BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24662_g2_i1 len=986 path=[2944:0-552 541:553-581 2250:582-673
73:674-713 3622:714-721 3630:722-853 3630:854-985]

Length=986
                                                                      Score     E

ref|XP_008940935.1|  PREDICTED: kininogen-1a                          72.0    2e-11   
ref|XP_001619355.1|  hypothetical protein NEMVEDRAFT_v1g5894          59.7    1e-07   Nematostella vectensis
ref|XP_001636137.1|  predicted protein                                56.2    2e-06   Nematostella vectensis
ref|XP_001636074.1|  predicted protein                                54.7    6e-06   Nematostella vectensis
ref|XP_001897367.1|  hypothetical protein Bm1_29625                   56.2    9e-06   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001621635.1|  hypothetical protein NEMVEDRAFT_v1g19000         52.4    3e-05   Nematostella vectensis
ref|XP_009058593.1|  hypothetical protein LOTGIDRAFT_86619            51.2    2e-04   
ref|XP_001629991.1|  predicted protein                                48.5    6e-04   Nematostella vectensis
ref|XP_001636962.1|  predicted protein                                48.9    8e-04   Nematostella vectensis



>ref|XP_008940935.1| PREDICTED: kininogen-1a, partial [Merops nubicus]
Length=228

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 102/227 (45%), Gaps = 36/227 (16%)
 Frame = -1

Query  968  YHGKVVDIHAKVVGYH------LREAVSRHEKVVDIHVKAVGCHLREVGSYHGKVVDIHA  807
            +H K VD ++ +V +H        +++  H K VD + K+V  H + +  +  K+VD++ 
Sbjct  8    FHHKPVDFYSNLVHFHPEPVDFYSKSMDFHPKPVDFYSKSVHFHPKPID-FCSKLVDLNP  66

Query  806  KVVGYHLR------EAVSRHEKVVDIHVKAVGCHLRTVESH------HEKVVDVHV*AVG  663
            K V ++L+      + V  H K VD +   V  H + ++ +      H K+VD +   V 
Sbjct  67   KPVDFYLKLVHFYSKLVHFHPKPVDFYPNLVHFHPKPIDFYSKLVHFHPKLVDFYSKPVD  126

Query  662  CHPKEAKSRHEKVDDVHVKAVGSHLRTAESH------HGKVVDYHPREAAYCHKVEDSWN  501
             HPK     +  + D H K V  + +  + H      + K+VD+HP+   +  K+ D   
Sbjct  127  FHPKPV-DFYPNLVDFHPKPVDFYPKLMDFHPKPIDFYPKLVDFHPKPVDFYPKLMD---  182

Query  500  *THQKEVNGQHGRAANGRQKVKVVSCRSRDTILANWQLQQQRGLKQV  360
              H K V+  + +  +     K V   SR   L ++  Q  R   QV
Sbjct  183  -FHPKPVDF-YSKLVHFHP--KPVDFYSR---LMDFHPQTSRFPPQV  222



>ref|XP_001619355.1| hypothetical protein NEMVEDRAFT_v1g5894 [Nematostella vectensis]
 gb|EDO27255.1| predicted protein [Nematostella vectensis]
Length=138

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 60/132 (45%), Gaps = 9/132 (7%)
 Frame = -1

Query  980  EVGSYHGKVVDIHAKVVGYHLREAVSRHEKVVDIHVKAVGCHLREVGSYHGKVVDIHAKV  801
            +  S H K   +HAK +  H +  +S H K   +H K +  H + V S   K   +HA  
Sbjct  13   KTTSLHAKTTSLHAKPMSLHAKP-MSLHAKTTLLHAKTMSLHAKNV-SLRAKTTSLHANT  70

Query  800  VGYHLREAVSRHEKVVDIHVKAVGCHLRTVESHHEKVVDVHV*AVGCHPKEAKSR--HEK  627
               H +  +S H K + +H K +  H +T+ S H K + +H   +     +AK+   H K
Sbjct  71   TSLHAKT-MSLHAKTMSLHAKTMSLHAKTM-SLHAKTMSLHAKTMSL---QAKTMWLHAK  125

Query  626  VDDVHVKAVGSH  591
               +H K V  H
Sbjct  126  TVSLHAKTVSLH  137



>ref|XP_001636137.1| predicted protein [Nematostella vectensis]
 gb|EDO44074.1| predicted protein [Nematostella vectensis]
Length=113

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +3

Query  663  TNRLHMDINHLLVVALHRPQVATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAP  842
             + L+M  +HL + A H   ++ + L+M  +HL ++AH L  +  +HL M  +HL M A 
Sbjct  10   AHHLYMSAHHLYMSA-HHLYMSAHHLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAH  67

Query  843  HLP*VATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP  983
            HL  ++ + L+M  +HL ++AH L  +  +HL M  +HL M A HL 
Sbjct  68   HLY-MSAHHLYMSAHHLFMSAHHL-YMSAHHLYMSAHHLYMSAHHLY  112


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +3

Query  663  TNRLHMDINHLLVVALHRPQVATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAP  842
             + L+M  +HL + A H   ++ + L+M  +HL ++AH L  +  +HL M  +HL M A 
Sbjct  3    AHHLYMSAHHLYMSA-HHLYMSAHHLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAH  60

Query  843  HLP*VATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP  983
            HL  ++ + L+M  +HL ++AH L  +  +HL M  +HL M A HL 
Sbjct  61   HLY-MSAHHLYMSAHHLYMSAHHLF-MSAHHLYMSAHHLYMSAHHLY  105


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = +3

Query  678  MDINHLLVVALHRPQVATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP*V  857
            M  +HL + A H   ++ + L+M  +HL ++AH L  +  +HL M  +HL M A HL  +
Sbjct  1    MSAHHLYMSA-HHLYMSAHHLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAHHLY-M  57

Query  858  ATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP  983
            + + L+M  +HL ++AH L  +  +HL M  +HL M A HL 
Sbjct  58   SAHHLYMSAHHLYMSAHHL-YMSAHHLFMSAHHLYMSAHHLY  98



>ref|XP_001636074.1| predicted protein [Nematostella vectensis]
 gb|EDO44011.1| predicted protein [Nematostella vectensis]
Length=121

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 3/105 (3%)
 Frame = +3

Query  663  TNRLHMDINHLLVVALHRPQVATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAP  842
             + L+M  +HL + A H   ++ + L+M  +HL ++AH L  +  +HL M   HL M A 
Sbjct  10   AHHLYMSAHHLYMSA-HHLYMSAHHLYMSAHHLYMSAHHLYIMSAHHLYMSARHLYMSAH  68

Query  843  HLP*VATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPH  977
            H P ++ + L+M  +HL ++AH L  +  +HL M  +HL M A H
Sbjct  69   H-PYMSAHHLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAHH  111


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  723  VATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP*VATNRLHMDINHLLVA  902
            ++ + L+M  +HL ++AH L  +  +HL M  +HL M A HL  ++ + L+M   HL ++
Sbjct  8    MSAHHLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAHHLYIMSAHHLYMSARHLYMS  66

Query  903  AHRLPQVVTNHLRMDINHLPMVAPHL  980
            AH  P +  +HL M  +HL M A HL
Sbjct  67   AHH-PYMSAHHLYMSAHHLYMSAHHL  91



>ref|XP_001897367.1| hypothetical protein Bm1_29625 [Brugia malayi]
Length=251

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 66/154 (43%), Gaps = 11/154 (7%)
 Frame = -1

Query  971  SYHGKVVDIHAKVVGYH------LREAVSRHEKVVDIHVKAVGCHLREVGSYHGKVVDIH  810
            SYHG  +  H   + YH         A+S +E  +  H  A+  H   + SY+   +  H
Sbjct  12   SYHGYAISYHEYAISYHEYAISYYEYAISYYEYAISYHEYAISYHEYAI-SYYEYAISYH  70

Query  809  AKVVGYHLREAVSRHEKVVDIHVKAVGCHLRTVESHHEKVVDVHV*AVGCHPKEAKSRHE  630
               + YH   A+S +E  +  H  A+  H   + S+HE  +  H  A+  H   A S HE
Sbjct  71   EYAISYH-EYAISYYEYAISYHEYAISYHEYAI-SYHEYAISYHEYAISYHEY-AISYHE  127

Query  629  KVDDVHVKAVGSHLRTAESHHGKVVDYHPREAAY  528
                 H  A+ S+   A S+H   + YH    +Y
Sbjct  128  YAISYHEYAI-SYYEYAISYHEYAISYHEYAISY  160



>ref|XP_001621635.1| hypothetical protein NEMVEDRAFT_v1g19000 [Nematostella vectensis]
 gb|EDO29535.1| predicted protein [Nematostella vectensis]
Length=108

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = +3

Query  687  NHLLVVALHRPQVATNRLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP*VATN  866
            +H L ++ H   ++ + L+M  +HL ++AH L  +  +HL M  +HL M A HL  ++  
Sbjct  5    SHHLYMSAHHLYISAHHLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAHHLY-MSAR  62

Query  867  RLHMDINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP  983
             L+M  +HL ++AH L  +  +HL M  +HL M A HL 
Sbjct  63   HLYMSAHHLYMSAHHL-YMSAHHLYMSAHHLYMSAHHLY  100


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 52/95 (55%), Gaps = 8/95 (8%)
 Frame = +3

Query  717  PQVATNRLHMDINHLLVAAHRLP------QVVTNHLRMDINHLPMVAPHLP*VATNRLHM  878
              ++++ L+M  +HL ++AH L        +  +HL M  +HL M A HL  ++ + L+M
Sbjct  1    TYLSSHHLYMSAHHLYISAHHLYMSAHHLYMSAHHLYMSAHHLYMSAHHLY-MSAHHLYM  59

Query  879  DINHLLVAAHRLPQVVTNHLRMDINHLPMVAPHLP  983
               HL ++AH L  +  +HL M  +HL M A HL 
Sbjct  60   SARHLYMSAHHL-YMSAHHLYMSAHHLYMSAHHLY  93



>ref|XP_009058593.1| hypothetical protein LOTGIDRAFT_86619, partial [Lottia gigantea]
 gb|ESO90616.1| hypothetical protein LOTGIDRAFT_86619, partial [Lottia gigantea]
Length=210

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 32/89 (36%), Gaps = 3/89 (3%)
 Frame = +1

Query  721  RWQPTAFTWISTTFSWRLTASLKW*PTTFAWISTTFPW*LPTSLKWQPTAFTWISTTFSW  900
            RW    F W+   F W      +W    F W+   F W +    +W    F W+   F W
Sbjct  98   RWVECCFRWVECCFRWVECLLFRWVVCCFRWVECCFRW-VECCFRWVECCFRWVVCCFRW  156

Query  901  RLTASLKW-*PTTFAWISTTFPW*LPTSL  984
             +    +W     F W+   F W    SL
Sbjct  157  -VVCCFRWLGACCFRWVECCFRWLGAVSL  184



>ref|XP_001629991.1| predicted protein [Nematostella vectensis]
 gb|EDO37928.1| predicted protein [Nematostella vectensis]
Length=83

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 43/88 (49%), Gaps = 10/88 (11%)
 Frame = -1

Query  965  HGKVVDIHAKVVGYHLREAVSRHEKVVDIHVKAVGCHLREVGSYHGKVVDIHAKVVGYHL  786
            H KV   H KV G H++   S H KV   H+K  G H+R  GS        H KV G H+
Sbjct  3    HMKVTGSHMKVTGSHMKVTGS-HMKVTGSHMKVTGSHMRVTGS--------HMKVTGSHM  53

Query  785  REAVSRHEKVVDIHVKAVGCHLRTVESH  702
            R   S H KV   H++  G H++   SH
Sbjct  54   RVTGS-HMKVTGSHMRVTGSHMKVTGSH  80



>ref|XP_001636962.1| predicted protein [Nematostella vectensis]
 gb|EDO44899.1| predicted protein [Nematostella vectensis]
Length=145

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = -1

Query  833  HGKVVDIHAKVVGYHLREAVSRHEKVVDIHVKAVGCHLRTVESHHEKVVDVHV*AVGCHP  654
            H ++V  H ++V  H R  V  H ++V  H + V  H R V+S H ++V  H   V  H 
Sbjct  7    HTRIVPSHTRIVPSHTR-IVPSHTRIVPSHTRIVPSHTRMVQS-HTRIVPSHTRIVPSHT  64

Query  653  KEAKSRHEKVDDVHVKAVGSHLRTAESHHGKVVDYHPR  540
            +   S H ++   H + V +H R   S H ++V  HPR
Sbjct  65   RIVPS-HTRIVPSHTRIVPNHTRIVPS-HTRIVPSHPR  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2169515985086