BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24656_g2_i1 len=344 path=[6151:0-343]

Length=344
                                                                      Score     E

ref|XP_009624275.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    176   7e-52   
ref|XP_009624276.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    176   7e-52   
gb|EPS67280.1|  hypothetical protein M569_07496                         176   8e-52   
ref|XP_011094836.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    176   1e-51   
ref|XP_009624274.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    176   2e-51   
ref|XP_011077448.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    174   7e-51   
emb|CDP06637.1|  unnamed protein product                                174   1e-50   
ref|XP_009763331.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    174   1e-50   
gb|EYU41703.1|  hypothetical protein MIMGU_mgv1a010276mg                174   1e-50   
ref|XP_009620213.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    172   3e-50   
ref|XP_009625387.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    171   5e-50   
ref|XP_009620212.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    172   7e-50   
ref|XP_009763323.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    171   1e-49   
ref|XP_009780021.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    171   3e-49   
ref|XP_006341052.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    170   4e-49   
ref|XP_004249626.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    170   5e-49   
ref|XP_004246442.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    169   5e-49   
ref|XP_006349516.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    169   9e-49   
ref|NP_001241121.1|  uncharacterized protein LOC100795299               169   1e-48   
ref|XP_007144454.1|  hypothetical protein PHAVU_007G157500g             168   2e-48   
gb|EYU26573.1|  hypothetical protein MIMGU_mgv1a010245mg                167   6e-48   
ref|XP_003637513.1|  Retinol dehydrogenase                              164   1e-47   
ref|NP_001042042.1|  Os01g0151700                                       166   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010047535.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    166   2e-47   
ref|XP_007027084.1|  Putativepod-specific dehydrogenase SAC25 iso...    165   2e-47   
gb|EAZ10566.1|  hypothetical protein OsJ_00398                          166   2e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EAY72561.1|  hypothetical protein OsI_00427                          166   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_003637512.1|  Retinol dehydrogenase                              165   3e-47   
ref|XP_006645504.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    165   3e-47   
ref|XP_006381188.1|  hypothetical protein POPTR_0006s08410g             163   4e-47   
ref|XP_002457359.1|  hypothetical protein SORBIDRAFT_03g005980          164   5e-47   Sorghum bicolor [broomcorn]
ref|XP_010111499.1|  Short-chain dehydrogenase TIC 32                   164   6e-47   
ref|XP_002309049.2|  hypothetical protein POPTR_0006s08410g             163   8e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010253253.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    163   9e-47   
ref|XP_003521337.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    164   9e-47   
gb|KHN48985.1|  Short-chain dehydrogenase TIC 32, chloroplastic         164   9e-47   
ref|XP_003542461.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    163   1e-46   
ref|XP_010253252.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    163   2e-46   
ref|XP_002273550.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    163   2e-46   Vitis vinifera
emb|CDM81286.1|  unnamed protein product                                162   2e-46   
ref|XP_003554326.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    162   2e-46   
dbj|BAJ90409.1|  predicted protein                                      162   3e-46   
ref|XP_004968226.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    162   3e-46   
ref|XP_007205567.1|  hypothetical protein PRUPE_ppa008709mg             162   4e-46   
ref|XP_004302745.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    162   5e-46   
gb|EEC69960.1|  hypothetical protein OsI_00419                          164   6e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_004495007.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    162   6e-46   
ref|XP_008241306.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    161   7e-46   
ref|XP_007162660.1|  hypothetical protein PHAVU_001G169500g             161   7e-46   
gb|EPS67753.1|  hypothetical protein M569_07022                         161   8e-46   
ref|XP_008363853.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    160   8e-46   
ref|XP_008369963.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    159   9e-46   
gb|EMT03523.1|  WW domain-containing oxidoreductase                     161   1e-45   
ref|XP_009338773.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    161   1e-45   
ref|XP_008363852.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    161   1e-45   
gb|EMS50830.1|  Retinol dehydrogenase 14                                161   1e-45   
ref|XP_009384884.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    160   1e-45   
ref|XP_007027083.1|  NAD(P)-binding Rossmann-fold superfamily pro...    162   1e-45   
ref|XP_008795035.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    160   2e-45   
emb|CDY10440.1|  BnaCnng03410D                                          160   2e-45   
ref|XP_009122769.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    160   3e-45   
emb|CDY40365.1|  BnaA10g27030D                                          160   3e-45   
ref|XP_009414312.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    160   3e-45   
gb|AAM13049.1|  putative protein                                        160   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ADE75710.1|  unknown                                                 159   3e-45   
ref|NP_568102.1|  NAD(P)-binding Rossmann-fold superfamily protein      160   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003568767.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    159   4e-45   
ref|XP_003625499.1|  Retinol dehydrogenase                              159   4e-45   
gb|AAM63701.1|  putativepod-specific dehydrogenase SAC25                160   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ABN05708.1|  Short-chain dehydrogenase/reductase SDR                 159   4e-45   Medicago truncatula
tpg|DAA53452.1|  TPA: hypothetical protein ZEAMMB73_545165              159   4e-45   
ref|XP_002881514.1|  short-chain dehydrogenase/reductase family p...    159   6e-45   
ref|XP_006398712.1|  hypothetical protein EUTSA_v10013579mg             161   7e-45   
ref|XP_009130710.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   7e-45   
gb|KDP35604.1|  hypothetical protein JCGZ_09042                         159   7e-45   
tpg|DAA52893.1|  TPA: hypothetical protein ZEAMMB73_523779              157   7e-45   
ref|XP_010684103.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    159   7e-45   
ref|XP_010490715.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    159   8e-45   
ref|NP_001182780.1|  retinol dehydrogenase 11                           159   8e-45   
ref|XP_002870978.1|  short-chain dehydrogenase/reductase family p...    159   8e-45   
ref|XP_008810802.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    158   9e-45   
gb|KFK24712.1|  hypothetical protein AALP_AA8G015000                    159   1e-44   
emb|CDY55418.1|  BnaCnng28820D                                          157   2e-44   
emb|CDX81232.1|  BnaC09g06430D                                          157   2e-44   
ref|XP_002531343.1|  short-chain dehydrogenase, putative                157   2e-44   Ricinus communis
ref|XP_010937675.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   2e-44   
ref|XP_009141671.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   3e-44   
emb|CDY18436.1|  BnaA04g21510D                                          157   3e-44   
gb|ACJ84304.1|  unknown                                                 157   3e-44   Medicago truncatula
ref|NP_181290.1|  Rossmann-fold NAD(P)-binding domain-containing ...    157   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423848.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   3e-44   
emb|CDY11217.1|  BnaA03g00530D                                          157   3e-44   
gb|AFK45597.1|  unknown                                                 157   3e-44   
ref|XP_010452099.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   3e-44   
ref|XP_009130709.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   3e-44   
gb|KDO44661.1|  hypothetical protein CISIN_1g023054mg                   156   4e-44   
ref|XP_009419948.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    157   4e-44   
gb|KHF98432.1|  Short-chain dehydrogenase TIC 32, chloroplastic         156   5e-44   
gb|KHF98431.1|  Short-chain dehydrogenase TIC 32, chloroplastic         157   6e-44   
ref|XP_009409529.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    155   6e-44   
emb|CAB85991.1|  putative protein                                       157   6e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20110.1|  unknown                                                 153   6e-44   Glycine max [soybeans]
ref|XP_006429047.1|  hypothetical protein CICLE_v10012197mg             156   7e-44   
ref|XP_008356311.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    156   8e-44   
ref|XP_011019884.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    156   8e-44   
ref|XP_009374671.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    156   1e-43   
ref|XP_006288165.1|  hypothetical protein CARUB_v10001402mg             156   1e-43   
gb|EMT28766.1|  Retinol dehydrogenase 12                                157   1e-43   
ref|XP_008442566.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    155   1e-43   
ref|XP_006294503.1|  hypothetical protein CARUB_v10023534mg             156   1e-43   
ref|XP_009409528.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    155   2e-43   
ref|XP_010920666.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    155   2e-43   
ref|XP_010505343.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    155   2e-43   
ref|XP_010558313.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    155   3e-43   
ref|XP_010509322.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    154   3e-43   
gb|ABR25584.1|  retinol dehydrogenase 11                                151   4e-43   Oryza sativa Indica Group [Indian rice]
emb|CDY52816.1|  BnaC04g53630D                                          154   4e-43   
emb|CDY52817.1|  BnaC04g53640D                                          154   4e-43   
emb|CAB58175.1|  putative pod-specific dehydrogenase SAC25              154   4e-43   Brassica napus [oilseed rape]
emb|CDX74954.1|  BnaA05g07000D                                          154   4e-43   
gb|ACG40401.1|  retinol dehydrogenase 11                                154   5e-43   Zea mays [maize]
ref|XP_006410941.1|  hypothetical protein EUTSA_v10016943mg             154   8e-43   
ref|XP_010553028.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    154   8e-43   
ref|XP_002965372.1|  hypothetical protein SELMODRAFT_439201             153   1e-42   
gb|KHN21767.1|  Short-chain dehydrogenase TIC 32, chloroplastic         152   2e-42   
ref|XP_010517024.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    152   3e-42   
ref|XP_008241317.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    152   3e-42   
ref|XP_004137776.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    152   3e-42   
ref|XP_004172458.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    152   4e-42   
ref|XP_007205568.1|  hypothetical protein PRUPE_ppa008713mg             152   4e-42   
gb|KGN58884.1|  hypothetical protein Csa_3G734860                       152   4e-42   
ref|XP_010543329.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    150   5e-42   
ref|XP_002977219.1|  hypothetical protein SELMODRAFT_106485             151   6e-42   
ref|XP_010543328.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    150   2e-41   
ref|XP_010543327.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    150   2e-41   
emb|CDY68648.1|  BnaC03g71290D                                          147   2e-41   
gb|KFK36643.1|  hypothetical protein AALP_AA4G151300                    151   3e-41   
gb|KFK36642.1|  hypothetical protein AALP_AA4G151300                    151   3e-41   
ref|NP_001240197.1|  uncharacterized protein LOC100783465               149   6e-41   
gb|EYU19564.1|  hypothetical protein MIMGU_mgv1a0091942mg               147   1e-40   
gb|ABK22403.1|  unknown                                                 144   1e-40   Picea sitchensis
ref|XP_009784180.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    147   2e-40   
ref|XP_009143483.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    147   2e-40   
ref|XP_007143442.1|  hypothetical protein PHAVU_007G072600g             147   2e-40   
ref|XP_010554932.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    147   3e-40   
ref|XP_006353884.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    147   3e-40   
ref|XP_009589937.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    146   4e-40   
gb|KDP22254.1|  hypothetical protein JCGZ_26085                         145   4e-40   
ref|XP_004496543.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    146   4e-40   
ref|XP_004234415.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    146   5e-40   
gb|AAN64176.1|  unknown protein                                         143   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006846071.1|  hypothetical protein AMTR_s00012p00077460          146   6e-40   
emb|CDY10884.1|  BnaC01g14990D                                          145   7e-40   
ref|XP_009136980.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    145   9e-40   
ref|XP_009340057.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    144   2e-39   
ref|XP_009340058.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    144   2e-39   
emb|CDY44096.1|  BnaA01g13040D                                          145   2e-39   
gb|KCW90667.1|  hypothetical protein EUGRSUZ_A02763                     142   2e-39   
ref|XP_009340056.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    144   3e-39   
gb|AFK45926.1|  unknown                                                 143   4e-39   
ref|NP_001190811.1|  NAD(P)-binding Rossmann-fold superfamily pro...    144   4e-39   
emb|CDY13264.1|  BnaC09g23920D                                          144   5e-39   
ref|XP_009108602.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    142   5e-39   
ref|XP_009108166.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    143   5e-39   
ref|XP_006413556.1|  hypothetical protein EUTSA_v10025732mg             144   5e-39   
ref|NP_194073.2|  NAD(P)-binding Rossmann-fold superfamily protein      143   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053249.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    143   6e-39   
ref|XP_002513680.1|  short-chain dehydrogenase, putative                143   8e-39   Ricinus communis
gb|KEH43681.1|  short-chain dehydrogenase TIC 32                        142   9e-39   
ref|XP_004956238.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    142   1e-38   
emb|CDY69917.1|  BnaAnng32000D                                          142   1e-38   
ref|XP_010060703.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    141   1e-38   
ref|XP_010529606.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    141   1e-38   
ref|XP_002869780.1|  short-chain dehydrogenase/reductase family p...    142   1e-38   
ref|NP_849428.1|  short-chain dehydrogenase TIC 32                      142   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108601.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    142   1e-38   
ref|XP_006661006.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    142   1e-38   
dbj|BAE99458.1|  hypothetical protein                                   142   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43129.1|  unknown                                                 142   1e-38   
sp|Q6RVV4.1|TIC32_PEA  RecName: Full=Short-chain dehydrogenase TI...    142   2e-38   Pisum sativum [garden pea]
gb|KEH43689.1|  NAD(P)-binding rossmann-fold protein                    142   2e-38   
ref|XP_008379922.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    142   2e-38   
gb|KEH43683.1|  NAD(P)-binding rossmann-fold protein                    140   2e-38   
ref|XP_010529605.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    141   3e-38   
ref|XP_008379916.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    142   3e-38   
gb|KEH43680.1|  NAD(P)-binding rossmann-fold protein                    141   3e-38   
gb|KEH43682.1|  NAD(P)-binding rossmann-fold protein                    140   3e-38   
ref|XP_006396906.1|  hypothetical protein EUTSA_v10028811mg             141   3e-38   
gb|KHN12151.1|  Short-chain dehydrogenase TIC 32, chloroplastic         141   3e-38   
gb|KCW90666.1|  hypothetical protein EUGRSUZ_A02763                     140   3e-38   
emb|CAN65621.1|  hypothetical protein VITISV_040853                     139   3e-38   Vitis vinifera
gb|KFK28921.1|  hypothetical protein AALP_AA7G065400                    141   3e-38   
ref|XP_010529604.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    141   4e-38   
ref|XP_010060696.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    141   4e-38   
ref|NP_001063985.1|  Os09g0570300                                       141   4e-38   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD46231.1|  putative oxidoreductase                                141   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006490431.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    140   4e-38   
gb|AFK36887.1|  unknown                                                 140   5e-38   
gb|KEH43684.1|  NAD(P)-binding rossmann-fold protein                    140   5e-38   
ref|NP_001242868.1|  uncharacterized protein LOC100796920               140   6e-38   
ref|XP_003536459.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    140   8e-38   
gb|ACU19473.1|  unknown                                                 140   8e-38   Glycine max [soybeans]
ref|XP_008234205.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    140   9e-38   
ref|XP_002318807.2|  hypothetical protein POPTR_0012s12980g             139   9e-38   Populus trichocarpa [western balsam poplar]
emb|CAA20464.1|  putative protein                                       139   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009374994.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    139   1e-37   
ref|XP_011072846.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    139   1e-37   
ref|XP_004308067.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    139   2e-37   
ref|XP_010935852.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    138   2e-37   
gb|EMT00057.1|  Retinol dehydrogenase 14                                137   2e-37   
gb|KCW77505.1|  hypothetical protein EUGRSUZ_D01837                     139   2e-37   
ref|XP_007209377.1|  hypothetical protein PRUPE_ppa008889mg             139   3e-37   
ref|XP_006284119.1|  hypothetical protein CARUB_v10005252mg             139   3e-37   
ref|XP_010455548.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    139   3e-37   
ref|XP_002270104.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    139   3e-37   Vitis vinifera
ref|XP_009374991.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    138   4e-37   
ref|XP_002980982.1|  hypothetical protein SELMODRAFT_420551             139   4e-37   
ref|XP_002982463.1|  hypothetical protein SELMODRAFT_116561             138   5e-37   
ref|XP_010434965.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   5e-37   
ref|XP_010422096.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   5e-37   
ref|XP_010935851.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    138   6e-37   
ref|XP_007038745.1|  NAD(P)-binding Rossmann-fold superfamily pro...    139   6e-37   
emb|CDP05170.1|  unnamed protein product                                138   6e-37   
ref|XP_010529609.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    138   7e-37   
ref|XP_002459855.1|  hypothetical protein SORBIDRAFT_02g012420          138   7e-37   Sorghum bicolor [broomcorn]
ref|XP_010529607.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   8e-37   
ref|XP_004495009.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   9e-37   
ref|XP_010434947.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   9e-37   
ref|XP_010676470.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   9e-37   
ref|XP_002874690.1|  short-chain dehydrogenase/reductase family p...    137   9e-37   
gb|EMS64241.1|  Retinol dehydrogenase 14                                135   1e-36   
ref|XP_009386208.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   1e-36   
gb|KCW77510.1|  hypothetical protein EUGRSUZ_D01838                     136   1e-36   
emb|CDP12036.1|  unnamed protein product                                137   1e-36   
ref|XP_010422094.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   1e-36   
ref|XP_008437510.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   1e-36   
gb|EMS64246.1|  WW domain-containing oxidoreductase                     138   1e-36   
gb|KEH26386.1|  NAD(P)-binding rossmann-fold protein                    137   1e-36   
ref|XP_006827578.1|  hypothetical protein AMTR_s00009p00229460          135   1e-36   
gb|KDO51988.1|  hypothetical protein CISIN_1g021391mg                   135   2e-36   
ref|XP_004298808.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   2e-36   
ref|XP_004169031.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   2e-36   
ref|XP_002274932.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   2e-36   Vitis vinifera
ref|XP_010671842.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   2e-36   
gb|EPS64916.1|  hypothetical protein M569_09862                         137   2e-36   
ref|XP_006421967.1|  hypothetical protein CICLE_v10005473mg             135   2e-36   
ref|XP_007152235.1|  hypothetical protein PHAVU_004G112900g             134   2e-36   
ref|XP_006587287.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   2e-36   
ref|XP_011022674.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    136   2e-36   
ref|XP_010433910.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    137   2e-36   
ref|XP_010053247.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    136   2e-36   
ref|XP_006490428.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   3e-36   
gb|KCW77507.1|  hypothetical protein EUGRSUZ_D01838                     137   3e-36   
ref|XP_007040273.1|  NAD(P)-binding Rossmann-fold superfamily pro...    134   3e-36   
ref|XP_007152238.1|  hypothetical protein PHAVU_004G113100g             136   3e-36   
ref|XP_011030152.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   3e-36   
ref|XP_007040274.1|  NAD(P)-binding Rossmann-fold superfamily pro...    134   4e-36   
ref|XP_008347234.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   4e-36   
ref|NP_001136855.1|  Retinol dehydrogenase 14                           135   4e-36   Zea mays [maize]
ref|XP_010448713.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    136   4e-36   
ref|XP_003525392.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   4e-36   
gb|ACU23411.1|  unknown                                                 135   5e-36   Glycine max [soybeans]
ref|XP_008650990.1|  PREDICTED: retinol dehydrogenase 14 isoform X1     135   5e-36   
ref|XP_006421968.1|  hypothetical protein CICLE_v10005473mg             135   5e-36   
ref|XP_007152226.1|  hypothetical protein PHAVU_004G112100g             135   5e-36   
ref|XP_004496544.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   5e-36   
ref|XP_006584724.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   5e-36   
ref|XP_007152225.1|  hypothetical protein PHAVU_004G112100g             135   5e-36   
gb|EMT01331.1|  WW domain-containing oxidoreductase                     136   5e-36   
ref|XP_009350917.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   6e-36   
ref|XP_007152224.1|  hypothetical protein PHAVU_004G112100g             135   6e-36   
ref|XP_007152227.1|  hypothetical protein PHAVU_004G112100g             135   6e-36   
ref|XP_010422095.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   6e-36   
ref|XP_011048757.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   6e-36   
ref|XP_004145894.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   6e-36   
gb|KEH21075.1|  NAD(P)-binding rossmann-fold protein                    133   7e-36   
ref|XP_010317626.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   7e-36   
ref|XP_011030153.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    136   7e-36   
gb|ACJ84535.1|  unknown                                                 133   7e-36   Medicago truncatula
ref|XP_002318806.1|  short-chain dehydrogenase Tic32 family protein     135   9e-36   
ref|XP_004298805.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   9e-36   
ref|XP_011030151.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   9e-36   
ref|NP_567681.1|  short-chain dehydrogenase TIC 32                      135   9e-36   
ref|XP_010538804.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   9e-36   
ref|XP_010243086.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    135   1e-35   
ref|XP_002509816.1|  short-chain dehydrogenase, putative                135   1e-35   
ref|XP_002321927.1|  short-chain dehydrogenase Tic32 family protein     135   1e-35   
ref|XP_003532825.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   1e-35   
ref|XP_007208884.1|  hypothetical protein PRUPE_ppa026508mg             134   1e-35   
gb|KHN16813.1|  Short-chain dehydrogenase TIC 32, chloroplastic         134   1e-35   
ref|XP_007152236.1|  hypothetical protein PHAVU_004G113000g             133   1e-35   
ref|XP_011030150.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   1e-35   
ref|XP_006827577.1|  hypothetical protein AMTR_s00009p00229030          134   1e-35   
dbj|BAK03237.1|  predicted protein                                      134   1e-35   
gb|KHG23016.1|  Short-chain dehydrogenase TIC 32, chloroplastic -...    134   1e-35   
gb|EPS61961.1|  hypothetical protein M569_12835                         134   1e-35   
gb|AAY23356.1|  3-ketoacyl-CoA reductase 3                              134   2e-35   
gb|EMS63479.1|  WW domain-containing oxidoreductase                     134   2e-35   
gb|KHN41463.1|  Short-chain dehydrogenase TIC 32, chloroplastic         134   2e-35   
ref|XP_004234418.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   2e-35   
ref|XP_003548175.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   2e-35   
ref|XP_010439177.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   2e-35   
gb|KEH21077.1|  NAD(P)-binding rossmann-fold protein                    132   2e-35   
ref|XP_006587288.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   2e-35   
ref|XP_007040272.1|  NAD(P)-binding Rossmann-fold superfamily pro...    134   2e-35   
ref|XP_003577768.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   2e-35   
dbj|BAF00238.1|  hypothetical protein                                   131   2e-35   
ref|XP_010538803.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   3e-35   
ref|XP_006653248.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   3e-35   
ref|XP_008787473.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   3e-35   
ref|XP_006652156.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   3e-35   
ref|XP_010930756.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   3e-35   
ref|XP_004298807.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   4e-35   
ref|XP_004146522.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   4e-35   
ref|XP_010089089.1|  Short-chain dehydrogenase TIC 32                   133   4e-35   
ref|XP_007152237.1|  hypothetical protein PHAVU_004G113000g             133   4e-35   
gb|EYU25113.1|  hypothetical protein MIMGU_mgv1a010279mg                133   4e-35   
ref|XP_008238918.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   5e-35   
ref|XP_011084437.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    134   5e-35   
ref|XP_010930755.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   5e-35   
gb|EEE60689.1|  hypothetical protein OsJ_14167                          133   5e-35   
ref|XP_006353882.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   5e-35   
ref|NP_001052391.1|  Os04g0291100                                       133   6e-35   
ref|XP_010317627.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   6e-35   
ref|XP_006599559.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   6e-35   
gb|EEC76961.1|  hypothetical protein OsI_15249                          132   6e-35   
gb|AFK45460.1|  unknown                                                 132   6e-35   
ref|XP_006353883.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   6e-35   
gb|KDO51983.1|  hypothetical protein CISIN_1g020927mg                   131   6e-35   
gb|KEH21076.1|  NAD(P)-binding rossmann-fold protein                    132   6e-35   
ref|XP_002303597.1|  short-chain dehydrogenase Tic32 family protein     132   7e-35   
ref|XP_010662701.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    131   7e-35   
ref|XP_006353886.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   7e-35   
ref|XP_004978860.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    133   8e-35   
gb|ABK96367.1|  unknown                                                 132   8e-35   
ref|XP_006286532.1|  hypothetical protein CARUB_v10001488mg             132   8e-35   
ref|XP_010239459.1|  PREDICTED: uncharacterized protein LOC100827514    137   1e-34   
ref|XP_008663106.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   1e-34   
gb|KDO51982.1|  hypothetical protein CISIN_1g020927mg                   131   1e-34   
ref|XP_008663103.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   1e-34   
ref|XP_010930752.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   1e-34   
ref|XP_007160076.1|  hypothetical protein PHAVU_002G290500g             132   1e-34   
gb|KDP25421.1|  hypothetical protein JCGZ_20577                         132   1e-34   
ref|XP_008452031.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   1e-34   
gb|KDP25423.1|  hypothetical protein JCGZ_20579                         132   1e-34   
gb|EMS59548.1|  WW domain-containing oxidoreductase                     136   2e-34   
gb|AFK34836.1|  unknown                                                 131   2e-34   
ref|XP_008663102.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   2e-34   
ref|XP_004234460.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    131   2e-34   
ref|XP_004512815.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   2e-34   
ref|XP_006490429.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    132   2e-34   
gb|KFK28924.1|  hypothetical protein AALP_AA7G065800                    131   2e-34   
ref|XP_009389516.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    131   2e-34   
ref|XP_004234417.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    131   2e-34   
ref|XP_006421970.1|  hypothetical protein CICLE_v10005454mg             131   2e-34   
gb|KDP25422.1|  hypothetical protein JCGZ_20578                         131   2e-34   
ref|XP_006662784.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    131   3e-34   
ref|XP_006421965.1|  hypothetical protein CICLE_v10005473mg             128   3e-34   
ref|XP_006421971.1|  hypothetical protein CICLE_v10005402mg             131   3e-34   
ref|XP_002272242.2|  PREDICTED: short-chain dehydrogenase TIC 32,...    130   3e-34   
ref|NP_192880.1|  Rossmann-fold NAD(P)-binding domain-containing ...    131   3e-34   
ref|XP_010102663.1|  Short-chain dehydrogenase TIC 32                   130   3e-34   
gb|KDO51981.1|  hypothetical protein CISIN_1g020927mg                   130   3e-34   
ref|XP_004503702.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    130   4e-34   
ref|XP_010053248.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    130   4e-34   
ref|XP_010314952.1|  PREDICTED: LOW QUALITY PROTEIN: short-chain ...    130   5e-34   
ref|XP_007152230.1|  hypothetical protein PHAVU_004G112400g             128   5e-34   
ref|XP_008781577.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    130   5e-34   
ref|XP_008238963.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    130   6e-34   
ref|XP_008804441.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    130   7e-34   
gb|EMT01330.1|  WW domain-containing oxidoreductase                     130   8e-34   
ref|XP_008376618.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   9e-34   
ref|NP_001065901.1|  Os11g0181700                                       130   1e-33   
gb|KEH26388.1|  NAD(P)-binding rossmann-fold protein                    129   1e-33   
ref|XP_003533174.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   1e-33   
gb|KDO51985.1|  hypothetical protein CISIN_1g020927mg                   129   1e-33   
ref|XP_010102661.1|  Short-chain dehydrogenase TIC 32                   129   1e-33   
ref|XP_008799176.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   1e-33   
emb|CDP05169.1|  unnamed protein product                                129   1e-33   
ref|XP_009342942.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   1e-33   
ref|XP_008663104.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   1e-33   
ref|XP_010237884.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   1e-33   
ref|NP_001065902.1|  Os11g0181800                                       129   2e-33   
ref|XP_009757987.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   2e-33   
ref|XP_004977854.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    129   2e-33   
ref|XP_004300799.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   3e-33   
emb|CDP05172.1|  unnamed protein product                                128   3e-33   
ref|XP_004244723.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   3e-33   
ref|XP_006490430.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   3e-33   
ref|XP_008799175.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   4e-33   
ref|XP_008238962.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   4e-33   
ref|XP_009387906.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    128   4e-33   
ref|XP_010089090.1|  Short-chain dehydrogenase TIC 32                   128   5e-33   
ref|XP_006352310.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    127   5e-33   
ref|XP_010930751.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    127   7e-33   
gb|EEE60688.1|  hypothetical protein OsJ_14166                          126   7e-33   
gb|KFK28922.1|  hypothetical protein AALP_AA7G065600                    127   7e-33   
ref|XP_010904565.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    125   8e-33   
ref|XP_006587286.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    127   9e-33   
emb|CAE04461.1|  OSJNBa0029L02.2                                        127   1e-32   
ref|XP_010671837.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    127   1e-32   
ref|XP_009607829.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    124   1e-32   
ref|XP_006600032.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    122   1e-32   
ref|XP_004975222.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    126   2e-32   
ref|XP_007210846.1|  hypothetical protein PRUPE_ppa016184mg             127   2e-32   
ref|XP_006663260.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    126   2e-32   
gb|ABK22279.1|  unknown                                                 126   2e-32   
ref|XP_009802403.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    126   2e-32   
ref|XP_009802402.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    126   3e-32   
ref|XP_009595669.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    125   4e-32   
ref|XP_006587285.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    124   5e-32   
ref|XP_006492049.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    127   5e-32   
ref|XP_006421991.1|  hypothetical protein CICLE_v10006489mg             124   5e-32   
gb|EEC67796.1|  hypothetical protein OsI_35356                          127   6e-32   
emb|CDP05171.1|  unnamed protein product                                119   6e-32   
ref|XP_006837464.1|  hypothetical protein AMTR_s00107p00149370          123   6e-32   
ref|XP_010907218.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    125   8e-32   
ref|XP_002449113.1|  hypothetical protein SORBIDRAFT_05g005300          125   9e-32   
ref|XP_009350657.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    124   1e-31   
ref|XP_008392587.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    124   1e-31   
ref|XP_007152233.1|  hypothetical protein PHAVU_004G112700g             124   2e-31   
gb|ACF86600.1|  unknown                                                 124   2e-31   
ref|XP_006587284.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    124   2e-31   
ref|NP_001149089.1|  retinol dehydrogenase 12                           124   2e-31   
ref|XP_010053245.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    123   3e-31   
gb|KHN09320.1|  Short-chain dehydrogenase TIC 32, chloroplastic         123   4e-31   
ref|XP_006429053.1|  hypothetical protein CICLE_v10013882mg             119   4e-31   
gb|EEE51351.1|  hypothetical protein OsJ_32359                          122   6e-31   
gb|EEC67395.1|  hypothetical protein OsI_34553                          122   7e-31   
gb|AAK43511.1|AC020666_21  putative WW-domain oxidoreductase            122   8e-31   
ref|XP_003548174.2|  PREDICTED: short-chain dehydrogenase TIC 32,...    123   8e-31   
gb|AAP54899.2|  NAD dependent epimerase/dehydratase family protei...    122   9e-31   
tpg|DAA46192.1|  TPA: hypothetical protein ZEAMMB73_013074              121   1e-30   
ref|XP_009393455.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    121   1e-30   
gb|KDO51986.1|  hypothetical protein CISIN_1g020927mg                   118   2e-30   
ref|NP_001170354.1|  uncharacterized protein LOC100384331               120   2e-30   
ref|XP_011022673.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    120   2e-30   
gb|AFK36838.1|  unknown                                                 120   3e-30   
ref|XP_003634099.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    119   5e-30   
ref|XP_006385764.1|  hypothetical protein POPTR_0003s12890g             120   6e-30   
ref|NP_001131199.1|  hypothetical protein                               114   6e-30   
ref|XP_006343970.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    119   7e-30   
ref|XP_004245595.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    119   9e-30   
emb|CDP10262.1|  unnamed protein product                                119   1e-29   
ref|XP_004171149.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    118   2e-29   
dbj|BAJ92336.1|  predicted protein                                      118   2e-29   
ref|XP_004145893.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    118   2e-29   
ref|XP_006599558.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    118   3e-29   
ref|XP_004983758.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    118   3e-29   
ref|XP_002981917.1|  hypothetical protein SELMODRAFT_228800             117   4e-29   
gb|EMT28739.1|  WW domain-containing oxidoreductase                     117   4e-29   
gb|KFK22610.1|  hypothetical protein AALP_AAs41518U000100               113   4e-29   
ref|XP_002989636.1|  hypothetical protein SELMODRAFT_160296             117   4e-29   
ref|XP_002464989.1|  hypothetical protein SORBIDRAFT_01g029960          117   5e-29   
ref|XP_002982015.1|  hypothetical protein SELMODRAFT_445059             117   5e-29   
gb|ABK24078.1|  unknown                                                 117   5e-29   
ref|XP_003574296.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    117   6e-29   
ref|XP_009780082.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    117   6e-29   
ref|XP_008437509.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    117   6e-29   
ref|XP_007038743.1|  NAD(P)-binding Rossmann-fold superfamily pro...    117   7e-29   
ref|XP_009600057.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    116   7e-29   
ref|XP_008658239.1|  PREDICTED: uncharacterized protein LOC100272...    116   1e-28   
gb|ABG66238.1|  oxidoreductase, short chain dehydrogenase/reducta...    114   2e-28   
ref|XP_010053246.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    115   3e-28   
ref|XP_010671845.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    115   3e-28   
ref|XP_002513679.1|  short-chain dehydrogenase, putative                115   3e-28   
ref|XP_002982020.1|  hypothetical protein SELMODRAFT_421434             115   3e-28   
gb|EYU38339.1|  hypothetical protein MIMGU_mgv1a0103241mg               112   4e-28   
ref|NP_001065300.1|  Os10g0548000                                       114   5e-28   
gb|KHN41464.1|  Short-chain dehydrogenase TIC 32, chloroplastic         112   1e-27   
ref|NP_001119035.1|  short-chain dehydrogenase TIC 32                   112   2e-27   
ref|XP_008658240.1|  PREDICTED: uncharacterized protein LOC100272...    112   2e-27   
gb|EEC67396.1|  hypothetical protein OsI_34554                          113   2e-27   
ref|XP_002464991.1|  hypothetical protein SORBIDRAFT_01g029980          112   2e-27   
gb|EEE51352.1|  hypothetical protein OsJ_32360                          113   3e-27   
ref|XP_006587289.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    112   3e-27   
ref|XP_009375040.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    112   3e-27   
ref|XP_008658238.1|  PREDICTED: uncharacterized protein LOC100272...    112   5e-27   
ref|XP_008360719.1|  PREDICTED: uncharacterized protein LOC103424414    112   8e-27   
gb|EMS49665.1|  Retinol dehydrogenase 14                                110   1e-26   
ref|XP_006599561.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    109   3e-26   
ref|XP_007138035.1|  hypothetical protein PHAVU_009G175600g             108   4e-26   
ref|XP_007138034.1|  hypothetical protein PHAVU_009G175600g             108   5e-26   
ref|XP_010102667.1|  Short-chain dehydrogenase TIC 32                   106   5e-26   
emb|CDP12037.1|  unnamed protein product                                110   6e-26   
emb|CAE04462.3|  OSJNBa0029L02.3                                        107   6e-26   
ref|XP_007138033.1|  hypothetical protein PHAVU_009G175600g             108   8e-26   
gb|ACU15846.1|  unknown                                                 106   9e-26   
gb|KDO51984.1|  hypothetical protein CISIN_1g020927mg                   106   9e-26   
ref|XP_007218325.1|  hypothetical protein PRUPE_ppa008452mg             106   6e-25   
gb|EAZ10151.1|  hypothetical protein OsI_32466                          105   7e-25   
ref|XP_004980661.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    105   1e-24   
gb|KHN19273.1|  Short-chain dehydrogenase TIC 32, chloroplastic         104   2e-24   
ref|XP_001782679.1|  predicted protein                                  104   2e-24   
ref|XP_006421974.1|  hypothetical protein CICLE_v10005965mg             102   3e-24   
gb|EKC38323.1|  Retinol dehydrogenase 12                                106   4e-24   
ref|XP_002299525.2|  short-chain dehydrogenase Tic32 family protein     103   5e-24   
ref|XP_002981343.1|  hypothetical protein SELMODRAFT_420931             103   5e-24   
ref|NP_001242298.1|  uncharacterized protein LOC100801384               103   6e-24   
ref|XP_011029302.1|  PREDICTED: short-chain dehydrogenase TIC 32,...    103   7e-24   



>ref|XP_009624275.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=294

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+FKALNLPLNILINNAG+MFCPFQLS DG E QFATNHLGHFYL NLL+DKMKETA
Sbjct  99   AFADNFKALNLPLNILINNAGIMFCPFQLSGDGIEMQFATNHLGHFYLTNLLIDKMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             A+G+QGRIVNLSSVAHL  Y++GIRF KIN++SSY  K+AYGQSKLANILHAN
Sbjct  159  KASGIQGRIVNLSSVAHLCPYKDGIRFHKINNKSSYQDKLAYGQSKLANILHAN  212



>ref|XP_009624276.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Nicotiana tomentosiformis]
Length=268

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+FKALNLPLNILINNAG+MFCPFQLS DG E QFATNHLGHFYL NLL+DKMKETA
Sbjct  47   AFADNFKALNLPLNILINNAGIMFCPFQLSGDGIEMQFATNHLGHFYLTNLLIDKMKETA  106

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             A+G+QGRIVNLSSVAHL  Y++GIRF KIN++SSY  K+AYGQSKLANILHAN
Sbjct  107  KASGIQGRIVNLSSVAHLCPYKDGIRFHKINNKSSYQDKLAYGQSKLANILHAN  160



>gb|EPS67280.1| hypothetical protein M569_07496, partial [Genlisea aurea]
Length=284

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ALNLPLNILINNAGVMFCP+QLSEDG ETQFATNHLGHFYL NLLLDKMKETA
Sbjct  64   AFADHFIALNLPLNILINNAGVMFCPYQLSEDGIETQFATNHLGHFYLTNLLLDKMKETA  123

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSSVAHLY YE+GIRF+KIND+  Y  K AYGQSKLANILHAN
Sbjct  124  ERSGIEGRIVNLSSVAHLYVYEDGIRFEKINDKKRYDEKKAYGQSKLANILHAN  177



>ref|XP_011094836.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Sesamum 
indicum]
Length=320

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ALNLPLNILINNAG+MFCP+QLSEDG E QFATNHLGHFYL NLLLDKMKETA
Sbjct  99   AFADAFIALNLPLNILINNAGIMFCPYQLSEDGIEIQFATNHLGHFYLTNLLLDKMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N+TG++GRIVNLSS+AH++TY+ GIRF KIND+S Y+SK AYGQSKLANILHAN
Sbjct  159  NSTGIEGRIVNLSSIAHIHTYKGGIRFAKINDKSGYNSKRAYGQSKLANILHAN  212



>ref|XP_009624274.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=320

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+FKALNLPLNILINNAG+MFCPFQLS DG E QFATNHLGHFYL NLL+DKMKETA
Sbjct  99   AFADNFKALNLPLNILINNAGIMFCPFQLSGDGIEMQFATNHLGHFYLTNLLIDKMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             A+G+QGRIVNLSSVAHL  Y++GIRF KIN++SSY  K+AYGQSKLANILHAN
Sbjct  159  KASGIQGRIVNLSSVAHLCPYKDGIRFHKINNKSSYQDKLAYGQSKLANILHAN  212



>ref|XP_011077448.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Sesamum indicum]
Length=320

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCP++LSEDG E QFATNHLGHFYL NLLL+KMK+TA
Sbjct  99   AFADNFIALNLPLNILINNAGIMFCPYELSEDGIEMQFATNHLGHFYLTNLLLEKMKDTA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N+TG++GRI+NLSSVAHL+TYEEGIRF+ IND SSY  K AYGQSKLANILHAN
Sbjct  159  NSTGIEGRIINLSSVAHLHTYEEGIRFEHINDNSSYDDKKAYGQSKLANILHAN  212



>emb|CDP06637.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFADDF AL LPLNILINNAGVMFCP+QLS+DG E QFATNHLGHFYL NLLLDKMK TA
Sbjct  99   AFADDFYALGLPLNILINNAGVMFCPYQLSQDGIEMQFATNHLGHFYLTNLLLDKMKHTA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N+TG++GRIVNLSSVAH++TY  GIRFD+IND+ SY  K AYGQSKLANILHAN
Sbjct  159  NSTGIEGRIVNLSSVAHVHTYGGGIRFDRINDKDSYSDKKAYGQSKLANILHAN  212



>ref|XP_009763331.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana sylvestris]
 ref|XP_009763338.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana sylvestris]
Length=320

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD FKALNLPLNILINNAG+MFCPFQLSEDG E QFATNH+GHFYL NLL+DKMKET+
Sbjct  99   AFADKFKALNLPLNILINNAGIMFCPFQLSEDGIEMQFATNHIGHFYLTNLLIDKMKETS  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+ H Y YEEGI+F+KI+D+SSY  ++AYGQSKLAN+LH+N
Sbjct  159  KATGIQGRIVNLSSLLHQYPYEEGIQFNKISDKSSYQERLAYGQSKLANLLHSN  212



>gb|EYU41703.1| hypothetical protein MIMGU_mgv1a010276mg [Erythranthe guttata]
Length=317

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCP+QLSEDG E QFATNHLGHFYL NLLLDKMKETA
Sbjct  99   AFADNFIALNLPLNILINNAGIMFCPYQLSEDGIEIQFATNHLGHFYLTNLLLDKMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSSVAH++ Y+ GIRF+KIND+S Y  K AYGQSKLANILHAN
Sbjct  159  KCTGVEGRIVNLSSVAHIHPYKRGIRFEKINDKSRYDDKRAYGQSKLANILHAN  212



>ref|XP_009620213.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009620214.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009620215.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=301

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD  KALNLPLNILINNAG+MFCPFQLSEDG ETQFATNH+GHFYL NLL+DKMKET+
Sbjct  80   AFADKLKALNLPLNILINNAGIMFCPFQLSEDGIETQFATNHIGHFYLTNLLIDKMKETS  139

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+ H Y Y+EGI+F KI+D+SSY  ++AYGQSKLAN+LH+N
Sbjct  140  KATGIQGRIVNLSSILHQYPYKEGIQFHKISDKSSYQERLAYGQSKLANLLHSN  193



>ref|XP_009625387.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   171 bits (432),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCPFQLSEDG E QFATN+LGHFYL NLLLDKMKETA
Sbjct  35   AFADNFLALNLPLNILINNAGIMFCPFQLSEDGIEMQFATNYLGHFYLTNLLLDKMKETA  94

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRIVNLSSVAH+  Y EGI+F  IND++SY  K+AYGQSKLANILHAN
Sbjct  95   KATGIEGRIVNLSSVAHICPYREGIQFHNINDKNSYQDKLAYGQSKLANILHAN  148



>ref|XP_009620212.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=320

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD  KALNLPLNILINNAG+MFCPFQLSEDG ETQFATNH+GHFYL NLL+DKMKET+
Sbjct  99   AFADKLKALNLPLNILINNAGIMFCPFQLSEDGIETQFATNHIGHFYLTNLLIDKMKETS  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+ H Y Y+EGI+F KI+D+SSY  ++AYGQSKLAN+LH+N
Sbjct  159  KATGIQGRIVNLSSILHQYPYKEGIQFHKISDKSSYQERLAYGQSKLANLLHSN  212



>ref|XP_009763323.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana sylvestris]
Length=320

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCPFQLSEDG E QFATNHLGHFYL NLL+D MKETA
Sbjct  99   AFADNFIALNLPLNILINNAGIMFCPFQLSEDGIEMQFATNHLGHFYLTNLLIDNMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSSVAHL  Y++GI+F KIND+SSY  K+AYGQSKLANILHAN
Sbjct  159  KVSGIEGRIVNLSSVAHLCPYKKGIKFHKINDKSSYQDKLAYGQSKLANILHAN  212



>ref|XP_009780021.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCPFQLSEDG E QFATNHLGHFYL NLLLDKMKET 
Sbjct  99   AFADNFLALNLPLNILINNAGIMFCPFQLSEDGIEMQFATNHLGHFYLTNLLLDKMKETT  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRIVNLSSVAH+  Y EGI+F  +ND++SY  K+AYGQSKLANILHAN
Sbjct  159  KATGIEGRIVNLSSVAHICPYWEGIQFHNVNDKNSYQDKLAYGQSKLANILHAN  212



>ref|XP_006341052.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Solanum tuberosum]
Length=320

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FAD+FKAL+LPLNILINNAG+MFCPFQLSEDG E QFATNHLGHFYL NLLLDKMKETA 
Sbjct  100  FADNFKALDLPLNILINNAGIMFCPFQLSEDGVEMQFATNHLGHFYLTNLLLDKMKETAK  159

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            ++G++GRIVNLSSVAH+  Y+ GIRF KIN ++SY +K+AY QSKLANILHAN
Sbjct  160  SSGIEGRIVNLSSVAHICPYKGGIRFQKINQKNSYQNKLAYAQSKLANILHAN  212



>ref|XP_004249626.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Solanum 
lycopersicum]
Length=323

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCPFQLSEDG E QFATNHLGHFYL +LLLDKMKETA
Sbjct  99   AFADNFLALNLPLNILINNAGIMFCPFQLSEDGIEMQFATNHLGHFYLTSLLLDKMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +TG++GRIVNLSSVAHL    EGIRF  IND++SY  K+AYGQSKLAN+LHAN
Sbjct  159  KSTGIEGRIVNLSSVAHLVCPREGIRFQNINDKNSYQDKVAYGQSKLANLLHAN  212



>ref|XP_004246442.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Solanum 
lycopersicum]
Length=320

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD+FKAL+LPLNILINNAG+MFCPFQLSEDG E QFATNHLGHFYL NLLLDKMKET+
Sbjct  99   SFADNFKALDLPLNILINNAGIMFCPFQLSEDGVEMQFATNHLGHFYLTNLLLDKMKETS  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ++GV+GRIVNLSSVAH+  Y+ GIRF KIN ++SY +K+AY QSKLANILHAN
Sbjct  159  KSSGVEGRIVNLSSVAHICPYKGGIRFQKINKKNSYQNKLAYAQSKLANILHAN  212



>ref|XP_006349516.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Solanum tuberosum]
Length=323

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALNLPLNILINNAG+MFCPFQLSEDG E QFATNHLGHFYL N LLDKMKETA
Sbjct  99   AFADNFLALNLPLNILINNAGIMFCPFQLSEDGIEMQFATNHLGHFYLTNFLLDKMKETA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +TG++GRIVNLSSVAHL    EGIRF  IND++SY  K+AYGQSKLAN+LHAN
Sbjct  159  KSTGIEGRIVNLSSVAHLVCPREGIRFHNINDKNSYQDKVAYGQSKLANLLHAN  212



>ref|NP_001241121.1| uncharacterized protein LOC100795299 [Glycine max]
 ref|XP_006588449.1| PREDICTED: uncharacterized protein LOC100795299 isoform X1 [Glycine 
max]
 gb|ACU18739.1| unknown [Glycine max]
 gb|KHN05919.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=323

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F D+F AL LPLNILINNAGVMFCP+Q +EDG E QFATN+LGHF L NLLLDKMK+TA 
Sbjct  103  FVDNFIALGLPLNILINNAGVMFCPYQQTEDGIEMQFATNYLGHFLLTNLLLDKMKQTAK  162

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             TG++GRIVNLSS+AHLYTYEEGIRFD INDE  YH K AYGQSKLANILH N
Sbjct  163  DTGIEGRIVNLSSIAHLYTYEEGIRFDTINDEDGYHEKKAYGQSKLANILHTN  215



>ref|XP_007144454.1| hypothetical protein PHAVU_007G157500g [Phaseolus vulgaris]
 gb|ESW16448.1| hypothetical protein PHAVU_007G157500g [Phaseolus vulgaris]
Length=323

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F D+F AL LPLNILINNAGVMFCP+Q +EDG E QFATNHLGHF L NLLLDKMK+TA 
Sbjct  103  FVDNFIALALPLNILINNAGVMFCPYQKTEDGIEMQFATNHLGHFLLTNLLLDKMKQTAK  162

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             TG++GRIVNLSS+AHLYTYEEGIRFD IN+E  Y  K AYGQSKLANILHAN
Sbjct  163  ETGIEGRIVNLSSIAHLYTYEEGIRFDNINEEDGYSDKKAYGQSKLANILHAN  215



>gb|EYU26573.1| hypothetical protein MIMGU_mgv1a010245mg [Erythranthe guttata]
Length=318

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ALNLPLNILINNAG+MFCP+QLSEDG E QFATNHLGHFYL NLLL+KMK+TA
Sbjct  99   AFADSFIALNLPLNILINNAGIMFCPYQLSEDGIEMQFATNHLGHFYLTNLLLEKMKDTA  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ++G++GRI+NL+SVAHL+TYE+GI+F+ IND+SSY  K AYGQSKLAN+LHAN
Sbjct  159  KSSGIEGRILNLTSVAHLHTYEKGIQFEHINDQSSYQDKKAYGQSKLANLLHAN  212



>ref|XP_003637513.1| Retinol dehydrogenase [Medicago truncatula]
 gb|KEH42384.1| short-chain dehydrogenase TIC 32 [Medicago truncatula]
Length=256

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F ++F AL+LPLNILINNAGVMFCPFQL++DG E QFATNHLGHF L NLLL+KMK+TA
Sbjct  35   SFVENFLALDLPLNILINNAGVMFCPFQLTQDGIEMQFATNHLGHFLLTNLLLEKMKQTA  94

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRI+NLSS+AH YTYEEGIR D IND+  Y  K AYGQSKLANILHAN
Sbjct  95   KATGIEGRIINLSSIAHTYTYEEGIRLDNINDQIGYSDKKAYGQSKLANILHAN  148



>ref|NP_001042042.1| Os01g0151700 [Oryza sativa Japonica Group]
 dbj|BAB03618.1| putative pod-specific dehydrogenase SAC25 [Oryza sativa Japonica 
Group]
 dbj|BAB44039.1| putative pod-specific dehydrogenase SAC25 [Oryza sativa Japonica 
Group]
 dbj|BAF03956.1| Os01g0151700 [Oryza sativa Japonica Group]
 dbj|BAG94370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=321

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPF LSEDG E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFADQFNSMNLPLNILINNAGVMFCPFGLSEDGVEMQFATNHLGHFLLTNLLLDNMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI FDK+NDE +Y  KMAYGQSKLANILHA
Sbjct  161  KSTGIEGRIVNLSSVAHLHTYPKGIEFDKLNDEKTYDDKMAYGQSKLANILHA  213



>ref|XP_010047535.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Eucalyptus 
grandis]
 gb|KCW88920.1| hypothetical protein EUGRSUZ_A01247 [Eucalyptus grandis]
Length=322

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF +DF AL+LPLNILINNAG+MFCP+QLSEDG+E QFATNHLGHF L NLLLDKMK TA
Sbjct  101  AFVNDFIALDLPLNILINNAGIMFCPYQLSEDGFEVQFATNHLGHFLLTNLLLDKMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSS+AHL+TY+EGIRFD IND+  Y  K AYGQSKLANILHA+
Sbjct  161  RVSGIEGRIVNLSSIAHLHTYKEGIRFDDINDQLGYSDKKAYGQSKLANILHAS  214



>ref|XP_007027084.1| Putativepod-specific dehydrogenase SAC25 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07586.1| Putativepod-specific dehydrogenase SAC25 isoform 2, partial [Theobroma 
cacao]
Length=291

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALN  LNILINNAG+MFCPFQLS+DG E QFATNH+GHF L NLLLD MK TA
Sbjct  70   AFADNFLALNRRLNILINNAGIMFCPFQLSQDGIEVQFATNHIGHFLLTNLLLDNMKNTA  129

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+AH + Y+ GIRFDKI+++S Y+ K AYGQSKLANILHAN
Sbjct  130  KATGIQGRIVNLSSIAHSHCYKNGIRFDKISEKSGYNDKRAYGQSKLANILHAN  183



>gb|EAZ10566.1| hypothetical protein OsJ_00398 [Oryza sativa Japonica Group]
Length=336

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPF LSEDG E QFATNHLGHF L NLLLD MK TA
Sbjct  116  AFADQFNSMNLPLNILINNAGVMFCPFGLSEDGVEMQFATNHLGHFLLTNLLLDNMKATA  175

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI FDK+NDE +Y  KMAYGQSKLANILHA
Sbjct  176  KSTGIEGRIVNLSSVAHLHTYPKGIEFDKLNDEKTYDDKMAYGQSKLANILHA  228



>gb|EAY72561.1| hypothetical protein OsI_00427 [Oryza sativa Indica Group]
Length=336

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPF LSEDG E QFATNHLGHF L NLLLD MK TA
Sbjct  116  AFADQFNSMNLPLNILINNAGVMFCPFGLSEDGVEMQFATNHLGHFLLTNLLLDNMKATA  175

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI FDK+NDE +Y  KMAYGQSKLANILHA
Sbjct  176  KSTGIEGRIVNLSSVAHLHTYPKGIEFDKLNDEKTYDDKMAYGQSKLANILHA  228



>ref|XP_003637512.1| Retinol dehydrogenase [Medicago truncatula]
 gb|KEH42385.1| short-chain dehydrogenase TIC 32 [Medicago truncatula]
Length=323

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F ++F AL+LPLNILINNAGVMFCPFQL++DG E QFATNHLGHF L NLLL+KMK+TA
Sbjct  102  SFVENFLALDLPLNILINNAGVMFCPFQLTQDGIEMQFATNHLGHFLLTNLLLEKMKQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRI+NLSS+AH YTYEEGIR D IND+  Y  K AYGQSKLANILHAN
Sbjct  162  KATGIEGRIINLSSIAHTYTYEEGIRLDNINDQIGYSDKKAYGQSKLANILHAN  215



>ref|XP_006645504.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Oryza brachyantha]
Length=322

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPF+LSEDG E QFATNHLGHF L NLLLDKMK TA
Sbjct  103  AFADQFNSMNLPLNILINNAGVMFCPFELSEDGIEMQFATNHLGHFLLTNLLLDKMKATA  162

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAH +TY  GI FDK+NDE  Y+ KMAYGQSKLANILHA
Sbjct  163  KSTGIEGRIVNLSSVAHHHTYPNGIDFDKVNDEKIYNDKMAYGQSKLANILHA  215



>ref|XP_006381188.1| hypothetical protein POPTR_0006s08410g [Populus trichocarpa]
 gb|ERP58985.1| hypothetical protein POPTR_0006s08410g [Populus trichocarpa]
Length=271

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FAD+  +L+LPLNILINNAG+MFCP+QLSEDG E QFATNHLGHF L NLLLDKMKETA 
Sbjct  102  FADNLNSLDLPLNILINNAGIMFCPYQLSEDGIEMQFATNHLGHFLLTNLLLDKMKETAR  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TGV+GRIVNLSSVAH++TY++GIRF+ IND+  Y  K AYGQSKLANILHA
Sbjct  162  TTGVEGRIVNLSSVAHIHTYKDGIRFNNINDKKRYSDKRAYGQSKLANILHA  213



>ref|XP_002457359.1| hypothetical protein SORBIDRAFT_03g005980 [Sorghum bicolor]
 gb|EES02479.1| hypothetical protein SORBIDRAFT_03g005980 [Sorghum bicolor]
Length=320

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++ LPLNILINNAGVMFCPFQLS+DG E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFADQFNSMKLPLNILINNAGVMFCPFQLSKDGVEMQFATNHLGHFLLTNLLLDTMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +TG++GRIVNLSSVAH +TY +GI FDK+NDE  Y+ KMAYGQSKLAN+LHAN
Sbjct  161  KSTGIEGRIVNLSSVAHHHTYPKGIDFDKLNDEKIYNDKMAYGQSKLANLLHAN  214



>ref|XP_010111499.1| Short-chain dehydrogenase TIC 32 [Morus notabilis]
 gb|EXC31022.1| Short-chain dehydrogenase TIC 32 [Morus notabilis]
Length=322

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ALNLPLN+LINNAGVMFCPF LSEDG E QFATNHLGHF L NLL++KMKETA
Sbjct  101  AFVDSFNALNLPLNLLINNAGVMFCPFNLSEDGIEMQFATNHLGHFLLTNLLVEKMKETA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AHL+  E+GI+FDKIND++SY  K AYGQSKLANILHAN
Sbjct  161  RTTGIEGRIVNLSSIAHLHPCEDGIQFDKINDQNSYSDKRAYGQSKLANILHAN  214



>ref|XP_002309049.2| hypothetical protein POPTR_0006s08410g [Populus trichocarpa]
 gb|EEE92572.2| hypothetical protein POPTR_0006s08410g [Populus trichocarpa]
Length=287

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FAD+  +L+LPLNILINNAG+MFCP+QLSEDG E QFATNHLGHF L NLLLDKMKETA 
Sbjct  102  FADNLNSLDLPLNILINNAGIMFCPYQLSEDGIEMQFATNHLGHFLLTNLLLDKMKETAR  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TGV+GRIVNLSSVAH++TY++GIRF+ IND+  Y  K AYGQSKLANILHA
Sbjct  162  TTGVEGRIVNLSSVAHIHTYKDGIRFNNINDKKRYSDKRAYGQSKLANILHA  213



>ref|XP_010253253.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=286

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ALNLPLN+LINNAGVMF P+QLSEDG E QFATNHLGHF L NLLLDKMK TA
Sbjct  63   AFVDSFNALNLPLNMLINNAGVMFSPYQLSEDGIEMQFATNHLGHFLLTNLLLDKMKTTA  122

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
              +GV+GRIVNLSS+AH+YTYE GIRF+ INDES Y  K AYGQSKLANILHA
Sbjct  123  RVSGVEGRIVNLSSIAHVYTYEGGIRFEGINDESGYSDKKAYGQSKLANILHA  175



>ref|XP_003521337.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN09425.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=323

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAGVMFCPF+LSEDG E QFATNH+GHF+L+NLLLDKMK+TA
Sbjct  102  SFVDNFIALDLPLNILINNAGVMFCPFKLSEDGIEMQFATNHIGHFHLSNLLLDKMKQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRI+NLSS+AH YTY +GIRF+KIN+   Y +K AYGQSKLANILH N
Sbjct  162  KATGIEGRIINLSSIAHNYTYRKGIRFNKINERKGYGNKKAYGQSKLANILHTN  215



>gb|KHN48985.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=323

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F D+F AL +PLNILINNAGVMFCP+Q +EDG E QFATNHLGHF L  LLLDKMK+TA 
Sbjct  103  FVDNFIALGVPLNILINNAGVMFCPYQQTEDGIEMQFATNHLGHFLLTKLLLDKMKQTAK  162

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             TG++GRI+NLSS+AH+YTYEEGIRFD INDE  Y  K AYGQSKLANILH N
Sbjct  163  DTGIEGRIINLSSIAHVYTYEEGIRFDNINDEDGYSDKKAYGQSKLANILHTN  215



>ref|XP_003542461.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic isoform 
1 [Glycine max]
Length=323

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F D+F AL +PLNILINNAGVMFCP+Q +EDG E QFATNHLGHF L  LLLDKMK+TA 
Sbjct  103  FVDNFIALGVPLNILINNAGVMFCPYQQTEDGIEMQFATNHLGHFLLTKLLLDKMKQTAK  162

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             TG++GRI+NLSS+AH+YTYEEGIRFD INDE  Y  K AYGQSKLANILH N
Sbjct  163  DTGIEGRIINLSSIAHVYTYEEGIRFDNINDEDGYSDKKAYGQSKLANILHTN  215



>ref|XP_010253252.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=324

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ALNLPLN+LINNAGVMF P+QLSEDG E QFATNHLGHF L NLLLDKMK TA
Sbjct  101  AFVDSFNALNLPLNMLINNAGVMFSPYQLSEDGIEMQFATNHLGHFLLTNLLLDKMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
              +GV+GRIVNLSS+AH+YTYE GIRF+ INDES Y  K AYGQSKLANILHA
Sbjct  161  RVSGVEGRIVNLSSIAHVYTYEGGIRFEGINDESGYSDKKAYGQSKLANILHA  213



>ref|XP_002273550.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Vitis 
vinifera]
 emb|CBI32603.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D+F ALNLPLN+LINNAG+MFCPFQLS+DG E+QFATNH+GHF L NLLLDKMK TA
Sbjct  101  AFVDNFNALNLPLNLLINNAGIMFCPFQLSQDGIESQFATNHIGHFLLTNLLLDKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
              TG++GRIVNLSS+AHL+TYE GI+FD INDE SY  K AYGQSKLANILHA
Sbjct  161  RTTGIEGRIVNLSSIAHLHTYENGIKFDGINDEKSYSDKRAYGQSKLANILHA  213



>emb|CDM81286.1| unnamed protein product [Triticum aestivum]
Length=320

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F A+NLPLNILINNAGVMFCPFQLSED  E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFADQFNAMNLPLNILINNAGVMFCPFQLSEDEVEMQFATNHLGHFLLTNLLLDNMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI FD++ND+  Y+ KMAYGQSKLANILHA
Sbjct  161  KSTGIEGRIVNLSSVAHLHTYPKGILFDQLNDKKIYNDKMAYGQSKLANILHA  213



>ref|XP_003554326.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN02422.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=323

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAGVMFCPF+LSEDG E QFATNHLGHF+L NLLLDKM++TA
Sbjct  102  SFVDNFIALDLPLNILINNAGVMFCPFKLSEDGIEMQFATNHLGHFHLTNLLLDKMQQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRI+NLSS+AH YTY +GIRF+KIN+   Y +K AYGQSKLANILH N
Sbjct  162  KATGIEGRIINLSSIAHNYTYRKGIRFNKINERKGYGNKKAYGQSKLANILHTN  215



>dbj|BAJ90409.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91920.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPFQLSED  E QFATNHLGHF L NLLL+ MK TA
Sbjct  101  AFADQFNSMNLPLNILINNAGVMFCPFQLSEDEVEMQFATNHLGHFLLTNLLLENMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI+FD++ND+ +Y+ KMAYGQSKLANILHA
Sbjct  161  KSTGIEGRIVNLSSVAHLHTYPKGIQFDQLNDKKTYNDKMAYGQSKLANILHA  213



>ref|XP_004968226.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Setaria italica]
Length=320

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++ LPLNILINNAGVMFCPFQLS+DG E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFADQFNSMKLPLNILINNAGVMFCPFQLSKDGVEMQFATNHLGHFLLTNLLLDNMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAH +TY +GI FDK+NDE  Y+ KMAYGQSKLAN+LHA
Sbjct  161  KSTGIEGRIVNLSSVAHHHTYPKGIDFDKLNDEKIYNDKMAYGQSKLANLLHA  213



>ref|XP_007205567.1| hypothetical protein PRUPE_ppa008709mg [Prunus persica]
 gb|EMJ06766.1| hypothetical protein PRUPE_ppa008709mg [Prunus persica]
Length=322

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCP +LSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFVDSFNALDLPLNLLINNAGVMFCPHRLSEDGIELQFATNHLGHFLLTNLLLEKMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+AH++TY++GI FDKIND  SY+ K AYGQSKLANILHAN
Sbjct  161  RTTGVEGRIVNLSSIAHVHTYKDGIYFDKINDRMSYNDKRAYGQSKLANILHAN  214



>ref|XP_004302745.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=323

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCP QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFVDSFIALDLPLNLLINNAGVMFCPHQLSEDGIELQFATNHLGHFLLTNLLLEKMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AH++TY  GIRF++IND S Y  K AYGQSKLANILHAN
Sbjct  161  KTTGIEGRIVNLSSIAHVHTYNNGIRFERINDRSGYSDKRAYGQSKLANILHAN  214



>gb|EEC69960.1| hypothetical protein OsI_00419 [Oryza sativa Indica Group]
Length=421

 Score =   164 bits (415),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPF LSEDG E QFATNHLGHF L NLLLD MK TA
Sbjct  116  AFADQFNSMNLPLNILINNAGVMFCPFGLSEDGVEMQFATNHLGHFLLTNLLLDNMKATA  175

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++ RIVNLSSVAHL+TY +GI FDK+NDE +Y  KMAYGQSKLANILHA
Sbjct  176  KSTGIESRIVNLSSVAHLHTYPKGIEFDKLNDEKTYDDKMAYGQSKLANILHA  228



>ref|XP_004495007.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004495008.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=322

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F  +F AL+LPLNILINNAGVMFCPFQLS DG E QFATNHLGHF L NLLLDKMK+TA
Sbjct  101  SFVRNFLALHLPLNILINNAGVMFCPFQLSYDGIEMQFATNHLGHFLLTNLLLDKMKQTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ++G++GRI+NLSS+AH YTYEEGIR D IND+  Y  K AYGQSKLANILHAN
Sbjct  161  KSSGIEGRIINLSSIAHTYTYEEGIRLDNINDKIGYSDKKAYGQSKLANILHAN  214



>ref|XP_008241306.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Prunus mume]
Length=322

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF + F AL+LPLN+LINNAGVMFCP QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFVNSFNALDLPLNLLINNAGVMFCPHQLSEDGIELQFATNHLGHFLLTNLLLEKMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+AH++TY++GI FDKIND  SY+ K AYGQSKLANILHAN
Sbjct  161  RTTGVEGRIVNLSSIAHVHTYKDGIHFDKINDWISYNDKRAYGQSKLANILHAN  214



>ref|XP_007162660.1| hypothetical protein PHAVU_001G169500g [Phaseolus vulgaris]
 gb|ESW34654.1| hypothetical protein PHAVU_001G169500g [Phaseolus vulgaris]
Length=322

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAGVMFCPF+LSEDG E QFATNHLGHF L NLLL+KMK+TA
Sbjct  101  SFVDNFIALDLPLNILINNAGVMFCPFKLSEDGIEMQFATNHLGHFLLTNLLLEKMKQTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG++GRI+NLSS+AH YTY +GIRF+KIN+   Y  K AYGQSKLANILH N
Sbjct  161  QATGIEGRIINLSSIAHNYTYRKGIRFNKINERKGYGKKKAYGQSKLANILHTN  214



>gb|EPS67753.1| hypothetical protein M569_07022, partial [Genlisea aurea]
Length=314

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F AL+LPL+ILINNAG+MFCPF LSEDG ETQFATNHLGHFYL NLLL+KMK+T 
Sbjct  99   AFADEFLALDLPLHILINNAGIMFCPFALSEDGIETQFATNHLGHFYLTNLLLEKMKDTV  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRIVNLSSVAH++ Y+ GIRF+K+ND+  Y    AYGQSKLANILHAN
Sbjct  159  RNSGVEGRIVNLSSVAHVHPYKGGIRFEKLNDKKKYDENKAYGQSKLANILHAN  212



>ref|XP_008363853.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Malus domestica]
Length=290

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCP QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  66   AFVDSFSALDLPLNLLINNAGVMFCPHQLSEDGIEMQFATNHLGHFLLTNLLLEKMKHTA  125

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+A +++YE GIRF +IND SSY  K AYGQSKLANILHAN
Sbjct  126  RTTGVEGRIVNLSSIAXIHSYEGGIRFKEINDRSSYSDKRAYGQSKLANILHAN  179



>ref|XP_008369963.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Malus domestica]
Length=258

 Score =   159 bits (403),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCPFQLSEDG E QFATNHLGHF L NLLL+KMK T 
Sbjct  101  AFVDSFNALDLPLNLLINNAGVMFCPFQLSEDGIEMQFATNHLGHFLLTNLLLEKMKTTV  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+ RIVNLSS+AH  TYE GIR D+IND  SY +  AYGQSKLANILHAN
Sbjct  161  QTTGVEARIVNLSSIAHTSTYEGGIRLDRINDPDSYSTLNAYGQSKLANILHAN  214



>gb|EMT03523.1| WW domain-containing oxidoreductase [Aegilops tauschii]
Length=335

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPFQLSED  E QFATNHLGHF L NLLLD MK TA
Sbjct  116  AFADQFNSMNLPLNILINNAGVMFCPFQLSEDEVEMQFATNHLGHFLLTNLLLDNMKTTA  175

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI FD++ND+  Y+ KMAYGQSKLANILHA
Sbjct  176  KSTGIEGRIVNLSSVAHLHTYPKGILFDQLNDKKIYNDKMAYGQSKLANILHA  228



>ref|XP_009338773.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Pyrus x bretschneideri]
Length=325

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCP QLSEDG E QFATNHLGHF L N LL+KMK TA
Sbjct  101  AFVDSFSALDLPLNLLINNAGVMFCPHQLSEDGIEMQFATNHLGHFLLTNHLLEKMKHTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+AH+++YE+GIRF++IN+ SSY  K AYGQSKLANILHAN
Sbjct  161  RTTGVEGRIVNLSSIAHIHSYEDGIRFEEINNRSSYSDKRAYGQSKLANILHAN  214



>ref|XP_008363852.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCP QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFVDSFSALDLPLNLLINNAGVMFCPHQLSEDGIEMQFATNHLGHFLLTNLLLEKMKHTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+A +++YE GIRF +IND SSY  K AYGQSKLANILHAN
Sbjct  161  RTTGVEGRIVNLSSIAXIHSYEGGIRFKEINDRSSYSDKRAYGQSKLANILHAN  214



>gb|EMS50830.1| Retinol dehydrogenase 14 [Triticum urartu]
Length=354

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPFQLSED  E QFATNHLGHF L NLLLD MK TA
Sbjct  135  AFADQFNSMNLPLNILINNAGVMFCPFQLSEDEVEMQFATNHLGHFLLTNLLLDNMKTTA  194

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI FD++ND+  Y+ KMAYGQSKLANILHA
Sbjct  195  KSTGIEGRIVNLSSVAHLHTYPKGILFDQLNDKKIYNDKMAYGQSKLANILHA  247



>ref|XP_009384884.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=324

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF+D F +++LPLNILINNAGVMFCP QLSEDG E QFATNH+GHF L NLLL+KMK TA
Sbjct  101  AFSDKFLSMDLPLNILINNAGVMFCPHQLSEDGTEMQFATNHIGHFQLTNLLLEKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSSVAH+YTYE+GIRF ++N++  Y SK AYGQSKLANILHAN
Sbjct  161  RKTGIEGRIVNLSSVAHIYTYEDGIRFSELNEKYGYSSKKAYGQSKLANILHAN  214



>ref|XP_007027083.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY07585.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=391

 Score =   162 bits (410),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F ALN  LNILINNAG+MFCPFQLS+DG E QFATNH+GHF L NLLLD MK TA
Sbjct  170  AFADNFLALNRRLNILINNAGIMFCPFQLSQDGIEVQFATNHIGHFLLTNLLLDNMKNTA  229

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+AH + Y+ GIRFDKI+++S Y+ K AYGQSKLANILHAN
Sbjct  230  KATGIQGRIVNLSSIAHSHCYKNGIRFDKISEKSGYNDKRAYGQSKLANILHAN  283



>ref|XP_008795035.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Phoenix 
dactylifera]
Length=320

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F +++LPLNILINNAGVMFCP+QLS+DG E  FATNHLGHF L NLLL+KMK T 
Sbjct  101  AFADKFISMDLPLNILINNAGVMFCPYQLSDDGIEMHFATNHLGHFLLTNLLLEKMKSTE  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AHL++Y+EGIRFDK+ND+  Y  K AYGQSKLANILHAN
Sbjct  161  RKTGIEGRIVNLSSIAHLHSYDEGIRFDKLNDKDGYSDKRAYGQSKLANILHAN  214



>emb|CDY10440.1| BnaCnng03410D [Brassica napus]
Length=325

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+LPLNILINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALHLPLNILINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY+EGI+F+ IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSIAHIYTYQEGIQFNSINDICSYSDKKAYGQSKLANILHAN  214



>ref|XP_009122769.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Brassica 
rapa]
Length=331

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+ PLNILINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALHRPLNILINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY+EGI+F+ IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSIAHIYTYQEGIQFNSINDICSYSDKKAYGQSKLANILHAN  214



>emb|CDY40365.1| BnaA10g27030D [Brassica napus]
Length=331

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+LPLNILINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALHLPLNILINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY+EGI+F+ IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSIAHIYTYQEGIQFNSINDICSYSDKKAYGQSKLANILHAN  214



>ref|XP_009414312.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=320

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F +L+LPLNILINNAGVMFCP+QLSEDG E QFATNHLGHF+L NLLLDKMK TA
Sbjct  101  AFADKFLSLDLPLNILINNAGVMFCPYQLSEDGIEMQFATNHLGHFFLTNLLLDKMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AHL TYE GI FDK+N +  Y  K AYGQSKLANILHAN
Sbjct  161  EKTGIEGRIVNLSSIAHLNTYEGGIWFDKLNHKEVYLDKKAYGQSKLANILHAN  214



>gb|AAM13049.1| putative protein [Arabidopsis thaliana]
 gb|AAN15622.1| putative protein [Arabidopsis thaliana]
Length=331

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+N+SSVAH+YTY+EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNVSSVAHIYTYQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>gb|ADE75710.1| unknown [Picea sitchensis]
Length=317

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA+DF ALNLPLNILINNAGVMFCPF+LSEDG E  FATNH+GHF L NLLLD MK+TA 
Sbjct  102  FANDFHALNLPLNILINNAGVMFCPFKLSEDGLEMHFATNHVGHFLLTNLLLDNMKKTAK  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TGV+GR+VNLSSVAH  TY+EGI+F++INDES Y  K AYGQSKLANILHA
Sbjct  162  ETGVEGRVVNLSSVAHFLTYDEGIQFNRINDESGYSDKKAYGQSKLANILHA  213



>ref|NP_568102.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AED90487.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=331

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+N+SSVAH+YTY+EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNVSSVAHIYTYQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>ref|XP_003568767.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Brachypodium distachyon]
Length=320

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA+ F ++NLPLNILINNAGVMFCPFQLSED  E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFAEQFNSMNLPLNILINNAGVMFCPFQLSEDEVEMQFATNHLGHFLLTNLLLDNMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAHL+TY +GI+FD++ND+  Y+ K+AYGQSKLANILHA
Sbjct  161  KSTGIEGRIVNLSSVAHLHTYPKGIQFDELNDKKIYNDKLAYGQSKLANILHA  213



>ref|XP_003625499.1| Retinol dehydrogenase [Medicago truncatula]
 gb|AES81717.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=324

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAG+MFCPF++SE+G E QFATNHLGHF L NLLLDKMK+TA
Sbjct  102  SFVDNFIALDLPLNILINNAGIMFCPFKISEEGIEMQFATNHLGHFLLTNLLLDKMKQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTY-EEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRI+NLSS+AH YTY  +GI+F+KIND+  Y SK AYGQSKLANILHAN
Sbjct  162  KTTGIEGRIINLSSIAHRYTYFRKGIKFEKINDKKGYSSKKAYGQSKLANILHAN  216



>gb|AAM63701.1| putativepod-specific dehydrogenase SAC25 [Arabidopsis thaliana]
Length=331

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+N+SSVAH+YTY+EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNVSSVAHIYTYQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>gb|ABN05708.1| Short-chain dehydrogenase/reductase SDR [Medicago truncatula]
Length=321

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAG+MFCPF++SE+G E QFATNHLGHF L NLLLDKMK+TA
Sbjct  102  SFVDNFIALDLPLNILINNAGIMFCPFKISEEGIEMQFATNHLGHFLLTNLLLDKMKQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTY-EEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRI+NLSS+AH YTY  +GI+F+KIND+  Y SK AYGQSKLANILHAN
Sbjct  162  KTTGIEGRIINLSSIAHRYTYFRKGIKFEKINDKKGYSSKKAYGQSKLANILHAN  216



>tpg|DAA53452.1| TPA: hypothetical protein ZEAMMB73_545165, partial [Zea mays]
Length=287

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ++ LPLNILINNAGVMFCPFQLS+DG E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFVDQFNSMKLPLNILINNAGVMFCPFQLSKDGVEMQFATNHLGHFLLTNLLLDTMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAH +TY +GI FD +NDE  Y+ KMAYGQSKLAN+LHA
Sbjct  161  KSTGIEGRIVNLSSVAHHHTYPKGIDFDNLNDEKIYNDKMAYGQSKLANLLHA  213



>ref|XP_002881514.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH57773.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=321

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D F ALN+PLNILINNAGVMFCPF+LSEDG E+QFATNH+GHF L NLLLDKMK TA
Sbjct  101  SFVDQFLALNVPLNILINNAGVMFCPFKLSEDGIESQFATNHIGHFLLTNLLLDKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GVQGRIVNLSS+AH YTY EGI+F  IND   Y  + AYGQSKLAN+LH+N
Sbjct  161  RESGVQGRIVNLSSIAHTYTYPEGIKFQGINDPDGYSERRAYGQSKLANLLHSN  214



>ref|XP_006398712.1| hypothetical protein EUTSA_v10013579mg [Eutrema salsugineum]
 gb|ESQ40165.1| hypothetical protein EUTSA_v10013579mg [Eutrema salsugineum]
Length=437

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  207  AFVRDFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKSTA  266

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  267  KTSGVEGRILNLSSIAHIYTYPEGIQFDSINDICSYSDKRAYGQSKLANILHAN  320



>ref|XP_009130710.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=269

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+LPLN+LINNAGVMFCP+QLSED  E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALHLPLNLLINNAGVMFCPYQLSEDEIELQFATNHIGHFLLTNLLLDTMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY+EGI+FD IND   Y  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSIAHIYTYKEGIKFDSINDICCYSDKRAYGQSKLANILHAN  214



>gb|KDP35604.1| hypothetical protein JCGZ_09042 [Jatropha curcas]
Length=322

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FAD F ALNLPLNILINNAG+MFCP+QLSEDG E QFATNH+GHF L NL+LDKMKETA 
Sbjct  102  FADKFIALNLPLNILINNAGIMFCPYQLSEDGIEMQFATNHIGHFLLTNLVLDKMKETAR  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TG++GRIVNLSS+AH++TY+ GI+FD IN++  Y  K AYGQSKLANILHA
Sbjct  162  TTGIEGRIVNLSSIAHIHTYKRGIQFDDINNKRRYSDKRAYGQSKLANILHA  213



>tpg|DAA52893.1| TPA: hypothetical protein ZEAMMB73_523779 [Zea mays]
Length=243

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ++ LPLNILINNAGVMFCPFQLS+DG E QFATNHLGHF L NLLLD MK TA
Sbjct  24   AFVDQFNSIKLPLNILINNAGVMFCPFQLSKDGVEMQFATNHLGHFLLTNLLLDTMKATA  83

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAH +TY +GI FD +NDE  Y+ KMAYGQSKLAN+LHA
Sbjct  84   KSTGIEGRIVNLSSVAHHHTYPKGIDFDNLNDEKIYNDKMAYGQSKLANLLHA  136



>ref|XP_010684103.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=328

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +L+LPLNILINNAG+MFCPF+LSEDG E QFATNH+GHF L N+LLDKMK+TA 
Sbjct  103  FAAEFLSLDLPLNILINNAGIMFCPFKLSEDGIELQFATNHIGHFLLTNMLLDKMKQTAK  162

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TG++GRIVNLSS+AHL+TY  GIRFD INDE  Y  K AYGQSKLAN+LHA
Sbjct  163  TTGIEGRIVNLSSIAHLHTYPGGIRFDNINDEVGYSDKRAYGQSKLANVLHA  214



>ref|XP_010490715.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010490716.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=331

 Score =   159 bits (402),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCPFQLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPFQLSEDGIELQFATNHIGHFLLTNLLLDTMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSSVAH+YT +EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSVAHIYTNQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>ref|NP_001182780.1| retinol dehydrogenase 11 [Zea mays]
 gb|ACF84434.1| unknown [Zea mays]
 gb|ACF85682.1| unknown [Zea mays]
 gb|ACL54500.1| unknown [Zea mays]
 tpg|DAA53453.1| TPA: retinol dehydrogenase 11 [Zea mays]
Length=320

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ++ LPLNILINNAGVMFCPFQLS+DG E QFATNHLGHF L NLLLD MK TA
Sbjct  101  AFVDQFNSMKLPLNILINNAGVMFCPFQLSKDGVEMQFATNHLGHFLLTNLLLDTMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAH +TY +GI FD +NDE  Y+ KMAYGQSKLAN+LHA
Sbjct  161  KSTGIEGRIVNLSSVAHHHTYPKGIDFDNLNDEKIYNDKMAYGQSKLANLLHA  213



>ref|XP_002870978.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47237.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=331

 Score =   159 bits (402),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK T+
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTS  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ++GV+GRI+N+SSVAH+YTY+EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KSSGVEGRILNVSSVAHIYTYQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>ref|XP_008810802.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Phoenix dactylifera]
Length=320

 Score =   158 bits (400),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD F +++LPLNILINNAG+MFC +QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  SFADKFISMDLPLNILINNAGIMFCAYQLSEDGIEMQFATNHLGHFLLTNLLLEKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AHL++Y+EGIRFD +ND   Y  K AYGQSKLANILHAN
Sbjct  161  RKTGIEGRIVNLSSIAHLHSYDEGIRFDNLNDSDGYSDKKAYGQSKLANILHAN  214



>gb|KFK24712.1| hypothetical protein AALP_AA8G015000 [Arabis alpina]
Length=333

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL LPLNILINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALKLPLNILINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSSVAH+YTY++GI+FD IND   Y  K AYGQSKLANILH N
Sbjct  161  KTSGVEGRILNLSSVAHIYTYQDGIKFDSINDICRYSDKRAYGQSKLANILHMN  214



>emb|CDY55418.1| BnaCnng28820D [Brassica napus]
Length=299

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF +DF AL+LPLN+LINNAG+MFCP+QLS+DG E QFATNH+GHF L NLLLD MK TA
Sbjct  69   AFVNDFHALHLPLNLLINNAGLMFCPYQLSDDGIELQFATNHIGHFLLTNLLLDTMKTTA  128

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+N+SS+AH+YTY+EGI+FD IND S Y  K +YGQSKLANILHAN
Sbjct  129  KTSGVEGRILNISSIAHIYTYQEGIQFDSINDISCYSDKKSYGQSKLANILHAN  182



>emb|CDX81232.1| BnaC09g06430D [Brassica napus]
Length=321

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F   F ALNLPLNILINNAGVMFCPFQL+EDG E+QFATNH+GHF L NLLLDKMK +A
Sbjct  101  SFVHQFLALNLPLNILINNAGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSSA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSSVAH YTY EGI+FD IND  +Y  K AYGQSKLAN+LH+N
Sbjct  161  RESGIEGRIVNLSSVAHTYTYTEGIKFDSINDPDTYSEKKAYGQSKLANLLHSN  214



>ref|XP_002531343.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF31050.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=322

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FAD+F AL+LPLN+LINNAG+MFCP+QLSEDG E QFATNH+GHF L NLLL+KMKETA 
Sbjct  102  FADNFIALDLPLNLLINNAGIMFCPYQLSEDGIEIQFATNHIGHFLLTNLLLEKMKETAR  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TG++GRIVNLSS+AH++TY+ GI FD +N++ SY  K AYGQSKLANILHA
Sbjct  162  TTGIEGRIVNLSSIAHIHTYKGGILFDDLNNKRSYSDKRAYGQSKLANILHA  213



>ref|XP_010937675.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Elaeis guineensis]
Length=320

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD F +++LPLNILINNAG+MFCP+QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  SFADKFISMDLPLNILINNAGIMFCPYQLSEDGIEMQFATNHLGHFLLTNLLLEKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
               G++GRIVNLSS+AHL++Y+EGIRFD ++D   Y  K AYGQSKLANILHAN
Sbjct  161  RKMGIEGRIVNLSSIAHLHSYDEGIRFDNLSDTDGYSDKKAYGQSKLANILHAN  214



>ref|XP_009141671.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Brassica rapa]
Length=321

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F   F ALNLPLNILINNAGVMFCPFQL+EDG E+QFATNH+GHF L NLLLDKMK +A
Sbjct  101  SFVHQFLALNLPLNILINNAGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSSA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSSVAH YTY EGI+FD IND  +Y  K AYGQSKLAN+LH+N
Sbjct  161  RESGIEGRIVNLSSVAHTYTYTEGIKFDSINDPDTYSEKKAYGQSKLANLLHSN  214



>emb|CDY18436.1| BnaA04g21510D [Brassica napus]
Length=321

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F   F ALNLPLNILINNAGVMFCPFQL+EDG E+QFATNH+GHF L NLLLDKMK +A
Sbjct  101  SFVHQFLALNLPLNILINNAGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSSA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSSVAH YTY EGI+FD IND  +Y  K AYGQSKLAN+LH+N
Sbjct  161  RESGIEGRIVNLSSVAHTYTYTEGIKFDSINDPDTYSEKKAYGQSKLANLLHSN  214



>gb|ACJ84304.1| unknown [Medicago truncatula]
Length=324

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAG+MFCPF++SE+G E QFATNHLGHF L NLLLDKMK+TA
Sbjct  102  SFVDNFIALDLPLNILINNAGIMFCPFKISEEGIEMQFATNHLGHFLLTNLLLDKMKQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTY-EEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRI+NLSS+AH YTY  +GI+F+KIND+  + SK AYGQSKLANILHAN
Sbjct  162  KTTGIEGRIINLSSIAHRYTYFRKGIKFEKINDKKGHSSKKAYGQSKLANILHAN  216



>ref|NP_181290.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC23625.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AAM20410.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AAN65131.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEC09413.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=321

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D F ALN+PLNILINNAGVMFCPF+L+EDG E+QFATNH+GHF L NLLLDKMK TA
Sbjct  101  SFVDQFLALNVPLNILINNAGVMFCPFKLTEDGIESQFATNHIGHFLLTNLLLDKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GVQGRIVNLSS+AH YTY EGI+F  IND + Y  + AYGQSKL+N+LH+N
Sbjct  161  RESGVQGRIVNLSSIAHTYTYSEGIKFQGINDPAGYSERRAYGQSKLSNLLHSN  214



>ref|XP_010423848.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSSVAH+YT +EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSVAHIYTNQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>emb|CDY11217.1| BnaA03g00530D [Brassica napus]
Length=331

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+LPLN+LINNAGVMFCP+QLSED  E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALHLPLNLLINNAGVMFCPYQLSEDEIELQFATNHIGHFLLTNLLLDTMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY+EGI+FD IND   Y  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSIAHIYTYKEGIKFDSINDICCYSDKRAYGQSKLANILHAN  214



>gb|AFK45597.1| unknown [Medicago truncatula]
Length=324

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F D+F AL+LPLNILINNAG+MFCPF++SE+G E QFATNHLGHF L NLLLDKMK+TA
Sbjct  102  SFVDNFIALDLPLNILINNAGIMFCPFKISEEGIEMQFATNHLGHFLLTNLLLDKMKQTA  161

Query  182  NATGVQGRIVNLSSVAHLYTY-EEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRI+NLSS+AH YTY  +GI+F+KIND+  + SK AYGQSKLANILHAN
Sbjct  162  KTTGIEGRIINLSSIAHRYTYFRKGIKFEKINDKKGHSSKKAYGQSKLANILHAN  216



>ref|XP_010452099.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSSVAH+YT +EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSVAHIYTNQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>ref|XP_009130709.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=331

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  DF AL+LPLN+LINNAGVMFCP+QLSED  E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVRDFHALHLPLNLLINNAGVMFCPYQLSEDEIELQFATNHIGHFLLTNLLLDTMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+NLSS+AH+YTY+EGI+FD IND   Y  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNLSSIAHIYTYKEGIKFDSINDICCYSDKRAYGQSKLANILHAN  214



>gb|KDO44661.1| hypothetical protein CISIN_1g023054mg [Citrus sinensis]
Length=288

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F ALNLPLNILINNAG+MFCP+Q+SEDG E QFATNH+GHF L NLLLD M  TA 
Sbjct  66   FAQNFIALNLPLNILINNAGIMFCPYQISEDGIEMQFATNHIGHFLLTNLLLDTMNRTAK  125

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             TG++GRIVNLSS+AH YTY+ GIRF KIND + Y  K AYGQSKLANILHAN
Sbjct  126  ETGIEGRIVNLSSIAHQYTYKGGIRFQKINDRAGYSDKKAYGQSKLANILHAN  178



>ref|XP_009419948.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=321

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA  F +++LPLNILINNAGVMFCPFQLSEDG E QFATNHLGHF L NLLL++MK TA
Sbjct  101  AFAGQFLSMDLPLNILINNAGVMFCPFQLSEDGIELQFATNHLGHFLLTNLLLERMKSTA  160

Query  182  NATGVQGRIVNLSSVAH-LYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AH L+ YEE IRFDK+ND+ +Y  K AYGQSKLANILHAN
Sbjct  161  EETGIEGRIVNLSSIAHLLHRYEEVIRFDKLNDKDTYSDKKAYGQSKLANILHAN  215



>gb|KHF98432.1| Short-chain dehydrogenase TIC 32, chloroplastic [Gossypium arboreum]
Length=319

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F AL+LPLNILINNAG+MFCPFQLS+DG E Q ATNH+GHF L NLLLD MK T 
Sbjct  121  AFADNFIALHLPLNILINNAGIMFCPFQLSQDGIEVQLATNHIGHFLLTNLLLDTMKNTV  180

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+AH Y Y +GIRF KIN +  Y  K AYGQSKLANILHAN
Sbjct  181  KATGIQGRIVNLSSIAHHYCYYKGIRFHKINHKQGYSEKRAYGQSKLANILHAN  234



>gb|KHF98431.1| Short-chain dehydrogenase TIC 32, chloroplastic [Gossypium arboreum]
Length=342

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD+F AL+LPLNILINNAG+MFCPFQLS+DG E Q ATNH+GHF L NLLLD MK T 
Sbjct  121  AFADNFIALHLPLNILINNAGIMFCPFQLSQDGIEVQLATNHIGHFLLTNLLLDTMKNTV  180

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ATG+QGRIVNLSS+AH Y Y +GIRF KIN +  Y  K AYGQSKLANILHAN
Sbjct  181  KATGIQGRIVNLSSIAHHYCYYKGIRFHKINHKQGYSEKRAYGQSKLANILHAN  234



>ref|XP_009409529.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F +++LPL+ILINNAGVMFCP+QLS DG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFADKFLSMDLPLDILINNAGVMFCPYQLSRDGIEMQFATNHLGHFLLTNLLLEKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRI+NLSS+AH +TY+ GI FDK+ND+  Y  K AYGQSKLANILHAN
Sbjct  161  KKTGMEGRIINLSSIAHKHTYKGGIWFDKLNDKDVYSDKKAYGQSKLANILHAN  214



>emb|CAB85991.1| putative protein [Arabidopsis thaliana]
Length=350

 Score =   157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA  +GV+GRI+N+SSVAH+Y
Sbjct  139  AGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTAKTSGVEGRILNVSSVAHIY  198

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY+EGI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  199  TYQEGIQFDSINDICSYSDKRAYGQSKLANILHAN  233



>gb|ACU20110.1| unknown [Glycine max]
Length=203

 Score =   153 bits (386),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  68   MFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLYTYE  247
            MFCP+Q +EDG E QFATNHLGHF L  LLLDKMK+TA  TG++GRI+NLSS+AH+YTYE
Sbjct  1    MFCPYQQTEDGIEMQFATNHLGHFLLTKLLLDKMKQTAKDTGIEGRIINLSSIAHVYTYE  60

Query  248  EGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            EGIRFD INDE  Y  K AYGQSKLANILH N
Sbjct  61   EGIRFDNINDEDGYSDKKAYGQSKLANILHTN  92



>ref|XP_006429047.1| hypothetical protein CICLE_v10012197mg [Citrus clementina]
 gb|ESR42287.1| hypothetical protein CICLE_v10012197mg [Citrus clementina]
Length=324

 Score =   156 bits (395),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F ALNLPLNILINNAG+MFCP+Q+SEDG E QFATNH+GHF L NLLLD M  TA 
Sbjct  102  FAQNFIALNLPLNILINNAGIMFCPYQISEDGIEMQFATNHIGHFLLTNLLLDTMNRTAK  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             TG++GRIVNLSS+AH YTY+ GIRF KIND + Y  K AYGQSKLANILHAN
Sbjct  162  ETGIEGRIVNLSSIAHQYTYKGGIRFQKINDRAGYSDKKAYGQSKLANILHAN  214



>ref|XP_008356311.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Malus domestica]
Length=309

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F + F AL+LPLN+LINNAGVMFCPFQLSEDG E  FATNHLGHF L NLLL+KMK TA
Sbjct  101  SFVNSFNALDLPLNLLINNAGVMFCPFQLSEDGIEMHFATNHLGHFLLTNLLLEKMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+AH  TY+ GIRFDKIND  SY +  AYGQSKLAN+LHAN
Sbjct  161  KTTGVEGRIVNLSSLAHAGTYKGGIRFDKINDPDSYSTINAYGQSKLANLLHAN  214



>ref|XP_011019884.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Populus euphratica]
Length=322

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F AL+LPLNILINNAG+MFCP+QLS DG E QFATNHLGHF L NLLLDKMK+TA 
Sbjct  102  FAVNFNALDLPLNILINNAGIMFCPYQLSVDGIEMQFATNHLGHFLLTNLLLDKMKDTAR  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TGV+GRIVNLSSVAH++TY++GI+F+ IND+  Y  K AYGQSKLANILHA
Sbjct  162  TTGVEGRIVNLSSVAHMHTYKDGIQFNNINDKKRYSDKRAYGQSKLANILHA  213



>ref|XP_009374671.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Pyrus x bretschneideri]
Length=322

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F + F AL+LPLN+LINNAGVMFCPFQLSEDG E  FATNHLGHF L NLLL+KMK TA
Sbjct  101  SFVNSFNALDLPLNLLINNAGVMFCPFQLSEDGIEMHFATNHLGHFLLTNLLLEKMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIVNLSS+AH  TY+ GIRFDKIND  SY +  AYGQSKLAN+LHAN
Sbjct  161  KTTGVEGRIVNLSSLAHAGTYKGGIRFDKINDPDSYSTINAYGQSKLANLLHAN  214



>ref|XP_006288165.1| hypothetical protein CARUB_v10001402mg [Capsella rubella]
 gb|EOA21063.1| hypothetical protein CARUB_v10001402mg [Capsella rubella]
Length=331

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF  +F AL+LPLN+LINNAGVMFCP+QLSEDG E QFATNH+GHF L NLLLD MK TA
Sbjct  101  AFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHIGHFLLTNLLLDTMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GV+GRI+N+SSVAH+YT+++GI+FD IND  SY  K AYGQSKLANILHAN
Sbjct  161  KTSGVEGRILNVSSVAHIYTHQDGIQFDSINDICSYSDKRAYGQSKLANILHAN  214



>gb|EMT28766.1| Retinol dehydrogenase 12 [Aegilops tauschii]
Length=402

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F ++NLPLNILINNAGVMFCPFQLSEDG E QFATNHLGHF L NLLLD MK TA
Sbjct  181  AFADQFNSMNLPLNILINNAGVMFCPFQLSEDGVEMQFATNHLGHFLLTNLLLDNMKATA  240

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSS+AH +TY +GI+FD +ND+ ++  + AYGQSKLANILHA
Sbjct  241  ESTGIEGRIVNLSSIAHEHTYPKGIQFDTLNDKKTFDRRSAYGQSKLANILHA  293



>ref|XP_008442566.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Cucumis 
melo]
Length=322

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F ALNLPLNILINNAGVMFCPFQLSEDG E QFATNH+GHF L NLLL+KMK TA 
Sbjct  102  FAHNFLALNLPLNILINNAGVMFCPFQLSEDGIEMQFATNHIGHFLLTNLLLEKMKNTAK  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            +TG++GRIVNLSS+AH +TY  GIRF+KIND++ Y  K AYGQSKLANILH 
Sbjct  162  STGIEGRIVNLSSIAHAHTYGGGIRFNKINDKNGYSDKRAYGQSKLANILHV  213



>ref|XP_006294503.1| hypothetical protein CARUB_v10023534mg, partial [Capsella rubella]
 gb|EOA27401.1| hypothetical protein CARUB_v10023534mg, partial [Capsella rubella]
Length=350

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD F ALNLPLNILINNAGVMFCPFQL+EDG E+QFATNH+GHF L NLLL+KMK +A
Sbjct  130  SFADQFLALNLPLNILINNAGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLEKMKSSA  189

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSSVAH YTY EGI+F  IND   Y  + AYGQSKLAN+LH+N
Sbjct  190  RESGIEGRIVNLSSVAHTYTYPEGIKFQSINDPDGYSDRRAYGQSKLANLLHSN  243



>ref|XP_009409528.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=324

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFAD F +++LPL+ILINNAGVMFCP+QLS DG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFADKFLSMDLPLDILINNAGVMFCPYQLSRDGIEMQFATNHLGHFLLTNLLLEKMKSTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRI+NLSS+AH +TY+ GI FDK+ND+  Y  K AYGQSKLANILHAN
Sbjct  161  KKTGMEGRIINLSSIAHKHTYKGGIWFDKLNDKDVYSDKKAYGQSKLANILHAN  214



>ref|XP_010920666.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Elaeis guineensis]
Length=321

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F +++LPLNILINNAGVMFCP+QLSEDG E  FATNHLGHF L NLLL+KMK T 
Sbjct  101  AFVDKFISMDLPLNILINNAGVMFCPYQLSEDGIEMHFATNHLGHFLLTNLLLEKMKNTE  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TG++GRIVNLSS+AHL +Y+EGI+FD +ND + Y  K AYGQSKLANILHAN
Sbjct  161  RKTGIEGRIVNLSSIAHLRSYDEGIQFDNLNDNNGYSDKRAYGQSKLANILHAN  214



>ref|XP_010505343.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=321

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD F ALNLPLNILINNAGVMFCPFQL+EDG E+QFATNH+GHF L NLLL+KMK +A
Sbjct  101  SFADQFLALNLPLNILINNAGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLEKMKSSA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G +GRIVNLSS+AH YTY EGI+F+ IND   Y  + AYGQSKLAN+LH+N
Sbjct  161  RESGTEGRIVNLSSIAHTYTYPEGIKFESINDPDGYSDRRAYGQSKLANLLHSN  214



>ref|XP_010558313.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Tarenaya hassleriana]
Length=333

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F  DF +L+LPL++LINNAG+MFCPFQLS+DG E QFATNH+GHF + NLL++KMK TA
Sbjct  101  SFVRDFDSLSLPLHLLINNAGIMFCPFQLSQDGIELQFATNHIGHFLVTNLLMEKMKTTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G++GRIVNLSS+AH+YTY +GI FD IND S Y  K AYGQSKLANILHAN
Sbjct  161  KESGIEGRIVNLSSIAHIYTYPDGICFDNINDISRYSDKRAYGQSKLANILHAN  214



>ref|XP_010509322.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=321

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD F ALNLPLNILINNAGVMFCPFQL+EDG E+QFATNH+GHF L NLLL+KMK +A
Sbjct  101  SFADQFLALNLPLNILINNAGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLEKMKSSA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G +GRIVNLSS+AH YTY EGI+F  IND   Y  + AYGQSKLAN+LH+N
Sbjct  161  RESGTEGRIVNLSSIAHTYTYPEGIKFQSINDPDEYSDRRAYGQSKLANLLHSN  214



>gb|ABR25584.1| retinol dehydrogenase 11 [Oryza sativa Indica Group]
Length=198

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  71   FCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLYTYEE  250
            FCPF LSEDG E QFATNHLGHF L NLLLD MK TA +TG++GRIVNLSSVAHL+TY +
Sbjct  1    FCPFGLSEDGVEMQFATNHLGHFLLTNLLLDNMKATAKSTGIEGRIVNLSSVAHLHTYPK  60

Query  251  GIRFDKINDESSYHSKMAYGQSKLANILHA  340
            GI FDK+NDE +Y  KMAYGQSKLANILHA
Sbjct  61   GIEFDKLNDEKTYDDKMAYGQSKLANILHA  90



>emb|CDY52816.1| BnaC04g53630D [Brassica napus]
Length=320

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E+QFATNH+GHF L NLLLDKMK +A  +G++GRIVNLSS+AH Y
Sbjct  120  AGVMFCPFQLSEDGIESQFATNHIGHFLLTNLLLDKMKSSARESGIEGRIVNLSSIAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY EGI FD IND   Y  K AYGQSKLAN+LH+N
Sbjct  180  TYTEGIMFDYINDPDRYSEKKAYGQSKLANLLHSN  214



>emb|CDY52817.1| BnaC04g53640D [Brassica napus]
Length=320

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E+QFATNH+GHF L NLLLDKMK +A  +G++GRIVNLSS+AH Y
Sbjct  120  AGVMFCPFQLSEDGIESQFATNHIGHFLLTNLLLDKMKSSARESGIEGRIVNLSSIAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY EGI FD IND   Y  K AYGQSKLAN+LH+N
Sbjct  180  TYTEGIMFDYINDPDRYSEKKAYGQSKLANLLHSN  214



>emb|CAB58175.1| putative pod-specific dehydrogenase SAC25 [Brassica napus]
Length=320

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E+QFATNH+GHF L NLLLDKMK +A  +G++GRIVNLSS+AH Y
Sbjct  120  AGVMFCPFQLSEDGIESQFATNHIGHFLLTNLLLDKMKSSARESGIEGRIVNLSSIAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY EGI FD IND   Y  K AYGQSKLAN+LH+N
Sbjct  180  TYTEGIMFDYINDPDRYSEKKAYGQSKLANLLHSN  214



>emb|CDX74954.1| BnaA05g07000D [Brassica napus]
Length=320

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E+QFATNH+GHF L NLLLDKMK +A  +G++GRIVNLSS+AH Y
Sbjct  120  AGVMFCPFQLSEDGIESQFATNHIGHFLLTNLLLDKMKSSARESGIEGRIVNLSSIAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY EGI FD IND   Y  K AYGQSKLAN+LH+N
Sbjct  180  TYTEGIMFDYINDPDRYSEKKAYGQSKLANLLHSN  214



>gb|ACG40401.1| retinol dehydrogenase 11 [Zea mays]
Length=320

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F ++ LPLNILINNAGVMFCPFQLS++G E QFATNHLG+F L NLLLD MK TA
Sbjct  101  AFVDQFNSMKLPLNILINNAGVMFCPFQLSKNGVEMQFATNHLGYFLLTNLLLDTMKATA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +TG++GRIVNLSSVAH +TY +GI FD +NDE  Y+ KMAYGQSKLAN+LHA
Sbjct  161  KSTGIEGRIVNLSSVAHHHTYPKGIDFDNLNDEKIYNDKMAYGQSKLANLLHA  213



>ref|XP_006410941.1| hypothetical protein EUTSA_v10016943mg [Eutrema salsugineum]
 gb|ESQ52394.1| hypothetical protein EUTSA_v10016943mg [Eutrema salsugineum]
Length=320

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQL+EDG E+QFATNH+GHF L NLLLDKMK +A  +G++GRIVNLSSVAH Y
Sbjct  120  AGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSSARESGIEGRIVNLSSVAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY +GI+F+ IND   Y  K AYGQSKLAN+LH+N
Sbjct  180  TYPDGIKFNSINDPDGYSEKKAYGQSKLANLLHSN  214



>ref|XP_010553028.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Tarenaya hassleriana]
Length=326

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F  DF +L+LPLN+LINNAG+MFCP+QLS+DG E QFATNH+GHF L NLLL++MK+T 
Sbjct  101  SFVRDFDSLSLPLNLLINNAGIMFCPYQLSQDGIELQFATNHIGHFLLTNLLLERMKKTV  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +GVQGRIVNLSSVAH+Y Y  GI FD IND S Y  K AYGQSKLANILHAN
Sbjct  161  KESGVQGRIVNLSSVAHIYAYPHGILFDDINDISCYSDKRAYGQSKLANILHAN  214



>ref|XP_002965372.1| hypothetical protein SELMODRAFT_439201 [Selaginella moellendorffii]
 gb|EFJ34210.1| hypothetical protein SELMODRAFT_439201 [Selaginella moellendorffii]
Length=314

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F +DFK   LPLN+LINNAGVMFCPF L+ DG E+QFATNHLGHF L NLLLD MKETA 
Sbjct  93   FVEDFKKSGLPLNLLINNAGVMFCPFSLTADGVESQFATNHLGHFLLTNLLLDTMKETAA  152

Query  185  ATGVQGRIVNLSSVAHLYT-YEEGIR-FDKINDESSYHSKMAYGQSKLANILHAN  343
             +G+QGRIVNLSSVAH    Y+EGIR  D IND  SY SK AYGQSKLANILHAN
Sbjct  153  KSGIQGRIVNLSSVAHTTVGYKEGIRDLDAINDRGSYDSKKAYGQSKLANILHAN  207



>gb|KHN21767.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=313

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+  LPLN+LINNAG+M CPF+LS+D  E QFATNHLGHF L NLLLD MK+T+ 
Sbjct  98   FASEFKSSGLPLNMLINNAGIMACPFKLSKDKIELQFATNHLGHFLLTNLLLDTMKKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN+SS AH +TY EGIRFDKINDESSY +  AYGQSKLANILHAN
Sbjct  158  ETKKEGRIVNVSSEAHRFTYSEGIRFDKINDESSYSNWRAYGQSKLANILHAN  210



>ref|XP_010517024.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=321

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FAD F ALN+PLNILINNAGVMF PFQL+EDG E+QFATNH+GHF L NLLLDKMK +A
Sbjct  101  SFADQFLALNIPLNILINNAGVMFSPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSSA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              +G +GRIVNLSS+AH YTY EGI+F  IND   Y  + AYGQSKLAN+LH+N
Sbjct  161  RESGTEGRIVNLSSIAHTYTYPEGIKFQSINDPDGYSDRRAYGQSKLANLLHSN  214



>ref|XP_008241317.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Prunus mume]
Length=322

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFCP QLSEDG E QFATNHLGHF L NLLL+KMK TA
Sbjct  101  AFVDSFNALDLPLNLLINNAGVMFCPHQLSEDGVEVQFATNHLGHFLLTNLLLEKMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIV LSS+AH   Y+EGI+FDKIND   Y    AYGQSKLAN+LH+N
Sbjct  161  RTTGVEGRIVILSSLAHTTPYQEGIQFDKINDRIGYSELKAYGQSKLANLLHSN  214



>ref|XP_004137776.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Cucumis sativus]
Length=322

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E QFATNHLGHF L NLL++KMK TA +TG++GRIVNLSS+AH +
Sbjct  120  AGVMFCPFQLSEDGIEMQFATNHLGHFLLTNLLIEKMKNTAKSTGIEGRIVNLSSIAHAH  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            TY  GIRF+KIN+++ Y  K AYGQSKLANILH 
Sbjct  180  TYGGGIRFNKINEKNGYSDKRAYGQSKLANILHV  213



>ref|XP_004172458.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Cucumis sativus]
Length=322

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E QFATNHLGHF L NLL++KMK TA +TG++GRIVNLSS+AH +
Sbjct  120  AGVMFCPFQLSEDGIEMQFATNHLGHFLLTNLLIEKMKNTAKSTGIEGRIVNLSSIAHAH  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            TY  GIRF+KIN+++ Y  K AYGQSKLANILH 
Sbjct  180  TYGGGIRFNKINEKNGYSDKRAYGQSKLANILHV  213



>ref|XP_007205568.1| hypothetical protein PRUPE_ppa008713mg [Prunus persica]
 gb|EMJ06767.1| hypothetical protein PRUPE_ppa008713mg [Prunus persica]
Length=322

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AF D F AL+LPLN+LINNAGVMFC  QLSEDG E QFATNHLGHF L NLLLDKMK TA
Sbjct  101  AFVDSFNALDLPLNLLINNAGVMFCSHQLSEDGVEVQFATNHLGHFLLTNLLLDKMKNTA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              TGV+GRIV LSS+AH   Y+EGIRFDKIND   Y    AYGQSKLAN+LH+N
Sbjct  161  RTTGVEGRIVILSSLAHTTPYQEGIRFDKINDRIGYSELKAYGQSKLANLLHSN  214



>gb|KGN58884.1| hypothetical protein Csa_3G734860 [Cucumis sativus]
Length=322

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E QFATNHLGHF L NLL++KMK TA +TG++GRIVNLSS+AH +
Sbjct  120  AGVMFCPFQLSEDGIEMQFATNHLGHFLLTNLLIEKMKNTAKSTGIEGRIVNLSSIAHAH  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            TY  GIRF+KIN+++ Y  K AYGQSKLANILH 
Sbjct  180  TYGGGIRFNKINEKNGYSDKRAYGQSKLANILHV  213



>ref|XP_010543329.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=274

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AG+MFCPFQLS+DG E QFATNH+GHF L NLLL+KMK+TA  +GV+GRIVNLSS+AH +
Sbjct  120  AGIMFCPFQLSQDGIELQFATNHIGHFLLTNLLLEKMKKTAKESGVEGRIVNLSSIAHNF  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            TY  G+RFD +ND S Y  K AYGQSKLANILHA
Sbjct  180  TYPHGLRFDSLNDVSRYSDKRAYGQSKLANILHA  213



>ref|XP_002977219.1| hypothetical protein SELMODRAFT_106485 [Selaginella moellendorffii]
 gb|EFJ21828.1| hypothetical protein SELMODRAFT_106485 [Selaginella moellendorffii]
Length=314

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F +DFK   LPLN+LINNAG+MFCPF L+ DG E+QFATNHLGHF L NLLLD MKETA 
Sbjct  93   FVEDFKKSGLPLNLLINNAGLMFCPFSLTADGVESQFATNHLGHFLLTNLLLDTMKETAA  152

Query  185  ATGVQGRIVNLSSVAHLYT-YEEGIR-FDKINDESSYHSKMAYGQSKLANILHAN  343
             +G+QGRIVNLSSVAH    Y+EGIR  D IND  SY SK AYGQSKLANILHAN
Sbjct  153  KSGIQGRIVNLSSVAHATVGYKEGIRDLDAINDRGSYDSKKAYGQSKLANILHAN  207



>ref|XP_010543328.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=328

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AG+MFCPFQLS+DG E QFATNH+GHF L NLLL+KMK+TA  +GV+GRIVNLSS+AH +
Sbjct  114  AGIMFCPFQLSQDGIELQFATNHIGHFLLTNLLLEKMKKTAKESGVEGRIVNLSSIAHNF  173

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            TY  G+RFD +ND S Y  K AYGQSKLANILHA
Sbjct  174  TYPHGLRFDSLNDVSRYSDKRAYGQSKLANILHA  207



>ref|XP_010543327.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=334

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AG+MFCPFQLS+DG E QFATNH+GHF L NLLL+KMK+TA  +GV+GRIVNLSS+AH +
Sbjct  120  AGIMFCPFQLSQDGIELQFATNHIGHFLLTNLLLEKMKKTAKESGVEGRIVNLSSIAHNF  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            TY  G+RFD +ND S Y  K AYGQSKLANILHA
Sbjct  180  TYPHGLRFDSLNDVSRYSDKRAYGQSKLANILHA  213



>emb|CDY68648.1| BnaC03g71290D [Brassica napus]
Length=209

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  68   MFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLYTYE  247
            MFCP+QLSED  E QFATNH+GHF L NLLLD MK TA  +GV+GRI+NLSS+AH+YTY+
Sbjct  1    MFCPYQLSEDEIELQFATNHIGHFLLTNLLLDTMKTTAKTSGVEGRILNLSSIAHIYTYK  60

Query  248  EGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            EGI+FD IND   Y  K AYGQSKLANILHAN
Sbjct  61   EGIKFDSINDICCYSDKRAYGQSKLANILHAN  92



>gb|KFK36643.1| hypothetical protein AALP_AA4G151300 [Arabis alpina]
Length=403

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQL+EDG E+QFATNH+GHF L NLLLDKMK T+  + ++GRIVNLSSVAH Y
Sbjct  120  AGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSTSKESRIEGRIVNLSSVAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY +GI+FD IND   Y  K AYGQSKL+N+LH+N
Sbjct  180  TYSQGIKFDSINDPDGYSEKKAYGQSKLSNLLHSN  214



>gb|KFK36642.1| hypothetical protein AALP_AA4G151300 [Arabis alpina]
Length=416

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQL+EDG E+QFATNH+GHF L NLLLDKMK T+  + ++GRIVNLSSVAH Y
Sbjct  120  AGVMFCPFQLTEDGIESQFATNHIGHFLLTNLLLDKMKSTSKESRIEGRIVNLSSVAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY +GI+FD IND   Y  K AYGQSKL+N+LH+N
Sbjct  180  TYSQGIKFDSINDPDGYSEKKAYGQSKLSNLLHSN  214



>ref|NP_001240197.1| uncharacterized protein LOC100783465 [Glycine max]
 gb|ACU22908.1| unknown [Glycine max]
Length=349

 Score =   149 bits (376),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+  LPLN+LINNAG+M CPF+LS+D  E QFATNHLGHF L NLLLD MK+T+ 
Sbjct  134  FASEFKSSGLPLNMLINNAGIMACPFKLSKDKIELQFATNHLGHFLLTNLLLDTMKKTSR  193

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN+SS AH +TY EGIRFDKINDESSY +  AYGQSKLANILHAN
Sbjct  194  ETKKEGRIVNVSSEAHRFTYSEGIRFDKINDESSYSNWRAYGQSKLANILHAN  246



>gb|EYU19564.1| hypothetical protein MIMGU_mgv1a0091942mg, partial [Erythranthe 
guttata]
Length=296

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF +   PLNILINNAGVM  PFQLS+D  ETQFATNHLGHF LANLLLD MK+TA 
Sbjct  133  FASDFSSSGRPLNILINNAGVMTPPFQLSKDNIETQFATNHLGHFLLANLLLDTMKKTAR  192

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN+SS AH + Y+EGIRFDK+NDE  Y    AYGQSKLAN+LHAN
Sbjct  193  ETKKEGRIVNVSSEAHRFPYKEGIRFDKLNDEEGYSRWGAYGQSKLANVLHAN  245



>gb|ABK22403.1| unknown [Picea sitchensis]
Length=200

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  68   MFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLYTYE  247
            M CPF+LSEDG E QFATNH+GHF L +LLLD MK+TA  TGV+GR+VNLSS  H +TY 
Sbjct  1    MLCPFKLSEDGLEMQFATNHVGHFLLTHLLLDNMKKTAKVTGVEGRVVNLSSAGHFFTYG  60

Query  248  EGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            EGIRF++INDES Y    AYGQSKLANILHAN
Sbjct  61   EGIRFNRINDESGYSDHKAYGQSKLANILHAN  92



>ref|XP_009784180.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana sylvestris]
Length=313

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+   PLN+LINNAGVM  PF LS+D  E QFATNHLGHF L NLLLDKMKETA 
Sbjct  98   FASDFKSSGRPLNLLINNAGVMATPFMLSKDNIELQFATNHLGHFLLTNLLLDKMKETAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN++S AH + Y EG+RFDKIND  SY+S  AYGQSKLANILHAN
Sbjct  158  KTKREGRIVNVASEAHRFAYREGVRFDKINDSKSYNSFGAYGQSKLANILHAN  210



>ref|XP_009143483.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Brassica 
rapa]
Length=317

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 3/95 (3%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E+QFATNH+GHF L NLLLDKMK +A  +G++GRIVNLSS+AH Y
Sbjct  120  AGVMFCPFQLSEDGIESQFATNHIGHFLLTNLLLDKMKSSARESGIEGRIVNLSSIAHTY  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY EGI FD IND      K AYGQSKLAN+LH+N
Sbjct  180  TYTEGIMFDYINDPD---RKKAYGQSKLANLLHSN  211



>ref|XP_007143442.1| hypothetical protein PHAVU_007G072600g [Phaseolus vulgaris]
 gb|ESW15436.1| hypothetical protein PHAVU_007G072600g [Phaseolus vulgaris]
Length=312

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+  LPLNILINNAG+M CPF+LS D  E QFATNH+GHF L NLLLD MK+T+ 
Sbjct  98   FASDFKSSGLPLNILINNAGIMACPFKLSADKIELQFATNHIGHFLLTNLLLDTMKKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN+SS AH + Y EGIRFDKIND+ SY++  AYGQSKLANILHAN
Sbjct  158  ETKKEGRIVNVSSEAHRFAYSEGIRFDKINDKPSYNNWRAYGQSKLANILHAN  210



>ref|XP_010554932.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Tarenaya 
hassleriana]
Length=337

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVMFCPFQLSEDG E QFA NH+GHF L  LLLDKMK TA  TG QGRIVNLSS+AH +
Sbjct  120  AGVMFCPFQLSEDGIEMQFAVNHIGHFVLTKLLLDKMKSTAEETGTQGRIVNLSSIAHFF  179

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            TY EGI+F  ++D   Y  K AYGQSKLANILH+N
Sbjct  180  TYTEGIKFHDLSDLHPYSDKRAYGQSKLANILHSN  214



>ref|XP_006353884.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Solanum tuberosum]
Length=351

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+   PLN+LINNAG+M  PF LS+D  E QFATNHLGHF L NLLL+KMKETA 
Sbjct  136  FASDFKSSGRPLNLLINNAGIMATPFMLSKDNIELQFATNHLGHFLLTNLLLEKMKETAR  195

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN+SS AH + Y EGIRFDKIND  SY+S  AYGQSKLANILHAN
Sbjct  196  KTKREGRIVNVSSEAHRFAYREGIRFDKINDPKSYNSYGAYGQSKLANILHAN  248



>ref|XP_009589937.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=313

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK    PLN+LINNAGVM  PF LS+D  E QFATNHLGHF L NLLLDKMKETA 
Sbjct  98   FASDFKLSGRPLNLLINNAGVMATPFMLSKDNIELQFATNHLGHFLLTNLLLDKMKETAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN++S AH + Y EG+RFDKIND  SY+S  AYGQSKLANILHAN
Sbjct  158  KTKREGRIVNVASEAHRFAYREGVRFDKINDRKSYNSFGAYGQSKLANILHAN  210



>gb|KDP22254.1| hypothetical protein JCGZ_26085 [Jatropha curcas]
Length=256

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF +  LPLNILINNAG+M  PF+LS+D  E QFATNHLGHF L NLLL+ MK+TAN
Sbjct  41   FASDFNSSGLPLNILINNAGIMATPFKLSKDNIELQFATNHLGHFLLTNLLLETMKKTAN  100

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH Y Y EGIRFDKINDES Y S  AYGQSKLAN+LHAN
Sbjct  101  KSKREGRIVNVSSEAHRYPYPEGIRFDKINDESGYSSFRAYGQSKLANVLHAN  153



>ref|XP_004496543.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Cicer arietinum]
Length=315

 Score =   146 bits (368),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +   PLNILINNAG+M CPF+LS+D  E QFATNH+GHF L NLLLD MK+T  
Sbjct  98   FASEFNSSGRPLNILINNAGIMACPFKLSKDNIELQFATNHIGHFLLTNLLLDTMKKTTR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN++S AH +TY EGIRFDKINDESSY++  AYGQSKLANILHAN
Sbjct  158  KSKKEGRIVNVASEAHRFTYTEGIRFDKINDESSYNNWRAYGQSKLANILHAN  210



>ref|XP_004234415.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Solanum lycopersicum]
Length=313

 Score =   146 bits (368),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+   PLN+LINNAG+M  PF LS+D  E QFATNH+GHF L NLLL+KMKETA 
Sbjct  98   FASDFKSSGRPLNLLINNAGIMATPFMLSKDNIELQFATNHVGHFLLTNLLLEKMKETAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIVN+SS AH + Y EGIRFDKIND  SY+S  AYGQSKLANILHAN
Sbjct  158  KTKREGRIVNVSSEAHRFAYREGIRFDKINDPKSYNSYGAYGQSKLANILHAN  210



>gb|AAN64176.1| unknown protein [Arabidopsis thaliana]
Length=220

 Score =   143 bits (361),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSAGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH Y+Y EG+RFDKINDESSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNVSSEAHRYSYPEGVRFDKINDESSYSSIRAYGQSKLCNVLHAN  210



>ref|XP_006846071.1| hypothetical protein AMTR_s00012p00077460 [Amborella trichopoda]
 gb|ERN07746.1| hypothetical protein AMTR_s00012p00077460 [Amborella trichopoda]
Length=322

 Score =   146 bits (368),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            F ++F AL +PLNILINNAGVMFCP+QLS+DG E QFATNHLGHF L NLLL+K+K TA 
Sbjct  102  FVNEFNALGVPLNILINNAGVMFCPYQLSDDGIEMQFATNHLGHFLLTNLLLEKLKNTAK  161

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             TG++GRIVNLSS+AHL+TY EGIRFDKIND+S Y  K +YGQSKLANILHA
Sbjct  162  TTGIEGRIVNLSSIAHLHTYHEGIRFDKINDQSGYSDKKSYGQSKLANILHA  213



>emb|CDY10884.1| BnaC01g14990D [Brassica napus]
Length=322

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+   PLN+L+NNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASDYKSSGRPLNLLVNNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH Y+Y EG+RFDKIND+SSY S  AYGQSKL NILHAN
Sbjct  158  ESKREGRIVNLSSEAHRYSYPEGVRFDKINDKSSYSSIRAYGQSKLCNILHAN  210



>ref|XP_009136980.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Brassica 
rapa]
Length=324

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+   PLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASDYKSSGRPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH Y+Y EG+RFDKIND+SSY S  AYGQSKL NILHAN
Sbjct  158  ESKREGRIVNLSSEAHRYSYPEGVRFDKINDKSSYSSIRAYGQSKLCNILHAN  210



>ref|XP_009340057.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=313

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+  LPLNILINNAGVM  PF LS+D  E QFATNH GHF L NLLLD MK+TA 
Sbjct  98   FASDFKSSGLPLNILINNAGVMATPFLLSKDKIELQFATNHAGHFLLTNLLLDTMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  QGRIVN+SS AH + Y EGIRFDKIND++ Y S +AYGQSKLANILHAN
Sbjct  158  KSSKQGRIVNVSSEAHRFPYPEGIRFDKINDQAGYRSYLAYGQSKLANILHAN  210



>ref|XP_009340058.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=313

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+  LPLNILINNAGVM  PF LS+D  E QFATNH GHF L NLLLD MK+TA 
Sbjct  98   FASDFKSSGLPLNILINNAGVMATPFLLSKDKIELQFATNHAGHFLLTNLLLDTMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  QGRIVN+SS AH + Y EGIRFDKIND++ Y S +AYGQSKLANILHAN
Sbjct  158  KSSKQGRIVNVSSEAHRFPYPEGIRFDKINDQAGYRSYLAYGQSKLANILHAN  210



>emb|CDY44096.1| BnaA01g13040D [Brassica napus]
Length=361

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+   PLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  135  FASDYKSSGRPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  194

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH Y+Y EG+RFDKIND+SSY S  AYGQSKL NILHAN
Sbjct  195  ESKREGRIVNLSSEAHRYSYPEGVRFDKINDKSSYSSIRAYGQSKLCNILHAN  247



>gb|KCW90667.1| hypothetical protein EUGRSUZ_A02763 [Eucalyptus grandis]
 gb|KCW90668.1| hypothetical protein EUGRSUZ_A02763 [Eucalyptus grandis]
Length=219

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +    LNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLLD MK+TA 
Sbjct  98   FASNFNSSGHALNILINNAGIMATPFILSKDNIELQFATNHIGHFLLTNLLLDNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH +TY EGIRFDKIND+S YH   AYGQSKLANILH+N
Sbjct  158  KSSREGRIVNVSSEAHRWTYNEGIRFDKINDKSEYHGYKAYGQSKLANILHSN  210



>ref|XP_009340056.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=319

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+  LPLNILINNAGVM  PF LS+D  E QFATNH GHF L NLLLD MK+TA 
Sbjct  98   FASDFKSSGLPLNILINNAGVMATPFLLSKDKIELQFATNHAGHFLLTNLLLDTMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  QGRIVN+SS AH + Y EGIRFDKIND++ Y S +AYGQSKLANILHAN
Sbjct  158  KSSKQGRIVNVSSEAHRFPYPEGIRFDKINDQAGYRSYLAYGQSKLANILHAN  210



>gb|AFK45926.1| unknown [Medicago truncatula]
Length=278

 Score =   143 bits (360),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAGVM CPF LS D  E QFATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGVMACPFMLSNDNIELQFATNHLGHFLLTNLLLDTMKKTAS  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH + Y EGIRFDKIN++SSY    AYGQSKLANILHAN
Sbjct  158  ESKTEGRIVNVSSEAHKFAYSEGIRFDKINEQSSYSKWGAYGQSKLANILHAN  210



>ref|NP_001190811.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AEE84752.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=333

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  115  FASEYKSAGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  174

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH Y+Y EG+RFDKINDESSY S  AYGQSKL N+LHAN
Sbjct  175  ESKREGRIVNVSSEAHRYSYPEGVRFDKINDESSYSSIRAYGQSKLCNVLHAN  227



>emb|CDY13264.1| BnaC09g23920D [Brassica napus]
Length=317

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA +FK+L+LPLN+LINNAG+M CP+ LS D  E QFATNHLGHF L NLLLD MK+TA
Sbjct  97   SFASEFKSLDLPLNLLINNAGIMACPYTLSSDNIELQFATNHLGHFLLTNLLLDTMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            N +  +GRIV LSS  H Y Y EGIRFDKINDE+SY++  AYGQSKL NILHA
Sbjct  157  NESNTEGRIVILSSEGHRYAYREGIRFDKINDEASYNTLQAYGQSKLCNILHA  209



>ref|XP_009108602.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=265

 Score =   142 bits (358),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+  LPLNILINNAGVM CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  41   FASDYKSTGLPLNILINNAGVMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  100

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND SSY S  AYGQSKL N+LHAN
Sbjct  101  ESKREGRIVNLSSEAHRFSYPEGVRFDKINDVSSYSSISAYGQSKLCNVLHAN  153



>ref|XP_009108166.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Brassica 
rapa]
 emb|CDX86777.1| BnaA09g21670D [Brassica napus]
Length=317

 Score =   143 bits (361),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA +FK+L+LPLN+LINNAG+M CP+ LS D  E QFATNHLGHF L NLLLD MK+TA
Sbjct  97   SFASEFKSLDLPLNLLINNAGIMACPYTLSSDNIELQFATNHLGHFLLTNLLLDTMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            N +  +GRIV LSS  H Y Y EGIRFDKINDE+SY++  AYGQSKL NILHA
Sbjct  157  NESNTEGRIVILSSEGHRYAYREGIRFDKINDEASYNTLQAYGQSKLCNILHA  209



>ref|XP_006413556.1| hypothetical protein EUTSA_v10025732mg [Eutrema salsugineum]
 gb|ESQ55009.1| hypothetical protein EUTSA_v10025732mg [Eutrema salsugineum]
Length=322

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASDYKSAGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  158  ESNREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  210



>ref|NP_194073.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 ref|NP_974596.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAN13078.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44049.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84750.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AEE84751.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=316

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSAGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH Y+Y EG+RFDKINDESSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNVSSEAHRYSYPEGVRFDKINDESSYSSIRAYGQSKLCNVLHAN  210



>ref|XP_010053249.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW77506.1| hypothetical protein EUGRSUZ_D01837 [Eucalyptus grandis]
Length=315

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+++  LPLN+LINNAGVM CPF LS+D  E QFATNH+GHF L NLLL+ MK+T+ 
Sbjct  98   FASDYQSSALPLNLLINNAGVMACPFTLSQDNIELQFATNHIGHFLLTNLLLETMKKTSE  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH + Y+EGIRFDKIN+ES Y    AYGQSKLANILHAN
Sbjct  158  ESNTEGRIVNLSSEAHRFAYQEGIRFDKINNESEYTPIKAYGQSKLANILHAN  210



>ref|XP_002513680.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF49083.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=313

 Score =   143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF +  LPLNILINNAGVM  PF LS+D  E QFATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASDFNSSGLPLNILINNAGVMATPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH Y+Y EGIRFDKIND S Y S  AYGQSKLAN+LHAN
Sbjct  158  QSNREGRIVNVSSEAHRYSYHEGIRFDKINDRSGYSSFRAYGQSKLANVLHAN  210



>gb|KEH43681.1| short-chain dehydrogenase TIC 32 [Medicago truncatula]
Length=315

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAGVM CPF LS D  E QFATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGVMACPFMLSNDNIELQFATNHLGHFLLTNLLLDTMKKTAS  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH + Y EGIRFDKIN++SSY    AYGQSKLANILHAN
Sbjct  158  ESKTEGRIVNVSSEAHKFAYSEGIRFDKINEQSSYSKWGAYGQSKLANILHAN  210



>ref|XP_004956238.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Setaria italica]
Length=316

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA +F +  LPLNIL+NNAGVM  PF LS+DG E QFATNH+GHF L +LLLD MK+T+
Sbjct  100  AFASEFVSRGLPLNILVNNAGVMAIPFALSKDGIEMQFATNHVGHFLLTHLLLDTMKKTS  159

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            + + V+GRIVN+SS  H +TY EGIRFDKINDES Y S  AYGQSKLANILHAN
Sbjct  160  HESNVEGRIVNVSSEGHRFTYGEGIRFDKINDESVYSSIGAYGQSKLANILHAN  213



>emb|CDY69917.1| BnaAnng32000D [Brassica napus]
Length=305

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+  LPLNILINNAGVM CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  81   FASDYKSTGLPLNILINNAGVMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  140

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND SSY S  AYGQSKL N+LHAN
Sbjct  141  ESKREGRIVNLSSEAHRFSYPEGVRFDKINDVSSYSSISAYGQSKLCNVLHAN  193



>ref|XP_010060703.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
Length=270

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +    LNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLLD MK+TA 
Sbjct  98   FASNFNSSGHALNILINNAGIMATPFILSKDNIELQFATNHIGHFLLTNLLLDNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH +TY EGIRFDKIND+S YH   AYGQSKLANILH+N
Sbjct  158  KSSREGRIVNVSSEAHRWTYNEGIRFDKINDKSEYHGYKAYGQSKLANILHSN  210



>ref|XP_010529606.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=272

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLN+LINNAG+M CPF LS+D  E QFATNHLGHF L NLLLD MK T+ 
Sbjct  98   FASEYNSSGRPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +   GRIVN+SS AH Y Y+EGIRFD IND+SSY++ +AYGQSKL+N+LHAN
Sbjct  158  ESKRGGRIVNVSSAAHRYPYKEGIRFDTINDKSSYNTMLAYGQSKLSNVLHAN  210



>ref|XP_002869780.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46039.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=322

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSAGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNLSSEAHWFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  210



>ref|NP_849428.1| short-chain dehydrogenase TIC 32 [Arabidopsis thaliana]
 sp|A2RVM0.1|TIC32_ARATH RecName: Full=Short-chain dehydrogenase TIC 32, chloroplastic; 
AltName: Full=Translocon at the inner envelope membrane of 
chloroplasts 32; Short=AtTIC32 [Arabidopsis thaliana]
 gb|ABN04749.1| At4g23430 [Arabidopsis thaliana]
 gb|AEE84754.1| short-chain dehydrogenase TIC 32 [Arabidopsis thaliana]
Length=322

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  210



>ref|XP_009108601.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Brassica rapa]
 emb|CDX76338.1| BnaA08g10620D [Brassica napus]
Length=322

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+K+  LPLNILINNAGVM CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASDYKSTGLPLNILINNAGVMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND SSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNLSSEAHRFSYPEGVRFDKINDVSSYSSISAYGQSKLCNVLHAN  210



>ref|XP_006661006.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Oryza brachyantha]
Length=317

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA DF A  LPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+KMK+T+
Sbjct  101  AFASDFAAKGLPLNILINNAGVMATPFSLSKDGIELQFATNHVGHFLLTHLLLEKMKKTS  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              + V+GRIVN+SS  H + Y EGIRF KINDES Y++  AYGQSKLANILHAN
Sbjct  161  RESNVEGRIVNVSSEGHRFAYREGIRFAKINDESEYNTIGAYGQSKLANILHAN  214



>dbj|BAE99458.1| hypothetical protein [Arabidopsis thaliana]
Length=322

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  210



>gb|AFK43129.1| unknown [Lotus japonicus]
Length=313

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLNILINNAG+M CPF LS+D +E QFATNHLGHF L NLLLD MK+T+ 
Sbjct  98   FASEYKSSGLPLNILINNAGIMACPFMLSKDNHELQFATNHLGHFLLTNLLLDTMKKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIV +SS AH + Y EGIRFDKIND+SSY++  AYGQSKLANILHAN
Sbjct  158  ESKKEGRIVIVSSEAHRFAYSEGIRFDKINDQSSYNNWRAYGQSKLANILHAN  210



>sp|Q6RVV4.1|TIC32_PEA RecName: Full=Short-chain dehydrogenase TIC 32, chloroplastic; 
AltName: Full=Translocon at the inner envelope membrane of 
chloroplasts 32; Short=PsTIC32 [Pisum sativum]
 gb|AAS38575.1| short-chain dehydrogenase Tic32 [Pisum sativum]
Length=316

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +   PLNILINNAG+M CPF+LS+D  E QFATNH+GHF L NLLLD MK+T  
Sbjct  99   FASEFNSSGRPLNILINNAGIMACPFKLSKDNIELQFATNHIGHFLLTNLLLDTMKKTTR  158

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN++S AH + Y EGIRFDKIND+SSY++  AYGQSKLAN+LHAN
Sbjct  159  ESKKEGRIVNVASEAHRFAYPEGIRFDKINDQSSYNNWRAYGQSKLANVLHAN  211



>gb|KEH43689.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=315

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAG+M CPF LS+D  E QFATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGIMSCPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+S  A+ + Y EGIRFDKIND+SSY+ + AYGQSKLANILHAN
Sbjct  158  QSKKEGRIVNVSGEAYTFAYSEGIRFDKINDQSSYNKQSAYGQSKLANILHAN  210



>ref|XP_008379922.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Malus domestica]
Length=313

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF +  LPLNILINNAGVM  PF LS+D  E QFATNH+GHF L NLLL  MK+TA 
Sbjct  98   FASDFNSSGLPLNILINNAGVMATPFLLSKDKIELQFATNHVGHFLLTNLLLGNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  QGRIVN+SS AH Y Y EGIRFDKIND++ Y S +AYGQSKLANILHAN
Sbjct  158  KSSKQGRIVNVSSEAHRYPYPEGIRFDKINDQAGYRSYLAYGQSKLANILHAN  210



>gb|KEH43683.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=263

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAG+M CPF LS+D  E  FATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGIMLCPFMLSKDNIELHFATNHLGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+S+ A+++ Y EGIRFDKIND+SSY    AYGQSKLANILHAN
Sbjct  158  QSKKEGRIVNVSAKAYIFAYPEGIRFDKINDQSSYSKWGAYGQSKLANILHAN  210



>ref|XP_010529605.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=315

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLN+LINNAG+M CPF LS+D  E QFATNHLGHF L NLLLD MK T+ 
Sbjct  98   FASEYNSSGRPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +   GRIVN+SS AH Y Y+EGIRFD IND+SSY++ +AYGQSKL+N+LHAN
Sbjct  158  ESKRGGRIVNVSSAAHRYPYKEGIRFDTINDKSSYNTMLAYGQSKLSNVLHAN  210



>ref|XP_008379916.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Malus domestica]
Length=319

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF +  LPLNILINNAGVM  PF LS+D  E QFATNH+GHF L NLLL  MK+TA 
Sbjct  98   FASDFNSSGLPLNILINNAGVMATPFLLSKDKIELQFATNHVGHFLLTNLLLGNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  QGRIVN+SS AH Y Y EGIRFDKIND++ Y S +AYGQSKLANILHAN
Sbjct  158  KSSKQGRIVNVSSEAHRYPYPEGIRFDKINDQAGYRSYLAYGQSKLANILHAN  210



>gb|KEH43680.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=315

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLNILINNAGVM CPF+LS+D  E QFATNH+GHF L NLLLD MK+T  
Sbjct  98   FASEYNSSGRPLNILINNAGVMACPFKLSKDNIELQFATNHIGHFLLTNLLLDTMKKTTR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN++S AH + Y EGIRFDKINDESSY    AYGQSKLANILHAN
Sbjct  158  KSKKEGRIVNVASEAHRFAYSEGIRFDKINDESSYSRWGAYGQSKLANILHAN  210



>gb|KEH43682.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=275

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAG+M CPF LS+D  E  FATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGIMLCPFMLSKDNIELHFATNHLGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+S+ A+++ Y EGIRFDKIND+SSY    AYGQSKLANILHAN
Sbjct  158  QSKKEGRIVNVSAKAYIFAYPEGIRFDKINDQSSYSKWGAYGQSKLANILHAN  210



>ref|XP_006396906.1| hypothetical protein EUTSA_v10028811mg [Eutrema salsugineum]
 gb|ESQ38359.1| hypothetical protein EUTSA_v10028811mg [Eutrema salsugineum]
Length=317

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA ++K+L+LPLN+LINNAG+M CPF LS D  E QFATNHLGHF L NLLLD MK+TA
Sbjct  97   SFASEYKSLDLPLNLLINNAGIMACPFTLSNDNIELQFATNHLGHFLLTNLLLDTMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N +  +GR+V +SS  H +TY EGIRFDKINDE+SY++  AYGQSKL NILHA+
Sbjct  157  NESNREGRVVIVSSEGHRFTYREGIRFDKINDEASYNTLQAYGQSKLCNILHAS  210



>gb|KHN12151.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=313

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+  LPLNILINNAG+M CPF LS+D  E QFATNH+GHF L NLLLD +K+T+ 
Sbjct  98   FASEFKSSGLPLNILINNAGIMACPFSLSKDKIELQFATNHIGHFLLTNLLLDTIKKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH + Y EGI FDKINDESSY++  AYGQSKLANILHAN
Sbjct  158  ESKKEGRIVNVSSEAHRFAYSEGICFDKINDESSYNNWRAYGQSKLANILHAN  210



>gb|KCW90666.1| hypothetical protein EUGRSUZ_A02763 [Eucalyptus grandis]
Length=288

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +    LNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLLD MK+TA 
Sbjct  98   FASNFNSSGHALNILINNAGIMATPFILSKDNIELQFATNHIGHFLLTNLLLDNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH +TY EGIRFDKIND+S YH   AYGQSKLANILH+N
Sbjct  158  KSSREGRIVNVSSEAHRWTYNEGIRFDKINDKSEYHGYKAYGQSKLANILHSN  210



>emb|CAN65621.1| hypothetical protein VITISV_040853 [Vitis vinifera]
Length=231

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +  LPLNILINNAG+M  P+ LS+D  E QFATNHLGHF L NLLLD MK+T  
Sbjct  98   FASEYNSSGLPLNILINNAGIMAVPYMLSKDNIEMQFATNHLGHFLLTNLLLDTMKKTTR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS+AH Y Y EGIRFDKIND+S Y S  AYGQSKLAN+LHAN
Sbjct  158  KSRKEGRIVNVSSMAHRYPYREGIRFDKINDKSGYSSLFAYGQSKLANVLHAN  210



>gb|KFK28921.1| hypothetical protein AALP_AA7G065400 [Arabis alpina]
Length=322

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSARLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y EG+RFDKIND+SSY S  AYGQSKL NILHAN
Sbjct  158  ESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSFRAYGQSKLCNILHAN  210



>ref|XP_010529604.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=323

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLN+LINNAG+M CPF LS+D  E QFATNHLGHF L NLLLD MK T+ 
Sbjct  98   FASEYNSSGRPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +   GRIVN+SS AH Y Y+EGIRFD IND+SSY++ +AYGQSKL+N+LHAN
Sbjct  158  ESKRGGRIVNVSSAAHRYPYKEGIRFDTINDKSSYNTMLAYGQSKLSNVLHAN  210



>ref|XP_010060696.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
Length=313

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +    LNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLLD MK+TA 
Sbjct  98   FASNFNSSGHALNILINNAGIMATPFILSKDNIELQFATNHIGHFLLTNLLLDNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH +TY EGIRFDKIND+S YH   AYGQSKLANILH+N
Sbjct  158  KSSREGRIVNVSSEAHRWTYNEGIRFDKINDKSEYHGYKAYGQSKLANILHSN  210



>ref|NP_001063985.1| Os09g0570300 [Oryza sativa Japonica Group]
 dbj|BAF25899.1| Os09g0570300 [Oryza sativa Japonica Group]
 dbj|BAG87989.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA DF A  LPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+ MK+T+
Sbjct  100  AFASDFAAKGLPLNILINNAGVMATPFSLSKDGIELQFATNHVGHFLLTHLLLETMKKTS  159

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              + V+GRIVN+SS  H + Y EGIRF KINDES Y+S  AYGQSKLANILHAN
Sbjct  160  RESNVEGRIVNVSSEGHRFAYREGIRFAKINDESEYNSIGAYGQSKLANILHAN  213



>dbj|BAD46231.1| putative oxidoreductase [Oryza sativa Japonica Group]
 gb|EEE70271.1| hypothetical protein OsJ_30418 [Oryza sativa Japonica Group]
Length=315

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA DF A  LPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+ MK+T+
Sbjct  99   AFASDFAAKGLPLNILINNAGVMATPFSLSKDGIELQFATNHVGHFLLTHLLLETMKKTS  158

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              + V+GRIVN+SS  H + Y EGIRF KINDES Y+S  AYGQSKLANILHAN
Sbjct  159  RESNVEGRIVNVSSEGHRFAYREGIRFAKINDESEYNSIGAYGQSKLANILHAN  212



>ref|XP_006490431.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Citrus sinensis]
Length=292

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF    LPLNILINNAG+M  PF LS+D  E QFATNHLGHF L NLLLD MK TA 
Sbjct  100  FASDFTTKGLPLNILINNAGIMASPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKRTAQ  159

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +G +GRIVN+SS  H +TY EGIRF+K+ND+S Y + +AYGQSKLANILHAN
Sbjct  160  ESGREGRIVNVSSEGHRFTYREGIRFEKLNDQSGYGNFVAYGQSKLANILHAN  212



>gb|AFK36887.1| unknown [Medicago truncatula]
Length=315

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAG+M CPF LS+D  E  FATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGIMLCPFMLSKDNIELHFATNHLGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+S+ A+++ Y EGIRFDKIND+SSY    AYGQSKLANILHAN
Sbjct  158  QSKKEGRIVNVSAKAYIFAYPEGIRFDKINDQSSYSKWGAYGQSKLANILHAN  210



>gb|KEH43684.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=315

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAG+M CPF LS+D  E  FATNHLGHF L NLLLD MK+TA+
Sbjct  98   FASEFNSSGLPLNILINNAGIMLCPFMLSKDNIELHFATNHLGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+S+ A+++ Y EGIRFDKIND+SSY    AYGQSKLANILHAN
Sbjct  158  QSKKEGRIVNVSAKAYIFAYPEGIRFDKINDQSSYSKWGAYGQSKLANILHAN  210



>ref|NP_001242868.1| uncharacterized protein LOC100796920 [Glycine max]
 gb|ACU19656.1| unknown [Glycine max]
Length=313

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+  LPLNILINNAG+M CPF LS+D  E QFATNH+GHF L NLLLD +K+T+ 
Sbjct  98   FASEFKSSGLPLNILINNAGIMACPFSLSKDKIELQFATNHIGHFLLTNLLLDTIKKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH + Y EGI FDKINDESSY +  AYGQSKLANILHAN
Sbjct  158  ESKKEGRIVNVSSEAHRFAYSEGICFDKINDESSYDNWRAYGQSKLANILHAN  210



>ref|XP_003536459.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Glycine max]
 gb|KHN21766.1| Short-chain dehydrogenase TIC 32, chloroplastic [Glycine soja]
Length=313

 Score =   140 bits (353),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA  FK+  LPLNILINNAG+M CPF LS+D  E QFATNH+GHF L NLLLD +++T+ 
Sbjct  98   FASAFKSSGLPLNILINNAGIMACPFSLSKDKIELQFATNHIGHFLLTNLLLDTIEKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH + Y EGIRF+KINDESSY++  AYGQSKLANILHAN
Sbjct  158  ESKKEGRIVNVSSEAHRFAYSEGIRFNKINDESSYNNWRAYGQSKLANILHAN  210



>gb|ACU19473.1| unknown [Glycine max]
Length=313

 Score =   140 bits (353),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA  FK+  LPLNILINNAG+M CPF LS+D  E QFATNH+GHF L NLLLD +++T+ 
Sbjct  98   FASAFKSSGLPLNILINNAGIMACPFSLSKDKIELQFATNHIGHFLLTNLLLDTIEKTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH + Y EGIRF+KINDESSY++  AYGQSKLANILHAN
Sbjct  158  ESKKEGRIVNVSSEAHRFAYSEGIRFNKINDESSYNNWRAYGQSKLANILHAN  210



>ref|XP_008234205.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Prunus mume]
Length=317

 Score =   140 bits (353),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +   PLNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLLD MK+TA 
Sbjct  98   FASEFNSSGRPLNILINNAGIMATPFMLSKDNIELQFATNHVGHFLLTNLLLDTMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH Y Y EGIRFDKIND S Y S  AYGQSKLANILHAN
Sbjct  158  KSSKEGRIVNVSSEAHRYPYREGIRFDKINDPSGYSSFAAYGQSKLANILHAN  210



>ref|XP_002318807.2| hypothetical protein POPTR_0012s12980g [Populus trichocarpa]
 gb|EEE97027.2| hypothetical protein POPTR_0012s12980g [Populus trichocarpa]
Length=262

 Score =   139 bits (349),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF +   PLN+LINNAG+M  PF LS+D  E QFATNHLGHF L NLLLD MK+TA 
Sbjct  41   FASDFNSSGRPLNLLINNAGIMATPFMLSKDNIELQFATNHLGHFLLTNLLLDTMKKTAR  100

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + ++GRIVN+SS  H Y Y EGIRFD IND+S Y   +AYGQSKLAN+LHAN
Sbjct  101  ESDIEGRIVNVSSEFHRYPYPEGIRFDNINDQSGYKRFLAYGQSKLANVLHAN  153



>emb|CAA20464.1| putative protein [Arabidopsis thaliana]
 emb|CAB79298.1| putative protein [Arabidopsis thaliana]
Length=294

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+  +  +GRIVNLSS AH +
Sbjct  133  AGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTSRESKREGRIVNLSSEAHRF  192

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            +Y EG+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  193  SYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  227



>ref|XP_009374994.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=261

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PL+ILINNAGVM  PF LS+D  E QFATNHLGHF L NLLL+ MK+T  
Sbjct  98   FASEYNSSGQPLHILINNAGVMATPFMLSKDNIEMQFATNHLGHFLLTNLLLETMKKTTK  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH + Y EGIRFDKINDES Y S  AYGQSKLANILHAN
Sbjct  158  ESNKEGRIVNLSSEAHRFAYTEGIRFDKINDESGYSSMYAYGQSKLANILHAN  210



>ref|XP_011072846.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Sesamum indicum]
Length=315

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +L LPLNILINNAGVM  PF LS++  E QFATNHLGHF L NLLLD MK+TA 
Sbjct  98   FASEYNSLGLPLNILINNAGVMAPPFMLSQENIELQFATNHLGHFLLTNLLLDNMKKTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS  H YTY EGIRFDKIND SSY+S  AYGQSKLAN+LHAN
Sbjct  158  ESQKEGRIVNLSSEGHRYTYLEGIRFDKINDSSSYYSIFAYGQSKLANVLHAN  210



>ref|XP_004308067.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=313

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+   PLNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLLD MK+TA+
Sbjct  98   FASEFKSAGHPLNILINNAGIMATPFLLSKDKIELQFATNHIGHFLLTNLLLDTMKKTAH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            ++  +GRIVN+SS AH Y Y EGIRFD+IND S Y S  AYGQSKLANILHA
Sbjct  158  SSSKEGRIVNVSSEAHRYAYPEGIRFDRINDPSGYSSWPAYGQSKLANILHA  209



>ref|XP_010935852.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=267

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF  LNLPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+ MK T+ 
Sbjct  98   FASDFDNLNLPLNILINNAGVMSTPFTLSQDGIELQFATNHVGHFLLTHLLLENMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + ++GRIVN+SS  H + Y EGIRFDKIND+S Y S  AYGQSKLANILHAN
Sbjct  158  ESKIEGRIVNVSSEGHRFPYREGIRFDKINDQSGYGSWTAYGQSKLANILHAN  210



>gb|EMT00057.1| Retinol dehydrogenase 14 [Aegilops tauschii]
Length=229

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF A  LPLNIL+NNAGVM  PF LS+DG E QFATNH+GHF L NLLL+ MK+T+ 
Sbjct  14   FAADFAATGLPLNILVNNAGVMATPFSLSKDGIEMQFATNHVGHFLLTNLLLETMKKTSR  73

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + V+GRIVN+SS  H + Y+EGIRF K+NDE  Y +  AYGQSKLANILHAN
Sbjct  74   ESNVEGRIVNVSSEGHRFAYKEGIRFAKLNDEEEYSTIAAYGQSKLANILHAN  126



>gb|KCW77505.1| hypothetical protein EUGRSUZ_D01837 [Eucalyptus grandis]
Length=324

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  59   AGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETANATGVQGRIVNLSSVAHLY  238
            AGVM CPF LS+D  E QFATNH+GHF L NLLL+ MK+T+  +  +GRIVNLSS AH +
Sbjct  125  AGVMACPFTLSQDNIELQFATNHIGHFLLTNLLLETMKKTSEESNTEGRIVNLSSEAHRF  184

Query  239  TYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             Y+EGIRFDKIN+ES Y    AYGQSKLANILHAN
Sbjct  185  AYQEGIRFDKINNESEYTPIKAYGQSKLANILHAN  219



>ref|XP_007209377.1| hypothetical protein PRUPE_ppa008889mg [Prunus persica]
 gb|EMJ10576.1| hypothetical protein PRUPE_ppa008889mg [Prunus persica]
Length=315

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +  LPLNILINNAGVM  PF LS+D  E QFATNHLGHF L NLLL+ MK+T  
Sbjct  98   FASEYNSSGLPLNILINNAGVMATPFMLSQDNIELQFATNHLGHFLLTNLLLETMKKTTR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH + Y EGIRFDKINDES Y S  AYGQSKLANILHAN
Sbjct  158  ESKKEGRIVNLSSEAHRFAYSEGIRFDKINDESGYSSIYAYGQSKLANILHAN  210



>ref|XP_006284119.1| hypothetical protein CARUB_v10005252mg [Capsella rubella]
 gb|ACC91270.1| short-chain dehydrogenase/reductase family protein [Capsella 
rubella]
 gb|EOA17017.1| hypothetical protein CARUB_v10005252mg [Capsella rubella]
Length=322

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E QFATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSAGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y  G+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNLSSEAHRFSYPGGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  210



>ref|XP_010455548.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=317

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA ++K+L+LPLN+LINNAG+M CPF LS D +E QFATNHLGHF L NLLL+ MK+TA
Sbjct  97   SFASEYKSLDLPLNLLINNAGIMACPFMLSSDNFELQFATNHLGHFLLTNLLLETMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N +  +GRIV +SS  H + Y EGIRFDKINDE+SY++  AYGQSKL NILHA+
Sbjct  157  NESNREGRIVIVSSEGHRFAYGEGIRFDKINDEASYNTLQAYGQSKLCNILHAS  210



>ref|XP_002270104.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Vitis 
vinifera]
 emb|CBI22689.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +  LPLNILINNAG+M  P+ LS+D  E QFATNHLGHF L NLLLD MK+T  
Sbjct  98   FASEYNSSGLPLNILINNAGIMAVPYMLSKDNIEMQFATNHLGHFLLTNLLLDTMKKTTR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS+AH Y Y EGIRFDKIND+S Y S  AYGQSKLAN+LHAN
Sbjct  158  KSRKEGRIVNVSSMAHRYPYREGIRFDKINDKSGYSSLFAYGQSKLANVLHAN  210



>ref|XP_009374991.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374993.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=315

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PL+ILINNAGVM  PF LS+D  E QFATNHLGHF L NLLL+ MK+T  
Sbjct  98   FASEYNSSGQPLHILINNAGVMATPFMLSKDNIEMQFATNHLGHFLLTNLLLETMKKTTK  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH + Y EGIRFDKINDES Y S  AYGQSKLANILHAN
Sbjct  158  ESNKEGRIVNLSSEAHRFAYTEGIRFDKINDESGYSSMYAYGQSKLANILHAN  210



>ref|XP_002980982.1| hypothetical protein SELMODRAFT_420551 [Selaginella moellendorffii]
 gb|EFJ17683.1| hypothetical protein SELMODRAFT_420551 [Selaginella moellendorffii]
Length=322

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA +F A  LPLNILINNAG+M  P++LS DG E QFATNHLGHF L NLLLDKMKETA
Sbjct  101  SFAAEFLATKLPLNILINNAGIMMIPYELSPDGIEMQFATNHLGHFLLTNLLLDKMKETA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
              +G+QGRIVNLSS+AH+ +Y  GI+F  +ND++ Y    AY QSKLANILHA
Sbjct  161  KESGIQGRIVNLSSIAHIASYSGGIQFSHLNDKAWYSDTRAYSQSKLANILHA  213



>ref|XP_002982463.1| hypothetical protein SELMODRAFT_116561 [Selaginella moellendorffii]
 gb|EFJ16216.1| hypothetical protein SELMODRAFT_116561 [Selaginella moellendorffii]
Length=322

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA +F A  LPLNILINNAG+M  P++LS DG E QFATNHLGHF L NLLLDKMKETA
Sbjct  101  SFAAEFLATKLPLNILINNAGIMMIPYELSPDGIEMQFATNHLGHFLLTNLLLDKMKETA  160

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
              +G+QGRIVNLSS+AH+ +Y  GI+F  +ND++ Y    AY QSKLANILHA
Sbjct  161  KESGIQGRIVNLSSIAHIASYSGGIQFSHLNDKAWYSDTRAYSQSKLANILHA  213



>ref|XP_010434965.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Camelina sativa]
 ref|XP_010434974.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X4 [Camelina sativa]
Length=254

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA ++K+L+LPLN+LINNAG+M CPF LS D +E QFATNHLGHF L NLLL+ MK+TA
Sbjct  97   SFASEYKSLDLPLNLLINNAGIMACPFMLSSDNFELQFATNHLGHFLLTNLLLETMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N +  +GRIV +SS  H + Y +GIRFDKINDE+SY++  AYGQSKL NILHA+
Sbjct  157  NESNREGRIVIVSSEGHRFAYGQGIRFDKINDEASYNTLQAYGQSKLCNILHAS  210



>ref|XP_010422096.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=254

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA  +K+L+LPLN+LINNAG+M CPF LS D +E QFATNHLGHF L NLLL+ MK+TA
Sbjct  97   SFASGYKSLDLPLNLLINNAGIMACPFMLSSDKFELQFATNHLGHFLLTNLLLETMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N +  +GRIV +SS  H + Y EGIRFDKINDE+SY++  AYGQSKL NILHA+
Sbjct  157  NESNREGRIVIVSSEGHRFAYGEGIRFDKINDEASYNTLQAYGQSKLCNILHAS  210



>ref|XP_010935851.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=313

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF  LNLPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+ MK T+ 
Sbjct  98   FASDFDNLNLPLNILINNAGVMSTPFTLSQDGIELQFATNHVGHFLLTHLLLENMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + ++GRIVN+SS  H + Y EGIRFDKIND+S Y S  AYGQSKLANILHAN
Sbjct  158  ESKIEGRIVNVSSEGHRFPYREGIRFDKINDQSGYGSWTAYGQSKLANILHAN  210



>ref|XP_007038745.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY23246.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=408

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DFK+  LPLNILINNAG+M   F LS+DG E QFATNH+GHF L NLLL+ MK+TA+
Sbjct  168  FAADFKSSGLPLNILINNAGIMATSFMLSKDGIELQFATNHMGHFLLTNLLLETMKKTAD  227

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS  H ++Y EGIRFDKIND+S Y+S  AYGQSKLAN+LHAN
Sbjct  228  GSKTEGRIVNVSSRRHKFSYPEGIRFDKINDQSGYNSVSAYGQSKLANVLHAN  280



>emb|CDP05170.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+   PLNILINNAGVM  PF+LS+D  E QFATNHLGHF L NLLLDKMK+T +
Sbjct  98   FAKEFKSSGRPLNILINNAGVMATPFKLSKDNIELQFATNHLGHFLLTNLLLDKMKKTCH  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             T  +GRIV ++S AH Y Y EG+RFDKIND+  Y S  AYGQSKL+N+LHAN
Sbjct  158  QTKREGRIVIVASEAHRYPYREGVRFDKINDQEGYSSFFAYGQSKLSNVLHAN  210



>ref|XP_010529609.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=315

 Score =   138 bits (347),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLNILINNAG+M CPF LS+D  E QFATNHLGHF L NLLLD MK T+ 
Sbjct  98   FASEYISSGRPLNILINNAGIMACPFMLSKDNVELQFATNHLGHFLLTNLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AHL+TY+EGIRFDKI DE SY    AY +SKL NILHAN
Sbjct  158  ESRREGRIVNVSSDAHLFTYKEGIRFDKITDEPSYSRTTAYAESKLCNILHAN  210



>ref|XP_002459855.1| hypothetical protein SORBIDRAFT_02g012420 [Sorghum bicolor]
 gb|EER96376.1| hypothetical protein SORBIDRAFT_02g012420 [Sorghum bicolor]
Length=316

 Score =   138 bits (347),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            AFA  F    LPLNILINNAGVM  PF+LS+DG E QFATNH+GHF L +LLLD MK+T+
Sbjct  100  AFASQFIDRGLPLNILINNAGVMAIPFELSKDGIEMQFATNHVGHFLLTHLLLDTMKKTS  159

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
              + V+GRIVN+SS  H + Y+EGIRFDKINDES Y    AYGQSKLANILHAN
Sbjct  160  RESNVEGRIVNVSSEGHRFAYQEGIRFDKINDESVYSIFGAYGQSKLANILHAN  213



>ref|XP_010529607.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=316

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLNILINNAG+M CPF LS+D  E QFATNHLGHF L NLLLD MK T+ 
Sbjct  98   FASEYISSGRPLNILINNAGIMACPFMLSKDNVELQFATNHLGHFLLTNLLLDTMKNTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AHL+TY+EGIRFDKI DE SY    AY +SKL NILHAN
Sbjct  158  ESRREGRIVNVSSDAHLFTYKEGIRFDKITDEPSYSRTTAYAESKLCNILHAN  210



>ref|XP_004495009.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=312

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 10/114 (9%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +F  +F AL+LPLNILINNAGVMFCPFQLS DG E QFATNHL          DKMK+TA
Sbjct  101  SFVRNFLALHLPLNILINNAGVMFCPFQLSYDGIEMQFATNHL----------DKMKQTA  150

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             ++G++GRI+NLSS+AH YTYEEGIR D IND+  Y  K AYGQSKLANILHAN
Sbjct  151  KSSGIEGRIINLSSIAHTYTYEEGIRLDNINDKIGYSDKKAYGQSKLANILHAN  204



>ref|XP_010434947.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010434955.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA ++K+L+LPLN+LINNAG+M CPF LS D +E QFATNHLGHF L NLLL+ MK+TA
Sbjct  97   SFASEYKSLDLPLNLLINNAGIMACPFMLSSDNFELQFATNHLGHFLLTNLLLETMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N +  +GRIV +SS  H + Y +GIRFDKINDE+SY++  AYGQSKL NILHA+
Sbjct  157  NESNREGRIVIVSSEGHRFAYGQGIRFDKINDEASYNTLQAYGQSKLCNILHAS  210



>ref|XP_010676470.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=318

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+ NL LN+LINNAG+M  PFQLS++  E QFATNHLGHF+L +LLLD MK+TA 
Sbjct  101  FASEFKSSNLSLNVLINNAGIMATPFQLSKENIELQFATNHLGHFHLTDLLLDAMKKTAR  160

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
                +GRIVN+SS AH ++Y EGI FD+IN+ES Y S  AYGQSKLANILHAN
Sbjct  161  ECNREGRIVNVSSEAHRFSYSEGICFDRINNESGYSSLQAYGQSKLANILHAN  213



>ref|XP_002874690.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50949.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=317

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA ++K+LN PLN+LINNAG+M CPF LS D  E QFATNHLGHF L NLLL+ MK+TA
Sbjct  97   SFASEYKSLNHPLNLLINNAGIMACPFTLSSDNIELQFATNHLGHFLLTNLLLETMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
            N +  +GRIV +SS  H + Y EG+RFDKINDE+SY++  AYGQSKL NILHA
Sbjct  157  NESNREGRIVIVSSEGHRFAYREGVRFDKINDEASYNTLQAYGQSKLCNILHA  209



>gb|EMS64241.1| Retinol dehydrogenase 14 [Triticum urartu]
Length=230

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA DF A  LPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+ MK+T+ 
Sbjct  14   FAVDFAARGLPLNILINNAGVMATPFTLSKDGIEMQFATNHVGHFLLTHLLLETMKKTSR  73

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + VQGRIVN+SS  H + Y+EGIRF K+NDE  Y +  AYGQSKLANILHAN
Sbjct  74   ESNVQGRIVNVSSEGHRFAYKEGIRFAKLNDEEEYSTIAAYGQSKLANILHAN  126



>ref|XP_009386208.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=313

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +LNLPLNILINNAGVM  PF LSEDG E QFATNH+GHF L  LLLD MK  + 
Sbjct  98   FASEFNSLNLPLNILINNAGVMATPFSLSEDGIELQFATNHVGHFLLTYLLLDNMKNASR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + ++GRIVN+SS  H + Y EGIRFDKIND+S Y+S  AYGQSKLANILHAN
Sbjct  158  TSRIEGRIVNVSSEGHRFAYSEGIRFDKINDQSGYNSIGAYGQSKLANILHAN  210



>gb|KCW77510.1| hypothetical protein EUGRSUZ_D01838 [Eucalyptus grandis]
Length=273

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+++  LPLN+LINNAGVM CPF LS D  E QFATNH+GHF L NLLL+ MK+T+ 
Sbjct  56   FASDYQSSALPLNLLINNAGVMACPFILSPDNIELQFATNHIGHFLLTNLLLETMKKTSQ  115

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIV +SS  H + Y EGIRFDKIN ES Y S  AYGQSKLANILHAN
Sbjct  116  ESNREGRIVIVSSEGHRFAYREGIRFDKINSESEYSSIQAYGQSKLANILHAN  168



>emb|CDP12036.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ + +L LNILINNAGVM  P+ +S+DG E QFATNH+GHF L NLLL KMK TA 
Sbjct  98   FASEYNSSDLLLNILINNAGVMAPPYMVSQDGMEMQFATNHIGHFLLTNLLLQKMKTTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
                +GRIVN+SSV H +TY+EGIRFDKIND+SSY    AYGQSKLANILHA+
Sbjct  158  DCQREGRIVNVSSVGHNFTYQEGIRFDKINDQSSYSPFRAYGQSKLANILHAS  210



>ref|XP_010422094.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=317

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  2    AFADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETA  181
            +FA  +K+L+LPLN+LINNAG+M CPF LS D +E QFATNHLGHF L NLLL+ MK+TA
Sbjct  97   SFASGYKSLDLPLNLLINNAGIMACPFMLSSDKFELQFATNHLGHFLLTNLLLETMKKTA  156

Query  182  NATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
            N +  +GRIV +SS  H + Y EGIRFDKINDE+SY++  AYGQSKL NILHA+
Sbjct  157  NESNREGRIVIVSSEGHRFAYGEGIRFDKINDEASYNTLQAYGQSKLCNILHAS  210



>ref|XP_008437510.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Cucumis melo]
Length=313

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+++   PLNIL+NNAG+M  PF LS+D  E QFATNH+GHF L NLLL+ MK+TA 
Sbjct  98   FASDYQSSGFPLNILVNNAGIMATPFGLSKDNIELQFATNHVGHFLLTNLLLENMKKTAA  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH YTY EGIRFD INDES Y+   AYGQSKL+NILHAN
Sbjct  158  ESKKEGRIVNVSSEAHRYTYPEGIRFDGINDESRYNKMQAYGQSKLSNILHAN  210



>gb|EMS64246.1| WW domain-containing oxidoreductase [Triticum urartu]
Length=375

 Score =   138 bits (348),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FADDF A  LPLNILINNAGVM  PF LS+DG E QFATNH+GHF L +LLL+ MK+T+ 
Sbjct  159  FADDFAARGLPLNILINNAGVMATPFSLSKDGIEMQFATNHVGHFLLTHLLLETMKKTSR  218

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             + V+GRIVN+SS  H + Y+EGIRF K+NDE  Y +  AYGQSKLANILHAN
Sbjct  219  ESNVEGRIVNVSSEGHRFAYKEGIRFAKLNDEEEYSTIAAYGQSKLANILHAN  271



>gb|KEH26386.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=324

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F + +LPLNILINNAG+   PF LS+D  E QFATNHLGHF L NLLLD MK+TAN
Sbjct  106  FASEFNSSSLPLNILINNAGICAPPFTLSKDNIELQFATNHLGHFLLTNLLLDTMKKTAN  165

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRI+N+SS  H YTY+EGI FD INDESSY    AYGQSKLANILHAN
Sbjct  166  ESKKEGRIINVSSDGHGYTYDEGILFDNINDESSYQRWRAYGQSKLANILHAN  218



>ref|XP_006827578.1| hypothetical protein AMTR_s00009p00229460 [Amborella trichopoda]
 gb|ERM94994.1| hypothetical protein AMTR_s00009p00229460 [Amborella trichopoda]
Length=254

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +++LPLNIL+NNAGVM  PFQLSEDG E QFATNH+GHF L NLLL+ MK TA 
Sbjct  99   FASEFNSMDLPLNILVNNAGVMGTPFQLSEDGIELQFATNHIGHFLLTNLLLENMKTTAR  158

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
                +GRIVN+SS  H  TY EGI FD+IND+S Y    AYGQSKLANILHAN
Sbjct  159  KCKTEGRIVNVSSDGHKLTYREGIWFDQINDKSGYSFIFAYGQSKLANILHAN  211



>gb|KDO51988.1| hypothetical protein CISIN_1g021391mg [Citrus sinensis]
Length=255

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLNILINNAG+M  PF LS+D  E QFATNHLGHF L +LLLD MK+TA 
Sbjct  98   FASEYNSQGRPLNILINNAGIMASPFMLSKDNIELQFATNHLGHFLLTHLLLDTMKKTAQ  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +  +GRIVN+SS AH + Y EGIRFDKINDES+Y+S  AYGQSKLANILHA
Sbjct  158  KSSREGRIVNVSSEAHRFAYSEGIRFDKINDESAYNSFGAYGQSKLANILHA  209



>ref|XP_004298808.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=318

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+    LPLNILINNAGV+  P++LSED  E QFATNHLGHF L NLLL+ MK T+ 
Sbjct  98   FAADYNTKGLPLNILINNAGVI-TPYKLSEDNIELQFATNHLGHFLLTNLLLENMKRTSR  156

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
                +GRIVN+SSVAH Y+Y EGIRFDKINDESSY+   AYGQSKLAN+LHAN
Sbjct  157  ENNREGRIVNVSSVAHKYSYHEGIRFDKINDESSYNKYFAYGQSKLANVLHAN  209



>ref|XP_004169031.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Cucumis sativus]
Length=252

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA D+++   PLNILINNAG+M  PF LS+D  E QFATNH+GHF L NLLL+ MK+TA 
Sbjct  98   FASDYQSSGFPLNILINNAGIMATPFGLSKDNIEVQFATNHIGHFLLTNLLLENMKKTAA  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN+SS AH YTY EGIRFD INDE  Y+   AYGQSKL+NILHAN
Sbjct  158  ESKKEGRIVNVSSEAHRYTYPEGIRFDGINDELRYNKMQAYGQSKLSNILHAN  210



>ref|XP_002274932.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Vitis 
vinifera]
 emb|CBI34658.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+L LPLN+LINNAGVM  PF LS D  E QFATNHLGHF L NLLL+ MK TA 
Sbjct  98   FASEYKSLGLPLNLLINNAGVMATPFLLSHDNIELQFATNHLGHFLLTNLLLETMKNTAR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +G +GRIVN+SS  H + Y EGI FDKINDES+Y+S  AYGQSKLANILHAN
Sbjct  158  ESGREGRIVNVSSEGHRFPYSEGICFDKINDESAYNSVYAYGQSKLANILHAN  210



>ref|XP_010671842.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=341

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLN+LINNAGVM  PF LS+D  E QFATNHLGHF L +LLLD MK+TA 
Sbjct  125  FASEYSSSKRPLNLLINNAGVMATPFILSKDNMELQFATNHLGHFLLTHLLLDTMKKTAR  184

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +G +GRIVN+SS AH + Y EGIRFDK+ND S Y S  AYGQSKLAN+LHAN
Sbjct  185  ESGREGRIVNVSSEAHRFAYSEGIRFDKLNDPSGYSSWRAYGQSKLANVLHAN  237



>gb|EPS64916.1| hypothetical protein M569_09862, partial [Genlisea aurea]
Length=317

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +FK+   PLNILINNAGVM  PFQLSED  E QFATNHLGHF L NLLLD MK+TA 
Sbjct  101  FATEFKSSGRPLNILINNAGVMAPPFQLSEDQIELQFATNHLGHFLLTNLLLDTMKKTAQ  160

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
                +GRIVN+SS AH  +Y EGIRFD++ND   Y    AYGQSKLANILH+N
Sbjct  161  QAKREGRIVNVSSEAHRASYHEGIRFDRLNDPKGYQRWGAYGQSKLANILHSN  213



>ref|XP_006421967.1| hypothetical protein CICLE_v10005473mg [Citrus clementina]
 gb|ESR35207.1| hypothetical protein CICLE_v10005473mg [Citrus clementina]
Length=256

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++ +   PLNILINNAG+M  PF LS+D  E QFATNHLGHF L +LLLD MK+TA 
Sbjct  41   FASEYNSQGRPLNILINNAGIMASPFMLSKDNIELQFATNHLGHFLLTHLLLDTMKKTAQ  100

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHA  340
             +  +GRIVN+SS AH + Y EGIRFDKINDES+Y+S  AYGQSKLANILHA
Sbjct  101  KSSREGRIVNVSSEAHRFAYSEGIRFDKINDESAYNSFGAYGQSKLANILHA  152



>ref|XP_007152235.1| hypothetical protein PHAVU_004G112900g [Phaseolus vulgaris]
 gb|ESW24229.1| hypothetical protein PHAVU_004G112900g [Phaseolus vulgaris]
Length=216

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +  LPLNILINNAG+   PF LSED  E QFATNH+GHF L NLLLD MK+TA+
Sbjct  95   FASEFISSALPLNILINNAGIFGTPFMLSEDNIELQFATNHMGHFLLTNLLLDTMKKTAD  154

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVN++S  H  TY  GIRFDKINDESSY    AY QSKLANILHAN
Sbjct  155  ESKREGRIVNVTSCGHRLTYRGGIRFDKINDESSYQKFRAYAQSKLANILHAN  207



>ref|XP_006587287.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic isoform 
X1 [Glycine max]
Length=238

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F + +LPLNILINNAG+   PF LSED  E QFATNH+GHF L NLLLD MK+T +
Sbjct  48   FASEFISSSLPLNILINNAGIFGTPFMLSEDNIELQFATNHIGHFLLTNLLLDTMKKTTH  107

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  QGRIVN+SS  H +TY EGI FDK+ND+SSY +  AYGQSKLANILHAN
Sbjct  108  ESKKQGRIVNVSSQGHQFTYREGILFDKLNDQSSYQAFRAYGQSKLANILHAN  160



>ref|XP_011022674.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Populus euphratica]
Length=315

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA +F +L LPLN+LINNAG+M  PF LS+D  E QFATNH+GHF L +L+LD MK+TA 
Sbjct  98   FASEFISLGLPLNLLINNAGIMAAPFMLSQDNIEMQFATNHVGHFLLTDLVLDTMKKTAL  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIV LSS AH +TY EGIRFDKINDES Y+S  AYGQSKLAN+LHAN
Sbjct  158  ESNQEGRIVILSSEAHRFTYSEGIRFDKINDESGYNSIWAYGQSKLANVLHAN  210



>ref|XP_010433910.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like 
[Camelina sativa]
Length=322

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  5    FADDFKAlnlplnilinnAGVMFCPFQLSEDGYETQFATNHLGHFYLANLLLDKMKETAN  184
            FA ++K+  LPLN+LINNAG+M CPF LS+D  E Q ATNHLGHF L  LLLD MK T+ 
Sbjct  98   FASEYKSAGLPLNLLINNAGIMACPFMLSKDNIELQLATNHLGHFLLTKLLLDTMKTTSR  157

Query  185  ATGVQGRIVNLSSVAHLYTYEEGIRFDKINDESSYHSKMAYGQSKLANILHAN  343
             +  +GRIVNLSS AH ++Y  G+RFDKIND+SSY S  AYGQSKL N+LHAN
Sbjct  158  ESKREGRIVNLSSDAHRFSYPGGVRFDKINDKSSYSSMRAYGQSKLCNVLHAN  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288