BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24674_g1_i2 len=815 path=[4713:0-135 1751:136-814]

Length=815
                                                                      Score     E

ref|XP_006343056.1|  PREDICTED: uncharacterized protein LOC102584037    180   1e-50   
ref|XP_004235657.1|  PREDICTED: uncharacterized protein LOC101259623    179   5e-50   
ref|XP_007215625.1|  hypothetical protein PRUPE_ppa007984mg             177   3e-49   
ref|XP_009353638.1|  PREDICTED: uncharacterized protein LOC103944890    177   3e-49   
ref|XP_008228464.1|  PREDICTED: uncharacterized protein LOC103327874    177   3e-49   
ref|XP_008380893.1|  PREDICTED: uncharacterized protein LOC103443777    177   4e-49   
ref|XP_008353706.1|  PREDICTED: uncharacterized protein LOC103417295    176   6e-49   
ref|XP_009377970.1|  PREDICTED: uncharacterized protein LOC103966529    174   4e-48   
ref|XP_009350483.1|  PREDICTED: uncharacterized protein LOC103942006    173   7e-48   
gb|KDO56986.1|  hypothetical protein CISIN_1g025501mg                   166   3e-46   
ref|XP_009591080.1|  PREDICTED: uncharacterized protein LOC104088149    169   4e-46   
gb|KDO56987.1|  hypothetical protein CISIN_1g025501mg                   166   4e-46   
gb|KDO56988.1|  hypothetical protein CISIN_1g025501mg                   166   4e-46   
gb|KDO56989.1|  hypothetical protein CISIN_1g025501mg                   166   4e-46   
gb|KHG07391.1|  Uncharacterized protein F383_33998                      167   1e-45   
ref|XP_009804101.1|  PREDICTED: uncharacterized protein LOC104249382    167   2e-45   
emb|CDO97996.1|  unnamed protein product                                166   3e-45   
ref|XP_006465665.1|  PREDICTED: uncharacterized protein LOC102627...    164   6e-45   
ref|XP_006465664.1|  PREDICTED: uncharacterized protein LOC102627...    165   1e-44   
ref|XP_006426908.1|  hypothetical protein CICLE_v10026017mg             165   1e-44   
ref|XP_002284154.1|  PREDICTED: uncharacterized protein LOC100256719    165   2e-44   Vitis vinifera
ref|XP_010062515.1|  PREDICTED: uncharacterized protein LOC104449...    163   2e-44   
ref|XP_010062514.1|  PREDICTED: uncharacterized protein LOC104449...    164   3e-44   
ref|XP_004141757.1|  PREDICTED: uncharacterized protein LOC101218138    163   4e-44   
gb|KGN45399.1|  hypothetical protein Csa_7G447140                       163   9e-44   
ref|XP_008462182.1|  PREDICTED: uncharacterized protein LOC103500605    160   8e-43   
ref|XP_010535175.1|  PREDICTED: uncharacterized protein LOC104810...    158   3e-42   
ref|XP_010098117.1|  hypothetical protein L484_026251                   155   4e-42   
ref|XP_003529760.2|  PREDICTED: uncharacterized protein LOC100804586    158   5e-42   
ref|XP_007135648.1|  hypothetical protein PHAVU_010G146700g             157   8e-42   
gb|KHN05344.1|  hypothetical protein glysoja_036885                     157   9e-42   
ref|XP_010545681.1|  PREDICTED: uncharacterized protein LOC104817...    156   2e-41   
ref|XP_010545679.1|  PREDICTED: uncharacterized protein LOC104817...    156   2e-41   
ref|XP_003533045.1|  PREDICTED: uncharacterized protein LOC100787313    157   2e-41   
ref|XP_002515993.1|  conserved hypothetical protein                     153   3e-41   Ricinus communis
ref|XP_007024259.1|  Uncharacterized protein TCM_028846                 155   4e-41   
ref|XP_004302875.1|  PREDICTED: uncharacterized protein LOC101309649    155   7e-41   
ref|XP_004516301.1|  PREDICTED: uncharacterized protein LOC101508861    155   9e-41   
ref|XP_010545680.1|  PREDICTED: uncharacterized protein LOC104817...    154   1e-40   
ref|XP_010535176.1|  PREDICTED: uncharacterized protein LOC104810...    153   2e-40   
ref|XP_003626990.1|  hypothetical Protein MTR_8g013830                  150   3e-40   
gb|AET01466.2|  transmembrane protein, putative                         151   5e-40   
ref|XP_006307729.1|  hypothetical protein CARUB_v100096330mg            150   6e-40   
ref|XP_010249579.1|  PREDICTED: uncharacterized protein LOC104592096    152   6e-40   
emb|CDY47818.1|  BnaC06g05250D                                          150   2e-39   
gb|EYU21486.1|  hypothetical protein MIMGU_mgv1a010114mg                150   2e-39   
gb|EYU21487.1|  hypothetical protein MIMGU_mgv1a010114mg                150   2e-39   
ref|XP_002891677.1|  hypothetical protein ARALYDRAFT_474331             147   3e-39   
ref|XP_009147708.1|  PREDICTED: uncharacterized protein LOC103871233    150   3e-39   
emb|CDY60593.1|  BnaA06g01930D                                          150   3e-39   
ref|XP_003626989.1|  hypothetical Protein MTR_8g013830                  150   5e-39   
ref|NP_683420.3|  uncharacterized protein                               149   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462054.1|  PREDICTED: uncharacterized protein LOC104742718    148   2e-38   
ref|XP_010479715.1|  PREDICTED: uncharacterized protein LOC104758531    148   2e-38   
ref|XP_010500809.1|  PREDICTED: uncharacterized protein LOC104778136    147   3e-38   
gb|KFK35806.1|  hypothetical protein AALP_AA4G039200                    147   3e-38   
ref|XP_006392952.1|  hypothetical protein EUTSA_v10011664mg             147   5e-38   
gb|KDO56990.1|  hypothetical protein CISIN_1g025501mg                   143   1e-37   
ref|XP_011072406.1|  PREDICTED: uncharacterized protein LOC105157...    145   2e-37   
ref|XP_011004914.1|  PREDICTED: uncharacterized protein LOC105111...    139   4e-35   
ref|XP_010691438.1|  PREDICTED: uncharacterized protein LOC104904764    131   3e-32   
ref|XP_009394184.1|  PREDICTED: uncharacterized protein LOC103979723    127   1e-30   
ref|XP_009396528.1|  PREDICTED: uncharacterized protein LOC103981...    126   2e-30   
emb|CAN71927.1|  hypothetical protein VITISV_002309                     130   5e-30   Vitis vinifera
ref|XP_009396526.1|  PREDICTED: uncharacterized protein LOC103981...    124   1e-29   
ref|XP_002299728.2|  hypothetical protein POPTR_0001s18790g             121   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010917839.1|  PREDICTED: uncharacterized protein LOC105042365    121   3e-28   
ref|XP_008801479.1|  PREDICTED: uncharacterized protein LOC103715578    119   2e-27   
ref|XP_006853625.1|  hypothetical protein AMTR_s00056p00066830          114   6e-26   
gb|AAD12690.1|  This gene is cut off                                    103   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001764290.1|  predicted protein                                  106   8e-23   
ref|XP_011072407.1|  PREDICTED: uncharacterized protein LOC105157...    104   2e-22   
gb|EMS49205.1|  hypothetical protein TRIUR3_28670                       100   3e-21   
dbj|BAK06544.1|  predicted protein                                    99.4    1e-20   
emb|CDM83956.1|  unnamed protein product                              99.4    1e-20   
ref|XP_010232137.1|  PREDICTED: uncharacterized protein LOC100836152  97.8    3e-20   
ref|XP_001773258.1|  predicted protein                                96.3    4e-20   
gb|ABA93541.1|  expressed protein                                     97.8    8e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52076.1|  hypothetical protein OsJ_33843                        97.8    9e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002962167.1|  hypothetical protein SELMODRAFT_68127            92.0    9e-19   
gb|EMT31930.1|  hypothetical protein F775_06985                       94.0    2e-18   
gb|ACF87716.1|  unknown                                               92.4    2e-18   Zea mays [maize]
ref|XP_002965078.1|  hypothetical protein SELMODRAFT_83794            91.3    2e-18   
ref|NP_001142426.1|  hypothetical protein                             92.8    3e-18   Zea mays [maize]
ref|XP_001779506.1|  predicted protein                                91.3    3e-18   
ref|XP_002456131.1|  hypothetical protein SORBIDRAFT_03g031050        91.7    4e-18   Sorghum bicolor [broomcorn]
ref|XP_001764776.1|  predicted protein                                90.9    7e-18   
ref|XP_006646200.1|  PREDICTED: uncharacterized protein LOC102719639  90.5    1e-17   
ref|XP_001775894.1|  predicted protein                                91.7    4e-17   
gb|EEC68128.1|  hypothetical protein OsI_36040                        87.4    7e-17   Oryza sativa Indica Group [Indian rice]
gb|EEE55171.1|  hypothetical protein OsJ_02996                        87.0    4e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71264.1|  hypothetical protein OsI_03254                        87.0    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_001777016.1|  predicted protein                                81.3    7e-15   
gb|KDO56991.1|  hypothetical protein CISIN_1g025501mg                 53.9    1e-05   



>ref|XP_006343056.1| PREDICTED: uncharacterized protein LOC102584037 [Solanum tuberosum]
Length=333

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L I IN+DNS+ +YWLRLL+REWA FCILSYIGWTFRSKDLAPRFSVMP ++  G+
Sbjct  210  AVAELAILINVDNSIGNYWLRLLVREWAQFCILSYIGWTFRSKDLAPRFSVMPVIKSLGE  269

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNS  479
            R++PPIYSIEMDAATF+DFS H WHIGVPTS  K +L +SVLVV+Q PHV R T   ++S
Sbjct  270  RMVPPIYSIEMDAATFKDFSTHGWHIGVPTSPKKGTLKNSVLVVVQQPHVCRLTPPDTHS  329

Query  480  HSPA  491
             + A
Sbjct  330  QTVA  333



>ref|XP_004235657.1| PREDICTED: uncharacterized protein LOC101259623 [Solanum lycopersicum]
Length=333

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L I IN+D+S+ +YWLRLL+REWA FCILSYIGWTFRSKDLAPRFSVMP ++  G+
Sbjct  210  AVAELAILINVDHSIGNYWLRLLVREWAQFCILSYIGWTFRSKDLAPRFSVMPVIKSLGE  269

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNS  479
             ++PPIYSIEMDAATFRDFS H WHIGVPTS  K +L +SVLVV+QHPHV R T   ++S
Sbjct  270  IMVPPIYSIEMDAATFRDFSTHGWHIGVPTSPKKGTLKNSVLVVVQHPHVCRLTPPDTHS  329

Query  480  HSPA  491
             + A
Sbjct  330  QTVA  333



>ref|XP_007215625.1| hypothetical protein PRUPE_ppa007984mg [Prunus persica]
 gb|EMJ16824.1| hypothetical protein PRUPE_ppa007984mg [Prunus persica]
Length=349

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++ KG+ ++PPI
Sbjct  228  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDLAPRFSVMPTLKSKGELVVPPI  287

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSHS  485
            YSIEMDA TFRDF++HEWHIGVPT+ S  ES  DSVLV+IQHPH YR T+A  +  S
Sbjct  288  YSIEMDAETFRDFTKHEWHIGVPTTPSCDESSMDSVLVIIQHPHAYRPTAAGKSCQS  344



>ref|XP_009353638.1| PREDICTED: uncharacterized protein LOC103944890 [Pyrus x bretschneideri]
Length=342

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+DLAPRFS+MP ++ KG+ ++PPI
Sbjct  220  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDLAPRFSIMPALKSKGELVVPPI  279

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSHS  485
            YSIEMDA TFRDF++HEWHIG+PTS S  ES  DSVLV+IQHPH +R T+A  +S S
Sbjct  280  YSIEMDAETFRDFTKHEWHIGLPTSPSCAESTKDSVLVIIQHPHAHRPTAAGESSQS  336



>ref|XP_008228464.1| PREDICTED: uncharacterized protein LOC103327874 [Prunus mume]
Length=349

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++ KG+ ++PPI
Sbjct  228  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDLAPRFSVMPTLKSKGELVVPPI  287

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSHS  485
            YSIEMDA TFRDF++HEWHIGVPT+ S  ES  DSVLV+IQHPH YR T+A  +  S
Sbjct  288  YSIEMDAETFRDFTKHEWHIGVPTTPSCDESSKDSVLVIIQHPHAYRPTAAGKSCQS  344



>ref|XP_008380893.1| PREDICTED: uncharacterized protein LOC103443777 [Malus domestica]
Length=350

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+DLAPRFS+MP ++ KG+ ++PP+
Sbjct  228  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDLAPRFSIMPALKSKGELVVPPV  287

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSHS  485
            YSIEMDA TFRDF++HEWHIGVPTS S  +S  DSVLV+IQHPH +R T+A  +S S
Sbjct  288  YSIEMDAETFRDFTKHEWHIGVPTSPSCAKSTKDSVLVIIQHPHAHRMTAAGESSQS  344



>ref|XP_008353706.1| PREDICTED: uncharacterized protein LOC103417295 [Malus domestica]
Length=348

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+IN D+S ++YW+RLLIREWA FCI  YIGWTFRS+DLAPRFSVMP   LK K ++PPI
Sbjct  228  IYINTDDSSENYWIRLLIREWAQFCIFVYIGWTFRSRDLAPRFSVMPT--LKSKLVVPPI  285

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSH  482
            YSIEMDA TFRDF++HEWHIGVPTS S +ES  DSVLV+IQHPH YR T+A  +SH
Sbjct  286  YSIEMDAETFRDFTKHEWHIGVPTSPSCEESAKDSVLVIIQHPHAYRTTAAGKSSH  341



>ref|XP_009377970.1| PREDICTED: uncharacterized protein LOC103966529 [Pyrus x bretschneideri]
Length=349

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+D+APRFSVMP ++ KG+ ++PPI
Sbjct  228  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDMAPRFSVMPTLKSKGELVVPPI  287

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSH  482
            YSIEMDA TFRDF++HEWHIGVPTS   +E   DSVLV+IQHPH YR T+A  +SH
Sbjct  288  YSIEMDAETFRDFTKHEWHIGVPTSPPCEEGTKDSVLVIIQHPHAYR-TAARKSSH  342



>ref|XP_009350483.1| PREDICTED: uncharacterized protein LOC103942006 [Pyrus x bretschneideri]
Length=341

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++ KG+ ++PPI
Sbjct  220  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDLAPRFSVMPTLKSKGELVVPPI  279

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSH  482
            YSIE+DA TFRDF++HEWHIGVPTS   +E   DSVLV+IQHPH YR T+A  +SH
Sbjct  280  YSIEVDAETFRDFTKHEWHIGVPTSPPCEEGTKDSVLVIIQHPHAYR-TAARKSSH  334



>gb|KDO56986.1| hypothetical protein CISIN_1g025501mg [Citrus sinensis]
Length=220

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  100  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  159

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  160  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  206



>ref|XP_009591080.1| PREDICTED: uncharacterized protein LOC104088149 [Nicotiana tomentosiformis]
Length=333

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L I IN+DNS+ +YWLRLL+REWA F ILSYIGWTFRSKDLAPRFSVMP ++  G+
Sbjct  210  AVAELAILINVDNSIHNYWLRLLVREWAQFSILSYIGWTFRSKDLAPRFSVMPVIKSIGE  269

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNS  479
            R++PPIYSIEMDA TFRDFS H WHIGVPTSS K SL  SVLVV+QHPH+ R T   ++S
Sbjct  270  RMVPPIYSIEMDATTFRDFSSHGWHIGVPTSSKKGSLKSSVLVVVQHPHMCRLTPLDTHS  329

Query  480  HSPA  491
            H  A
Sbjct  330  HRVA  333



>gb|KDO56987.1| hypothetical protein CISIN_1g025501mg [Citrus sinensis]
Length=247

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  127  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  186

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  187  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  233



>gb|KDO56988.1| hypothetical protein CISIN_1g025501mg [Citrus sinensis]
Length=251

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  131  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  190

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  191  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  237



>gb|KDO56989.1| hypothetical protein CISIN_1g025501mg [Citrus sinensis]
Length=252

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  132  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  191

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  192  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  238



>gb|KHG07391.1| Uncharacterized protein F383_33998 [Gossypium arboreum]
Length=358

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+IN+D+S ++YWLRLL+REWA FCI  YIGWTFRS++LAPRFSVMP ++ K   ++PPI
Sbjct  241  IYINIDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQELAPRFSVMPTLKSKVDLMVPPI  300

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNSHSPA  491
            Y IEMDA TFR+F  HEWHIGVPTS   ES  DSVLV+IQHP+ YR T+ LS+   P 
Sbjct  301  YRIEMDATTFREFQSHEWHIGVPTSVRDESSRDSVLVIIQHPNAYRPTTILSSRKQPV  358



>ref|XP_009804101.1| PREDICTED: uncharacterized protein LOC104249382 [Nicotiana sylvestris]
Length=334

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L I IN+DNS+ +YWLRLL+REWA F I+SYIGWTFRSKDLAPRFSVMP ++  G+
Sbjct  211  AVAELAILINVDNSIHNYWLRLLVREWAQFSIISYIGWTFRSKDLAPRFSVMPVIKSIGE  270

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNS  479
            R++PPIYSIEMDA TF+DFS H WHIGVPTSS K SL  SVLVV+QHPH+ R T   ++S
Sbjct  271  RMVPPIYSIEMDATTFKDFSSHGWHIGVPTSSKKGSLKSSVLVVVQHPHMCRLTPLDTHS  330

Query  480  HSPA  491
            H  A
Sbjct  331  HRVA  334



>emb|CDO97996.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            L IF N+++S+D+YWLRL++REWA FCI+ YIGWTFRSKDLAPRFSVMP ++  G +++P
Sbjct  215  LAIFFNINDSLDNYWLRLVVREWAQFCIILYIGWTFRSKDLAPRFSVMPTLKSTGMKMVP  274

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNSHSPA  491
            PIYSIEMDA TF++F  HEWHIGVPTS  K  L  SVLVVIQHP     TS      SPA
Sbjct  275  PIYSIEMDATTFKEFKSHEWHIGVPTSLQKGRLEGSVLVVIQHPRADTMTSI-----SPA  329

Query  492  LSC*T  506
              C T
Sbjct  330  SLCTT  334



>ref|XP_006465665.1| PREDICTED: uncharacterized protein LOC102627484 isoform X2 [Citrus 
sinensis]
Length=304

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  184  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  243

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  244  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  290



>ref|XP_006465664.1| PREDICTED: uncharacterized protein LOC102627484 isoform X1 [Citrus 
sinensis]
Length=336

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  216  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  276  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  322



>ref|XP_006426908.1| hypothetical protein CICLE_v10026017mg [Citrus clementina]
 gb|ESR40148.1| hypothetical protein CICLE_v10026017mg [Citrus clementina]
Length=336

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  216  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAA F+DFSRHEWHIGVPTS S+ +S  +SVLV+IQHP+ +R
Sbjct  276  YSIEMDAAAFKDFSRHEWHIGVPTSRSHDKSSKESVLVIIQHPNAHR  322



>ref|XP_002284154.1| PREDICTED: uncharacterized protein LOC100256719 [Vitis vinifera]
 emb|CBI36096.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+IN+D+S + YWLRLL+REWA FCI  YIGWTFRS+DLAPRFS MP ++   +  LPP+
Sbjct  220  IYINVDDSSEKYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSFMPSLKSNMEVWLPPV  279

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSHSPA  491
            YSIEMDA  F+DFS HEWHIGVP+S S  E   DSVLVVIQHPH +R TSA  +S +PA
Sbjct  280  YSIEMDATAFKDFSSHEWHIGVPSSLSCNERFNDSVLVVIQHPHAHRPTSATPSSPTPA  338



>ref|XP_010062515.1| PREDICTED: uncharacterized protein LOC104449906 isoform X2 [Eucalyptus 
grandis]
Length=307

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S  +YWLRLL REWA FCI  YIGWTFRS+DLAPRF+VMP V+ KG  ++PPI
Sbjct  188  IYVNIDDSSHNYWLRLLFREWAIFCIFLYIGWTFRSQDLAPRFTVMPSVKSKGSTVIPPI  247

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTS  464
            YSIEMDAATF+DFSR++WHIG+PTS    +S  DS+LVVIQHPH +R T+
Sbjct  248  YSIEMDAATFKDFSRNKWHIGIPTSPCGDKSCGDSILVVIQHPHQHRLTN  297



>ref|XP_010062514.1| PREDICTED: uncharacterized protein LOC104449906 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69659.1| hypothetical protein EUGRSUZ_F03061 [Eucalyptus grandis]
Length=335

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S  +YWLRLL REWA FCI  YIGWTFRS+DLAPRF+VMP V+ KG  ++PPI
Sbjct  216  IYVNIDDSSHNYWLRLLFREWAIFCIFLYIGWTFRSQDLAPRFTVMPSVKSKGSTVIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTS  464
            YSIEMDAATF+DFSR++WHIG+PTS    +S  DS+LVVIQHPH +R T+
Sbjct  276  YSIEMDAATFKDFSRNKWHIGIPTSPCGDKSCGDSILVVIQHPHQHRLTN  325



>ref|XP_004141757.1| PREDICTED: uncharacterized protein LOC101218138 [Cucumis sativus]
 ref|XP_004171298.1| PREDICTED: uncharacterized protein LOC101227476 [Cucumis sativus]
Length=343

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            IF+NMD+SV+ YWLRLL+REWA FCI SYIGW FRS+D+APRFSVMP V+ +  RI+PPI
Sbjct  221  IFLNMDDSVEIYWLRLLVREWAQFCIFSYIGWIFRSQDMAPRFSVMPTVKSENSRIVPPI  280

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTS-ALSN  476
            YSIE+DAAT+R FS H WHIGVPTS S  ES   S++V+IQHP  Y   S ++SN
Sbjct  281  YSIEVDAATYRGFSSHNWHIGVPTSLSRSESANSSIIVIIQHPCAYNANSQSMSN  335



>gb|KGN45399.1| hypothetical protein Csa_7G447140 [Cucumis sativus]
Length=375

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            IF+NMD+SV+ YWLRLL+REWA FCI SYIGW FRS+D+APRFSVMP V+ +  RI+PPI
Sbjct  253  IFLNMDDSVEIYWLRLLVREWAQFCIFSYIGWIFRSQDMAPRFSVMPTVKSENSRIVPPI  312

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTS-ALSN  476
            YSIE+DAAT+R FS H WHIGVPTS S  ES   S++V+IQHP  Y   S ++SN
Sbjct  313  YSIEVDAATYRGFSSHNWHIGVPTSLSRSESANSSIIVIIQHPCAYNANSQSMSN  367



>ref|XP_008462182.1| PREDICTED: uncharacterized protein LOC103500605 [Cucumis melo]
 ref|XP_008462183.1| PREDICTED: uncharacterized protein LOC103500605 [Cucumis melo]
Length=343

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            IF+NMD+SV+ YWLRLL+REWA FCI SYIGW FRS+D+APRFS+MP V+ +  RI+PPI
Sbjct  221  IFLNMDDSVEIYWLRLLVREWAQFCIFSYIGWIFRSQDMAPRFSIMPTVKSENNRIVPPI  280

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTS-ALSN  476
            YSIE+DAAT+R FS H WHIGVPTS S  ES   S++V+IQHP  +   S ++SN
Sbjct  281  YSIEVDAATYRGFSSHNWHIGVPTSLSRSESSNGSIIVIIQHPCAHNANSQSMSN  335



>ref|XP_010535175.1| PREDICTED: uncharacterized protein LOC104810533 isoform X1 [Tarenaya 
hassleriana]
Length=321

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  129  TLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRIL  308
            T+QI++NMDNS  +YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++LK   I+
Sbjct  214  TVQIYMNMDNSTQNYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTLKLKENSII  273

Query  309  PPIYSIEMDAATFRDFSRHEWHIGVPT--SSNKESLTDSVLVVIQHP  443
            PPIYS+EMD  TF +F  HEW+IGVPT  S+ K    +SVLV+IQHP
Sbjct  274  PPIYSVEMDTKTFEEFRSHEWNIGVPTPCSNEKHKDKESVLVIIQHP  320



>ref|XP_010098117.1| hypothetical protein L484_026251 [Morus notabilis]
 gb|EXB74554.1| hypothetical protein L484_026251 [Morus notabilis]
Length=221

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            ++IN+D+S ++YWLRL++REWA  CI SYIGWTFRS+DLAPRFSVMP ++ KG+  +PPI
Sbjct  113  LYINLDDSSENYWLRLVVREWAQLCIFSYIGWTFRSQDLAPRFSVMPTLKPKGETTIPPI  172

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYR  455
            YSIEMDAATF+DFS  EW IGV TSS KES  D V+++IQ PH  +
Sbjct  173  YSIEMDAATFKDFSSREWQIGVATSS-KESSKDPVIIIIQQPHATK  217



>ref|XP_003529760.2| PREDICTED: uncharacterized protein LOC100804586 [Glycine max]
 gb|KHN04232.1| hypothetical protein glysoja_032728 [Glycine soja]
Length=352

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGW FRS+DLAP FSVMP  + KG+ ++PPI
Sbjct  218  IYMNIDDSSENYWLRLLLREWAQFCIFVYIGWIFRSRDLAPNFSVMPTTKCKGETLVPPI  277

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSN-KESLTDSVLVVIQHPHVYR  455
            YSIEMDAATF++FS HEWHIGVPTS++  ES  D VL +IQHP   R
Sbjct  278  YSIEMDAATFKEFSSHEWHIGVPTSTSYDESSRDEVLAIIQHPRAQR  324



>ref|XP_007135648.1| hypothetical protein PHAVU_010G146700g [Phaseolus vulgaris]
 gb|ESW07642.1| hypothetical protein PHAVU_010G146700g [Phaseolus vulgaris]
Length=351

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NM++S ++YWLRLL+REWA FCI  YIGW FRS+DLAP FSVMP  + KG  ++PPI
Sbjct  218  IYMNMNDSSENYWLRLLLREWAQFCIFVYIGWIFRSQDLAPNFSVMPITKCKGDTLVPPI  277

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYRQTSALSNSHSP  488
            YSIEMDA TF++FS HEWHIGVPTS S+ ES T+ V V+IQHP   R     + SHS 
Sbjct  278  YSIEMDAVTFKEFSSHEWHIGVPTSASHVESSTNDVFVIIQHPRAQRLRKLDTFSHSA  335



>gb|KHN05344.1| hypothetical protein glysoja_036885, partial [Glycine soja]
Length=331

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGW FRS+DLAP FSVMP  + KG+ ++PP 
Sbjct  197  IYMNIDDSSENYWLRLLLREWAQFCIFLYIGWIFRSQDLAPNFSVMPTTKCKGETLVPPT  256

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDA TF++FS HEWHIGVPTS S+ ES  D VLV+IQHP   R
Sbjct  257  YSIEMDAGTFKEFSSHEWHIGVPTSTSHDESSKDEVLVIIQHPRAQR  303



>ref|XP_010545681.1| PREDICTED: uncharacterized protein LOC104817969 isoform X3 [Tarenaya 
hassleriana]
Length=317

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  135  QIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPP  314
            QI++NMDNS  +YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++LK   ++PP
Sbjct  214  QIYMNMDNSSQNYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTLKLKENSVIPP  273

Query  315  IYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHP  443
            IYS+EMD  TF++F  HEW+IG+P   + E   DSVLV+IQHP
Sbjct  274  IYSVEMDEKTFKEFRSHEWNIGLPMPCSNERHKDSVLVIIQHP  316



>ref|XP_010545679.1| PREDICTED: uncharacterized protein LOC104817969 isoform X1 [Tarenaya 
hassleriana]
Length=322

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  135  QIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPP  314
            QI++NMDNS  +YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++LK   ++PP
Sbjct  219  QIYMNMDNSSQNYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTLKLKENSVIPP  278

Query  315  IYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHP  443
            IYS+EMD  TF++F  HEW+IG+P   + E   DSVLV+IQHP
Sbjct  279  IYSVEMDEKTFKEFRSHEWNIGLPMPCSNERHKDSVLVIIQHP  321



>ref|XP_003533045.1| PREDICTED: uncharacterized protein LOC100787313 [Glycine max]
Length=352

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGW FRS+DLAP FSVMP  + KG+ ++PP 
Sbjct  218  IYMNIDDSSENYWLRLLLREWAQFCIFLYIGWIFRSQDLAPNFSVMPTTKCKGETLVPPT  277

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS-SNKESLTDSVLVVIQHPHVYR  455
            YSIEMDA TF++FS HEWHIGVPTS S+ ES  D VLV+IQHP   R
Sbjct  278  YSIEMDAGTFKEFSSHEWHIGVPTSTSHDESSKDEVLVIIQHPRAQR  324



>ref|XP_002515993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46413.1| conserved hypothetical protein [Ricinus communis]
Length=225

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I INMD S ++YWLRLL++EWA FCIL YIGWTFRS+ LAPRF VMP V+ +G+ ++PPI
Sbjct  103  IHINMDASSENYWLRLLLKEWAQFCILLYIGWTFRSQVLAPRFFVMPTVKSEGEVLVPPI  162

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNKE-SLTDSVLVVIQHPHVYRQTSALSNSHSP  488
            YS+EMDAATF+DF+  +WHIGVP SS+ + S  +SV+VVIQHPH  R  +A  +S SP
Sbjct  163  YSMEMDAATFKDFNCGQWHIGVPISSSYDRSSLESVVVVIQHPHPLRLPTATISSPSP  220



>ref|XP_007024259.1| Uncharacterized protein TCM_028846 [Theobroma cacao]
 gb|EOY26881.1| Uncharacterized protein TCM_028846 [Theobroma cacao]
Length=339

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMD+  ++YWLRLL+REWA FCI  YIGWTFRS++LA  FSVMP ++     ++PPI
Sbjct  220  IYLNMDDFSENYWLRLLVREWAQFCIFMYIGWTFRSQELATHFSVMPTLKSIVDSMVPPI  279

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPHVYRQTSALSNS  479
            Y IEMDA TFR+F+ HEWHIGVPTS   +S  DSVLV+IQHPH +R TS  + S
Sbjct  280  YRIEMDATTFREFTSHEWHIGVPTSVRDKSPRDSVLVIIQHPHAFRPTSGAAPS  333



>ref|XP_004302875.1| PREDICTED: uncharacterized protein LOC101309649 [Fragaria vesca 
subsp. vesca]
Length=348

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD+S ++YW+RLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++ KG+  + P+
Sbjct  228  IYINMDDSSENYWIRLLVREWAQFCIFVYIGWTFRSRDLAPRFSVMPTLKSKGELAVAPV  287

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHPHVYRQTSALSNSHSPA  491
            YSIEMDA TF+DF+RHEWHIGVPT  S+ ES  DSVLV+IQHP  +  T A +   S +
Sbjct  288  YSIEMDAETFKDFTRHEWHIGVPTLKSSDESSKDSVLVIIQHPRAFTLTKAGAGKSSQS  346



>ref|XP_004516301.1| PREDICTED: uncharacterized protein LOC101508861 [Cicer arietinum]
Length=352

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+ +S +SYWLRLLIREWA FCI  YIGW FRS+DLAP FSVMP  + KG+ ++PPI
Sbjct  214  IYMNICDSSESYWLRLLIREWAQFCIFVYIGWIFRSQDLAPHFSVMPDTKCKGETLMPPI  273

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSS-NKESLTDSVLVVIQHPHVYR  455
            YSIEMDAATF++FS HEWHIG+PTS+ + E   + VLV+IQHP   R
Sbjct  274  YSIEMDAATFKEFSSHEWHIGLPTSTIHDECSKNEVLVIIQHPRAQR  320



>ref|XP_010545680.1| PREDICTED: uncharacterized protein LOC104817969 isoform X2 [Tarenaya 
hassleriana]
Length=318

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++LK   ++PPI
Sbjct  216  IYMNMDNSSQNYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTLKLKENSVIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHP  443
            YS+EMD  TF++F  HEW+IG+P   + E   DSVLV+IQHP
Sbjct  276  YSVEMDEKTFKEFRSHEWNIGLPMPCSNERHKDSVLVIIQHP  317



>ref|XP_010535176.1| PREDICTED: uncharacterized protein LOC104810533 isoform X2 [Tarenaya 
hassleriana]
Length=320

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP ++LK   I+PPI
Sbjct  216  IYMNMDNSTQNYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTLKLKENSIIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT--SSNKESLTDSVLVVIQHP  443
            YS+EMD  TF +F  HEW+IGVPT  S+ K    +SVLV+IQHP
Sbjct  276  YSVEMDTKTFEEFRSHEWNIGVPTPCSNEKHKDKESVLVIIQHP  319



>ref|XP_003626990.1| hypothetical Protein MTR_8g013830 [Medicago truncatula]
Length=244

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+ +S ++YWLRLLIREW  FCI  YIGW FRS+DLAP FSVMP  + KG  ++PPI
Sbjct  103  IYMNIYDSSENYWLRLLIREWTQFCIFVYIGWIFRSQDLAPHFSVMPATKSKGVTLVPPI  162

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSS-NKESLTDSVLVVIQHPHVY--RQTSALSNS  479
            YSIEMDAATF++FS HEWHIG+PTS+ + E   + VLV+IQHP     R+  A+S+S
Sbjct  163  YSIEMDAATFKEFSSHEWHIGLPTSTRHDECSKNEVLVIIQHPSAQRPRKLDAISDS  219



>gb|AET01466.2| transmembrane protein, putative [Medicago truncatula]
Length=273

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+ +S ++YWLRLLIREW  FCI  YIGW FRS+DLAP FSVMP  + KG  ++PPI
Sbjct  132  IYMNIYDSSENYWLRLLIREWTQFCIFVYIGWIFRSQDLAPHFSVMPATKSKGVTLVPPI  191

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSS-NKESLTDSVLVVIQHPHVY--RQTSALSNS  479
            YSIEMDAATF++FS HEWHIG+PTS+ + E   + VLV+IQHP     R+  A+S+S
Sbjct  192  YSIEMDAATFKEFSSHEWHIGLPTSTRHDECSKNEVLVIIQHPSAQRPRKLDAISDS  248



>ref|XP_006307729.1| hypothetical protein CARUB_v100096330mg, partial [Capsella rubella]
 gb|EOA40627.1| hypothetical protein CARUB_v100096330mg, partial [Capsella rubella]
Length=273

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   I+PPI
Sbjct  170  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKHKENTIIPPI  229

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA +F++F  HEW+IGVP   SN E   DSVLV+IQHP
Sbjct  230  YSMEMDAKSFKEFRSHEWNIGVPMPYSNYERPKDSVLVIIQHP  272



>ref|XP_010249579.1| PREDICTED: uncharacterized protein LOC104592096 [Nelumbo nucifera]
Length=354

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+INMD++  +YWLR+L+REWA  CI  YIGWTFRS++ +PRFSVMP ++ KG+R++PPI
Sbjct  222  IYINMDDTSGNYWLRVLVREWAQLCIFFYIGWTFRSQEFSPRFSVMPTLKSKGERMVPPI  281

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSS--NKESLTDSVLVVIQHPHVYRQTSALSNSHSPA  491
            YSIEMDA  F+DF  HEWHIGVPTS   + E    S +V++QHPH Y   S    S S A
Sbjct  282  YSIEMDAEAFKDFRSHEWHIGVPTSCPPDIERSAGSFVVIVQHPHAYLAASRGPTSPSQA  341

Query  492  L  494
            +
Sbjct  342  I  342



>emb|CDY47818.1| BnaC06g05250D [Brassica napus]
Length=320

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   I+PPI
Sbjct  217  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKDNTIIPPI  276

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMD  TF++F  HEW+IGVP   SN E   DSVLV+IQHP
Sbjct  277  YSMEMDEKTFKEFRSHEWNIGVPMPHSNYERQKDSVLVIIQHP  319



>gb|EYU21486.1| hypothetical protein MIMGU_mgv1a010114mg [Erythranthe guttata]
Length=322

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L I I++DNS++++W+RL++REWA F I  YIGW FR +D APRFSVMP    KG+
Sbjct  213  AVSELAILISLDNSLETFWMRLVVREWAQFFIFMYIGWIFRCQDFAPRFSVMPTWSSKGE  272

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPH  446
             I+PPIYSIEMDAATF+ F+ HEWHIGVPT  NK S+ DSV+VVI+ PH
Sbjct  273  TIVPPIYSIEMDAATFKGFTSHEWHIGVPTLLNKGSVKDSVVVVIRQPH  321



>gb|EYU21487.1| hypothetical protein MIMGU_mgv1a010114mg [Erythranthe guttata]
Length=321

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L I I++DNS++++W+RL++REWA F I  YIGW FR +D APRFSVMP    KG+
Sbjct  212  AVSELAILISLDNSLETFWMRLVVREWAQFFIFMYIGWIFRCQDFAPRFSVMPTWSSKGE  271

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHPH  446
             I+PPIYSIEMDAATF+ F+ HEWHIGVPT  NK S+ DSV+VVI+ PH
Sbjct  272  TIVPPIYSIEMDAATFKGFTSHEWHIGVPTLLNKGSVKDSVVVVIRQPH  320



>ref|XP_002891677.1| hypothetical protein ARALYDRAFT_474331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67936.1| hypothetical protein ARALYDRAFT_474331 [Arabidopsis lyrata subsp. 
lyrata]
Length=235

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMD S  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   I+PPI
Sbjct  132  IYMNMDKSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKENTIIPPI  191

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA +F++F   EW+IGVP   SN E   DSVLV+IQHP
Sbjct  192  YSMEMDAKSFKEFRSQEWNIGVPMPYSNYEKQKDSVLVIIQHP  234



>ref|XP_009147708.1| PREDICTED: uncharacterized protein LOC103871233 [Brassica rapa]
Length=319

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   ++PPI
Sbjct  216  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKDNTVIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMD  TF++F  HEW+IGVP   SN E   DSVLV+IQHP
Sbjct  276  YSMEMDEKTFKEFRSHEWNIGVPMPHSNYERQKDSVLVIIQHP  318



>emb|CDY60593.1| BnaA06g01930D [Brassica napus]
Length=320

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   ++PPI
Sbjct  217  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKDNTVIPPI  276

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMD  TF++F  HEW+IGVP   SN E   DSVLV+IQHP
Sbjct  277  YSMEMDEKTFKEFRSHEWNIGVPMPHSNYERQKDSVLVIIQHP  319



>ref|XP_003626989.1| hypothetical Protein MTR_8g013830 [Medicago truncatula]
 gb|AET01465.1| transmembrane protein, putative [Medicago truncatula]
Length=354

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+ +S ++YWLRLLIREW  FCI  YIGW FRS+DLAP FSVMP  + KG  ++PPI
Sbjct  213  IYMNIYDSSENYWLRLLIREWTQFCIFVYIGWIFRSQDLAPHFSVMPATKSKGVTLVPPI  272

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSS-NKESLTDSVLVVIQHPHVY--RQTSALSNS  479
            YSIEMDAATF++FS HEWHIG+PTS+ + E   + VLV+IQHP     R+  A+S+S
Sbjct  273  YSIEMDAATFKEFSSHEWHIGLPTSTRHDECSKNEVLVIIQHPSAQRPRKLDAISDS  329



>ref|NP_683420.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32763.1| uncharacterized protein AT1G52155 [Arabidopsis thaliana]
Length=319

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   I+PPI
Sbjct  216  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKENTIIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA +F++F   EW+IGVP   SN E   DSVLV+IQHP
Sbjct  276  YSMEMDAKSFKEFRSQEWNIGVPMPYSNYEKQKDSVLVIIQHP  318



>ref|XP_010462054.1| PREDICTED: uncharacterized protein LOC104742718 [Camelina sativa]
Length=319

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   ++PPI
Sbjct  216  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKENTMIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA +F++F   EW+IGVP   SN E   DSVLV+IQHP
Sbjct  276  YSMEMDAKSFKEFRSQEWNIGVPMPYSNYEKQKDSVLVIIQHP  318



>ref|XP_010479715.1| PREDICTED: uncharacterized protein LOC104758531 [Camelina sativa]
Length=324

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   ++PPI
Sbjct  221  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKENTMIPPI  280

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA +F++F   EW+IGVP   SN E   DSVLV+IQHP
Sbjct  281  YSMEMDAKSFKEFRSQEWNIGVPMPYSNYEKQKDSVLVIIQHP  323



>ref|XP_010500809.1| PREDICTED: uncharacterized protein LOC104778136 [Camelina sativa]
Length=319

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   ++PPI
Sbjct  216  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKENTMIPPI  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA +F++F   EW+IGVP   SN E   DSVLV+IQHP
Sbjct  276  YSMEMDAKSFKEFRSQEWNIGVPMPYSNYEKQKDSVLVIIQHP  318



>gb|KFK35806.1| hypothetical protein AALP_AA4G039200 [Arabis alpina]
Length=319

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFRS+D+APRFSVMP ++ K   I+PP+
Sbjct  216  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRSQDMAPRFSVMPTLKPKDNAIIPPV  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            YS+EMDA TF++F  +EW+IG+P   +N E   DSVLV+IQHP
Sbjct  276  YSMEMDAKTFKEFRSNEWNIGLPMPYTNYERQKDSVLVIIQHP  318



>ref|XP_006392952.1| hypothetical protein EUTSA_v10011664mg [Eutrema salsugineum]
 gb|ESQ30238.1| hypothetical protein EUTSA_v10011664mg [Eutrema salsugineum]
Length=319

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIGWTFR +D+APRFSVMP ++ K   I+PP+
Sbjct  216  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIGWTFRCQDMAPRFSVMPTLKPKENTIIPPV  275

Query  318  YSIEMDAATFRDFSRHEWHIGVPT-SSNKESLTDSVLVVIQHP  443
            +S+EMDA TF++F   EW+IGVPT  SN +   DSVLV+IQHP
Sbjct  276  FSMEMDAKTFKEFRSREWNIGVPTPCSNYDRQKDSVLVIIQHP  318



>gb|KDO56990.1| hypothetical protein CISIN_1g025501mg [Citrus sinensis]
Length=223

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D+S ++YWLRLL+REWA FCI  YIGWTFRS+DLAPRFSVMP  + KG  ++PPI
Sbjct  132  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSVMPTTKSKGDTMVPPI  191

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNK  401
            YSIEMDAA F+DFSRHEWHIGV +  N 
Sbjct  192  YSIEMDAAAFKDFSRHEWHIGVVSILNS  219



>ref|XP_011072406.1| PREDICTED: uncharacterized protein LOC105157668 isoform X1 [Sesamum 
indicum]
Length=327

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L IFI++DNS +SYW+RLL+REWA F I  YIGW FRS++LAP FSVMP +R  G+
Sbjct  212  AVSELAIFISIDNSFESYWIRLLVREWAQFFIFMYIGWIFRSQELAPGFSVMPALRSDGE  271

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHP  443
            R+ PPIYSIEMDA TF++F   EWHIGVPT   K  L DS+LVVIQ P
Sbjct  272  RV-PPIYSIEMDAQTFKEFRSREWHIGVPTLPQKGGLKDSILVVIQQP  318



>ref|XP_011004914.1| PREDICTED: uncharacterized protein LOC105111304 isoform X1 [Populus 
euphratica]
 ref|XP_011004915.1| PREDICTED: uncharacterized protein LOC105111304 isoform X2 [Populus 
euphratica]
Length=329

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 87/115 (76%), Gaps = 3/115 (3%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I  N+D+S  +YWLRLL+REWA FCI  YIGWTFRS+D APRFSVMP  + KG+  +PPI
Sbjct  217  IHFNVDSSSVNYWLRLLVREWAQFCIFLYIGWTFRSQDWAPRFSVMP--KSKGELTVPPI  274

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSSNKE-SLTDSVLVVIQHPHVYRQTSALSNS  479
            YSIEMDA TF++FS  EWHI VPTS+  +  L+  ++VV+QHPH +R  +  ++S
Sbjct  275  YSIEMDAETFKEFSCREWHIAVPTSATYDRGLSAPIVVVVQHPHPHRLPTRTTSS  329



>ref|XP_010691438.1| PREDICTED: uncharacterized protein LOC104904764 [Beta vulgaris 
subsp. vulgaris]
Length=328

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+IN+D+S ++YW+RLL+REWA +CI  YIGWTFRS+DLAPRFSVMP  + +G  ++PP+
Sbjct  223  IYINVDDSPETYWIRLLVREWAQYCIFLYIGWTFRSQDLAPRFSVMPTEKFQGGVVVPPM  282

Query  318  YSIEMDAATFRDFSRHEWHIGVPTSS-NKESLTDSVLVVIQHP  443
            YSI MDA T++DF   +WHIGV TS     S   S ++++Q P
Sbjct  283  YSIVMDAGTYKDFCCQKWHIGVSTSPLPGRSSKKSAIIIVQQP  325



>ref|XP_009394184.1| PREDICTED: uncharacterized protein LOC103979723 [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++N+D ++D+YW RLL+REWA  CI  YIGWTFR+++++P FSVMP ++ K + +LPP+
Sbjct  226  IYMNVDEALDAYWFRLLVREWAQVCIFLYIGWTFRTQEVSPHFSVMPALKSKKEMVLPPV  285

Query  318  YSIEMDAATFRDFSRHEWHIGVPTS---SNKESLTDSVLVVIQHPHVYRQTS  464
            YSIEM+AA F D +  + H+GVPTS   SN  +    ++V++Q+PH  R TS
Sbjct  286  YSIEMNAADFNDLASQQLHVGVPTSFPYSNCGNSFKPLVVIVQNPHC-RSTS  336



>ref|XP_009396528.1| PREDICTED: uncharacterized protein LOC103981503 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=309

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V    I++N+D ++D+YW RLL+REWA FCI  YIGWTFR+++++  FSVMP ++ K +
Sbjct  167  AVVEAMIYLNVDETLDNYWFRLLVREWAQFCIFLYIGWTFRTQEVSLHFSVMPALKSKME  226

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPT---SSNKESLTDSVLVVIQHPHVYRQ--TS  464
             I+PP+YSIEMDAA F D    E H+GV T   SS  E     VL+++Q+P    +  T 
Sbjct  227  MIVPPVYSIEMDAADFNDLVSQECHVGVQTCFPSSTNEHFFKPVLIIVQNPRSASRHSTE  286

Query  465  ALSNSHS  485
            AL+ S S
Sbjct  287  ALTRSTS  293



>emb|CAN71927.1| hypothetical protein VITISV_002309 [Vitis vinifera]
Length=1107

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  126  FTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRI  305
            +   I+IN+D+S + YWLRLL+REWA FCI  YIGWTFRS+DLAPRFS MP ++   +  
Sbjct  282  YVFLIYINVDDSSEKYWLRLLVREWAQFCIFLYIGWTFRSQDLAPRFSFMPSLKSNMEVW  341

Query  306  LPPIYSIEMDAATFRDFSRHEWHIGV  383
            LPP+YSIEMDA  F+DFS HEWHIGV
Sbjct  342  LPPVYSIEMDATAFKDFSSHEWHIGV  367



>ref|XP_009396526.1| PREDICTED: uncharacterized protein LOC103981503 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=363

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V    I++N+D ++D+YW RLL+REWA FCI  YIGWTFR+++++  FSVMP ++ K +
Sbjct  221  AVVEAMIYLNVDETLDNYWFRLLVREWAQFCIFLYIGWTFRTQEVSLHFSVMPALKSKME  280

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPT---SSNKESLTDSVLVVIQHPHVYRQ--TS  464
             I+PP+YSIEMDAA F D    E H+GV T   SS  E     VL+++Q+P    +  T 
Sbjct  281  MIVPPVYSIEMDAADFNDLVSQECHVGVQTCFPSSTNEHFFKPVLIIVQNPRSASRHSTE  340

Query  465  ALSNSHS  485
            AL+ S S
Sbjct  341  ALTRSTS  347



>ref|XP_002299728.2| hypothetical protein POPTR_0001s18790g [Populus trichocarpa]
 gb|EEE84533.2| hypothetical protein POPTR_0001s18790g [Populus trichocarpa]
Length=305

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I  N+D S  +YWLRLL+REWA FCI  YIGWTFRS+D APRFSVMP  + KG+ ++PPI
Sbjct  217  IHFNVDTSSVNYWLRLLVREWAQFCIFLYIGWTFRSQDRAPRFSVMP--KSKGELMVPPI  274

Query  318  YSIEMDAATFRDFSRHEWHIGV  383
            YSIEMDA TF++FS  EWHIGV
Sbjct  275  YSIEMDAETFKEFSCREWHIGV  296



>ref|XP_010917839.1| PREDICTED: uncharacterized protein LOC105042365 [Elaeis guineensis]
Length=365

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 3/112 (3%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  + ++IN + + D+YW RLL+REW  FCI+ YIGWTFR+K+ +P FSVMP ++   +
Sbjct  220  AVLEILVYINANETPDNYWFRLLVREWVQFCIILYIGWTFRTKEASPHFSVMPILKSNLE  279

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPT---SSNKESLTDSVLVVIQHPH  446
              +PP+Y IE+DAA F +    EWH+GVPT   SS+     + +LV++Q+PH
Sbjct  280  MTVPPVYRIEVDAADFNNLVFQEWHVGVPTTLPSSHSGKTVNPLLVIVQNPH  331



>ref|XP_008801479.1| PREDICTED: uncharacterized protein LOC103715578 [Phoenix dactylifera]
Length=365

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  + +++N + + D+YW RLL+REW  F I  YIGWTFR+K+ +P FSVMP ++   +
Sbjct  220  AVLEILVYMNANETPDNYWFRLLVREWVQFGIFLYIGWTFRTKEASPHFSVMPILKSNLE  279

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPT---SSNKESLTDSVLVVIQHP  443
              +PP+YSIEMDAA F +    EWH+GVPT   SS+ E   + +LV++Q+P
Sbjct  280  TTVPPVYSIEMDAADFNNLVSQEWHVGVPTTLPSSHCEKTVNPLLVIVQNP  330



>ref|XP_006853625.1| hypothetical protein AMTR_s00056p00066830 [Amborella trichopoda]
 gb|ERN15092.1| hypothetical protein AMTR_s00056p00066830 [Amborella trichopoda]
Length=301

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I+IN   + D+YW+RLLIREW+ FCI  Y+GW FRS++++P F V+P V  KG++ +P I
Sbjct  154  IYINTGGATDNYWIRLLIREWSQFCIFFYVGWIFRSQEVSPGFHVVPTVNSKGRKTIPTI  213

Query  318  YSIEMDAATFRDFSRHEWHIGVP  386
            YSIEMD A F +   HEW IGVP
Sbjct  214  YSIEMDEADFSNLDFHEWQIGVP  236



>gb|AAD12690.1| This gene is cut off, partial [Arabidopsis thaliana]
Length=200

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 4/73 (5%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPI  317
            I++NMDNS  +YWLRLLIREWA FCI  YIG    S+D+APRFSVMP ++ K   I+PPI
Sbjct  132  IYMNMDNSSQNYWLRLLIREWAQFCIFLYIG----SQDMAPRFSVMPTLKPKENTIIPPI  187

Query  318  YSIEMDAATFRDF  356
            YS+EMDA +F++F
Sbjct  188  YSMEMDAKSFKEF  200



>ref|XP_001764290.1| predicted protein [Physcomitrella patens]
 gb|EDQ70844.1| predicted protein [Physcomitrella patens]
Length=466

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +3

Query  153  DNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSIEM  332
            D     YW+RLL+RE A   + SYIGWTFRS++L P F+V+P     G+RILPPIYS+E+
Sbjct  230  DGMAYEYWMRLLVRELAEMGLFSYIGWTFRSRELTPFFTVIPTQLSSGQRILPPIYSVEI  289

Query  333  DAATFRDFSRHEWHIGVPTSSNKESLTDS-VLVVIQHP  443
            +   F +    EWHIGVPTS +K   T   +LV++Q+P
Sbjct  290  NEKQFNNLDEKEWHIGVPTSISKNGGTHRPMLVIVQNP  327



>ref|XP_011072407.1| PREDICTED: uncharacterized protein LOC105157668 isoform X2 [Sesamum 
indicum]
Length=308

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 67/108 (62%), Gaps = 20/108 (19%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  L IFI++DNS +SYW+RLL+REWA F I  YIGW FRS++LAP FSVMP +R  G+
Sbjct  212  AVSELAIFISIDNSFESYWIRLLVREWAQFFIFMYIGWIFRSQELAPGFSVMPALRSDGE  271

Query  300  RILPPIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHP  443
            R+ PPIYSI                   PT   K  L DS+LVVIQ P
Sbjct  272  RV-PPIYSI-------------------PTLPQKGGLKDSILVVIQQP  299



>gb|EMS49205.1| hypothetical protein TRIUR3_28670 [Triticum urartu]
Length=358

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    VMP ++   +  +P
Sbjct  197  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVMPLMKSNWEITMP  256

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDS-VLVVIQHPHVYRQTSALSNSHSP  488
            PIYS+EMDAA FR     +WH+GV TS      +   +LV++Q+P      +A+++ + P
Sbjct  257  PIYSVEMDAADFRGLVSDQWHVGVRTSHADACYSSQPLLVLVQNPSPKVSRAAVASGYLP  316



>dbj|BAK06544.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D++W R+L+REW  FCI  YIGW FR  + +    VMP ++      +P
Sbjct  216  IMVYMRADDTPDNFWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVMPLMKSNWTIAMP  275

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESL-TDSVLVVIQHPHVYRQTSALSNSHS  485
            PIYS+EMDAA FR     EWH+GV TS       ++ +LV++Q+P      +A+++  S
Sbjct  276  PIYSVEMDAADFRGLVSDEWHVGVRTSRADACYSSEPLLVLVQNPSPKVSRAAIASGFS  334



>emb|CDM83956.1| unnamed protein product [Triticum aestivum]
Length=334

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 72/119 (61%), Gaps = 1/119 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    VMP ++   +  +P
Sbjct  216  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVMPLMKSNWEIAMP  275

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDS-VLVVIQHPHVYRQTSALSNSHS  485
            PIYS+EMDAA FR     +WH+GV TS      +   +LV++Q+P      +A+++  S
Sbjct  276  PIYSVEMDAADFRGLVSDQWHVGVRTSHADACYSSQPLLVLVQNPSPKVSRAAVASGFS  334



>ref|XP_010232137.1| PREDICTED: uncharacterized protein LOC100836152 [Brachypodium 
distachyon]
Length=330

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    VMP ++   +  +P
Sbjct  216  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLNLPVMPLMKSNWEITMP  275

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDS-VLVVIQHP  443
            PIYS+EMDAA FR     +WH+GV ++ +    +   +LV++Q+P
Sbjct  276  PIYSVEMDAADFRGLVSDQWHVGVRSAHDDSCCSSQPLLVLVQNP  320



>ref|XP_001773258.1| predicted protein [Physcomitrella patens]
 gb|EDQ61948.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  153  DNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSIEM  332
            D + + YW+RLL+RE +   I  YIGWTFRS++L P F+V+P +   G+RILPPIYS+E+
Sbjct  137  DGTANEYWMRLLMRECSEIVIFFYIGWTFRSRELTPFFTVIPTLHSSGQRILPPIYSVEI  196

Query  333  DAATFRDFSRHEWHIGV  383
            +   F + +  EWHIGV
Sbjct  197  NEKQFNNLNHKEWHIGV  213



>gb|ABA93541.1| expressed protein [Oryza sativa Japonica Group]
Length=443

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D + D+YW R+L+REW  FCI  YIGW FR  + +    V+P ++   +  +P
Sbjct  326  IMVYMRADGTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVVPLMKSTWEIAMP  385

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESL-TDSVLVVIQHPHVYRQTSALSN  476
            PIYS+EMDAA F+      WH+GV TS N     +  +LV++Q+P     T+A ++
Sbjct  386  PIYSVEMDAADFKGLVSDHWHVGVRTSHNNSGCPSQPLLVLVQNPSPKVSTAATAS  441



>gb|EEE52076.1| hypothetical protein OsJ_33843 [Oryza sativa Japonica Group]
Length=449

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D + D+YW R+L+REW  FCI  YIGW FR  + +    V+P ++   +  +P
Sbjct  332  IMVYMRADGTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVVPLMKSTWEIAMP  391

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESL-TDSVLVVIQHPHVYRQTSALSN  476
            PIYS+EMDAA F+      WH+GV TS N     +  +LV++Q+P     T+A ++
Sbjct  392  PIYSVEMDAADFKGLVSDHWHVGVRTSHNNSGCPSQPLLVLVQNPSPKVSTAATAS  447



>ref|XP_002962167.1| hypothetical protein SELMODRAFT_68127, partial [Selaginella moellendorffii]
 gb|EFJ37427.1| hypothetical protein SELMODRAFT_68127, partial [Selaginella moellendorffii]
Length=213

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +3

Query  153  DNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSIEM  332
            D   + YW+RLL+REW    I SYIGWTFR+++  P F+V+P +    + +LPPIYSIEM
Sbjct  137  DGVANEYWMRLLVREWTEIGIFSYIGWTFRARETTPFFTVIPTLHSGRESMLPPIYSIEM  196

Query  333  DAATFRDFSRHEWHIGV  383
            +   F   S  EWHIGV
Sbjct  197  NEKDFNTLSFKEWHIGV  213



>gb|EMT31930.1| hypothetical protein F775_06985 [Aegilops tauschii]
Length=455

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    VMP ++   +  +P
Sbjct  284  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVMPLMKSNWEITMP  343

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLT  413
            PIYS+EMDAA FR     +WH+GV + S   S T
Sbjct  344  PIYSVEMDAADFRGLVSDQWHVGVMSLSTTLSAT  377



>gb|ACF87716.1| unknown [Zea mays]
Length=342

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRIL-  308
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +     MP V+   +  + 
Sbjct  219  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPAMPLVKSAWEITMP  278

Query  309  PPIYSIEMDAATFRDFSRHEWHIGVPTSSNKE-SLTDSVLVVIQHP  443
            PPIYS+EMDAA F+     +WH+GV T+     S    +LV++Q+P
Sbjct  279  PPIYSVEMDAADFKGLVSDQWHVGVRTTEESGCSAQQPLLVLVQNP  324



>ref|XP_002965078.1| hypothetical protein SELMODRAFT_83794, partial [Selaginella moellendorffii]
 gb|EFJ33916.1| hypothetical protein SELMODRAFT_83794, partial [Selaginella moellendorffii]
Length=250

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +3

Query  153  DNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSIEM  332
            D   + YW+RLL+REW    I SYIGWTFR+++  P F+V+P +    + +LPPIYSIEM
Sbjct  137  DGVANEYWMRLLVREWTEIGIFSYIGWTFRARETTPFFTVIPTLHSGRESMLPPIYSIEM  196

Query  333  DAATFRDFSRHEWHIGV  383
            +   F   S  EWHIGV
Sbjct  197  NEKDFNTLSFKEWHIGV  213



>ref|NP_001142426.1| hypothetical protein [Zea mays]
 gb|ACF88467.1| unknown [Zea mays]
 tpg|DAA58141.1| TPA: hypothetical protein ZEAMMB73_150182 [Zea mays]
Length=390

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  120  GVFTLQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGK  299
             V  + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +     MP V+   +
Sbjct  263  AVAFIMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPAMPLVKSAWE  322

Query  300  RIL-PPIYSIEMDAATFRDFSRHEWHIGVPTSSNKE-SLTDSVLVVIQHP  443
              + PPIYS+EMDAA F+     +WH+GV T+     S    +LV++Q+P
Sbjct  323  ITMPPPIYSVEMDAADFKGLVSDQWHVGVRTTEESGCSAQQPLLVLVQNP  372



>ref|XP_001779506.1| predicted protein [Physcomitrella patens]
 gb|EDQ55682.1| predicted protein [Physcomitrella patens]
Length=278

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (60%), Gaps = 4/97 (4%)
 Frame = +3

Query  144  INMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYS  323
            I +D   + YW+RLL+RE     I  +IGWTFRS++  P F+VMP     G+R LPPIYS
Sbjct  168  IFLDFVFNEYWVRLLVRETTEIAIFCFIGWTFRSREQTPFFNVMPTSNTSGQRTLPPIYS  227

Query  324  IEMDAATFRDFSRHEWHIGV----PTSSNKESLTDSV  422
            +EM+   F +    EWHIGV    P  SN E + + +
Sbjct  228  VEMNERHFSNLDYKEWHIGVVSSYPPHSNMEYVPEGL  264



>ref|XP_002456131.1| hypothetical protein SORBIDRAFT_03g031050 [Sorghum bicolor]
 gb|EES01251.1| hypothetical protein SORBIDRAFT_03g031050 [Sorghum bicolor]
Length=339

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +     +P ++   +  +P
Sbjct  216  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPAIPLMKSAWEITMP  275

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSSNKESLTDSVLVVIQHP  443
            PIYS+EM+AA F+     +WH+GV + S   +    +LV++Q+P
Sbjct  276  PIYSVEMNAADFKGLVSDQWHVGVRSGSGCSA--QPLLVLVQNP  317



>ref|XP_001764776.1| predicted protein [Physcomitrella patens]
 gb|EDQ70475.1| predicted protein [Physcomitrella patens]
Length=326

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  153  DNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSIEM  332
            D  V+ YW+RLL RE A   I  YIGWT RSK+    FSV P + L G+RILPPIYS+E+
Sbjct  230  DGMVNEYWMRLLARECAEIAIFLYIGWTCRSKEPTLYFSVAPTIHLSGQRILPPIYSVEI  289

Query  333  DAATFRDFSRHEWHIGV  383
            +   F +    EWHIGV
Sbjct  290  NEKQFNNLDHKEWHIGV  306



>ref|XP_006646200.1| PREDICTED: uncharacterized protein LOC102719639 [Oryza brachyantha]
Length=340

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +     +P  +      +P
Sbjct  215  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPFVPLTKSTWDIAMP  274

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSS-NKESLTDSVLVVIQHP  443
             IYS+EMDAA F+      WH+GV TS  N    +  +LV++Q+P
Sbjct  275  TIYSVEMDAADFKGLVSEHWHVGVRTSQINSSCPSQPLLVLVQNP  319



>ref|XP_001775894.1| predicted protein [Physcomitrella patens]
 gb|EDQ59259.1| predicted protein [Physcomitrella patens]
Length=744

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 6/116 (5%)
 Frame = +3

Query  153  DNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSIEM  332
            D     YW+RLL+RE+    I  YIGWTFRS++L P F+V+P +   G+RILPPIY +E+
Sbjct  470  DGIGKEYWVRLLLREFVEIGIFFYIGWTFRSRELTPFFTVIPTLHPSGQRILPPIYCVEI  529

Query  333  DAATFRDFSRHEWHIGV--PTSSNKESLTDSVLVVIQHPHVYRQTSALSNSHSPAL  494
            +   F +    EWHIGV  P      + +DS   ++Q   +    S    +H P L
Sbjct  530  NEKQFNNLDHKEWHIGVEEPICPIFLATSDSYCCILQPASI----SENGGTHKPML  581



>gb|EEC68128.1| hypothetical protein OsI_36040 [Oryza sativa Indica Group]
Length=250

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    V+P ++   +  +P
Sbjct  150  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVVPLMKSTWEIAMP  209

Query  312  PIYSIEMDAATFRDFSRHEWHIGVPTSS  395
            PIYS+EMDAA F+      WH+GV  ++
Sbjct  210  PIYSVEMDAADFKGLVSDHWHVGVVGTT  237



>gb|EEE55171.1| hypothetical protein OsJ_02996 [Oryza sativa Japonica Group]
Length=442

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    V+P ++   +  +P
Sbjct  215  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVVPLMKSTWEIAMP  274

Query  312  PIYSIEMDAATFRDFSRHEWHIGV  383
            PIYS+EMDAA F+      WH+GV
Sbjct  275  PIYSVEMDAADFKGLVSDHWHVGV  298



>gb|EEC71264.1| hypothetical protein OsI_03254 [Oryza sativa Indica Group]
Length=442

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  132  LQIFINMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILP  311
            + +++  D++ D+YW R+L+REW  FCI  YIGW FR  + +    V+P ++   +  +P
Sbjct  215  IMVYMRADDTPDNYWFRVLVREWVQFCIFMYIGWNFRIPEASLHLPVVPLMKSTWEIAMP  274

Query  312  PIYSIEMDAATFRDFSRHEWHIGV  383
            PIYS+EMDAA F+      WH+GV
Sbjct  275  PIYSVEMDAADFKGLVSDHWHVGV  298



>ref|XP_001777016.1| predicted protein [Physcomitrella patens]
 gb|EDQ58130.1| predicted protein [Physcomitrella patens]
Length=256

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +3

Query  147  NMDNSVDSYWLRLLIREWAHFCILSYIGWTFRSKDLAPRFSVMPPVRLKGKRILPPIYSI  326
             +++ V+ YW+RLL+RE     I  +IGWTFRS++  P F VMP      +R L PIYS+
Sbjct  166  QVESVVNEYWMRLLVREMTEVIIFLFIGWTFRSRERFPFFDVMPTSNSAVQRTLAPIYSV  225

Query  327  EMDAATFRDFSRHEWHIGV  383
            EM+   F      EWHIGV
Sbjct  226  EMNEREFSKLDYKEWHIGV  244



>gb|KDO56991.1| hypothetical protein CISIN_1g025501mg [Citrus sinensis]
Length=178

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  138  IFINMDNSVDSYWLRLLIREWAHFCILSYIGWT  236
            I++N+D+S ++YWLRLL+REWA FCI  YIG+ 
Sbjct  132  IYLNVDDSSENYWLRLLVREWAQFCIFLYIGYV  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1536719273000