-R  94

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAF  641
            A+F   ++ NPDLYG  WI+TT+V  +   G ++ +L  +    T+  A+D   +S AA 
Sbjct  95   ANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISDWLSTRG---TAQFAYDFRLLSGAAG  151

Query  640  SVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
             VYGY   +P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+E + W  +
Sbjct  152  LVYGYTLFIPVALFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWTFV  211

Query  463  LLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
             +   +S  F+  NL   +   D     I+ I   +L  GL++ IK+ FF
Sbjct  212  AIGFGLSVVFLLRNLYPVLSATDRQVSKILLIIVVILHAGLSLTIKILFF  261



>gb|KIE01055.1| Yip1 domain family, partial [Metarhizium majus ARSEF 297]
Length=286

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 126/230 (55%), Gaps = 10/230 (4%)
 Frame = -3

Query  994  NNGGNAGQGTPAG--PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            +   +A +G P+G  P       S+++ + +++IS Y+Q+F+VDT  VL+R   +L P  
Sbjct  36   DTSHSARKGPPSGLPPPATAPSGSSSSKRFLWTISFYSQFFDVDTSAVLSRCWAALYP-R  94

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAF  641
            A+F   ++ NPDLYG  WI+TT+V  +   G ++ +L  +    T+  A+D   +S AA 
Sbjct  95   ANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISDWLSTRG---TAQFAYDFRLLSGAAG  151

Query  640  SVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
             VYGY   +P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+E + W  +
Sbjct  152  LVYGYTLFIPVALFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWTFV  211

Query  463  LLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
             +   +S  F+  NL   +   D     I+ I   +L  GL++ IK+ FF
Sbjct  212  AVGFGLSVVFLLRNLYPVLSATDRQVSKILLIIVVILHAGLSLTIKILFF  261



>gb|KEZ40983.1| hypothetical protein SAPIO_CDS7003 [Scedosporium apiospermum]
Length=295

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 117/228 (51%), Gaps = 8/228 (4%)
 Frame = -3

Query  994  NNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSAD  815
            +  G  G+ +P          ST   + +++I  Y Q+F+VDT  VL+R   SL P  A+
Sbjct  50   STAGRKGRSSPGLLPPPATASSTGGKRMLWTIGFYQQFFDVDTTAVLSRCWASLFP-RAN  108

Query  814  FFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSV  635
            F   ++ NPDLYG  WI+TT+V  +   G +  Y+    ++  +  A++   +S AA  +
Sbjct  109  FLDVLEGNPDLYGPFWIATTVVLILFLGGTIGDYM---STEKGTPFAYNFRLLSGAAGLI  165

Query  634  YGYAFIVPLGFYFLLQYLGSN-ANLVRFWCLWAYslfifilssflliIPVEFIKWIVILL  458
            YGY   VP+G + +L+Y GS  ANL+  W L+ Y+  I++  + +   P++ + W  + +
Sbjct  166  YGYTLFVPIGLFLILRYFGSEAANLLECWALYGYANLIWVPVALISWSPIDILNWTFVAI  225

Query  457  TGAMSGAFVTLNLKSFVQTNDLAI---VPIAAFVLQMGLAIFIKMWFF  323
               MS  F+  NL   +   D  I   + I    L  GLA+ +K  FF
Sbjct  226  GFGMSTTFLLRNLYPVLSATDRQISKGLLIVVVALHFGLALTVKFLFF  273



>gb|KID80626.1| Yip1 domain family, partial [Metarhizium brunneum ARSEF 3297]
Length=286

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 126/230 (55%), Gaps = 10/230 (4%)
 Frame = -3

Query  994  NNGGNAGQGTPAG--PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            +   +A +G P+G  P       S+++ + +++IS Y+Q+F+VDT  VL+R   +L P  
Sbjct  36   DTSHSARKGPPSGLPPPVTAPSASSSSKRFLWTISFYSQFFDVDTSAVLSRCWAALYP-R  94

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAF  641
            A+F   ++ NPDLYG  WI+TT+V  +   G ++ +L  +    T+  A+D   +S AA 
Sbjct  95   ANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISDWLSTRG---TAQFAYDFRLLSGAAG  151

Query  640  SVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
             VYGY   +P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+E + W  +
Sbjct  152  LVYGYTLFIPVALFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWTFV  211

Query  463  LLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
             +   +S  F+  NL   +   D     ++ I   +L  GL++ IK+ FF
Sbjct  212  AVGFGLSVVFLLRNLYPVLSATDRQVSKVLLIIVVILHAGLSLTIKILFF  261



>ref|XP_009650037.1| YIPF1 protein [Verticillium dahliae VdLs.17]
 gb|EGY13683.1| YIPF1 protein [Verticillium dahliae VdLs.17]
Length=283

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 126/232 (54%), Gaps = 15/232 (6%)
 Frame = -3

Query  991  NGGNAGQGTPAGPSEG----DGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPT  824
            N  N G G  + PS G        S+++ + +++IS Y Q+F+VDT  VL+R   +L P 
Sbjct  35   NDTNTG-GRKSAPSAGLPPPVTASSSSSKRFLWTISFYAQFFDVDTSAVLSRCWAALYP-  92

Query  823  SADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR-AFDVGYMSVA  647
             A+F   ++ NPDLYG  WI+TT+V  +   G ++ YL    +DT     A+D   +S A
Sbjct  93   RANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISAYL----ADTGDHPFAYDFKLLSGA  148

Query  646  AFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWI  470
            A  +YGY   +P+G +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+  + W+
Sbjct  149  AGLIYGYTLFIPVGLFLALRYFGSESANLLECWALYGYSNLIWIPVALISWSPITILNWV  208

Query  469  VILLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
             + +   +S AF+  NL   +   D     I+ I    L +GL++ IK+ FF
Sbjct  209  FVAVGFGLSVAFLLRNLYPVLSATDRQTSKILLIVVVALHLGLSLTIKILFF  260



>gb|AFK38668.1| unknown [Lotus japonicus]
Length=222

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 87/173 (50%), Gaps = 13/173 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQ-----------QSTNNWKGVFSISSYTQYFN  875
             ++NL+ FPP+       G    P + D             Q    W   F++++Y  YF+
Sbjct  33    DSNLKTFPPSETQGKITGGSRPPRDADDSFSKPVSGSDEPQQQGGWLHTFTVAAYKPYFD  92

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             +D+  VL R+  SL P    F  K   NPDLYG  WI TTL+   +S G   TYL HK  
Sbjct  93    IDSSDVLERINDSLFPFRGTFNEKTATNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLK  152

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAY  536
             D      +D+  ++ +A   YGY  +VPL  Y +L+Y  + A+LV+ +CL+ Y
Sbjct  153   D--KEWNYDINLVTWSAGLFYGYVTVVPLCLYVILKYFSAPASLVQLFCLYGY  203



>emb|CCE31449.1| uncharacterized protein CPUR_05302 [Claviceps purpurea 20.1]
Length=287

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 121/230 (53%), Gaps = 10/230 (4%)
 Frame = -3

Query  994  NNGGNAGQ--GTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            N    AG+   + A P       S    + ++SIS Y+Q+F+VDT  VL R   +L P  
Sbjct  35   NETSQAGRKGASSALPPPVTASSSPPGKRFLWSISFYSQFFDVDTSAVLQRCWAALYP-R  93

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAF  641
            A+F   ++ NPDLYG  WI+TT+V  +   G ++ +L    S  T+  A+D   +S +A 
Sbjct  94   ANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISDWL---SSRGTAQFAYDFRLLSGSAG  150

Query  640  SVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVI  464
             VYGY   +P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+E + W  +
Sbjct  151  LVYGYTLFIPMVLFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWTFV  210

Query  463  LLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
             +   +S AF+  NL   +   D     ++ I   VL  GLAI IK+ FF
Sbjct  211  AVGFGLSVAFLIRNLYPVLSATDRQVSKVLLIIVVVLHAGLAITIKILFF  260



>ref|XP_001224040.1| hypothetical protein CHGG_04826 [Chaetomium globosum CBS 148.51]
 gb|EAQ88207.1| hypothetical protein CHGG_04826 [Chaetomium globosum CBS 148.51]
Length=295

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 110/202 (54%), Gaps = 8/202 (4%)
 Frame = -3

Query  916  KGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAIS  737
            + ++++S Y Q+F+VDT  VL+R   +L P  A+F   +D NPDLYG  WI+TT+V  + 
Sbjct  75   RMLWTMSFYAQFFDVDTSSVLHRCWAALYP-RANFLDVLDGNPDLYGPFWIATTVVLILF  133

Query  736  SFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLV  560
              G ++ Y      +     A+D G +S AA  +YGY F++P+  Y  L+Y GS +ANL+
Sbjct  134  LGGTISDY---SAREGRGEFAYDFGLLSGAAGLIYGYTFVIPVVLYLALRYFGSESANLL  190

Query  559  RFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---A  389
              W L+ Y    +I  + +   P+  + W+ + +   +S AF+  NL   +   D     
Sbjct  191  ECWALYGYGNLTWIPVALISWSPIAILNWVFVGVGFGVSVAFLLRNLYPVLSATDRQTSK  250

Query  388  IVPIAAFVLQMGLAIFIKMWFF  323
            ++ I    L  GLAI IK+ FF
Sbjct  251  VLLILVVALHFGLAIAIKVLFF  272



>ref|XP_007814974.1| Yip1 domain family [Metarhizium acridum CQMa 102]
 gb|EFY85334.1| Yip1 domain family [Metarhizium acridum CQMa 102]
Length=286

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 113/200 (57%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            +++IS Y+Q+F+VDT  VL+R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  66   LWTISFYSQFFDVDTSAVLSRCWAALYP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  124

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ +L  +    T+  A+D   +S AA  VYGY   +P+  +  L+Y GS +ANL+  
Sbjct  125  GTISDWLSTRG---TTQFAYDFRLLSGAAGLVYGYTLFIPVALFLALRYFGSESANLLEC  181

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIV  383
            W L+ YS  I+I  + +   P+E + W  + L   +S AF+  NL   +   D     ++
Sbjct  182  WALYGYSNLIWIPVAIISWSPIEILNWTFVALGFGLSVAFLLRNLYPVLSATDRQVSKVL  241

Query  382  PIAAFVLQMGLAIFIKMWFF  323
             I   +L  GL+I IK+ FF
Sbjct  242  LIIVVILHAGLSITIKILFF  261



>ref|XP_006433315.1| hypothetical protein CICLE_v10002100mg [Citrus clementina]
 gb|ESR46555.1| hypothetical protein CICLE_v10002100mg [Citrus clementina]
Length=252

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 90/173 (52%), Gaps = 13/173 (8%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG-----------QQSTNNWKGVFSISSYTQYFN  875
             ++NLQ FPP++      G    PS+ D            +  ++ W   F++++Y  YF+
Sbjct  34    DSNLQTFPPSDTRGKISGVSGPPSDVDDTFSKPASGSSDEAQSSGWFRAFTVAAYKPYFD  93

Query  874   VDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQS  695
             VDT  VL R+  SL P    F  K   NPDLYG  WI +TL+   +S G   TY+ HK +
Sbjct  94    VDTSDVLERIKDSLFPFRDTFTEKTSDNPDLYGPFWICSTLIFVAASIGTFVTYISHKVN  153

Query  694   DTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCLWAY  536
             +      +D+  +  +A   YGY  IVPL  Y +L+Y  + + LV+ +CL+ Y
Sbjct  154   N--KDWNYDINLVPWSAGLFYGYVTIVPLCLYIILKYFSAPSGLVQLFCLYGY  204



>ref|XP_007918655.1| putative yip1 domain family protein [Togninia minima UCRPA7]
 gb|EON96576.1| putative yip1 domain family protein [Togninia minima UCRPA7]
Length=267

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 123/235 (52%), Gaps = 13/235 (6%)
 Frame = -3

Query  1003  FPPNNGGNAGQGTPAGPSEG----DGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCS  836
             F  +N  +   G    PS G        S++  + ++S+S Y Q+F+VDT  VL R   +
Sbjct  29    FHNSNFADTTPGNRKAPSSGLPLPATASSSSGKRFLWSMSFYAQFFDVDTSAVLTRCWAA  88

Query  835   LNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYM  656
             L P  A+F   ++ NPDLYG  WI+TT+V  +   G +++YL    + T     +D   +
Sbjct  89    LYP-RANFLDVLEGNPDLYGPFWIATTVVFILFLGGTISSYL----ATTGEPFVYDFRLL  143

Query  655   SVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFI  479
             S AA  +YGY  ++P+  Y  L+Y GS +ANL+  W L+ YS  I+I  + +    ++ +
Sbjct  144   SGAAGLIYGYTLVIPVALYLALRYFGSESANLLECWALYGYSNLIWIPVALISWSRIDIL  203

Query  478   KWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
              W+ + +   +S +F+  NL   +   D     I+ I    L +GLAI IK+ FF
Sbjct  204   NWVFVAVGLGLSVSFILRNLYPVLSATDKQTSKILLIVVVALHVGLAIAIKILFF  258



>ref|XP_007779007.1| hypothetical protein W97_02918 [Coniosporium apollinis CBS 100218]
 gb|EON63690.1| hypothetical protein W97_02918 [Coniosporium apollinis CBS 100218]
Length=284

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 117/215 (54%), Gaps = 8/215 (4%)
 Frame = -3

Query  955  PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYG  776
            P     + S  + + ++S++ Y Q+F+VDT+ VL R   ++ P  A F   +D NPDLYG
Sbjct  73   PGGTANRSSGTSKRYLWSLAFYAQFFDVDTNEVLRRCQAAIFP-RARFLDVLDGNPDLYG  131

Query  775  LIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYF  596
              WI+TT+V  +   G ++ YL  K  D     A+D   +S AA  +YGY  I+PLG + 
Sbjct  132  PFWIATTVVMILFLTGTISQYLARKGHDHF---AYDFKLLSGAAGLIYGYTGIIPLGLWG  188

Query  595  LLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNL  419
             L++ GS +ANL+  W L+ Y+  I+I  + +   P+  + ++ + +  A+SG F+  NL
Sbjct  189  ALRWFGSESANLLECWALYGYANLIWIPVALISWSPIPILNYVFVAVGFAISGLFLWRNL  248

Query  418  KSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
               +   D+    I+ I    L  GLAI I + FF
Sbjct  249  YPVLSATDVRTSKILLIVVVALHAGLAIAINVLFF  283



>ref|XP_003660668.1| hypothetical protein MYCTH_2299238 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO55423.1| hypothetical protein MYCTH_2299238 [Myceliophthora thermophila 
ATCC 42464]
Length=291

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 115/215 (53%), Gaps = 8/215 (4%)
 Frame = -3

Query  955  PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYG  776
            P+     Q     + ++++S Y Q+F+VDT  VL+R   +L P  A+F   ++ NPDLYG
Sbjct  59   PATATTSQHGGGKRFLWTLSFYAQFFDVDTTSVLHRCGAALFP-RANFLDVLEGNPDLYG  117

Query  775  LIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYF  596
              WI+TT+V  +   G ++ YL    S    + A+D G +S AA  +YGY F++P+  + 
Sbjct  118  PFWIATTVVLILFLGGTISAYL---ASAGKGSFAYDFGLLSGAAGLIYGYTFVIPVLLFL  174

Query  595  LLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNL  419
             L+Y GS +ANL+  W L+ Y   I+I  + +   P+  + W+ + +   +S  F+  NL
Sbjct  175  ALRYFGSESANLLECWALYGYGNLIWIPVALISWSPITILNWVFVGVGFGLSVVFLLRNL  234

Query  418  KSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
               +   D     ++ I    L  GLA+ IK+ FF
Sbjct  235  YPVLSATDRQTSKVLLILVVALHFGLAVAIKVLFF  269



>ref|XP_003040087.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU34374.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=281

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 120/225 (53%), Gaps = 13/225 (6%)
 Frame = -3

Query  982  NAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRK  803
            + G G PA P+      S+  +  ++S+S Y Q+F+VDT  VL R   +L P  A+F   
Sbjct  46   SGGSGLPA-PATASTSGSSKRF--LWSMSFYAQFFDVDTSAVLARCWAALFP-RANFLDV  101

Query  802  IDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR-AFDVGYMSVAAFSVYGY  626
            ++ NPDLYG  WI+TT+V  +   G ++ YL    SDT      +D   +S AA  +YGY
Sbjct  102  LEGNPDLYGPFWIATTVVLILFLGGTISQYL----SDTGKGPFLYDFKLLSGAAGLIYGY  157

Query  625  AFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGA  449
               +P+G +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+  + W+ + +   
Sbjct  158  TLFIPMGLFLALRYFGSESANLLECWALYGYSNLIWIPVALISSSPISILNWVFVAVGFG  217

Query  448  MSGAFVTLNLKSFVQTNDLAIVPI---AAFVLQMGLAIFIKMWFF  323
            MS AF+  NL   +   D  +  I      VL  GLA+ IK+ FF
Sbjct  218  MSVAFLLRNLYPVLSATDRQVSKILLVVVVVLHAGLALAIKILFF  262



>gb|EHK48329.1| hypothetical protein TRIATDRAFT_238084 [Trichoderma atroviride 
IMI 206040]
Length=281

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 110/200 (55%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++S+S Y Q+F+VDT  VL+R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  67   LWSMSFYAQFFDVDTSAVLSRCWAALFP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  125

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL    +   S  A+D   +S AA  +YGY  ++P+  Y  L+Y GS +ANL+  
Sbjct  126  GTISQYL---STTGKSAFAYDFRLLSGAAGLIYGYTLVIPVALYLALRYFGSESANLLES  182

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPI-  377
            W L+ YS  I+I  + +   P+  + W+ + +   +S  F+  NL   +   D  I  I 
Sbjct  183  WALYGYSNLIWIPVAVISWSPISILNWVFVGVGFGLSVVFLVRNLYPVLSATDQQISKIL  242

Query  376  --AAFVLQMGLAIFIKMWFF  323
                 +L  GLA+ IK+ FF
Sbjct  243  LVVVILLHAGLALTIKILFF  262



>ref|XP_007817296.1| Yip1 domain family [Metarhizium robertsii ARSEF 23]
 gb|EFZ04033.1| Yip1 domain family protein [Metarhizium robertsii ARSEF 23]
 gb|EXV01002.1| Yip1 domain family protein [Metarhizium robertsii]
 gb|KFG84571.1| Yip1 domain family [Metarhizium anisopliae]
 gb|KID61908.1| Yip1 domain family, partial [Metarhizium anisopliae ARSEF 549]
Length=286

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 121/229 (53%), Gaps = 16/229 (7%)
 Frame = -3

Query  997  PNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSA  818
            P +G       P+GPS           + +++IS Y+Q+F+VDT  VL+R   +L P  A
Sbjct  45   PPSGLPPPATAPSGPSSSK--------RFLWTISFYSQFFDVDTSAVLSRCWAALYP-RA  95

Query  817  DFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFS  638
            +F   ++ NPDLYG  WI+TT+V  +   G ++ +L  +    T+  A+D   +S AA  
Sbjct  96   NFLDVLEGNPDLYGPFWIATTVVLILFLGGTISDWLSTRG---TAQFAYDFRLLSGAAGL  152

Query  637  VYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVIL  461
            VYGY   +P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+E + W  + 
Sbjct  153  VYGYTLFIPVALFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWTFVA  212

Query  460  LTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
            +   +S  F+  NL   +   D     ++ I   +L  GL++ IK+ FF
Sbjct  213  VGFGLSVVFLLRNLYPVLSATDRQVSKVLLIIVVILHAGLSLTIKILFF  261



>ref|XP_003348689.1| hypothetical protein SMAC_01712 [Sordaria macrospora k-hell]
 emb|CCC08163.1| unnamed protein product [Sordaria macrospora k-hell]
Length=311

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 110/200 (55%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++++S Y Q+F+VDT  VL R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  83   LWTLSFYAQFFDVDTSSVLQRCWAALYP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  141

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL     +     A+D   +S AA  +YGY F++P+  Y  L+Y GS +ANL+  
Sbjct  142  GTISDYLAQTGKEAF---AYDFRLLSGAAGLIYGYTFVLPVALYLALRYFGSESANLLEC  198

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIA  374
            W L+ Y+  I+I  + +   P+  + W+ + +   +S AF+  NL   +   D     + 
Sbjct  199  WALYGYANLIWIPVALISWSPITILNWVFVGVGFGVSVAFLLRNLYPVLSATDRQTSKVL  258

Query  373  AFV---LQMGLAIFIKMWFF  323
             FV   L  GLA+ IK+ FF
Sbjct  259  LFVVVALHFGLALAIKVLFF  278



>ref|XP_961913.1| hypothetical protein NCU05276 [Neurospora crassa OR74A]
 gb|EAA32677.1| Yip1 domain family [Neurospora crassa OR74A]
 gb|KHE84970.1| Yip1-domain-containing protein [Neurospora crassa]
Length=314

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 110/200 (55%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++++S Y Q+F+VDT  VL R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  86   LWTLSFYAQFFDVDTSSVLQRCWAALYP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  144

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL     +     A+D   +S AA  +YGY F++P+  Y  L+Y GS +ANL+  
Sbjct  145  GTISDYLAQTGKEAF---AYDFRLLSGAAGLIYGYTFVLPVALYLALRYFGSESANLLEC  201

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIA  374
            W L+ YS  I+I  + +   P+  + W+ + +   +S AF+  NL   +   D     + 
Sbjct  202  WALYGYSNLIWIPVALISWSPITILNWVFVGVGFGVSVAFLLRNLYPVLSATDRQTSKVL  261

Query  373  AFV---LQMGLAIFIKMWFF  323
             FV   L  GLA+ IK+ FF
Sbjct  262  LFVVVALHFGLALAIKVLFF  281



>ref|XP_009850098.1| hypothetical protein NEUTE1DRAFT_116694 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO59908.1| hypothetical protein NEUTE1DRAFT_116694 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ74058.1| Yip1-domain-containing protein [Neurospora tetrasperma FGSC 2509]
Length=312

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 110/200 (55%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++++S Y Q+F+VDT  VL R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  84   LWTLSFYAQFFDVDTSSVLQRCWAALYP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  142

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL     +     A+D   +S AA  +YGY F++P+  Y  L+Y GS +ANL+  
Sbjct  143  GTISDYLAQTGKEAF---AYDFRLLSGAAGLIYGYTFVLPVALYLALRYFGSESANLLEC  199

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDLAIVPIA  374
            W L+ YS  I+I  + +   P+  + W+ + +   +S AF+  NL   +   D     + 
Sbjct  200  WALYGYSNLIWIPVALISWSPITILNWVFVGVGFGVSVAFLLRNLYPVLSATDRQTSKVL  259

Query  373  AFV---LQMGLAIFIKMWFF  323
             FV   L  GLA+ IK+ FF
Sbjct  260  LFVVVALHFGLALAIKVLFF  279



>gb|KHN97882.1| Yip1 domain family [Metarhizium album ARSEF 1941]
Length=286

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 127/231 (55%), Gaps = 11/231 (5%)
 Frame = -3

Query  994  NNGGNAG-QGTPAG--PSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPT  824
            N   ++G +G P+G  P       S ++ + +++ S Y+Q+F+VDT  VL+R   +L P 
Sbjct  35   NETSHSGRKGAPSGLPPPATASSGSASSKRFLWTTSFYSQFFDVDTSAVLSRCWAALYP-  93

Query  823  SADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAA  644
             A+F   ++ NPDLYG  WI+TT+V  +   G ++ +L  +    T+  A+D   +S AA
Sbjct  94   RANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISDWLSTRG---TTQFAYDFRLLSGAA  150

Query  643  FSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIV  467
              VYG+   +P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+E + W  
Sbjct  151  GLVYGFTLFIPVALFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWTF  210

Query  466  ILLTGAMSGAFVTLNLKSFVQTNDLAI---VPIAAFVLQMGLAIFIKMWFF  323
            + +   +S AF+  NL   +   D  +   + I   +LQ GL+I IK+ FF
Sbjct  211  VAVGFGLSVAFLLRNLYPVLSATDRQVSKALLILVVILQAGLSITIKILFF  261



>ref|XP_006693433.1| hypothetical protein CTHT_0029780 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS21137.1| hypothetical protein CTHT_0029780 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=295

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 119/220 (54%), Gaps = 15/220 (7%)
 Frame = -3

Query  964  PAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPD  785
            PA  S   G  S    K ++S+S Y Q+F+VDT  VL R   +L P + +F   ++ NPD
Sbjct  63   PATASTSGGGSSK---KFLWSLSFYQQFFDVDTTSVLRRCGAALFPRT-NFLDVLEGNPD  118

Query  784  LYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLG  605
            LYG  WI+TT+V  +   G ++ YL           A+D   +S AA  +YGY FIVP+ 
Sbjct  119  LYGPFWIATTVVLILFLGGTISDYLARSGK---GEFAYDFRLLSGAAGLIYGYTFIVPMV  175

Query  604  FYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVT  428
             +  L+Y GS +ANL+  W L+ Y+  I+I  + +   P+  + W+ + +   +S AF+ 
Sbjct  176  LFLALRYFGSESANLLECWALYGYNNLIWIPVALISWSPIAILNWVFVGVGFGLSVAFLL  235

Query  427  LNLKSFV-----QTNDLAIVPIAAFVLQMGLAIFIKMWFF  323
             NL   +     QT+ + +V + A  L  GLA+ IK+ FF
Sbjct  236  RNLYPVLSATGHQTSKMLLVFVVA--LHFGLAVAIKVLFF  273



>ref|XP_003600768.1| YIPF1-like protein [Medicago truncatula]
Length=260

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 5/95 (5%)
 Frame = -3

Query  1051  QPLARLSSAPEANLQIFPPNNGGNAGQG-----TPAGPSEGDGQQSTNNWKGVFSISSYT  887
             Q  A  +  P AN+Q FPPN+GG  G G     T   P++  GQQ  NNW+G FS+SSYT
Sbjct  166   QKNASNNQVPYANMQTFPPNSGGGGGGGQQGYQTLGTPTDAFGQQPANNWQGFFSVSSYT  225

Query  886   QYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDL  782
             QYFNVDTDVV+NRL+ SLNP   DFF KIDANPDL
Sbjct  226   QYFNVDTDVVVNRLISSLNPVGDDFFAKIDANPDL  260



>ref|XP_001597676.1| hypothetical protein SS1G_01872 [Sclerotinia sclerotiorum 1980]
 gb|EDN96944.1| hypothetical protein SS1G_01872 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=287

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 118/219 (54%), Gaps = 8/219 (4%)
 Frame = -3

Query  967  TPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANP  788
            +P  P+       +N+ + ++S+  Y+Q+F+VDT  VL R   +L P  A+F   ++ NP
Sbjct  47   SPGLPAPATSSGPSNSKRYLWSLHFYSQFFDVDTSSVLARCWAALYP-RANFLDVLEGNP  105

Query  787  DLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPL  608
            DLYG  WI+TT++  +   G ++ YL  +        A+D G +S AA  +YGY F++P+
Sbjct  106  DLYGPFWIATTVIFILFMGGTVSLYLAERGE---GRFAYDFGLLSGAAGLIYGYTFVIPI  162

Query  607  GFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFV  431
              +  L+Y GS +ANL+    L+ YS  ++I  + +    +  + W+ + +   +S AF+
Sbjct  163  LLFLALKYFGSESANLLECAALYGYSNLVWIPVALVSWSSLTIMNWVFVGVGFGLSVAFL  222

Query  430  TLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
              NL   +   D     I+ I   VL  GLAI IK+ FF
Sbjct  223  LRNLYPVLSATDKKTSKILLILVVVLHAGLAIAIKVLFF  261



>gb|EWG47046.1| hypothetical protein FVEG_07285 [Fusarium verticillioides 7600]
Length=282

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 121/231 (52%), Gaps = 16/231 (7%)
 Frame = -3

Query  1000 PPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            PP++GG  G   PA  S G G      W    S++ Y Q+F+VDT  VL+R   +L P  
Sbjct  44   PPSSGG--GLPPPATASTGSGSSKRFLW----SMNFYAQFFDVDTSAVLSRCWAALFP-R  96

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR-AFDVGYMSVAA  644
            A+F   ++ NPDLYG  WI+TT++  +   G ++ Y+    SDT      +D   +S AA
Sbjct  97   ANFLDVLEGNPDLYGPFWIATTVILILFLGGTISQYM----SDTGKGPFLYDFKLLSGAA  152

Query  643  FSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIV  467
              +YGY   +P+  +  L+Y GS +ANL+  W L+ YS  I++  + +   P+  + W+ 
Sbjct  153  GLIYGYTLFIPMALFLALRYFGSESANLLECWALYGYSNLIWVPVALISSSPISILNWVF  212

Query  466  ILLTGAMSGAFVTLNLKSFVQTNDLAIVP---IAAFVLQMGLAIFIKMWFF  323
            + +   +S AF+  NL   +   D  +     +   +L  GLA+ IK+ FF
Sbjct  213  VGVGFGISVAFLLRNLYPVLSATDRQVSKVLLVVVVLLHAGLALAIKILFF  263



>ref|XP_006965951.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47868.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS01966.1| Yip1-domain-containing protein [Trichoderma reesei RUT C-30]
Length=286

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 111/200 (56%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++S+S Y Q+F+VDT  VL+R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  73   LWSMSFYAQFFDVDTSAVLSRCWAALFP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  131

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL    +   S  A+D   +S AA  +YGY  ++P+  +  L+Y GS +ANL+  
Sbjct  132  GTISQYL---STTGKSQFAYDFRLLSGAAGLIYGYTMVIPVALFLALRYFGSESANLLEC  188

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIV  383
            W L+ YS  I+I  + +   P+  + W+ + +   +S  F+  NL   +   D     I+
Sbjct  189  WALYGYSNLIWIPVALISWSPISILNWVFVGVGFGLSVVFLVRNLYPVLSATDRQVSKIL  248

Query  382  PIAAFVLQMGLAIFIKMWFF  323
             +   +L  GL++ IK+ FF
Sbjct  249  LVIVILLHAGLSLTIKILFF  268



>gb|EFQ27592.1| Yip1 domain-containing protein [Colletotrichum graminicola M1.001]
Length=288

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 106/210 (50%), Gaps = 9/210 (4%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLM  842
              +N Q   P        G P   +   G      W    SI+ Y QYF+VDT  VL+R  
Sbjct  33    SSNFQDSAPGARKPPASGLPPPVTASSGSSKRFLW----SINFYAQYFDVDTSAVLSRGW  88

Query  841   CSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVG  662
              +L P  A+F   ++ NPDLYG  WI+TT+V  +   G ++ YL    S+ TS  A+D  
Sbjct  89    AALYPR-ANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISQYL---ASNGTSPFAYDFK  144

Query  661   YMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVE  485
              +S AA  +YGY   VP+  Y  L+Y GS +ANL+  W L+ Y+  I+I  + +   P+ 
Sbjct  145   LLSGAAGLIYGYTLFVPMALYIALRYFGSESANLLEQWALYGYANLIWIPVALISWSPIN  204

Query  484   FIKWIVILLTGAMSGAFVTLNLKSFVQTND  395
              + W+ + +   +S AF+  NL   +   D
Sbjct  205   ILNWVFVAVGCGVSVAFLLRNLYPVLSATD  234



>gb|AFW83224.1| hypothetical protein ZEAMMB73_666256 [Zea mays]
Length=251

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 85/183 (46%), Gaps = 23/183 (13%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDG---------------------QQSTNNWKGVF  905
             ++NLQ FPP+       G    P++ D                        +   W  +F
Sbjct  34    DSNLQTFPPSEARGKIAGAYRPPTDADDTFSSKGGGAGSGGRGGSAGSDDAAQGGWFRMF  93

Query  904   SISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGN  725
             S+++Y  YF+VDT  V+ R+  S+ P    F  K   NPDLYG  W  TTL+   +S   
Sbjct  94    SVAAYKPYFDVDTSDVVERIWESVFPFRGTFTEKTSENPDLYGPFWTCTTLIFVAASIAT  153

Query  724   LATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGSNANLVRFWCL  545
               TYL HK         +D+  ++ +A   YGY   VPL  Y +L+YL + A LV+ WCL
Sbjct  154   FVTYLSHKWHKKEWN--YDINLVTWSAGLFYGYVTFVPLLLYVILKYLSAPAGLVQLWCL  211

Query  544   WAY  536
             + Y
Sbjct  212   YGY  214



>ref|XP_006668176.1| Yip1 domain family [Cordyceps militaris CM01]
 gb|EGX94690.1| Yip1 domain family [Cordyceps militaris CM01]
Length=323

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 121/229 (53%), Gaps = 9/229 (4%)
 Frame = -3

Query  994  NNGGNAGQGTPAGPSEGDGQQSTNNWKG-VFSISSYTQYFNVDTDVVLNRLMCSLNPTSA  818
              GG  G  +P  P       S+ + K  ++S+S Y Q+F+VDT  VL+R   +L P  A
Sbjct  72   TRGGRKGGNSPGLPLPVTASSSSPSSKRFLWSMSFYAQFFDVDTSAVLSRCGAALFP-RA  130

Query  817  DFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFS  638
            +F   +D NPDLYG  WI+TT+V  +   G+++ +L  +    T   A+D   +S AA  
Sbjct  131  NFLDVLDGNPDLYGPFWIATTVVLILFLGGSISQWLATRG---TVPFAYDFRLLSGAAGL  187

Query  637  VYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVIL  461
            VYGY   +P+  +  L+Y GS +ANL+  W L+ Y+  I++  + +   P+  + W  + 
Sbjct  188  VYGYTLFIPVVLFLALRYFGSESANLLECWALYGYANLIWVPVACISWSPISILNWTFVA  247

Query  460  LTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
            +   +S AF+  NL   +   D     ++ I    L +GL++ IK+ FF
Sbjct  248  VGFGLSVAFLLRNLYPVLSATDRQTSKVLLIIVVALHLGLSLAIKILFF  296



>emb|CDP26954.1| Putative protein of unknown function similar to YIP5 og Schizosaccharomyces 
pombe [Podospora anserina S mat+]
Length=314

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 111/202 (55%), Gaps = 8/202 (4%)
 Frame = -3

Query  916  KGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAIS  737
            K ++++  Y+Q+F+VDT  VL R   +L P  A+F   ++ NPDLYG  WI+TT+V  + 
Sbjct  85   KLIWTLGFYSQFFDVDTTSVLQRCWAALFP-RANFLDVLEGNPDLYGPFWIATTVVLILF  143

Query  736  SFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLV  560
              G ++ YL    S      A+D   +S AA  VYGY   +P+  Y  L+Y GS +ANL+
Sbjct  144  LGGTISDYL---ASTGRGNFAYDFRLLSGAAGLVYGYTTFIPVVLYLALRYFGSESANLL  200

Query  559  RFWCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---A  389
              W L+ YS  I+I  + +   P++ + W+ + +   +S AF+  NL   +   D     
Sbjct  201  ECWALYGYSNLIWIPVALVSWSPIKILNWVFVGVGFGVSVAFLLRNLYPVLSATDRQTSK  260

Query  388  IVPIAAFVLQMGLAIFIKMWFF  323
            ++ +A   L  GLAI IK+ FF
Sbjct  261  VLLVAVVALHFGLAIAIKVLFF  282



>gb|EKG14194.1| hypothetical protein MPH_08647 [Macrophomina phaseolina MS6]
Length=310

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 110/200 (55%), Gaps = 7/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++SI  Y Q+F+VDT+ VL R   ++ P  ++F   +D NPDLYG +WI+TT+V  +   
Sbjct  86   LWSIGYYQQFFDVDTNEVLKRCGAAIFPLRSNFLDVLDGNPDLYGPVWIATTVVMILFLT  145

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL     D      +D   +S  A  VYGY  +VP+  + +L++ GS +AN++  
Sbjct  146  GTMSQYLARSGDDHF---PYDFRLLSGGAGLVYGYTLVVPVALWGVLRWFGSESANVLEC  202

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIV  383
            W L+ Y+  I+I  + +   PV+ + ++ + +   +S  F+  NL   +   D+    ++
Sbjct  203  WALYGYANIIWIPVALISWSPVQILNYVFVGVGFGVSAFFLFRNLNPVLSATDVKTSKML  262

Query  382  PIAAFVLQMGLAIFIKMWFF  323
             I    L  GLAI IK+ FF
Sbjct  263  LIVVVALHAGLAIAIKILFF  282



>gb|EHK20260.1| hypothetical protein TRIVIDRAFT_68943 [Trichoderma virens Gv29-8]
Length=282

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 111/200 (56%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++S+S Y Q+F+VDT  VL+R   +L P  A+F   ++ NPDLYG  WI+TT+V  +   
Sbjct  66   LWSMSFYAQFFDVDTSAVLSRCWAALFP-RANFLDVLEGNPDLYGPFWIATTVVLILFLG  124

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G ++ YL    +   S  A+D   +S AA  +YGY  ++P+  +  L+Y GS +ANL+  
Sbjct  125  GTISQYL---STTGKSQFAYDFRLLSGAAGLIYGYTLVIPVALFLALRYFGSESANLLEC  181

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIV  383
            W L+ YS  I+I  + +   P+  + W+ + +   +S  F+  NL   +   D     I+
Sbjct  182  WALYGYSNLIWIPVALISWSPISILNWVFVGVGFGLSVVFLVRNLYPVLSATDRQVSKIL  241

Query  382  PIAAFVLQMGLAIFIKMWFF  323
             +   +L  GL++ IK+ FF
Sbjct  242  LVIVILLHAGLSLTIKILFF  261



>ref|XP_007294574.1| Yip1 domain family [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD15469.1| Yip1 domain family [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=293

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 117/224 (52%), Gaps = 11/224 (5%)
 Frame = -3

Query  982  NAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRK  803
             A  G PA P    G  S+  +  ++++S Y Q+F+VDT  VL R   +L P  A+F   
Sbjct  46   GASPGLPA-PVTASGSGSSKRF--LWTLSFYAQFFDVDTSSVLARCWAALYP-RANFLDV  101

Query  802  IDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYA  623
            ++ NPDLYG +WI+TT+V  +   G ++ YL    S+      +D   +S AA  +YGY 
Sbjct  102  LEGNPDLYGPVWIATTVVFILFLGGTISKYLAETGSE---HFVYDFRLLSGAAGLIYGYT  158

Query  622  FIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIVILLTGAM  446
             I+P+  +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+  +  + + +   +
Sbjct  159  LIIPIALFLALKYFGSESANLLECWALYGYSNLIWIPVALVSWSPITILNLVFVAVGFGL  218

Query  445  SGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGLAIFIKMWFF  323
            S AF+  NL   +   D      + I    L  GLAI IK+ FF
Sbjct  219  SVAFLLRNLYPVLSATDKQTSKALLILVVCLHAGLAIAIKVLFF  262



>ref|XP_003009071.1| YIPF1 [Verticillium alfalfae VaMs.102]
 gb|EEY14645.1| YIPF1 [Verticillium alfalfae VaMs.102]
Length=283

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 120/223 (54%), Gaps = 15/223 (7%)
 Frame = -3

Query  991  NGGNAGQGTPAGPSEG----DGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPT  824
            N  NAG G  + PS G        S+++ + ++++S Y Q+F+VDT  VL+R   +L P 
Sbjct  35   NDTNAG-GRKSAPSAGLPPPVTASSSSSKRFLWTLSFYAQFFDVDTSAVLSRCWAALYP-  92

Query  823  SADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR-AFDVGYMSVA  647
             A+F   ++ NPDLYG  WI+TT+V  +   G ++ YL    +DT     A+D   +S A
Sbjct  93   RANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISAYL----ADTGDHPFAYDFKLLSGA  148

Query  646  AFSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWI  470
            A  +YGY   +P+G +  L+Y GS +ANL+  W L+ YS  I+I  + +   P+  + W+
Sbjct  149  AGLIYGYTLFIPVGLFLALRYFGSESANLLECWALYGYSNLIWIPVALISWSPITILNWV  208

Query  469  VILLTGAMSGAFVTLNLKSFVQTNDL---AIVPIAAFVLQMGL  350
             + +   +S AF+  NL   +   D     I+ I    L +GL
Sbjct  209  FVAVGFGLSVAFLLRNLYPVLSATDRQTSKILLIVVVALHLGL  251



>emb|CCF40575.1| Yip1 domain-containing protein [Colletotrichum higginsianum]
Length=294

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 104/210 (50%), Gaps = 9/210 (4%)
 Frame = -3

Query  1021  EANLQIFPPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLM  842
              +N Q   P        G P   +   G      W    SI+ Y QYF+VDT  VL+R  
Sbjct  33    SSNFQDSTPGARKAPASGLPPPATASPGSSKRFLW----SINFYAQYFDVDTSAVLSRCW  88

Query  841   CSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTRAFDVG  662
              +L P  A+F   ++ NPDLYG  WI+TT+V  +   G ++ YL    S  T   A+D  
Sbjct  89    AALYP-RANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISQYL---ASTGTGPFAYDFK  144

Query  661   YMSVAAFSVYGYAFIVPLGFYFLLQYLGSN-ANLVRFWCLWAYslfifilssflliIPVE  485
              +S AA  +YGY   VP+  Y  L+Y GS+ ANL+  W L+ Y+  I+I  + +   P+ 
Sbjct  145   LLSGAAGLIYGYTLFVPVALYLALRYFGSDSANLLEQWALYGYANLIWIPVALISWSPIN  204

Query  484   FIKWIVILLTGAMSGAFVTLNLKSFVQTND  395
              + W+ + +   +S AF+  NL   +   D
Sbjct  205   ILNWVFVAIGCGLSIAFLLRNLYPVLSATD  234



>emb|CCT72417.1| probable YIP5 Protein that interacts with Rab GTPases involved 
in vesicle-mediated transport [Fusarium fujikuroi IMI 58289]
Length=282

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 121/231 (52%), Gaps = 16/231 (7%)
 Frame = -3

Query  1000 PPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            PP++G  +G   PA  S G G      W    S++ Y Q+F+VDT  VL+R   +L P  
Sbjct  44   PPSSG--SGLPPPATASTGSGSSKRFLW----SMNFYAQFFDVDTSAVLSRCWAALFP-R  96

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR-AFDVGYMSVAA  644
            A+F   ++ NPDLYG  WI+TT++  +   G ++ Y+    SDT      +D   +S AA
Sbjct  97   ANFLDVLEGNPDLYGPFWIATTVILILFLGGTISQYM----SDTGKGPFLYDFKLLSGAA  152

Query  643  FSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIV  467
              +YGY   +P+  +  L+Y GS +ANL+  W L+ YS  I++  + +   P+  + W+ 
Sbjct  153  GLIYGYTLFIPMALFLALRYFGSESANLLECWALYGYSNLIWVPVALISSSPISILNWVF  212

Query  466  ILLTGAMSGAFVTLNLKSFVQTNDLAIVP---IAAFVLQMGLAIFIKMWFF  323
            + +   +S AF+  NL   +   D  +     +   +L  GLA+ IK+ FF
Sbjct  213  VGIGFGISVAFLLRNLYPVLSATDRQVSKVLLVVVVLLHAGLALAIKILFF  263



>ref|XP_003299862.1| hypothetical protein PTT_10950 [Pyrenophora teres f. teres 0-1]
 gb|EFQ92030.1| hypothetical protein PTT_10950 [Pyrenophora teres f. teres 0-1]
Length=268

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 110/200 (55%), Gaps = 8/200 (4%)
 Frame = -3

Query  910  VFSISSYTQYFNVDTDVVLNRLMCSLNPTSADFFRKIDANPDLYGLIWISTTLVAAISSF  731
            ++S++ Y Q F+VDT+ VL R   +L P  A+F   ++ NPDLYG +WI+TT++  +   
Sbjct  41   LWSLNFYAQAFDVDTNEVLRRCTSTLYP-RANFLDVLEGNPDLYGPVWIATTVIVILFLT  99

Query  730  GNLATYLMHKQSDTTSTRAFDVGYMSVAAFSVYGYAFIVPLGFYFLLQYLGS-NANLVRF  554
            G +  YL  K  D     A+D   +S AA  VYGY   VP+G + +L++ GS +ANL+  
Sbjct  100  GTINQYLARKGEDHF---AYDFKLLSGAAGLVYGYTAFVPVGLWGVLKWYGSESANLLEC  156

Query  553  WCLWAYslfifilssflliIPVEFIKWIVILLTGAMSGAFVTLNLKSFVQTNDL---AIV  383
             CL+ Y+  ++I  S +   P   + + V+ L  A S  F+  NL   + T +     I+
Sbjct  157  CCLYGYANLVWIAVSLVAWSPWWIVNYTVVALGLAASAFFLLRNLYPVLSTTEAKTSKIL  216

Query  382  PIAAFVLQMGLAIFIKMWFF  323
             I   VL  G AI IK+ FF
Sbjct  217  LIVVLVLHAGFAIAIKVLFF  236



>gb|EWZ00911.1| hypothetical protein FOYG_00631 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ46942.1| hypothetical protein FOZG_02941 [Fusarium oxysporum Fo47]
 gb|EWZ82111.1| hypothetical protein FOWG_13831 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXL46959.1| hypothetical protein FOCG_11263 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=282

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 121/231 (52%), Gaps = 16/231 (7%)
 Frame = -3

Query  1000 PPNNGGNAGQGTPAGPSEGDGQQSTNNWKGVFSISSYTQYFNVDTDVVLNRLMCSLNPTS  821
            PP++G  +G   PA  S G G      W    S++ Y Q+F+VDT  VL+R   +L P  
Sbjct  44   PPSSG--SGLPPPATASTGSGSSKRFLW----SMNFYAQFFDVDTSAVLSRCWAALFP-R  96

Query  820  ADFFRKIDANPDLYGLIWISTTLVAAISSFGNLATYLMHKQSDTTSTR-AFDVGYMSVAA  644
            A+F   ++ NPDLYG  WI+TT++  +   G ++ Y+    SDT      +D   +S AA
Sbjct  97   ANFLDVLEGNPDLYGPFWIATTVILILFLGGTISQYM----SDTGKGPFLYDFKLLSGAA  152

Query  643  FSVYGYAFIVPLGFYFLLQYLGS-NANLVRFWCLWAYslfifilssflliIPVEFIKWIV  467
              +YGY   +P+  +  L+Y GS +ANL+  W L+ YS  I++  + +   P+  + W+ 
Sbjct  153  GLIYGYTLFIPMALFLALRYFGSESANLLECWALYGYSNLIWVPVALISSSPISILNWVF  212

Query  466  ILLTGAMSGAFVTLNLKSFVQTNDLAIVP---IAAFVLQMGLAIFIKMWFF  323
            + +   +S AF+  NL   +   D  +     +   VL  GLA+ IK+ FF
Sbjct  213  VGIGFGISVAFLLRNLYPVLSATDRQVSKVLLVVVVVLHAGLALAIKILFF  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3097160724972